F488378
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1020 | 425 | 2040 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300048903|Ga0496100_0354327|Ga0496100_0354327_611_1078 |
| Length | 155 |
| Sequence | MAAPPRLPSEHAGRLPSANRIWTAPMSSATTPPSKAPWPTELRLQKDRKTLVVSFEGGQSFELPAEYLRVRSPSAEVQGHSPAERRTVSGKRDVAILELHPVGNYAVRIVFDDLHSTGIFSWDYLFELGQNRERYWRDYLDELASKNLSRSPAAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 8 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 9 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 12 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 13 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 14 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 15 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 16 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 17 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 18 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 19 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 20 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 21 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 22 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 23 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 24 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 25 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 86 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 95 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 96 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 97 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 98 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 105 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 110 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 111 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 118 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 119 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 142 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 143 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 144 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 145 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 160 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 241 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 242 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 243 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 244 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 246 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 252 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 253 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 255 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 256 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 257 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 259 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 264 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 265 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 268 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 269 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 272 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 274 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 277 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 278 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 281 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 282 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 283 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 284 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 286 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 288 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 290 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 291 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 292 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 293 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 294 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 295 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 297 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 354 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 355 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 356 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 357 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 358 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 359 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 362 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 363 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 364 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 365 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 366 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 367 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 368 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 401 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 404 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 405 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 406 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 407 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 421 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 422 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 423 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.61 |
| Nodule | 0 |
| Rhizoplane | 6.18 |
| Rhizosphere | 88.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496100_0354327 | 3300048903 | Bacteria | 1109 |
| 2 | 2214856897 | 2209111006 | Bacteria | 608 |
| 3 | JGI24032J14994_100332 | 3300001430 | Bacteria | 2517 |
| 4 | JGI24736J21556_1004771 | 3300001904 | Bacteria | 2304 |
| 5 | JGI24741J21665_1010530 | 3300001915 | Bacteria | 1651 |
| 6 | JGI24752J21851_1002786 | 3300001976 | Bacteria | 2323 |
| 7 | JGI24746J21847_1000770 | 3300001977 | Bacteria | 4927 |
| 8 | JGI24747J21853_1001243 | 3300001978 | Bacteria | 1873 |
| 9 | JGI24739J22299_10001705 | 3300001989 | Bacteria | 8356 |
| 10 | JGI24737J22298_10000400 | 3300001990 | Bacteria | 14807 |
| 11 | JGI24743J22301_10003202 | 3300001991 | Bacteria | 2566 |
| 12 | JGI24750J21931_1000217 | 3300002070 | Bacteria | 9762 |
| 13 | JGI24745J21846_1000133 | 3300002073 | Bacteria | 5710 |
| 14 | JGI24748J21848_1007832 | 3300002074 | Bacteria | 1254 |
| 15 | JGI24738J21930_10000277 | 3300002075 | Bacteria | 14047 |
| 16 | JGI24749J21850_1000938 | 3300002076 | Bacteria | 4150 |
| 17 | JGI24744J21845_10000893 | 3300002077 | Bacteria | 5635 |
| 18 | JGI24035J26624_1001143 | 3300002126 | Bacteria | 2514 |
| 19 | JGI24033J26618_1000485 | 3300002155 | Bacteria | 3905 |
| 20 | JGI24034J26672_10008370 | 3300002239 | Bacteria | 1511 |
| 21 | JGI24742J22300_10002757 | 3300002244 | Bacteria | 2829 |
| 22 | JGI24751J29686_10009751 | 3300002459 | Bacteria | 1978 |
| 23 | JGI26129J50193_1007000 | 3300003349 | Unclassified | 813 |
| 24 | JGI25405J52794_10036913 | 3300003911 | Unclassified | 1026 |
| 25 | Ga0065716_1020057 | 3300005277 | Bacteria | 510 |
| 26 | Ga0065704_10433854 | 3300005289 | Bacteria | 720 |
| 27 | Ga0065712_10016781 | 3300005290 | Bacteria | 1486 |
| 28 | Ga0065712_10071749 | 3300005290 | Bacteria | 5082 |
| 29 | Ga0065715_10001161 | 3300005293 | Bacteria | 10533 |
| 30 | Ga0065715_10057426 | 3300005293 | Bacteria | 947 |
| 31 | Ga0065707_10097506 | 3300005295 | Bacteria | 3168 |
| 32 | Ga0070676_10000813 | 3300005328 | Bacteria | 15426 |
| 33 | Ga0070683_100000240 | 3300005329 | Bacteria | 37588 |
| 34 | Ga0070683_100176267 | 3300005329 | Bacteria | 2029 |
| 35 | Ga0070683_100330451 | 3300005329 | Unclassified | 1451 |
| 36 | Ga0070690_100000428 | 3300005330 | Bacteria | 21329 |
| 37 | Ga0070690_100296652 | 3300005330 | Bacteria | 1158 |
| 38 | Ga0070690_100387098 | 3300005330 | Bacteria | 1024 |
| 39 | Ga0070670_100005838 | 3300005331 | Bacteria | 10408 |
| 40 | Ga0070670_100390145 | 3300005331 | Bacteria | 1228 |
| 41 | Ga0070670_101156375 | 3300005331 | Bacteria | 706 |
| 42 | Ga0070677_10000294 | 3300005333 | Bacteria | 17512 |
| 43 | Ga0068869_100000595 | 3300005334 | Bacteria | 20312 |
| 44 | Ga0068869_100371927 | 3300005334 | Bacteria | 1170 |
| 45 | Ga0070666_10017675 | 3300005335 | Bacteria | 4575 |
| 46 | Ga0070666_10104535 | 3300005335 | Bacteria | 1955 |
| 47 | Ga0070666_10205982 | 3300005335 | Bacteria | 1384 |
| 48 | Ga0070680_100568210 | 3300005336 | Bacteria | 972 |
| 49 | Ga0070682_100000202 | 3300005337 | Bacteria | 44018 |
| 50 | Ga0070682_100026737 | 3300005337 | Bacteria | 3456 |
| 51 | Ga0070682_100546597 | 3300005337 | Bacteria | 906 |
| 52 | Ga0068868_100000614 | 3300005338 | Bacteria | 23959 |
| 53 | Ga0068868_100820452 | 3300005338 | Unclassified | 840 |
| 54 | Ga0070660_100000223 | 3300005339 | Bacteria | 37464 |
| 55 | Ga0070689_100000187 | 3300005340 | Bacteria | 37473 |
| 56 | Ga0070689_100450987 | 3300005340 | Bacteria | 1094 |
| 57 | Ga0070689_100484086 | 3300005340 | Bacteria | 1057 |
| 58 | Ga0070691_10277813 | 3300005341 | Bacteria | 907 |
| 59 | Ga0070687_100000200 | 3300005343 | Bacteria | 20836 |
| 60 | Ga0070687_100214590 | 3300005343 | Bacteria | 1175 |
| 61 | Ga0070687_100912825 | 3300005343 | Bacteria | 630 |
| 62 | Ga0070687_101168946 | 3300005343 | Bacteria | 566 |
| 63 | Ga0070661_100000298 | 3300005344 | Bacteria | 40083 |
| 64 | Ga0070661_100493290 | 3300005344 | Bacteria | 979 |
| 65 | Ga0070692_10000016 | 3300005345 | Bacteria | 34456 |
| 66 | Ga0070668_100428935 | 3300005347 | Bacteria | 1133 |
| 67 | Ga0070668_101600118 | 3300005347 | Bacteria | 597 |
| 68 | Ga0070669_100001525 | 3300005353 | Bacteria | 16755 |
| 69 | Ga0070669_100111462 | 3300005353 | Bacteria | 2077 |
| 70 | Ga0070669_100125374 | 3300005353 | Bacteria | 1964 |
| 71 | Ga0070675_100000215 | 3300005354 | Bacteria | 37364 |
| 72 | Ga0070675_101108160 | 3300005354 | Bacteria | 728 |
| 73 | Ga0070671_100000402 | 3300005355 | Bacteria | 29873 |
| 74 | Ga0070671_100060569 | 3300005355 | Bacteria | 3151 |
| 75 | Ga0070671_101750206 | 3300005355 | Bacteria | 552 |
| 76 | Ga0070674_100000511 | 3300005356 | Bacteria | 19453 |
| 77 | Ga0070674_100006921 | 3300005356 | Bacteria | 6648 |
| 78 | Ga0070674_101510526 | 3300005356 | Bacteria | 604 |
| 79 | Ga0070673_100000035 | 3300005364 | Bacteria | 57163 |
| 80 | Ga0070673_100172304 | 3300005364 | Unclassified | 1848 |
| 81 | Ga0070673_100431005 | 3300005364 | Bacteria | 1183 |
| 82 | Ga0070673_100587785 | 3300005364 | Unclassified | 1014 |
| 83 | Ga0070673_101052244 | 3300005364 | Bacteria | 759 |
| 84 | Ga0070673_101179599 | 3300005364 | Bacteria | 717 |
| 85 | Ga0070688_100000130 | 3300005365 | Bacteria | 40342 |
| 86 | Ga0070688_100182500 | 3300005365 | Bacteria | 1457 |
| 87 | Ga0070688_100516944 | 3300005365 | Bacteria | 903 |
| 88 | Ga0070688_101457330 | 3300005365 | Bacteria | 556 |
| 89 | Ga0070659_100003979 | 3300005366 | Bacteria | 10519 |
| 90 | Ga0070659_100627990 | 3300005366 | Bacteria | 925 |
| 91 | Ga0070667_100000712 | 3300005367 | Bacteria | 32083 |
| 92 | Ga0070667_100117062 | 3300005367 | Unclassified | 2315 |
| 93 | Ga0070703_10008655 | 3300005406 | Bacteria | 2863 |
| 94 | Ga0070709_10186165 | 3300005434 | Bacteria | 1461 |
| 95 | Ga0070709_11101585 | 3300005434 | Bacteria | 635 |
| 96 | Ga0070714_100040701 | 3300005435 | Bacteria | 3918 |
| 97 | Ga0070714_100156481 | 3300005435 | Bacteria | 2058 |
| 98 | Ga0070713_100081434 | 3300005436 | Bacteria | 2762 |
| 99 | Ga0070713_100342558 | 3300005436 | Unclassified | 1385 |
| 100 | Ga0070713_100614198 | 3300005436 | Bacteria | 1034 |
| 101 | Ga0070713_100970873 | 3300005436 | Bacteria | 819 |
| 102 | Ga0070713_100978422 | 3300005436 | Bacteria | 816 |
| 103 | Ga0070713_101040923 | 3300005436 | Unclassified | 790 |
| 104 | Ga0070710_10020265 | 3300005437 | Unclassified | 3448 |
| 105 | Ga0070710_10544320 | 3300005437 | Unclassified | 801 |
| 106 | Ga0070701_10000081 | 3300005438 | Bacteria | 26416 |
| 107 | Ga0070701_10187120 | 3300005438 | Bacteria | 1216 |
| 108 | Ga0070711_100061646 | 3300005439 | Bacteria | 2611 |
| 109 | Ga0070711_100076743 | 3300005439 | Bacteria | 2370 |
| 110 | Ga0070711_100477342 | 3300005439 | Unclassified | 1024 |
| 111 | Ga0070711_100684904 | 3300005439 | Bacteria | 862 |
| 112 | Ga0070705_100002491 | 3300005440 | Bacteria | 9254 |
| 113 | Ga0070700_100001353 | 3300005441 | Bacteria | 12190 |
| 114 | Ga0070700_100719446 | 3300005441 | Bacteria | 796 |
| 115 | Ga0070694_100000129 | 3300005444 | Bacteria | 37699 |
| 116 | Ga0070708_100007439 | 3300005445 | Bacteria | 8766 |
| 117 | Ga0070663_100001786 | 3300005455 | Bacteria | 11966 |
| 118 | Ga0070663_101361711 | 3300005455 | Unclassified | 628 |
| 119 | Ga0070678_100010388 | 3300005456 | Bacteria | 5684 |
| 120 | Ga0070678_100012816 | 3300005456 | Bacteria | 5229 |
| 121 | Ga0070678_100023973 | 3300005456 | Bacteria | 4076 |
| 122 | Ga0070678_100029790 | 3300005456 | Bacteria | 3742 |
| 123 | Ga0070662_100000933 | 3300005457 | Bacteria | 17890 |
| 124 | Ga0070662_100164222 | 3300005457 | Bacteria | 1739 |
| 125 | Ga0070662_100656567 | 3300005457 | Bacteria | 885 |
| 126 | Ga0070662_101648905 | 3300005457 | Bacteria | 554 |
| 127 | Ga0070681_10001286 | 3300005458 | Bacteria | 21879 |
| 128 | Ga0070681_12049975 | 3300005458 | Unclassified | 500 |
| 129 | Ga0068867_100000369 | 3300005459 | Bacteria | 29980 |
| 130 | Ga0070685_10001791 | 3300005466 | Bacteria | 11233 |
| 131 | Ga0070685_10049852 | 3300005466 | Unclassified | 2417 |
| 132 | Ga0070685_10182056 | 3300005466 | Bacteria | 1353 |
| 133 | Ga0070685_11131363 | 3300005466 | Bacteria | 593 |
| 134 | Ga0070679_100000553 | 3300005530 | Bacteria | 31683 |
| 135 | Ga0070679_100039247 | 3300005530 | Bacteria | 4706 |
| 136 | Ga0070684_100000246 | 3300005535 | Bacteria | 37600 |
| 137 | Ga0070684_100038423 | 3300005535 | Bacteria | 4112 |
| 138 | Ga0070697_100343559 | 3300005536 | Bacteria | 1288 |
| 139 | Ga0070697_100811724 | 3300005536 | Unclassified | 828 |
| 140 | Ga0068853_100002121 | 3300005539 | Bacteria | 14740 |
| 141 | Ga0068853_100545567 | 3300005539 | Bacteria | 1098 |
| 142 | Ga0068853_101032569 | 3300005539 | Bacteria | 792 |
| 143 | Ga0070672_100000157 | 3300005543 | Bacteria | 37598 |
| 144 | Ga0070672_100290140 | 3300005543 | Bacteria | 1385 |
| 145 | Ga0070686_100000260 | 3300005544 | Bacteria | 36083 |
| 146 | Ga0070695_100009157 | 3300005545 | Bacteria | 5888 |
| 147 | Ga0070696_100006359 | 3300005546 | Bacteria | 7905 |
| 148 | Ga0070696_100267392 | 3300005546 | Bacteria | 1299 |
| 149 | Ga0070693_100009423 | 3300005547 | Bacteria | 4854 |
| 150 | Ga0070693_100642150 | 3300005547 | Unclassified | 771 |
| 151 | Ga0070665_100014837 | 3300005548 | Bacteria | 7820 |
| 152 | Ga0070665_101146719 | 3300005548 | Unclassified | 788 |
| 153 | Ga0070704_100000171 | 3300005549 | Bacteria | 25774 |
| 154 | Ga0070704_101425650 | 3300005549 | Bacteria | 636 |
| 155 | Ga0068855_100005012 | 3300005563 | Bacteria | 16165 |
| 156 | Ga0070664_100000269 | 3300005564 | Bacteria | 37475 |
| 157 | Ga0070664_100293293 | 3300005564 | Bacteria | 1468 |
| 158 | Ga0070664_100738133 | 3300005564 | Unclassified | 919 |
| 159 | Ga0068857_100000174 | 3300005577 | Bacteria | 40766 |
| 160 | Ga0068857_100282150 | 3300005577 | Bacteria | 1528 |
| 161 | Ga0068857_101054664 | 3300005577 | Bacteria | 784 |
| 162 | Ga0068854_100000211 | 3300005578 | Bacteria | 39059 |
| 163 | Ga0068856_100000600 | 3300005614 | Bacteria | 39415 |
| 164 | Ga0068856_100598569 | 3300005614 | Unclassified | 1123 |
| 165 | Ga0068856_101863969 | 3300005614 | Unclassified | 613 |
| 166 | Ga0070702_100000312 | 3300005615 | Bacteria | 16802 |
| 167 | Ga0070702_100072607 | 3300005615 | Unclassified | 2037 |
| 168 | Ga0070702_101450997 | 3300005615 | Bacteria | 563 |
| 169 | Ga0068852_100003615 | 3300005616 | Bacteria | 10822 |
| 170 | Ga0068859_100000894 | 3300005617 | Bacteria | 30361 |
| 171 | Ga0068859_100404264 | 3300005617 | Bacteria | 1461 |
| 172 | Ga0068859_100487381 | 3300005617 | Bacteria | 1328 |
| 173 | Ga0068859_100553731 | 3300005617 | Bacteria | 1244 |
| 174 | Ga0068859_100563362 | 3300005617 | Bacteria | 1233 |
| 175 | Ga0068864_100000329 | 3300005618 | Bacteria | 41801 |
| 176 | Ga0068864_100227774 | 3300005618 | Bacteria | 1722 |
| 177 | Ga0068866_10341182 | 3300005718 | Bacteria | 949 |
| 178 | Ga0068870_10000056 | 3300005840 | Bacteria | 36039 |
| 179 | Ga0068870_10243906 | 3300005840 | Bacteria | 1111 |
| 180 | Ga0068863_100000278 | 3300005841 | Bacteria | 53024 |
| 181 | Ga0068863_100198453 | 3300005841 | Bacteria | 1929 |
| 182 | Ga0068863_100590603 | 3300005841 | Bacteria | 1098 |
| 183 | Ga0068858_100001048 | 3300005842 | Bacteria | 28582 |
| 184 | Ga0068858_100182355 | 3300005842 | Bacteria | 1982 |
| 185 | Ga0068858_100243060 | 3300005842 | Bacteria | 1708 |
| 186 | Ga0068858_100817437 | 3300005842 | Bacteria | 909 |
| 187 | Ga0068858_101282022 | 3300005842 | Bacteria | 721 |
| 188 | Ga0068860_100000985 | 3300005843 | Bacteria | 31478 |
| 189 | Ga0068860_100223025 | 3300005843 | Unclassified | 1831 |
| 190 | Ga0068862_100000593 | 3300005844 | Bacteria | 37703 |
| 191 | Ga0068862_100477351 | 3300005844 | Bacteria | 1180 |
| 192 | Ga0081455_10114341 | 3300005937 | Bacteria | 2139 |
| 193 | Ga0081540_1000008 | 3300005983 | Bacteria | 203702 |
| 194 | Ga0070717_10289983 | 3300006028 | Bacteria | 1453 |
| 195 | Ga0070717_10331433 | 3300006028 | Unclassified | 1358 |
| 196 | Ga0070717_10610210 | 3300006028 | Bacteria | 990 |
| 197 | Ga0075365_10979706 | 3300006038 | Bacteria | 596 |
| 198 | Ga0075363_100634200 | 3300006048 | Bacteria | 642 |
| 199 | Ga0075363_100655442 | 3300006048 | Bacteria | 632 |
| 200 | Ga0075364_10035141 | 3300006051 | Bacteria | 3238 |
| 201 | Ga0075364_10071044 | 3300006051 | Bacteria | 2292 |
| 202 | Ga0075432_10000435 | 3300006058 | Bacteria | 12267 |
| 203 | Ga0070715_10007119 | 3300006163 | Bacteria | 3839 |
| 204 | Ga0070712_100459829 | 3300006175 | Bacteria | 1061 |
| 205 | Ga0075362_10005903 | 3300006177 | Bacteria | 4521 |
| 206 | Ga0075367_10047325 | 3300006178 | Bacteria | 2530 |
| 207 | Ga0075367_10150782 | 3300006178 | Bacteria | 1443 |
| 208 | Ga0075367_10256697 | 3300006178 | Bacteria | 1097 |
| 209 | Ga0075367_10788310 | 3300006178 | Bacteria | 605 |
| 210 | Ga0075427_10000061 | 3300006194 | Bacteria | 8226 |
| 211 | Ga0075366_10016041 | 3300006195 | Bacteria | 4302 |
| 212 | Ga0075366_10073912 | 3300006195 | Bacteria | 2032 |
| 213 | Ga0075366_10554471 | 3300006195 | Bacteria | 712 |
| 214 | Ga0075366_10713402 | 3300006195 | Bacteria | 623 |
| 215 | Ga0075366_10882959 | 3300006195 | Bacteria | 557 |
| 216 | Ga0097621_100000504 | 3300006237 | Bacteria | 27335 |
| 217 | Ga0097621_100779752 | 3300006237 | Unclassified | 885 |
| 218 | Ga0097621_101025508 | 3300006237 | Bacteria | 772 |
| 219 | Ga0075370_10091733 | 3300006353 | Bacteria | 1753 |
| 220 | Ga0075370_10478118 | 3300006353 | Bacteria | 751 |
| 221 | Ga0068871_100000815 | 3300006358 | Bacteria | 20895 |
| 222 | Ga0068871_100070338 | 3300006358 | Bacteria | 2876 |
| 223 | Ga0068871_100076484 | 3300006358 | Bacteria | 2765 |
| 224 | Ga0075428_100001096 | 3300006844 | Bacteria | 28836 |
| 225 | Ga0075428_100001439 | 3300006844 | Bacteria | 25419 |
| 226 | Ga0075430_100001275 | 3300006846 | Bacteria | 20297 |
| 227 | Ga0075430_100061302 | 3300006846 | Bacteria | 3161 |
| 228 | Ga0075430_100640127 | 3300006846 | Bacteria | 877 |
| 229 | Ga0075431_100006467 | 3300006847 | Bacteria | 11636 |
| 230 | Ga0075431_100011265 | 3300006847 | Bacteria | 9007 |
| 231 | Ga0075431_100467799 | 3300006847 | Bacteria | 1255 |
| 232 | Ga0075431_101225776 | 3300006847 | Bacteria | 713 |
| 233 | Ga0075433_10011448 | 3300006852 | Bacteria | 7145 |
| 234 | Ga0075433_10062959 | 3300006852 | Bacteria | 3249 |
| 235 | Ga0075433_10328397 | 3300006852 | Unclassified | 1353 |
| 236 | Ga0075433_11444506 | 3300006852 | Bacteria | 595 |
| 237 | Ga0075434_100000244 | 3300006871 | Bacteria | 38039 |
| 238 | Ga0075434_100007451 | 3300006871 | Bacteria | 10123 |
| 239 | Ga0075434_100262160 | 3300006871 | Unclassified | 1747 |
| 240 | Ga0075429_100000388 | 3300006880 | Bacteria | 32233 |
| 241 | Ga0075429_100004065 | 3300006880 | Bacteria | 12537 |
| 242 | Ga0075429_101006317 | 3300006880 | Unclassified | 729 |
| 243 | Ga0075429_101405896 | 3300006880 | Unclassified | 608 |
| 244 | Ga0075436_100105119 | 3300006914 | Unclassified | 1969 |
| 245 | Ga0075436_100166843 | 3300006914 | Unclassified | 1554 |
| 246 | Ga0075436_100259095 | 3300006914 | Bacteria | 1240 |
| 247 | Ga0075436_100457545 | 3300006914 | Bacteria | 930 |
| 248 | Ga0075436_100688626 | 3300006914 | Unclassified | 757 |
| 249 | Ga0097620_100000894 | 3300006931 | Bacteria | 30361 |
| 250 | Ga0097620_100404243 | 3300006931 | Bacteria | 1461 |
| 251 | Ga0097620_100487484 | 3300006931 | Bacteria | 1328 |
| 252 | Ga0097620_100553730 | 3300006931 | Bacteria | 1244 |
| 253 | Ga0097620_100563363 | 3300006931 | Bacteria | 1233 |
| 254 | Ga0075435_100223748 | 3300007076 | Bacteria | 1598 |
| 255 | Ga0075435_100296359 | 3300007076 | Bacteria | 1383 |
| 256 | Ga0075435_100488950 | 3300007076 | Unclassified | 1063 |
| 257 | Ga0075435_100497848 | 3300007076 | Unclassified | 1053 |
| 258 | Ga0075435_101353843 | 3300007076 | Unclassified | 624 |
| 259 | Ga0099795_10009067 | 3300007788 | Bacteria | 2870 |
| 260 | Ga0105251_10060586 | 3300009011 | Bacteria | 1781 |
| 261 | Ga0105251_10143611 | 3300009011 | Bacteria | 1079 |
| 262 | Ga0105250_10444335 | 3300009092 | Bacteria | 581 |
| 263 | Ga0105240_10016606 | 3300009093 | Bacteria | 9959 |
| 264 | Ga0105240_10170530 | 3300009093 | Bacteria | 2578 |
| 265 | Ga0105240_11697185 | 3300009093 | Unclassified | 659 |
| 266 | Ga0111539_10000835 | 3300009094 | Bacteria | 40036 |
| 267 | Ga0111539_10001076 | 3300009094 | Bacteria | 36048 |
| 268 | Ga0111539_10002315 | 3300009094 | Bacteria | 25343 |
| 269 | Ga0111539_10105140 | 3300009094 | Bacteria | 3312 |
| 270 | Ga0111539_10172234 | 3300009094 | Bacteria | 2529 |
| 271 | Ga0105245_10000451 | 3300009098 | Bacteria | 37705 |
| 272 | Ga0105245_10039669 | 3300009098 | Unclassified | 4191 |
| 273 | Ga0105245_10580552 | 3300009098 | Unclassified | 1145 |
| 274 | Ga0105247_10001016 | 3300009101 | Bacteria | 21159 |
| 275 | Ga0105247_10015781 | 3300009101 | Bacteria | 4522 |
| 276 | Ga0105247_10236818 | 3300009101 | Unclassified | 1242 |
| 277 | Ga0114129_10003642 | 3300009147 | Bacteria | 21678 |
| 278 | Ga0114129_10005725 | 3300009147 | Bacteria | 17605 |
| 279 | Ga0114129_10006438 | 3300009147 | Bacteria | 16649 |
| 280 | Ga0114129_10690800 | 3300009147 | Bacteria | 1312 |
| 281 | Ga0114129_11055913 | 3300009147 | Bacteria | 1019 |
| 282 | Ga0114129_11188478 | 3300009147 | Bacteria | 951 |
| 283 | Ga0105243_10002173 | 3300009148 | Bacteria | 16567 |
| 284 | Ga0105243_10105337 | 3300009148 | Unclassified | 2349 |
| 285 | Ga0105243_10157922 | 3300009148 | Bacteria | 1952 |
| 286 | Ga0105241_10001549 | 3300009174 | Bacteria | 17620 |
| 287 | Ga0105241_10242485 | 3300009174 | Bacteria | 1524 |
| 288 | Ga0105242_10000947 | 3300009176 | Bacteria | 22652 |
| 289 | Ga0105242_10058894 | 3300009176 | Bacteria | 3151 |
| 290 | Ga0105242_10229439 | 3300009176 | Bacteria | 1663 |
| 291 | Ga0105248_10000837 | 3300009177 | Bacteria | 34570 |
| 292 | Ga0105237_10022344 | 3300009545 | Bacteria | 6492 |
| 293 | Ga0105237_10416353 | 3300009545 | Bacteria | 1349 |
| 294 | Ga0105238_10102115 | 3300009551 | Bacteria | 2850 |
| 295 | Ga0105238_10255872 | 3300009551 | Bacteria | 1730 |
| 296 | Ga0105238_10933194 | 3300009551 | Bacteria | 887 |
| 297 | Ga0105249_10000976 | 3300009553 | Bacteria | 25338 |
| 298 | Ga0105249_10298822 | 3300009553 | Bacteria | 1614 |
| 299 | Ga0105249_10387154 | 3300009553 | Bacteria | 1425 |
| 300 | Ga0099796_10017285 | 3300010159 | Bacteria | 2144 |
| 301 | Ga0105239_10040227 | 3300010375 | Bacteria | 5123 |
| 302 | Ga0105239_10348910 | 3300010375 | Bacteria | 1671 |
| 303 | Ga0105239_10895094 | 3300010375 | Bacteria | 1019 |
| 304 | Ga0105239_11955925 | 3300010375 | Bacteria | 680 |
| 305 | Ga0105246_10000100 | 3300011119 | Bacteria | 37689 |
| 306 | Ga0105246_10262932 | 3300011119 | Unclassified | 1375 |
| 307 | Ga0157325_1022502 | 3300012485 | Bacteria | 574 |
| 308 | Ga0157315_1003623 | 3300012508 | Unclassified | 1054 |
| 309 | Ga0157316_1007613 | 3300012510 | Bacteria | 925 |
| 310 | Ga0157326_1025419 | 3300012513 | Bacteria | 756 |
| 311 | Ga0157373_10125461 | 3300013100 | Bacteria | 1805 |
| 312 | Ga0157371_10001676 | 3300013102 | Bacteria | 22625 |
| 313 | Ga0157371_11018007 | 3300013102 | Unclassified | 632 |
| 314 | Ga0157370_10264187 | 3300013104 | Bacteria | 1590 |
| 315 | Ga0157374_10000956 | 3300013296 | Bacteria | 25071 |
| 316 | Ga0157374_10231659 | 3300013296 | Bacteria | 1814 |
| 317 | Ga0157374_10491830 | 3300013296 | Bacteria | 1231 |
| 318 | Ga0157374_10526487 | 3300013296 | Bacteria | 1188 |
| 319 | Ga0157378_10001544 | 3300013297 | Bacteria | 20818 |
| 320 | Ga0157378_10126320 | 3300013297 | Unclassified | 2363 |
| 321 | Ga0157378_10729447 | 3300013297 | Bacteria | 1012 |
| 322 | Ga0163162_12556632 | 3300013306 | Bacteria | 587 |
| 323 | Ga0157372_10026270 | 3300013307 | Bacteria | 6335 |
| 324 | Ga0157375_10000464 | 3300013308 | Bacteria | 36915 |
| 325 | Ga0157375_10232409 | 3300013308 | Bacteria | 2003 |
| 326 | Ga0157375_10364612 | 3300013308 | Bacteria | 1611 |
| 327 | Ga0163163_10003318 | 3300014325 | Bacteria | 13651 |
| 328 | Ga0157380_10000145 | 3300014326 | Bacteria | 40211 |
| 329 | Ga0157380_11689294 | 3300014326 | Bacteria | 690 |
| 330 | Ga0157377_10000179 | 3300014745 | Bacteria | 36682 |
| 331 | Ga0157379_10000067 | 3300014968 | Bacteria | 66051 |
| 332 | Ga0157379_10164378 | 3300014968 | Unclassified | 2003 |
| 333 | Ga0157379_11518984 | 3300014968 | Bacteria | 652 |
| 334 | Ga0157376_10023037 | 3300014969 | Unclassified | 4866 |
| 335 | Ga0157376_10244829 | 3300014969 | Unclassified | 1672 |
| 336 | Ga0157376_11715251 | 3300014969 | Bacteria | 663 |
| 337 | Ga0163161_10001462 | 3300017792 | Bacteria | 17455 |
| 338 | Ga0163161_10050492 | 3300017792 | Bacteria | 3011 |
| 339 | Ga0163161_10407560 | 3300017792 | Bacteria | 1091 |
| 340 | Ga0213876_10176105 | 3300021384 | Bacteria | 1138 |
| 341 | Ga0209233_1004623 | 3300025261 | Bacteria | 4654 |
| 342 | Ga0207666_1000002 | 3300025271 | Bacteria | 62717 |
| 343 | Ga0207673_1000015 | 3300025290 | Bacteria | 13527 |
| 344 | Ga0207697_10000113 | 3300025315 | Bacteria | 37772 |
| 345 | Ga0207697_10085892 | 3300025315 | Bacteria | 1330 |
| 346 | Ga0207713_1102851 | 3300025735 | Bacteria | 983 |
| 347 | Ga0207653_10001270 | 3300025885 | Bacteria | 8227 |
| 348 | Ga0207682_10000094 | 3300025893 | Bacteria | 41188 |
| 349 | Ga0207682_10001641 | 3300025893 | Bacteria | 10258 |
| 350 | Ga0207642_10000337 | 3300025899 | Bacteria | 14044 |
| 351 | Ga0207710_10000795 | 3300025900 | Bacteria | 17144 |
| 352 | Ga0207710_10004197 | 3300025900 | Bacteria | 6314 |
| 353 | Ga0207710_10022043 | 3300025900 | Unclassified | 2732 |
| 354 | Ga0207688_10000074 | 3300025901 | Bacteria | 37681 |
| 355 | Ga0207688_10057634 | 3300025901 | Bacteria | 2184 |
| 356 | Ga0207688_10200449 | 3300025901 | Bacteria | 1196 |
| 357 | Ga0207680_10010896 | 3300025903 | Bacteria | 4570 |
| 358 | Ga0207680_10363425 | 3300025903 | Bacteria | 1018 |
| 359 | Ga0207680_11187744 | 3300025903 | Unclassified | 544 |
| 360 | Ga0207647_10000218 | 3300025904 | Bacteria | 46963 |
| 361 | Ga0207685_10004360 | 3300025905 | Bacteria | 3587 |
| 362 | Ga0207685_10036665 | 3300025905 | Bacteria | 1800 |
| 363 | Ga0207699_10206091 | 3300025906 | Bacteria | 1335 |
| 364 | Ga0207699_10655603 | 3300025906 | Bacteria | 767 |
| 365 | Ga0207645_10000247 | 3300025907 | Bacteria | 44983 |
| 366 | Ga0207645_10042103 | 3300025907 | Bacteria | 2923 |
| 367 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 368 | Ga0207643_10299968 | 3300025908 | Bacteria | 1000 |
| 369 | Ga0207654_10000627 | 3300025911 | Bacteria | 19909 |
| 370 | Ga0207654_10117741 | 3300025911 | Unclassified | 1663 |
| 371 | Ga0207707_10000618 | 3300025912 | Bacteria | 35350 |
| 372 | Ga0207695_10030828 | 3300025913 | Bacteria | 5899 |
| 373 | Ga0207671_10011571 | 3300025914 | Bacteria | 7165 |
| 374 | Ga0207671_10432590 | 3300025914 | Bacteria | 1047 |
| 375 | Ga0207693_10011262 | 3300025915 | Bacteria | 7240 |
| 376 | Ga0207693_10344841 | 3300025915 | Bacteria | 1166 |
| 377 | Ga0207663_10119004 | 3300025916 | Unclassified | 1805 |
| 378 | Ga0207663_10605393 | 3300025916 | Bacteria | 861 |
| 379 | Ga0207663_11061123 | 3300025916 | Bacteria | 651 |
| 380 | Ga0207663_11320139 | 3300025916 | Bacteria | 581 |
| 381 | Ga0207660_10000741 | 3300025917 | Bacteria | 21651 |
| 382 | Ga0207660_10232039 | 3300025917 | Bacteria | 1451 |
| 383 | Ga0207660_10569458 | 3300025917 | Bacteria | 922 |
| 384 | Ga0207662_10000119 | 3300025918 | Bacteria | 37770 |
| 385 | Ga0207662_10090731 | 3300025918 | Bacteria | 1879 |
| 386 | Ga0207662_10349438 | 3300025918 | Bacteria | 993 |
| 387 | Ga0207662_10454914 | 3300025918 | Bacteria | 876 |
| 388 | Ga0207657_10000316 | 3300025919 | Bacteria | 51145 |
| 389 | Ga0207649_10000090 | 3300025920 | Bacteria | 75387 |
| 390 | Ga0207652_10000847 | 3300025921 | Bacteria | 29115 |
| 391 | Ga0207652_10049716 | 3300025921 | Bacteria | 3590 |
| 392 | Ga0207681_10000370 | 3300025923 | Bacteria | 31836 |
| 393 | Ga0207681_10080489 | 3300025923 | Bacteria | 2298 |
| 394 | Ga0207681_10170983 | 3300025923 | Bacteria | 1647 |
| 395 | Ga0207694_10100847 | 3300025924 | Bacteria | 2288 |
| 396 | Ga0207694_10129130 | 3300025924 | Bacteria | 2025 |
| 397 | Ga0207694_10193007 | 3300025924 | Bacteria | 1655 |
| 398 | Ga0207650_10008243 | 3300025925 | Bacteria | 7114 |
| 399 | Ga0207650_10521824 | 3300025925 | Bacteria | 994 |
| 400 | Ga0207659_10000038 | 3300025926 | Bacteria | 93848 |
| 401 | Ga0207659_10880873 | 3300025926 | Unclassified | 770 |
| 402 | Ga0207687_10000784 | 3300025927 | Bacteria | 21392 |
| 403 | Ga0207687_10265708 | 3300025927 | Bacteria | 1370 |
| 404 | Ga0207687_10308593 | 3300025927 | Bacteria | 1277 |
| 405 | Ga0207700_10187315 | 3300025928 | Unclassified | 1737 |
| 406 | Ga0207700_10256142 | 3300025928 | Bacteria | 1497 |
| 407 | Ga0207700_10312074 | 3300025928 | Bacteria | 1360 |
| 408 | Ga0207700_10934574 | 3300025928 | Unclassified | 776 |
| 409 | Ga0207664_10134950 | 3300025929 | Bacteria | 2082 |
| 410 | Ga0207664_10631794 | 3300025929 | Unclassified | 962 |
| 411 | Ga0207644_10001053 | 3300025931 | Bacteria | 17640 |
| 412 | Ga0207644_10182832 | 3300025931 | Bacteria | 1644 |
| 413 | Ga0207644_10514755 | 3300025931 | Bacteria | 988 |
| 414 | Ga0207690_10000239 | 3300025932 | Bacteria | 39850 |
| 415 | Ga0207690_10183222 | 3300025932 | Bacteria | 1578 |
| 416 | Ga0207690_10566048 | 3300025932 | Bacteria | 925 |
| 417 | Ga0207706_10000424 | 3300025933 | Bacteria | 45410 |
| 418 | Ga0207706_10050735 | 3300025933 | Bacteria | 3666 |
| 419 | Ga0207706_10193010 | 3300025933 | Bacteria | 1787 |
| 420 | Ga0207706_10468322 | 3300025933 | Bacteria | 1089 |
| 421 | Ga0207706_10875861 | 3300025933 | Bacteria | 759 |
| 422 | Ga0207686_10001203 | 3300025934 | Bacteria | 15007 |
| 423 | Ga0207686_10170038 | 3300025934 | Unclassified | 1536 |
| 424 | Ga0207709_10000379 | 3300025935 | Bacteria | 44189 |
| 425 | Ga0207709_10071000 | 3300025935 | Unclassified | 2210 |
| 426 | Ga0207709_10383642 | 3300025935 | Bacteria | 1070 |
| 427 | Ga0207670_10000176 | 3300025936 | Bacteria | 42483 |
| 428 | Ga0207669_10000165 | 3300025937 | Bacteria | 31741 |
| 429 | Ga0207669_10057031 | 3300025937 | Bacteria | 2375 |
| 430 | Ga0207669_10194341 | 3300025937 | Unclassified | 1467 |
| 431 | Ga0207669_11419668 | 3300025937 | Bacteria | 591 |
| 432 | Ga0207704_10001709 | 3300025938 | Bacteria | 9819 |
| 433 | Ga0207704_10037612 | 3300025938 | Bacteria | 2797 |
| 434 | Ga0207704_10750806 | 3300025938 | Bacteria | 811 |
| 435 | Ga0207665_10114251 | 3300025939 | Bacteria | 1900 |
| 436 | Ga0207665_10364748 | 3300025939 | Bacteria | 1093 |
| 437 | Ga0207665_10829070 | 3300025939 | Unclassified | 732 |
| 438 | Ga0207691_10000358 | 3300025940 | Bacteria | 46095 |
| 439 | Ga0207691_10030388 | 3300025940 | Bacteria | 5049 |
| 440 | Ga0207711_10000780 | 3300025941 | Bacteria | 31295 |
| 441 | Ga0207711_10123112 | 3300025941 | Bacteria | 2317 |
| 442 | Ga0207689_10000479 | 3300025942 | Bacteria | 37696 |
| 443 | Ga0207689_10013531 | 3300025942 | Bacteria | 6966 |
| 444 | Ga0207661_10000604 | 3300025944 | Bacteria | 22956 |
| 445 | Ga0207661_10146928 | 3300025944 | Bacteria | 2035 |
| 446 | Ga0207661_11645855 | 3300025944 | Bacteria | 587 |
| 447 | Ga0207679_10000139 | 3300025945 | Bacteria | 59804 |
| 448 | Ga0207679_10846709 | 3300025945 | Unclassified | 835 |
| 449 | Ga0207667_10003492 | 3300025949 | Bacteria | 19417 |
| 450 | Ga0207667_11046741 | 3300025949 | Unclassified | 801 |
| 451 | Ga0207651_10000072 | 3300025960 | Bacteria | 46009 |
| 452 | Ga0207651_10073755 | 3300025960 | Unclassified | 2428 |
| 453 | Ga0207651_10293347 | 3300025960 | Bacteria | 1349 |
| 454 | Ga0207651_10573620 | 3300025960 | Bacteria | 983 |
| 455 | Ga0207712_10000588 | 3300025961 | Bacteria | 29188 |
| 456 | Ga0207712_10735930 | 3300025961 | Bacteria | 863 |
| 457 | Ga0207712_10951283 | 3300025961 | Bacteria | 761 |
| 458 | Ga0207668_10000168 | 3300025972 | Bacteria | 45205 |
| 459 | Ga0207668_10070576 | 3300025972 | Bacteria | 2492 |
| 460 | Ga0207668_10583842 | 3300025972 | Bacteria | 972 |
| 461 | Ga0207668_11014867 | 3300025972 | Bacteria | 742 |
| 462 | Ga0207640_10000242 | 3300025981 | Bacteria | 37007 |
| 463 | Ga0207640_12096931 | 3300025981 | Bacteria | 513 |
| 464 | Ga0207658_10000667 | 3300025986 | Bacteria | 29975 |
| 465 | Ga0207677_10004440 | 3300026023 | Bacteria | 7533 |
| 466 | Ga0207703_10000463 | 3300026035 | Bacteria | 42725 |
| 467 | Ga0207703_10147628 | 3300026035 | Bacteria | 2047 |
| 468 | Ga0207703_10965194 | 3300026035 | Unclassified | 817 |
| 469 | Ga0207703_12043524 | 3300026035 | Unclassified | 549 |
| 470 | Ga0207639_10002404 | 3300026041 | Bacteria | 12567 |
| 471 | Ga0207678_10000447 | 3300026067 | Bacteria | 37597 |
| 472 | Ga0207678_10025607 | 3300026067 | Bacteria | 5149 |
| 473 | Ga0207708_10000293 | 3300026075 | Bacteria | 39298 |
| 474 | Ga0207708_10167148 | 3300026075 | Bacteria | 1740 |
| 475 | Ga0207708_10977867 | 3300026075 | Unclassified | 735 |
| 476 | Ga0207702_10007213 | 3300026078 | Bacteria | 9510 |
| 477 | Ga0207702_10501576 | 3300026078 | Bacteria | 1183 |
| 478 | Ga0207641_10000724 | 3300026088 | Bacteria | 35413 |
| 479 | Ga0207641_10876642 | 3300026088 | Bacteria | 890 |
| 480 | Ga0207641_11028329 | 3300026088 | Bacteria | 821 |
| 481 | Ga0207648_10000223 | 3300026089 | Bacteria | 61064 |
| 482 | Ga0207648_10404594 | 3300026089 | Bacteria | 1237 |
| 483 | Ga0207648_10418586 | 3300026089 | Bacteria | 1216 |
| 484 | Ga0207676_10000392 | 3300026095 | Bacteria | 37207 |
| 485 | Ga0207674_10000955 | 3300026116 | Bacteria | 37769 |
| 486 | Ga0207674_10203822 | 3300026116 | Bacteria | 1927 |
| 487 | Ga0207674_10945629 | 3300026116 | Bacteria | 830 |
| 488 | Ga0207675_100000364 | 3300026118 | Bacteria | 43420 |
| 489 | Ga0207675_100537267 | 3300026118 | Bacteria | 1167 |
| 490 | Ga0207675_101020457 | 3300026118 | Bacteria | 846 |
| 491 | Ga0207683_10000397 | 3300026121 | Bacteria | 39911 |
| 492 | Ga0207683_10015258 | 3300026121 | Bacteria | 6538 |
| 493 | Ga0207683_10033226 | 3300026121 | Bacteria | 4481 |
| 494 | Ga0207698_10003705 | 3300026142 | Bacteria | 9239 |
| 495 | Ga0209973_1016160 | 3300027252 | Bacteria | 949 |
| 496 | Ga0209996_1018694 | 3300027395 | Bacteria | 964 |
| 497 | Ga0209984_1012090 | 3300027424 | Bacteria | 1123 |
| 498 | Ga0210002_1001181 | 3300027617 | Unclassified | 3640 |
| 499 | Ga0209971_1037562 | 3300027682 | Bacteria | 1166 |
| 500 | Ga0209998_10000535 | 3300027717 | Bacteria | 10223 |
| 501 | Ga0209813_10239612 | 3300027866 | Bacteria | 685 |
| 502 | Ga0209813_10435923 | 3300027866 | Bacteria | 534 |
| 503 | Ga0209974_10001185 | 3300027876 | Bacteria | 9317 |
| 504 | Ga0207428_10000272 | 3300027907 | Bacteria | 69872 |
| 505 | Ga0207428_10000439 | 3300027907 | Bacteria | 50911 |
| 506 | Ga0207428_10016728 | 3300027907 | Bacteria | 6308 |
| 507 | Ga0207428_10620227 | 3300027907 | Bacteria | 778 |
| 508 | Ga0268266_10008599 | 3300028379 | Bacteria | 9068 |
| 509 | Ga0268265_10002666 | 3300028380 | Bacteria | 13234 |
| 510 | Ga0268265_10068403 | 3300028380 | Bacteria | 2754 |
| 511 | Ga0268265_10681146 | 3300028380 | Bacteria | 991 |
| 512 | Ga0268264_10000890 | 3300028381 | Bacteria | 31465 |
| 513 | Ga0265760_10135921 | 3300031090 | Bacteria | 798 |
| 514 | Ga0265325_10000019 | 3300031241 | Bacteria | 125265 |
| 515 | Ga0265325_10045188 | 3300031241 | Bacteria | 2290 |
| 516 | Ga0265325_10275903 | 3300031241 | Bacteria | 755 |
| 517 | Ga0265340_10023297 | 3300031247 | Bacteria | 3158 |
| 518 | Ga0307408_101817597 | 3300031548 | Unclassified | 583 |
| 519 | Ga0265313_10004790 | 3300031595 | Bacteria | 10192 |
| 520 | Ga0265314_10000577 | 3300031711 | Bacteria | 46408 |
| 521 | Ga0316576_10255584 | 3300031727 | Bacteria | 1315 |
| 522 | Ga0307405_10644535 | 3300031731 | Bacteria | 870 |
| 523 | Ga0307409_100305577 | 3300031995 | Bacteria | 1482 |
| 524 | Ga0307416_102768684 | 3300032002 | Bacteria | 586 |
| 525 | Ga0307415_100540982 | 3300032126 | Bacteria | 1026 |
| 526 | Ga0373930_0008163 | 3300034816 | Bacteria | 1827 |
| 527 | Ga0373930_0040686 | 3300034816 | Bacteria | 989 |
| 528 | Ga0373948_0023739 | 3300034817 | Bacteria | 1191 |
| 529 | Ga0373950_0005260 | 3300034818 | Bacteria | 1927 |
| 530 | Ga0373950_0020954 | 3300034818 | Bacteria | 1153 |
| 531 | Ga0373958_0008288 | 3300034819 | Bacteria | 1680 |
| 532 | Ga0373959_0009193 | 3300034820 | Bacteria | 1698 |
| 533 | Ga0373959_0040869 | 3300034820 | Bacteria | 972 |
| 534 | Ga0373938_0000801 | 3300034957 | Bacteria | 5110 |
| 535 | Ga0373938_0004620 | 3300034957 | Bacteria | 2310 |
| 536 | Ga0373926_0030151 | 3300035083 | Bacteria | 1909 |
| 537 | Ga0373928_0008041 | 3300035084 | Bacteria | 2042 |
| 538 | Ga0373928_0106569 | 3300035084 | Bacteria | 737 |
| 539 | Ga0373929_0026251 | 3300035085 | Bacteria | 1216 |
| 540 | Ga0373934_0029917 | 3300035086 | Bacteria | 2129 |
| 541 | Ga0373934_0131661 | 3300035086 | Unclassified | 1020 |
| 542 | Ga0373940_0024844 | 3300035088 | Bacteria | 1556 |
| 543 | Ga0373944_0005312 | 3300035089 | Unclassified | 3387 |
| 544 | Ga0373944_0254141 | 3300035089 | Bacteria | 649 |
| 545 | Ga0373949_0005655 | 3300035090 | Bacteria | 2782 |
| 546 | Ga0373949_0015968 | 3300035090 | Bacteria | 1681 |
| 547 | Ga0373951_0004903 | 3300035091 | Bacteria | 3140 |
| 548 | Ga0373951_0005568 | 3300035091 | Bacteria | 2921 |
| 549 | Ga0373952_0000491 | 3300035092 | Bacteria | 6857 |
| 550 | Ga0373952_0069200 | 3300035092 | Bacteria | 879 |
| 551 | Ga0373923_0001791 | 3300035111 | Bacteria | 6335 |
| 552 | Ga0373923_0135138 | 3300035111 | Bacteria | 1111 |
| 553 | Ga0373923_0252043 | 3300035111 | Bacteria | 826 |
| 554 | Ga0373923_0454255 | 3300035111 | Unclassified | 621 |
| 555 | Ga0373932_0010270 | 3300035112 | Bacteria | 2263 |
| 556 | Ga0373936_0059436 | 3300035113 | Bacteria | 1558 |
| 557 | Ga0373939_0000671 | 3300035114 | Bacteria | 8492 |
| 558 | Ga0373939_0158875 | 3300035114 | Bacteria | 828 |
| 559 | Ga0373941_0002421 | 3300035115 | Bacteria | 4103 |
| 560 | Ga0373941_0002853 | 3300035115 | Bacteria | 3854 |
| 561 | Ga0373945_0047206 | 3300035116 | Bacteria | 1574 |
| 562 | Ga0373945_0058782 | 3300035116 | Bacteria | 1430 |
| 563 | Ga0373945_0176927 | 3300035116 | Bacteria | 877 |
| 564 | Ga0373953_0003123 | 3300035117 | Bacteria | 5108 |
| 565 | Ga0373953_0203063 | 3300035117 | Bacteria | 857 |
| 566 | Ga0373954_0010232 | 3300035118 | Bacteria | 4136 |
| 567 | Ga0373954_0027582 | 3300035118 | Bacteria | 2608 |
| 568 | Ga0373954_0037490 | 3300035118 | Unclassified | 2253 |
| 569 | Ga0373957_0005354 | 3300035120 | Bacteria | 3973 |
| 570 | Ga0373957_0005745 | 3300035120 | Unclassified | 3866 |
| 571 | Ga0373960_0001077 | 3300035121 | Bacteria | 5890 |
| 572 | Ga0373960_0023438 | 3300035121 | Bacteria | 1662 |
| 573 | Ga0373960_0323101 | 3300035121 | Bacteria | 579 |
| 574 | Ga0373943_0000417 | 3300035170 | Bacteria | 17965 |
| 575 | Ga0373943_0013438 | 3300035170 | Bacteria | 3698 |
| 576 | Ga0373946_0001306 | 3300035171 | Bacteria | 8620 |
| 577 | Ga0373946_0005513 | 3300035171 | Bacteria | 4566 |
| 578 | Ga0373946_0019410 | 3300035171 | Bacteria | 2619 |
| 579 | Ga0373946_0061121 | 3300035171 | Bacteria | 1603 |
| 580 | Ga0373955_0002670 | 3300035172 | Bacteria | 7801 |
| 581 | Ga0373955_0007047 | 3300035172 | Bacteria | 5149 |
| 582 | Ga0373955_0012099 | 3300035172 | Unclassified | 4139 |
| 583 | Ga0373942_0011858 | 3300035207 | Bacteria | 2073 |
| 584 | Ga0373942_0017682 | 3300035207 | Bacteria | 1760 |
| 585 | Ga0373961_0005861 | 3300035241 | Bacteria | 2952 |
| 586 | Ga0373962_0001390 | 3300035242 | Bacteria | 5708 |
| 587 | Ga0373962_0020639 | 3300035242 | Bacteria | 1731 |
| 588 | Ga0316574_0033601 | 3300035398 | Bacteria | 3122 |
| 589 | Ga0373924_0002381 | 3300035410 | Bacteria | 6330 |
| 590 | Ga0373924_0017622 | 3300035410 | Bacteria | 2742 |
| 591 | Ga0373931_0000089 | 3300035691 | Bacteria | 42136 |
| 592 | Ga0373931_0022029 | 3300035691 | Bacteria | 3202 |
| 593 | Ga0373935_0000037 | 3300035692 | Bacteria | 51610 |
| 594 | Ga0373935_0015408 | 3300035692 | Bacteria | 4621 |
| 595 | Ga0373935_0026462 | 3300035692 | Bacteria | 3580 |
| 596 | Ga0373935_0175304 | 3300035692 | Bacteria | 1469 |
| 597 | Ga0373927_0000700 | 3300035695 | Bacteria | 25687 |
| 598 | Ga0373927_0044985 | 3300035695 | Bacteria | 2856 |
| 599 | Ga0373927_0241634 | 3300035695 | Bacteria | 1187 |
| 600 | Ga0373933_0001535 | 3300035724 | Bacteria | 13497 |
| 601 | Ga0373933_0013152 | 3300035724 | Bacteria | 4583 |
| 602 | Ga0373933_0013294 | 3300035724 | Unclassified | 4560 |
| 603 | Ga0373933_0951591 | 3300035724 | Unclassified | 566 |
| 604 | Ga0373947_0000333 | 3300035725 | Bacteria | 26541 |
| 605 | Ga0373947_0007823 | 3300035725 | Bacteria | 6174 |
| 606 | Ga0373947_0122291 | 3300035725 | Bacteria | 1654 |
| 607 | Ga0373947_0652924 | 3300035725 | Unclassified | 717 |
| 608 | Ga0373937_0000018 | 3300036401 | Bacteria | 144056 |
| 609 | Ga0373937_0001938 | 3300036401 | Bacteria | 17317 |
| 610 | Ga0373937_0007486 | 3300036401 | Bacteria | 9449 |
| 611 | Ga0373937_0158069 | 3300036401 | Bacteria | 2125 |
| 612 | Ga0373937_1589427 | 3300036401 | Unclassified | 601 |
| 613 | Ga0316584_0037455 | 3300036712 | Bacteria | 3604 |
| 614 | Ga0373925_0003079 | 3300037068 | Bacteria | 13090 |
| 615 | Ga0373925_0004485 | 3300037068 | Bacteria | 10548 |
| 616 | Ga0373925_0020402 | 3300037068 | Bacteria | 4824 |
| 617 | Ga0436364_0246124 | 3300037853 | Bacteria | 1586 |
| 618 | Ga0436364_0741110 | 3300037853 | Bacteria | 1609 |
| 619 | Ga0436365_1346123 | 3300039437 | Bacteria | 1329 |
| 620 | Ga0436365_1822239 | 3300039437 | Bacteria | 4605 |
| 621 | Ga0436360_0159932 | 3300039438 | Bacteria | 519 |
| 622 | Ga0436361_0031041 | 3300039447 | Bacteria | 4242 |
| 623 | Ga0451800_0770855 | 3300041459 | Bacteria | 530 |
| 624 | Ga0451804_0516851 | 3300041463 | Bacteria | 731 |
| 625 | Ga0451577_1680239 | 3300042876 | Bacteria | 559 |
| 626 | Ga0466967_0928838 | 3300045976 | Bacteria | 866 |
| 627 | Ga0495592_0000055 | 3300046454 | Bacteria | 106223 |
| 628 | Ga0495592_0056360 | 3300046454 | Unclassified | 2904 |
| 629 | Ga0495603_0051326 | 3300046455 | Bacteria | 2451 |
| 630 | Ga0495603_0726683 | 3300046455 | Bacteria | 567 |
| 631 | Ga0495629_0000715 | 3300046459 | Bacteria | 26888 |
| 632 | Ga0495629_0004595 | 3300046459 | Bacteria | 10333 |
| 633 | Ga0495629_0018872 | 3300046459 | Bacteria | 4930 |
| 634 | Ga0495629_0024418 | 3300046459 | Bacteria | 4305 |
| 635 | Ga0495629_0091826 | 3300046459 | Unclassified | 2119 |
| 636 | Ga0495629_0200721 | 3300046459 | Bacteria | 1379 |
| 637 | Ga0495641_0247329 | 3300046461 | Bacteria | 802 |
| 638 | Ga0495651_0000210 | 3300046462 | Bacteria | 44718 |
| 639 | Ga0495651_0000469 | 3300046462 | Bacteria | 31001 |
| 640 | Ga0495651_0004620 | 3300046462 | Bacteria | 10528 |
| 641 | Ga0495653_0000003 | 3300046463 | Bacteria | 377892 |
| 642 | Ga0495653_0000528 | 3300046463 | Bacteria | 29299 |
| 643 | Ga0495653_0001294 | 3300046463 | Bacteria | 19370 |
| 644 | Ga0495580_0220080 | 3300046472 | Bacteria | 1305 |
| 645 | Ga0495580_0612863 | 3300046472 | Unclassified | 718 |
| 646 | Ga0495582_0004541 | 3300046473 | Bacteria | 7796 |
| 647 | Ga0495582_0019173 | 3300046473 | Bacteria | 3742 |
| 648 | Ga0495605_0085040 | 3300046474 | Bacteria | 1474 |
| 649 | Ga0495639_0044935 | 3300046475 | Unclassified | 1998 |
| 650 | Ga0495639_0087214 | 3300046475 | Unclassified | 1460 |
| 651 | Ga0495662_0002357 | 3300046476 | Bacteria | 9522 |
| 652 | Ga0495662_0175453 | 3300046476 | Bacteria | 1056 |
| 653 | Ga0495662_0215187 | 3300046476 | Bacteria | 947 |
| 654 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 655 | Ga0495664_0002815 | 3300046477 | Bacteria | 9349 |
| 656 | Ga0495664_0020851 | 3300046477 | Bacteria | 3783 |
| 657 | Ga0495584_0211306 | 3300046491 | Bacteria | 986 |
| 658 | Ga0495594_0218359 | 3300046499 | Bacteria | 1087 |
| 659 | Ga0495608_0000012 | 3300046511 | Bacteria | 242758 |
| 660 | Ga0495608_0052498 | 3300046511 | Unclassified | 2698 |
| 661 | Ga0495608_0410299 | 3300046511 | Bacteria | 827 |
| 662 | Ga0495618_0000012 | 3300046514 | Bacteria | 170881 |
| 663 | Ga0495618_0004183 | 3300046514 | Bacteria | 8911 |
| 664 | Ga0495618_0025548 | 3300046514 | Unclassified | 3666 |
| 665 | Ga0495618_0077712 | 3300046514 | Unclassified | 2115 |
| 666 | Ga0495628_0000003 | 3300046516 | Bacteria | 470339 |
| 667 | Ga0495628_0059123 | 3300046516 | Bacteria | 3010 |
| 668 | Ga0495630_0000188 | 3300046517 | Bacteria | 48229 |
| 669 | Ga0495630_0009769 | 3300046517 | Bacteria | 6904 |
| 670 | Ga0495630_0106021 | 3300046517 | Bacteria | 2128 |
| 671 | Ga0495666_0042911 | 3300046526 | Bacteria | 2186 |
| 672 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 673 | Ga0495652_0007567 | 3300046529 | Bacteria | 10012 |
| 674 | Ga0495665_0085041 | 3300046531 | Unclassified | 1662 |
| 675 | Ga0495665_0313586 | 3300046531 | Bacteria | 802 |
| 676 | Ga0495640_0000022 | 3300046533 | Bacteria | 101825 |
| 677 | Ga0495640_0004486 | 3300046533 | Bacteria | 11129 |
| 678 | Ga0495640_0017063 | 3300046533 | Bacteria | 5418 |
| 679 | Ga0495640_0024843 | 3300046533 | Bacteria | 4353 |
| 680 | Ga0495640_0457418 | 3300046533 | Bacteria | 779 |
| 681 | Ga0495586_0064814 | 3300046535 | Bacteria | 1991 |
| 682 | Ga0495586_0279639 | 3300046535 | Bacteria | 955 |
| 683 | Ga0495586_0296414 | 3300046535 | Bacteria | 926 |
| 684 | Ga0495587_0000003 | 3300046536 | Bacteria | 424188 |
| 685 | Ga0495587_0006458 | 3300046536 | Bacteria | 7640 |
| 686 | Ga0495587_0007819 | 3300046536 | Bacteria | 6907 |
| 687 | Ga0495598_0171847 | 3300046537 | Bacteria | 768 |
| 688 | Ga0495609_0085018 | 3300046538 | Unclassified | 1380 |
| 689 | Ga0495621_0046407 | 3300046539 | Bacteria | 1541 |
| 690 | Ga0495645_0000004 | 3300046543 | Bacteria | 532661 |
| 691 | Ga0495645_0045284 | 3300046543 | Bacteria | 3209 |
| 692 | Ga0495645_0137530 | 3300046543 | Bacteria | 1707 |
| 693 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 694 | Ga0495667_0002575 | 3300046559 | Bacteria | 12117 |
| 695 | Ga0495667_0008025 | 3300046559 | Bacteria | 7160 |
| 696 | Ga0495634_0000012 | 3300046642 | Bacteria | 131341 |
| 697 | Ga0495634_0005822 | 3300046642 | Bacteria | 9406 |
| 698 | Ga0495634_0023237 | 3300046642 | Bacteria | 4360 |
| 699 | Ga0495634_0043987 | 3300046642 | Bacteria | 3025 |
| 700 | Ga0495625_0341665 | 3300046660 | Bacteria | 948 |
| 701 | Ga0495635_0000011 | 3300046663 | Bacteria | 240094 |
| 702 | Ga0495635_0010126 | 3300046663 | Bacteria | 6593 |
| 703 | Ga0495635_0021148 | 3300046663 | Bacteria | 4534 |
| 704 | Ga0495635_0251842 | 3300046663 | Unclassified | 1190 |
| 705 | Ga0495635_0767855 | 3300046663 | Bacteria | 622 |
| 706 | Ga0495588_0101284 | 3300046674 | Unclassified | 1513 |
| 707 | Ga0495657_0000086 | 3300046675 | Bacteria | 81806 |
| 708 | Ga0495657_0004107 | 3300046675 | Bacteria | 11678 |
| 709 | Ga0495657_0163989 | 3300046675 | Bacteria | 1373 |
| 710 | Ga0495599_0000004 | 3300046678 | Bacteria | 316231 |
| 711 | Ga0495599_0026597 | 3300046678 | Unclassified | 3626 |
| 712 | Ga0495599_0068271 | 3300046678 | Bacteria | 2219 |
| 713 | Ga0495623_0000044 | 3300046679 | Bacteria | 77517 |
| 714 | Ga0495623_0001286 | 3300046679 | Bacteria | 17039 |
| 715 | Ga0495623_0146057 | 3300046679 | Bacteria | 1402 |
| 716 | Ga0495646_0000010 | 3300046680 | Bacteria | 195319 |
| 717 | Ga0495646_0002714 | 3300046680 | Bacteria | 10940 |
| 718 | Ga0495646_0023303 | 3300046680 | Bacteria | 3898 |
| 719 | Ga0495647_0543163 | 3300046681 | Bacteria | 543 |
| 720 | Ga0495658_0004603 | 3300046683 | Bacteria | 6790 |
| 721 | Ga0495669_0202376 | 3300046684 | Bacteria | 949 |
| 722 | Ga0495613_0006333 | 3300046689 | Bacteria | 8853 |
| 723 | Ga0495613_0029810 | 3300046689 | Bacteria | 4056 |
| 724 | Ga0495613_0057372 | 3300046689 | Unclassified | 2859 |
| 725 | Ga0495613_0442717 | 3300046689 | Bacteria | 881 |
| 726 | Ga0495624_0035675 | 3300046690 | Bacteria | 3210 |
| 727 | Ga0495624_0072494 | 3300046690 | Unclassified | 2142 |
| 728 | Ga0495624_0085440 | 3300046690 | Unclassified | 1949 |
| 729 | Ga0495624_0224708 | 3300046690 | Bacteria | 1138 |
| 730 | Ga0495600_0000026 | 3300046809 | Bacteria | 91792 |
| 731 | Ga0495600_0013079 | 3300046809 | Bacteria | 5207 |
| 732 | Ga0495600_0051085 | 3300046809 | Bacteria | 2698 |
| 733 | Ga0495581_0011911 | 3300047315 | Bacteria | 5032 |
| 734 | Ga0495581_0052904 | 3300047315 | Bacteria | 2345 |
| 735 | Ga0495581_0064733 | 3300047315 | Unclassified | 2112 |
| 736 | Ga0495604_0000010 | 3300047317 | Bacteria | 312236 |
| 737 | Ga0495604_0000186 | 3300047317 | Bacteria | 55450 |
| 738 | Ga0495604_0008654 | 3300047317 | Bacteria | 8044 |
| 739 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 740 | Ga0495674_0041939 | 3300047319 | Unclassified | 4084 |
| 741 | Ga0495674_0207135 | 3300047319 | Bacteria | 1625 |
| 742 | Ga0495674_0701794 | 3300047319 | Bacteria | 794 |
| 743 | Ga0495676_0062812 | 3300047321 | Bacteria | 2898 |
| 744 | Ga0495676_0117646 | 3300047321 | Bacteria | 1938 |
| 745 | Ga0495680_0000527 | 3300047322 | Bacteria | 43004 |
| 746 | Ga0495680_0010600 | 3300047322 | Bacteria | 8219 |
| 747 | Ga0495680_0034946 | 3300047322 | Bacteria | 4053 |
| 748 | Ga0495680_0050611 | 3300047322 | Bacteria | 3247 |
| 749 | Ga0495675_0000009 | 3300047444 | Bacteria | 154214 |
| 750 | Ga0495675_0005457 | 3300047444 | Bacteria | 7755 |
| 751 | Ga0495675_0014129 | 3300047444 | Bacteria | 5047 |
| 752 | Ga0495684_0000005 | 3300047471 | Bacteria | 291932 |
| 753 | Ga0495684_0002670 | 3300047471 | Bacteria | 14133 |
| 754 | Ga0495684_0014505 | 3300047471 | Bacteria | 6064 |
| 755 | Ga0495684_0060437 | 3300047471 | Unclassified | 2885 |
| 756 | Ga0495684_0192799 | 3300047471 | Bacteria | 1506 |
| 757 | Ga0495593_0002803 | 3300047673 | Bacteria | 10498 |
| 758 | Ga0495593_0008599 | 3300047673 | Bacteria | 5936 |
| 759 | Ga0495593_0023096 | 3300047673 | Unclassified | 3460 |
| 760 | Ga0495593_0024339 | 3300047673 | Bacteria | 3357 |
| 761 | Ga0495602_0000002 | 3300048088 | Bacteria | 422216 |
| 762 | Ga0495602_0004101 | 3300048088 | Bacteria | 15167 |
| 763 | Ga0495614_0111023 | 3300048089 | Unclassified | 1204 |
| 764 | Ga0496100_0000200 | 3300048903 | Bacteria | 32909 |
| 765 | Ga0496100_0114661 | 3300048903 | Bacteria | 1877 |
| 766 | Ga0496100_0179265 | 3300048903 | Unclassified | 1531 |
| 767 | Ga0496101_0000339 | 3300048904 | Bacteria | 31619 |
| 768 | Ga0496101_0003678 | 3300048904 | Bacteria | 9571 |
| 769 | Ga0496102_0000729 | 3300048905 | Bacteria | 32340 |
| 770 | Ga0496102_0461011 | 3300048905 | Bacteria | 1192 |
| 771 | Ga0496102_1759116 | 3300048905 | Unclassified | 537 |
| 772 | Ga0496102_1763337 | 3300048905 | Bacteria | 536 |
| 773 | Ga0496103_0001639 | 3300048906 | Bacteria | 14682 |
| 774 | Ga0496103_0131869 | 3300048906 | Bacteria | 1596 |
| 775 | Ga0496103_0144988 | 3300048906 | Bacteria | 1519 |
| 776 | Ga0496104_0025091 | 3300048907 | Bacteria | 5493 |
| 777 | Ga0496104_0051617 | 3300048907 | Bacteria | 3882 |
| 778 | Ga0496104_0058138 | 3300048907 | Bacteria | 3660 |
| 779 | Ga0496104_0132483 | 3300048907 | Unclassified | 2394 |
| 780 | Ga0496104_1270707 | 3300048907 | Bacteria | 639 |
| 781 | Ga0496105_0006563 | 3300048908 | Bacteria | 8951 |
| 782 | Ga0496105_0253056 | 3300048908 | Bacteria | 1426 |
| 783 | Ga0496105_0579927 | 3300048908 | Bacteria | 872 |
| 784 | Ga0496106_0000202 | 3300048909 | Bacteria | 41819 |
| 785 | Ga0496106_0042328 | 3300048909 | Bacteria | 3416 |
| 786 | Ga0496106_0173583 | 3300048909 | Bacteria | 1709 |
| 787 | Ga0496107_0000066 | 3300048910 | Bacteria | 52207 |
| 788 | Ga0496107_0074818 | 3300048910 | Bacteria | 2464 |
| 789 | Ga0496107_0238732 | 3300048910 | Unclassified | 1352 |
| 790 | Ga0496108_0009303 | 3300048911 | Bacteria | 7954 |
| 791 | Ga0496108_0266257 | 3300048911 | Bacteria | 1491 |
| 792 | Ga0496108_0354504 | 3300048911 | Bacteria | 1280 |
| 793 | Ga0496108_1124738 | 3300048911 | Unclassified | 666 |
| 794 | Ga0496109_0000595 | 3300048912 | Bacteria | 30262 |
| 795 | Ga0496109_0024011 | 3300048912 | Bacteria | 5416 |
| 796 | Ga0496109_0071247 | 3300048912 | Unclassified | 3190 |
| 797 | Ga0496109_0117181 | 3300048912 | Bacteria | 2479 |
| 798 | Ga0496109_0907720 | 3300048912 | Bacteria | 819 |
| 799 | Ga0496110_0026354 | 3300048913 | Bacteria | 4973 |
| 800 | Ga0496110_0187973 | 3300048913 | Bacteria | 1876 |
| 801 | Ga0496110_0375595 | 3300048913 | Bacteria | 1295 |
| 802 | Ga0496110_0694837 | 3300048913 | Unclassified | 918 |
| 803 | Ga0496110_0998800 | 3300048913 | Unclassified | 744 |
| 804 | Ga0496110_1439933 | 3300048913 | Bacteria | 598 |
| 805 | Ga0496111_0111294 | 3300048914 | Bacteria | 2017 |
| 806 | Ga0496111_0122303 | 3300048914 | Bacteria | 1922 |
| 807 | Ga0496111_0795084 | 3300048914 | Unclassified | 685 |
| 808 | Ga0496112_0068357 | 3300048915 | Bacteria | 3508 |
| 809 | Ga0496112_0191248 | 3300048915 | Bacteria | 2009 |
| 810 | Ga0496112_0216209 | 3300048915 | Bacteria | 1873 |
| 811 | Ga0496112_0345944 | 3300048915 | Bacteria | 1430 |
| 812 | Ga0496112_0584216 | 3300048915 | Bacteria | 1049 |
| 813 | Ga0496112_1756306 | 3300048915 | Bacteria | 532 |
| 814 | Ga0496113_0017489 | 3300048916 | Bacteria | 4977 |
| 815 | Ga0496113_0110704 | 3300048916 | Bacteria | 2137 |
| 816 | Ga0496113_1555826 | 3300048916 | Bacteria | 509 |
| 817 | Ga0496114_0003763 | 3300048917 | Bacteria | 11696 |
| 818 | Ga0496114_0032917 | 3300048917 | Unclassified | 4269 |
| 819 | Ga0496114_1201037 | 3300048917 | Unclassified | 644 |
| 820 | Ga0496115_0001197 | 3300048918 | Bacteria | 18589 |
| 821 | Ga0496115_0286616 | 3300048918 | Bacteria | 1351 |
| 822 | Ga0496115_0986787 | 3300048918 | Unclassified | 644 |
| 823 | Ga0496115_1030232 | 3300048918 | Unclassified | 627 |
| 824 | Ga0496125_0408489 | 3300048928 | Unclassified | 791 |
| 825 | Ga0501031_0032901 | 3300049568 | Bacteria | 3381 |
| 826 | Ga0501031_0215411 | 3300049568 | Bacteria | 1251 |
| 827 | Ga0501032_0137729 | 3300049569 | Bacteria | 1608 |
| 828 | Ga0501033_0102149 | 3300049570 | Bacteria | 2091 |
| 829 | Ga0501033_1195642 | 3300049570 | Unclassified | 503 |
| 830 | Ga0501034_0016864 | 3300049571 | Bacteria | 7489 |
| 831 | Ga0501034_0019226 | 3300049571 | Bacteria | 6992 |
| 832 | Ga0501034_0024657 | 3300049571 | Bacteria | 6116 |
| 833 | Ga0501034_0069106 | 3300049571 | Bacteria | 3543 |
| 834 | Ga0501034_0147992 | 3300049571 | Bacteria | 2325 |
| 835 | Ga0501034_0243673 | 3300049571 | Bacteria | 1743 |
| 836 | Ga0501034_0451423 | 3300049571 | Bacteria | 1203 |
| 837 | Ga0501036_0000499 | 3300049572 | Bacteria | 28121 |
| 838 | Ga0501036_0034109 | 3300049572 | Bacteria | 4304 |
| 839 | Ga0501036_0117585 | 3300049572 | Bacteria | 2245 |
| 840 | Ga0501036_0263546 | 3300049572 | Bacteria | 1443 |
| 841 | Ga0501036_0432898 | 3300049572 | Bacteria | 1096 |
| 842 | Ga0501037_0001469 | 3300049573 | Bacteria | 17284 |
| 843 | Ga0501037_0027818 | 3300049573 | Bacteria | 4179 |
| 844 | Ga0501037_0296534 | 3300049573 | Bacteria | 1123 |
| 845 | Ga0501037_0337440 | 3300049573 | Bacteria | 1041 |
| 846 | Ga0501038_0007219 | 3300049574 | Bacteria | 10263 |
| 847 | Ga0501038_0031983 | 3300049574 | Bacteria | 4646 |
| 848 | Ga0501038_0120091 | 3300049574 | Bacteria | 2169 |
| 849 | Ga0501038_0127445 | 3300049574 | Bacteria | 2093 |
| 850 | Ga0501039_0044518 | 3300049575 | Bacteria | 3428 |
| 851 | Ga0501039_0103095 | 3300049575 | Bacteria | 2227 |
| 852 | Ga0501041_0018919 | 3300049577 | Bacteria | 4104 |
| 853 | Ga0501042_0041599 | 3300049578 | Bacteria | 3269 |
| 854 | Ga0501042_0340503 | 3300049578 | Bacteria | 1084 |
| 855 | Ga0501043_0013728 | 3300049579 | Bacteria | 6337 |
| 856 | Ga0501043_0034880 | 3300049579 | Bacteria | 3957 |
| 857 | Ga0501043_0071826 | 3300049579 | Bacteria | 2718 |
| 858 | Ga0501043_0338896 | 3300049579 | Bacteria | 1144 |
| 859 | Ga0501046_0162824 | 3300049580 | Bacteria | 1677 |
| 860 | Ga0501046_0386763 | 3300049580 | Bacteria | 1012 |
| 861 | Ga0501047_0004876 | 3300049581 | Bacteria | 12602 |
| 862 | Ga0501047_0037297 | 3300049581 | Bacteria | 4700 |
| 863 | Ga0501047_0148389 | 3300049581 | Bacteria | 2221 |
| 864 | Ga0501047_0855428 | 3300049581 | Bacteria | 723 |
| 865 | Ga0501047_1279639 | 3300049581 | Bacteria | 547 |
| 866 | Ga0501048_0000256 | 3300049582 | Bacteria | 35566 |
| 867 | Ga0501048_0275027 | 3300049582 | Bacteria | 1197 |
| 868 | Ga0501048_0435954 | 3300049582 | Bacteria | 938 |
| 869 | Ga0501048_0547103 | 3300049582 | Bacteria | 830 |
| 870 | Ga0501048_0773617 | 3300049582 | Bacteria | 690 |
| 871 | Ga0501067_0040264 | 3300049583 | Bacteria | 2596 |
| 872 | Ga0501068_0028486 | 3300049584 | Bacteria | 3303 |
| 873 | Ga0501068_0071123 | 3300049584 | Bacteria | 2123 |
| 874 | Ga0501069_0023506 | 3300049585 | Bacteria | 3361 |
| 875 | Ga0501069_0049875 | 3300049585 | Bacteria | 2327 |
| 876 | Ga0501070_0047545 | 3300049586 | Bacteria | 3565 |
| 877 | Ga0501070_0155338 | 3300049586 | Bacteria | 1886 |
| 878 | Ga0501070_0246398 | 3300049586 | Bacteria | 1462 |
| 879 | Ga0501070_0384653 | 3300049586 | Bacteria | 1136 |
| 880 | Ga0501070_0951723 | 3300049586 | Bacteria | 668 |
| 881 | Ga0501071_0011129 | 3300049587 | Bacteria | 6049 |
| 882 | Ga0501072_0080556 | 3300049588 | Bacteria | 2580 |
| 883 | Ga0501072_0676984 | 3300049588 | Bacteria | 811 |
| 884 | Ga0501072_1522850 | 3300049588 | Unclassified | 516 |
| 885 | Ga0501073_0006598 | 3300049589 | Bacteria | 8638 |
| 886 | Ga0501073_0029982 | 3300049589 | Bacteria | 3885 |
| 887 | Ga0501073_0038097 | 3300049589 | Bacteria | 3412 |
| 888 | Ga0501073_0358835 | 3300049589 | Bacteria | 1006 |
| 889 | Ga0501074_0015504 | 3300049590 | Bacteria | 5539 |
| 890 | Ga0501074_0022972 | 3300049590 | Bacteria | 4536 |
| 891 | Ga0501074_0024428 | 3300049590 | Bacteria | 4393 |
| 892 | Ga0501074_0580375 | 3300049590 | Bacteria | 793 |
| 893 | Ga0501074_0860202 | 3300049590 | Bacteria | 638 |
| 894 | Ga0501075_0009305 | 3300049591 | Bacteria | 6875 |
| 895 | Ga0501075_0168883 | 3300049591 | Bacteria | 1669 |
| 896 | Ga0501076_0041602 | 3300049592 | Bacteria | 3616 |
| 897 | Ga0501076_0381809 | 3300049592 | Bacteria | 1158 |
| 898 | Ga0501077_0009748 | 3300049593 | Bacteria | 5973 |
| 899 | Ga0501077_0416095 | 3300049593 | Bacteria | 860 |
| 900 | Ga0501079_0003629 | 3300049741 | Bacteria | 11361 |
| 901 | Ga0501079_0014491 | 3300049741 | Bacteria | 6011 |
| 902 | Ga0501079_0030013 | 3300049741 | Bacteria | 4177 |
| 903 | Ga0501079_0077391 | 3300049741 | Bacteria | 2573 |
| 904 | Ga0501079_0640827 | 3300049741 | Bacteria | 837 |
| 905 | Ga0501079_0663886 | 3300049741 | Bacteria | 821 |
| 906 | Ga0501079_1579006 | 3300049741 | Bacteria | 516 |
| 907 | Ga0501080_0004650 | 3300049742 | Bacteria | 12241 |
| 908 | Ga0501080_0025085 | 3300049742 | Bacteria | 5532 |
| 909 | Ga0501080_0103140 | 3300049742 | Bacteria | 2645 |
| 910 | Ga0501080_0405265 | 3300049742 | Bacteria | 1226 |
| 911 | Ga0501080_0882705 | 3300049742 | Bacteria | 780 |
| 912 | Ga0501081_0001079 | 3300049743 | Bacteria | 16435 |
| 913 | Ga0501081_0102415 | 3300049743 | Bacteria | 2025 |
| 914 | Ga0501081_1307438 | 3300049743 | Bacteria | 550 |
| 915 | Ga0501083_0034764 | 3300049744 | Bacteria | 3445 |
| 916 | Ga0501083_0096860 | 3300049744 | Bacteria | 1947 |
| 917 | Ga0501083_0116451 | 3300049744 | Bacteria | 1754 |
| 918 | Ga0501083_0168299 | 3300049744 | Bacteria | 1433 |
| 919 | Ga0501083_0890762 | 3300049744 | Unclassified | 579 |
| 920 | Ga0501035_0023528 | 3300049822 | Bacteria | 5652 |
| 921 | Ga0501035_0041186 | 3300049822 | Bacteria | 4171 |
| 922 | Ga0501035_0063169 | 3300049822 | Bacteria | 3294 |
| 923 | Ga0501035_0521965 | 3300049822 | Bacteria | 976 |
| 924 | Ga0501035_0661745 | 3300049822 | Bacteria | 846 |
| 925 | Ga0501044_0002125 | 3300049823 | Bacteria | 22744 |
| 926 | Ga0501044_0008679 | 3300049823 | Bacteria | 11123 |
| 927 | Ga0501044_0031400 | 3300049823 | Bacteria | 5591 |
| 928 | Ga0501044_0123677 | 3300049823 | Bacteria | 2585 |
| 929 | Ga0501044_0369256 | 3300049823 | Bacteria | 1351 |
| 930 | Ga0501044_0707733 | 3300049823 | Bacteria | 892 |
| 931 | Ga0501045_0127625 | 3300049824 | Bacteria | 1890 |
| 932 | nmdc:mga03n38_115640_c1 | 3300050490 | Bacteria | 1312 |
| 933 | nmdc:mga03n38_27245_c1 | 3300050490 | Bacteria | 2369 |
| 934 | nmdc:mga03n38_399682_c1 | 3300050490 | Bacteria | 756 |
| 935 | nmdc:mga03n38_412477_c1 | 3300050490 | Bacteria | 745 |
| 936 | nmdc:mga00v17_155294_c1 | 3300050491 | Bacteria | 1471 |
| 937 | nmdc:mga00v17_3029_c1 | 3300050491 | Bacteria | 8638 |
| 938 | nmdc:mga0yw44_296849_c1 | 3300050492 | Bacteria | 1082 |
| 939 | nmdc:mga0yw44_833269_c1 | 3300050492 | Bacteria | 626 |
| 940 | nmdc:mga0k408_239891_c1 | 3300050493 | Bacteria | 627 |
| 941 | nmdc:mga0k408_276835_c1 | 3300050493 | Bacteria | 1002 |
| 942 | nmdc:mga0k408_48174_c1 | 3300050493 | Bacteria | 2465 |
| 943 | nmdc:mga0k408_633758_c1 | 3300050493 | Bacteria | 629 |
| 944 | nmdc:mga06z11_316723_c1 | 3300050494 | Bacteria | 930 |
| 945 | nmdc:mga06z11_37907_c1 | 3300050494 | Bacteria | 2390 |
| 946 | nmdc:mga06z11_94660_c1 | 3300050494 | Bacteria | 1628 |
| 947 | nmdc:mga04h51_271192_c1 | 3300050495 | Bacteria | 685 |
| 948 | nmdc:mga04h51_470880_c1 | 3300050495 | Bacteria | 534 |
| 949 | nmdc:mga07m45_151233_c1 | 3300050496 | Bacteria | 789 |
| 950 | nmdc:mga07m45_172351_c1 | 3300050496 | Bacteria | 1258 |
| 951 | nmdc:mga07m45_198932_c1 | 3300050496 | Bacteria | 1165 |
| 952 | nmdc:mga07m45_57179_c1 | 3300050496 | Bacteria | 2205 |
| 953 | nmdc:mga05p37_1740_c1 | 3300050507 | Bacteria | 25419 |
| 954 | nmdc:mga05p37_586_c1 | 3300050507 | Bacteria | 40050 |
| 955 | nmdc:mga05p37_6524_c1 | 3300050507 | Bacteria | 13764 |
| 956 | nmdc:mga09592_1232001_c1 | 3300050508 | Bacteria | 617 |
| 957 | nmdc:mga09592_1499_c1 | 3300050508 | Bacteria | 18808 |
| 958 | nmdc:mga09592_1648_c2 | 3300050508 | Bacteria | 13068 |
| 959 | nmdc:mga09592_28653_c1 | 3300050508 | Bacteria | 4628 |
| 960 | nmdc:mga0qj67_1143631_c1 | 3300050509 | Unclassified | 607 |
| 961 | nmdc:mga0qj67_22813_c1 | 3300050509 | Bacteria | 4808 |
| 962 | nmdc:mga0qj67_243692_c1 | 3300050509 | Unclassified | 1458 |
| 963 | nmdc:mga0qj67_2505_c1 | 3300050509 | Bacteria | 13107 |
| 964 | nmdc:mga0qj67_27401_c1 | 3300050509 | Bacteria | 4417 |
| 965 | nmdc:mga06r32_125606_c1 | 3300050510 | Bacteria | 2534 |
| 966 | nmdc:mga06r32_1344_c1 | 3300050510 | Bacteria | 22203 |
| 967 | nmdc:mga06r32_474653_c1 | 3300050510 | Bacteria | 1229 |
| 968 | nmdc:mga06r32_546_c1 | 3300050510 | Bacteria | 32690 |
| 969 | nmdc:mga08y16_1229_c1 | 3300050511 | Bacteria | 25351 |
| 970 | nmdc:mga08y16_1436_c1 | 3300050511 | Bacteria | 23871 |
| 971 | nmdc:mga08y16_184393_c1 | 3300050511 | Bacteria | 2166 |
| 972 | nmdc:mga08y16_301796_c1 | 3300050511 | Bacteria | 1650 |
| 973 | nmdc:mga08y16_3164_c1 | 3300050511 | Bacteria | 17060 |
| 974 | nmdc:mga0n895_140547_c1 | 3300050512 | Unclassified | 2443 |
| 975 | nmdc:mga0n895_1689686_c1 | 3300050512 | Bacteria | 596 |
| 976 | nmdc:mga0n895_216044_c1 | 3300050512 | Bacteria | 1947 |
| 977 | nmdc:mga0n895_266_c1 | 3300050512 | Bacteria | 34104 |
| 978 | nmdc:mga0n895_381_c1 | 3300050512 | Bacteria | 30014 |
| 979 | nmdc:mga0n895_425224_c1 | 3300050512 | Bacteria | 1342 |
| 980 | nmdc:mga0n895_61717_c1 | 3300050512 | Bacteria | 3702 |
| 981 | nmdc:mga0rr50_1036263_c1 | 3300050513 | Unclassified | 699 |
| 982 | nmdc:mga0rr50_113055_c1 | 3300050513 | Unclassified | 2151 |
| 983 | nmdc:mga0rr50_160465_c1 | 3300050513 | Bacteria | 1824 |
| 984 | nmdc:mga0rr50_309080_c1 | 3300050513 | Bacteria | 1324 |
| 985 | nmdc:mga08x19_154970_c1 | 3300050514 | Unclassified | 1553 |
| 986 | nmdc:mga08x19_24_c1 | 3300050514 | Bacteria | 245940 |
| 987 | nmdc:mga08x19_64234_c1 | 3300050514 | Bacteria | 2383 |
| 988 | nmdc:mga08x19_92073_c1 | 3300050514 | Bacteria | 2002 |
| 989 | nmdc:mga0a205_1323_c1 | 3300050515 | Bacteria | 20896 |
| 990 | nmdc:mga0a205_160962_c2 | 3300050515 | Bacteria | 1762 |
| 991 | nmdc:mga0a205_35007_c1 | 3300050515 | Bacteria | 4822 |
| 992 | nmdc:mga0a205_391341_c1 | 3300050515 | Bacteria | 1254 |
| 993 | Ga0495601_0000003 | 3300053077 | Bacteria | 493642 |
| 994 | Ga0495601_0038047 | 3300053077 | Bacteria | 3007 |
| 995 | Ga0495601_0177997 | 3300053077 | Bacteria | 1390 |
| 996 | Ga0495612_0000009 | 3300053078 | Bacteria | 229858 |
| 997 | Ga0495612_0011957 | 3300053078 | Bacteria | 3498 |
| 998 | Ga0495595_0000011 | 3300053084 | Bacteria | 174945 |
| 999 | Ga0495595_0001186 | 3300053084 | Bacteria | 10128 |
| 1000 | Ga0495595_0003151 | 3300053084 | Bacteria | 6539 |
| 1001 | Ga0495619_0000009 | 3300053085 | Bacteria | 305595 |
| 1002 | Ga0495619_0000266 | 3300053085 | Bacteria | 38066 |
| 1003 | Ga0495619_0000480 | 3300053085 | Bacteria | 26747 |
| 1004 | Ga0495619_0008444 | 3300053085 | Bacteria | 6511 |
| 1005 | Ga0495619_0065459 | 3300053085 | Unclassified | 2425 |
| 1006 | Ga0495619_0114837 | 3300053085 | Unclassified | 1842 |
| 1007 | Ga0500562_006913 | 3300053108 | Bacteria | 2864 |
| 1008 | Ga0500595_010769 | 3300053119 | Bacteria | 3615 |
| 1009 | Ga0500616_0051286 | 3300053153 | Bacteria | 2175 |
| 1010 | Ga0500616_0223204 | 3300053153 | Bacteria | 820 |
| 1011 | Ga0500616_0229078 | 3300053153 | Bacteria | 805 |
| 1012 | Ga0500616_0241942 | 3300053153 | Bacteria | 775 |
| 1013 | Ga0501084_0021229 | 3300054114 | Bacteria | 5414 |
| 1014 | Ga0501084_0045457 | 3300054114 | Bacteria | 3676 |
| 1015 | Ga0501082_0009328 | 3300060353 | Bacteria | 8459 |
| 1016 | Ga0501082_0010492 | 3300060353 | Bacteria | 7971 |
| 1017 | Ga0501082_0176881 | 3300060353 | Bacteria | 1856 |
| 1018 | Ga0501082_0434740 | 3300060353 | Bacteria | 1146 |
| 1019 | Ga0501082_1162454 | 3300060353 | Bacteria | 674 |
| 1020 | Ga0530510_0425742 | 3300061734 | Bacteria | 1002 |
| 1021 | Ga0496100_0354327 | |||
| 1022 | 2214856897 | |||
| 1023 | JGI24032J14994_100332 | |||
| 1024 | JGI24736J21556_1004771 | |||
| 1025 | JGI24741J21665_1010530 | |||
| 1026 | JGI24752J21851_1002786 | |||
| 1027 | JGI24746J21847_1000770 | |||
| 1028 | JGI24747J21853_1001243 | |||
| 1029 | JGI24739J22299_10001705 | |||
| 1030 | JGI24737J22298_10000400 | |||
| 1031 | JGI24743J22301_10003202 | |||
| 1032 | JGI24750J21931_1000217 | |||
| 1033 | JGI24745J21846_1000133 | |||
| 1034 | JGI24748J21848_1007832 | |||
| 1035 | JGI24738J21930_10000277 | |||
| 1036 | JGI24749J21850_1000938 | |||
| 1037 | JGI24744J21845_10000893 | |||
| 1038 | JGI24035J26624_1001143 | |||
| 1039 | JGI24033J26618_1000485 | |||
| 1040 | JGI24034J26672_10008370 | |||
| 1041 | JGI24742J22300_10002757 | |||
| 1042 | JGI24751J29686_10009751 | |||
| 1043 | JGI26129J50193_1007000 | |||
| 1044 | JGI25405J52794_10036913 | |||
| 1045 | Ga0065716_1020057 | |||
| 1046 | Ga0065704_10433854 | |||
| 1047 | Ga0065712_10016781 | |||
| 1048 | Ga0065712_10071749 | |||
| 1049 | Ga0065715_10001161 | |||
| 1050 | Ga0065715_10057426 | |||
| 1051 | Ga0065707_10097506 | |||
| 1052 | Ga0070676_10000813 | |||
| 1053 | Ga0070683_100000240 | |||
| 1054 | Ga0070683_100176267 | |||
| 1055 | Ga0070683_100330451 | |||
| 1056 | Ga0070690_100000428 | |||
| 1057 | Ga0070690_100296652 | |||
| 1058 | Ga0070690_100387098 | |||
| 1059 | Ga0070670_100005838 | |||
| 1060 | Ga0070670_100390145 | |||
| 1061 | Ga0070670_101156375 | |||
| 1062 | Ga0070677_10000294 | |||
| 1063 | Ga0068869_100000595 | |||
| 1064 | Ga0068869_100371927 | |||
| 1065 | Ga0070666_10017675 | |||
| 1066 | Ga0070666_10104535 | |||
| 1067 | Ga0070666_10205982 | |||
| 1068 | Ga0070680_100568210 | |||
| 1069 | Ga0070682_100000202 | |||
| 1070 | Ga0070682_100026737 | |||
| 1071 | Ga0070682_100546597 | |||
| 1072 | Ga0068868_100000614 | |||
| 1073 | Ga0068868_100820452 | |||
| 1074 | Ga0070660_100000223 | |||
| 1075 | Ga0070689_100000187 | |||
| 1076 | Ga0070689_100450987 | |||
| 1077 | Ga0070689_100484086 | |||
| 1078 | Ga0070691_10277813 | |||
| 1079 | Ga0070687_100000200 | |||
| 1080 | Ga0070687_100214590 | |||
| 1081 | Ga0070687_100912825 | |||
| 1082 | Ga0070687_101168946 | |||
| 1083 | Ga0070661_100000298 | |||
| 1084 | Ga0070661_100493290 | |||
| 1085 | Ga0070692_10000016 | |||
| 1086 | Ga0070668_100428935 | |||
| 1087 | Ga0070668_101600118 | |||
| 1088 | Ga0070669_100001525 | |||
| 1089 | Ga0070669_100111462 | |||
| 1090 | Ga0070669_100125374 | |||
| 1091 | Ga0070675_100000215 | |||
| 1092 | Ga0070675_101108160 | |||
| 1093 | Ga0070671_100000402 | |||
| 1094 | Ga0070671_100060569 | |||
| 1095 | Ga0070671_101750206 | |||
| 1096 | Ga0070674_100000511 | |||
| 1097 | Ga0070674_100006921 | |||
| 1098 | Ga0070674_101510526 | |||
| 1099 | Ga0070673_100000035 | |||
| 1100 | Ga0070673_100172304 | |||
| 1101 | Ga0070673_100431005 | |||
| 1102 | Ga0070673_100587785 | |||
| 1103 | Ga0070673_101052244 | |||
| 1104 | Ga0070673_101179599 | |||
| 1105 | Ga0070688_100000130 | |||
| 1106 | Ga0070688_100182500 | |||
| 1107 | Ga0070688_100516944 | |||
| 1108 | Ga0070688_101457330 | |||
| 1109 | Ga0070659_100003979 | |||
| 1110 | Ga0070659_100627990 | |||
| 1111 | Ga0070667_100000712 | |||
| 1112 | Ga0070667_100117062 | |||
| 1113 | Ga0070703_10008655 | |||
| 1114 | Ga0070709_10186165 | |||
| 1115 | Ga0070709_11101585 | |||
| 1116 | Ga0070714_100040701 | |||
| 1117 | Ga0070714_100156481 | |||
| 1118 | Ga0070713_100081434 | |||
| 1119 | Ga0070713_100342558 | |||
| 1120 | Ga0070713_100614198 | |||
| 1121 | Ga0070713_100970873 | |||
| 1122 | Ga0070713_100978422 | |||
| 1123 | Ga0070713_101040923 | |||
| 1124 | Ga0070710_10020265 | |||
| 1125 | Ga0070710_10544320 | |||
| 1126 | Ga0070701_10000081 | |||
| 1127 | Ga0070701_10187120 | |||
| 1128 | Ga0070711_100061646 | |||
| 1129 | Ga0070711_100076743 | |||
| 1130 | Ga0070711_100477342 | |||
| 1131 | Ga0070711_100684904 | |||
| 1132 | Ga0070705_100002491 | |||
| 1133 | Ga0070700_100001353 | |||
| 1134 | Ga0070700_100719446 | |||
| 1135 | Ga0070694_100000129 | |||
| 1136 | Ga0070708_100007439 | |||
| 1137 | Ga0070663_100001786 | |||
| 1138 | Ga0070663_101361711 | |||
| 1139 | Ga0070678_100010388 | |||
| 1140 | Ga0070678_100012816 | |||
| 1141 | Ga0070678_100023973 | |||
| 1142 | Ga0070678_100029790 | |||
| 1143 | Ga0070662_100000933 | |||
| 1144 | Ga0070662_100164222 | |||
| 1145 | Ga0070662_100656567 | |||
| 1146 | Ga0070662_101648905 | |||
| 1147 | Ga0070681_10001286 | |||
| 1148 | Ga0070681_12049975 | |||
| 1149 | Ga0068867_100000369 | |||
| 1150 | Ga0070685_10001791 | |||
| 1151 | Ga0070685_10049852 | |||
| 1152 | Ga0070685_10182056 | |||
| 1153 | Ga0070685_11131363 | |||
| 1154 | Ga0070679_100000553 | |||
| 1155 | Ga0070679_100039247 | |||
| 1156 | Ga0070684_100000246 | |||
| 1157 | Ga0070684_100038423 | |||
| 1158 | Ga0070697_100343559 | |||
| 1159 | Ga0070697_100811724 | |||
| 1160 | Ga0068853_100002121 | |||
| 1161 | Ga0068853_100545567 | |||
| 1162 | Ga0068853_101032569 | |||
| 1163 | Ga0070672_100000157 | |||
| 1164 | Ga0070672_100290140 | |||
| 1165 | Ga0070686_100000260 | |||
| 1166 | Ga0070695_100009157 | |||
| 1167 | Ga0070696_100006359 | |||
| 1168 | Ga0070696_100267392 | |||
| 1169 | Ga0070693_100009423 | |||
| 1170 | Ga0070693_100642150 | |||
| 1171 | Ga0070665_100014837 | |||
| 1172 | Ga0070665_101146719 | |||
| 1173 | Ga0070704_100000171 | |||
| 1174 | Ga0070704_101425650 | |||
| 1175 | Ga0068855_100005012 | |||
| 1176 | Ga0070664_100000269 | |||
| 1177 | Ga0070664_100293293 | |||
| 1178 | Ga0070664_100738133 | |||
| 1179 | Ga0068857_100000174 | |||
| 1180 | Ga0068857_100282150 | |||
| 1181 | Ga0068857_101054664 | |||
| 1182 | Ga0068854_100000211 | |||
| 1183 | Ga0068856_100000600 | |||
| 1184 | Ga0068856_100598569 | |||
| 1185 | Ga0068856_101863969 | |||
| 1186 | Ga0070702_100000312 | |||
| 1187 | Ga0070702_100072607 | |||
| 1188 | Ga0070702_101450997 | |||
| 1189 | Ga0068852_100003615 | |||
| 1190 | Ga0068859_100000894 | |||
| 1191 | Ga0068859_100404264 | |||
| 1192 | Ga0068859_100487381 | |||
| 1193 | Ga0068859_100553731 | |||
| 1194 | Ga0068859_100563362 | |||
| 1195 | Ga0068864_100000329 | |||
| 1196 | Ga0068864_100227774 | |||
| 1197 | Ga0068866_10341182 | |||
| 1198 | Ga0068870_10000056 | |||
| 1199 | Ga0068870_10243906 | |||
| 1200 | Ga0068863_100000278 | |||
| 1201 | Ga0068863_100198453 | |||
| 1202 | Ga0068863_100590603 | |||
| 1203 | Ga0068858_100001048 | |||
| 1204 | Ga0068858_100182355 | |||
| 1205 | Ga0068858_100243060 | |||
| 1206 | Ga0068858_100817437 | |||
| 1207 | Ga0068858_101282022 | |||
| 1208 | Ga0068860_100000985 | |||
| 1209 | Ga0068860_100223025 | |||
| 1210 | Ga0068862_100000593 | |||
| 1211 | Ga0068862_100477351 | |||
| 1212 | Ga0081455_10114341 | |||
| 1213 | Ga0081540_1000008 | |||
| 1214 | Ga0070717_10289983 | |||
| 1215 | Ga0070717_10331433 | |||
| 1216 | Ga0070717_10610210 | |||
| 1217 | Ga0075365_10979706 | |||
| 1218 | Ga0075363_100634200 | |||
| 1219 | Ga0075363_100655442 | |||
| 1220 | Ga0075364_10035141 | |||
| 1221 | Ga0075364_10071044 | |||
| 1222 | Ga0075432_10000435 | |||
| 1223 | Ga0070715_10007119 | |||
| 1224 | Ga0070712_100459829 | |||
| 1225 | Ga0075362_10005903 | |||
| 1226 | Ga0075367_10047325 | |||
| 1227 | Ga0075367_10150782 | |||
| 1228 | Ga0075367_10256697 | |||
| 1229 | Ga0075367_10788310 | |||
| 1230 | Ga0075427_10000061 | |||
| 1231 | Ga0075366_10016041 | |||
| 1232 | Ga0075366_10073912 | |||
| 1233 | Ga0075366_10554471 | |||
| 1234 | Ga0075366_10713402 | |||
| 1235 | Ga0075366_10882959 | |||
| 1236 | Ga0097621_100000504 | |||
| 1237 | Ga0097621_100779752 | |||
| 1238 | Ga0097621_101025508 | |||
| 1239 | Ga0075370_10091733 | |||
| 1240 | Ga0075370_10478118 | |||
| 1241 | Ga0068871_100000815 | |||
| 1242 | Ga0068871_100070338 | |||
| 1243 | Ga0068871_100076484 | |||
| 1244 | Ga0075428_100001096 | |||
| 1245 | Ga0075428_100001439 | |||
| 1246 | Ga0075430_100001275 | |||
| 1247 | Ga0075430_100061302 | |||
| 1248 | Ga0075430_100640127 | |||
| 1249 | Ga0075431_100006467 | |||
| 1250 | Ga0075431_100011265 | |||
| 1251 | Ga0075431_100467799 | |||
| 1252 | Ga0075431_101225776 | |||
| 1253 | Ga0075433_10011448 | |||
| 1254 | Ga0075433_10062959 | |||
| 1255 | Ga0075433_10328397 | |||
| 1256 | Ga0075433_11444506 | |||
| 1257 | Ga0075434_100000244 | |||
| 1258 | Ga0075434_100007451 | |||
| 1259 | Ga0075434_100262160 | |||
| 1260 | Ga0075429_100000388 | |||
| 1261 | Ga0075429_100004065 | |||
| 1262 | Ga0075429_101006317 | |||
| 1263 | Ga0075429_101405896 | |||
| 1264 | Ga0075436_100105119 | |||
| 1265 | Ga0075436_100166843 | |||
| 1266 | Ga0075436_100259095 | |||
| 1267 | Ga0075436_100457545 | |||
| 1268 | Ga0075436_100688626 | |||
| 1269 | Ga0097620_100000894 | |||
| 1270 | Ga0097620_100404243 | |||
| 1271 | Ga0097620_100487484 | |||
| 1272 | Ga0097620_100553730 | |||
| 1273 | Ga0097620_100563363 | |||
| 1274 | Ga0075435_100223748 | |||
| 1275 | Ga0075435_100296359 | |||
| 1276 | Ga0075435_100488950 | |||
| 1277 | Ga0075435_100497848 | |||
| 1278 | Ga0075435_101353843 | |||
| 1279 | Ga0099795_10009067 | |||
| 1280 | Ga0105251_10060586 | |||
| 1281 | Ga0105251_10143611 | |||
| 1282 | Ga0105250_10444335 | |||
| 1283 | Ga0105240_10016606 | |||
| 1284 | Ga0105240_10170530 | |||
| 1285 | Ga0105240_11697185 | |||
| 1286 | Ga0111539_10000835 | |||
| 1287 | Ga0111539_10001076 | |||
| 1288 | Ga0111539_10002315 | |||
| 1289 | Ga0111539_10105140 | |||
| 1290 | Ga0111539_10172234 | |||
| 1291 | Ga0105245_10000451 | |||
| 1292 | Ga0105245_10039669 | |||
| 1293 | Ga0105245_10580552 | |||
| 1294 | Ga0105247_10001016 | |||
| 1295 | Ga0105247_10015781 | |||
| 1296 | Ga0105247_10236818 | |||
| 1297 | Ga0114129_10003642 | |||
| 1298 | Ga0114129_10005725 | |||
| 1299 | Ga0114129_10006438 | |||
| 1300 | Ga0114129_10690800 | |||
| 1301 | Ga0114129_11055913 | |||
| 1302 | Ga0114129_11188478 | |||
| 1303 | Ga0105243_10002173 | |||
| 1304 | Ga0105243_10105337 | |||
| 1305 | Ga0105243_10157922 | |||
| 1306 | Ga0105241_10001549 | |||
| 1307 | Ga0105241_10242485 | |||
| 1308 | Ga0105242_10000947 | |||
| 1309 | Ga0105242_10058894 | |||
| 1310 | Ga0105242_10229439 | |||
| 1311 | Ga0105248_10000837 | |||
| 1312 | Ga0105237_10022344 | |||
| 1313 | Ga0105237_10416353 | |||
| 1314 | Ga0105238_10102115 | |||
| 1315 | Ga0105238_10255872 | |||
| 1316 | Ga0105238_10933194 | |||
| 1317 | Ga0105249_10000976 | |||
| 1318 | Ga0105249_10298822 | |||
| 1319 | Ga0105249_10387154 | |||
| 1320 | Ga0099796_10017285 | |||
| 1321 | Ga0105239_10040227 | |||
| 1322 | Ga0105239_10348910 | |||
| 1323 | Ga0105239_10895094 | |||
| 1324 | Ga0105239_11955925 | |||
| 1325 | Ga0105246_10000100 | |||
| 1326 | Ga0105246_10262932 | |||
| 1327 | Ga0157325_1022502 | |||
| 1328 | Ga0157315_1003623 | |||
| 1329 | Ga0157316_1007613 | |||
| 1330 | Ga0157326_1025419 | |||
| 1331 | Ga0157373_10125461 | |||
| 1332 | Ga0157371_10001676 | |||
| 1333 | Ga0157371_11018007 | |||
| 1334 | Ga0157370_10264187 | |||
| 1335 | Ga0157374_10000956 | |||
| 1336 | Ga0157374_10231659 | |||
| 1337 | Ga0157374_10491830 | |||
| 1338 | Ga0157374_10526487 | |||
| 1339 | Ga0157378_10001544 | |||
| 1340 | Ga0157378_10126320 | |||
| 1341 | Ga0157378_10729447 | |||
| 1342 | Ga0163162_12556632 | |||
| 1343 | Ga0157372_10026270 | |||
| 1344 | Ga0157375_10000464 | |||
| 1345 | Ga0157375_10232409 | |||
| 1346 | Ga0157375_10364612 | |||
| 1347 | Ga0163163_10003318 | |||
| 1348 | Ga0157380_10000145 | |||
| 1349 | Ga0157380_11689294 | |||
| 1350 | Ga0157377_10000179 | |||
| 1351 | Ga0157379_10000067 | |||
| 1352 | Ga0157379_10164378 | |||
| 1353 | Ga0157379_11518984 | |||
| 1354 | Ga0157376_10023037 | |||
| 1355 | Ga0157376_10244829 | |||
| 1356 | Ga0157376_11715251 | |||
| 1357 | Ga0163161_10001462 | |||
| 1358 | Ga0163161_10050492 | |||
| 1359 | Ga0163161_10407560 | |||
| 1360 | Ga0213876_10176105 | |||
| 1361 | Ga0209233_1004623 | |||
| 1362 | Ga0207666_1000002 | |||
| 1363 | Ga0207673_1000015 | |||
| 1364 | Ga0207697_10000113 | |||
| 1365 | Ga0207697_10085892 | |||
| 1366 | Ga0207713_1102851 | |||
| 1367 | Ga0207653_10001270 | |||
| 1368 | Ga0207682_10000094 | |||
| 1369 | Ga0207682_10001641 | |||
| 1370 | Ga0207642_10000337 | |||
| 1371 | Ga0207710_10000795 | |||
| 1372 | Ga0207710_10004197 | |||
| 1373 | Ga0207710_10022043 | |||
| 1374 | Ga0207688_10000074 | |||
| 1375 | Ga0207688_10057634 | |||
| 1376 | Ga0207688_10200449 | |||
| 1377 | Ga0207680_10010896 | |||
| 1378 | Ga0207680_10363425 | |||
| 1379 | Ga0207680_11187744 | |||
| 1380 | Ga0207647_10000218 | |||
| 1381 | Ga0207685_10004360 | |||
| 1382 | Ga0207685_10036665 | |||
| 1383 | Ga0207699_10206091 | |||
| 1384 | Ga0207699_10655603 | |||
| 1385 | Ga0207645_10000247 | |||
| 1386 | Ga0207645_10042103 | |||
| 1387 | Ga0207643_10000004 | |||
| 1388 | Ga0207643_10299968 | |||
| 1389 | Ga0207654_10000627 | |||
| 1390 | Ga0207654_10117741 | |||
| 1391 | Ga0207707_10000618 | |||
| 1392 | Ga0207695_10030828 | |||
| 1393 | Ga0207671_10011571 | |||
| 1394 | Ga0207671_10432590 | |||
| 1395 | Ga0207693_10011262 | |||
| 1396 | Ga0207693_10344841 | |||
| 1397 | Ga0207663_10119004 | |||
| 1398 | Ga0207663_10605393 | |||
| 1399 | Ga0207663_11061123 | |||
| 1400 | Ga0207663_11320139 | |||
| 1401 | Ga0207660_10000741 | |||
| 1402 | Ga0207660_10232039 | |||
| 1403 | Ga0207660_10569458 | |||
| 1404 | Ga0207662_10000119 | |||
| 1405 | Ga0207662_10090731 | |||
| 1406 | Ga0207662_10349438 | |||
| 1407 | Ga0207662_10454914 | |||
| 1408 | Ga0207657_10000316 | |||
| 1409 | Ga0207649_10000090 | |||
| 1410 | Ga0207652_10000847 | |||
| 1411 | Ga0207652_10049716 | |||
| 1412 | Ga0207681_10000370 | |||
| 1413 | Ga0207681_10080489 | |||
| 1414 | Ga0207681_10170983 | |||
| 1415 | Ga0207694_10100847 | |||
| 1416 | Ga0207694_10129130 | |||
| 1417 | Ga0207694_10193007 | |||
| 1418 | Ga0207650_10008243 | |||
| 1419 | Ga0207650_10521824 | |||
| 1420 | Ga0207659_10000038 | |||
| 1421 | Ga0207659_10880873 | |||
| 1422 | Ga0207687_10000784 | |||
| 1423 | Ga0207687_10265708 | |||
| 1424 | Ga0207687_10308593 | |||
| 1425 | Ga0207700_10187315 | |||
| 1426 | Ga0207700_10256142 | |||
| 1427 | Ga0207700_10312074 | |||
| 1428 | Ga0207700_10934574 | |||
| 1429 | Ga0207664_10134950 | |||
| 1430 | Ga0207664_10631794 | |||
| 1431 | Ga0207644_10001053 | |||
| 1432 | Ga0207644_10182832 | |||
| 1433 | Ga0207644_10514755 | |||
| 1434 | Ga0207690_10000239 | |||
| 1435 | Ga0207690_10183222 | |||
| 1436 | Ga0207690_10566048 | |||
| 1437 | Ga0207706_10000424 | |||
| 1438 | Ga0207706_10050735 | |||
| 1439 | Ga0207706_10193010 | |||
| 1440 | Ga0207706_10468322 | |||
| 1441 | Ga0207706_10875861 | |||
| 1442 | Ga0207686_10001203 | |||
| 1443 | Ga0207686_10170038 | |||
| 1444 | Ga0207709_10000379 | |||
| 1445 | Ga0207709_10071000 | |||
| 1446 | Ga0207709_10383642 | |||
| 1447 | Ga0207670_10000176 | |||
| 1448 | Ga0207669_10000165 | |||
| 1449 | Ga0207669_10057031 | |||
| 1450 | Ga0207669_10194341 | |||
| 1451 | Ga0207669_11419668 | |||
| 1452 | Ga0207704_10001709 | |||
| 1453 | Ga0207704_10037612 | |||
| 1454 | Ga0207704_10750806 | |||
| 1455 | Ga0207665_10114251 | |||
| 1456 | Ga0207665_10364748 | |||
| 1457 | Ga0207665_10829070 | |||
| 1458 | Ga0207691_10000358 | |||
| 1459 | Ga0207691_10030388 | |||
| 1460 | Ga0207711_10000780 | |||
| 1461 | Ga0207711_10123112 | |||
| 1462 | Ga0207689_10000479 | |||
| 1463 | Ga0207689_10013531 | |||
| 1464 | Ga0207661_10000604 | |||
| 1465 | Ga0207661_10146928 | |||
| 1466 | Ga0207661_11645855 | |||
| 1467 | Ga0207679_10000139 | |||
| 1468 | Ga0207679_10846709 | |||
| 1469 | Ga0207667_10003492 | |||
| 1470 | Ga0207667_11046741 | |||
| 1471 | Ga0207651_10000072 | |||
| 1472 | Ga0207651_10073755 | |||
| 1473 | Ga0207651_10293347 | |||
| 1474 | Ga0207651_10573620 | |||
| 1475 | Ga0207712_10000588 | |||
| 1476 | Ga0207712_10735930 | |||
| 1477 | Ga0207712_10951283 | |||
| 1478 | Ga0207668_10000168 | |||
| 1479 | Ga0207668_10070576 | |||
| 1480 | Ga0207668_10583842 | |||
| 1481 | Ga0207668_11014867 | |||
| 1482 | Ga0207640_10000242 | |||
| 1483 | Ga0207640_12096931 | |||
| 1484 | Ga0207658_10000667 | |||
| 1485 | Ga0207677_10004440 | |||
| 1486 | Ga0207703_10000463 | |||
| 1487 | Ga0207703_10147628 | |||
| 1488 | Ga0207703_10965194 | |||
| 1489 | Ga0207703_12043524 | |||
| 1490 | Ga0207639_10002404 | |||
| 1491 | Ga0207678_10000447 | |||
| 1492 | Ga0207678_10025607 | |||
| 1493 | Ga0207708_10000293 | |||
| 1494 | Ga0207708_10167148 | |||
| 1495 | Ga0207708_10977867 | |||
| 1496 | Ga0207702_10007213 | |||
| 1497 | Ga0207702_10501576 | |||
| 1498 | Ga0207641_10000724 | |||
| 1499 | Ga0207641_10876642 | |||
| 1500 | Ga0207641_11028329 | |||
| 1501 | Ga0207648_10000223 | |||
| 1502 | Ga0207648_10404594 | |||
| 1503 | Ga0207648_10418586 | |||
| 1504 | Ga0207676_10000392 | |||
| 1505 | Ga0207674_10000955 | |||
| 1506 | Ga0207674_10203822 | |||
| 1507 | Ga0207674_10945629 | |||
| 1508 | Ga0207675_100000364 | |||
| 1509 | Ga0207675_100537267 | |||
| 1510 | Ga0207675_101020457 | |||
| 1511 | Ga0207683_10000397 | |||
| 1512 | Ga0207683_10015258 | |||
| 1513 | Ga0207683_10033226 | |||
| 1514 | Ga0207698_10003705 | |||
| 1515 | Ga0209973_1016160 | |||
| 1516 | Ga0209996_1018694 | |||
| 1517 | Ga0209984_1012090 | |||
| 1518 | Ga0210002_1001181 | |||
| 1519 | Ga0209971_1037562 | |||
| 1520 | Ga0209998_10000535 | |||
| 1521 | Ga0209813_10239612 | |||
| 1522 | Ga0209813_10435923 | |||
| 1523 | Ga0209974_10001185 | |||
| 1524 | Ga0207428_10000272 | |||
| 1525 | Ga0207428_10000439 | |||
| 1526 | Ga0207428_10016728 | |||
| 1527 | Ga0207428_10620227 | |||
| 1528 | Ga0268266_10008599 | |||
| 1529 | Ga0268265_10002666 | |||
| 1530 | Ga0268265_10068403 | |||
| 1531 | Ga0268265_10681146 | |||
| 1532 | Ga0268264_10000890 | |||
| 1533 | Ga0265760_10135921 | |||
| 1534 | Ga0265325_10000019 | |||
| 1535 | Ga0265325_10045188 | |||
| 1536 | Ga0265325_10275903 | |||
| 1537 | Ga0265340_10023297 | |||
| 1538 | Ga0307408_101817597 | |||
| 1539 | Ga0265313_10004790 | |||
| 1540 | Ga0265314_10000577 | |||
| 1541 | Ga0316576_10255584 | |||
| 1542 | Ga0307405_10644535 | |||
| 1543 | Ga0307409_100305577 | |||
| 1544 | Ga0307416_102768684 | |||
| 1545 | Ga0307415_100540982 | |||
| 1546 | Ga0373930_0008163 | |||
| 1547 | Ga0373930_0040686 | |||
| 1548 | Ga0373948_0023739 | |||
| 1549 | Ga0373950_0005260 | |||
| 1550 | Ga0373950_0020954 | |||
| 1551 | Ga0373958_0008288 | |||
| 1552 | Ga0373959_0009193 | |||
| 1553 | Ga0373959_0040869 | |||
| 1554 | Ga0373938_0000801 | |||
| 1555 | Ga0373938_0004620 | |||
| 1556 | Ga0373926_0030151 | |||
| 1557 | Ga0373928_0008041 | |||
| 1558 | Ga0373928_0106569 | |||
| 1559 | Ga0373929_0026251 | |||
| 1560 | Ga0373934_0029917 | |||
| 1561 | Ga0373934_0131661 | |||
| 1562 | Ga0373940_0024844 | |||
| 1563 | Ga0373944_0005312 | |||
| 1564 | Ga0373944_0254141 | |||
| 1565 | Ga0373949_0005655 | |||
| 1566 | Ga0373949_0015968 | |||
| 1567 | Ga0373951_0004903 | |||
| 1568 | Ga0373951_0005568 | |||
| 1569 | Ga0373952_0000491 | |||
| 1570 | Ga0373952_0069200 | |||
| 1571 | Ga0373923_0001791 | |||
| 1572 | Ga0373923_0135138 | |||
| 1573 | Ga0373923_0252043 | |||
| 1574 | Ga0373923_0454255 | |||
| 1575 | Ga0373932_0010270 | |||
| 1576 | Ga0373936_0059436 | |||
| 1577 | Ga0373939_0000671 | |||
| 1578 | Ga0373939_0158875 | |||
| 1579 | Ga0373941_0002421 | |||
| 1580 | Ga0373941_0002853 | |||
| 1581 | Ga0373945_0047206 | |||
| 1582 | Ga0373945_0058782 | |||
| 1583 | Ga0373945_0176927 | |||
| 1584 | Ga0373953_0003123 | |||
| 1585 | Ga0373953_0203063 | |||
| 1586 | Ga0373954_0010232 | |||
| 1587 | Ga0373954_0027582 | |||
| 1588 | Ga0373954_0037490 | |||
| 1589 | Ga0373957_0005354 | |||
| 1590 | Ga0373957_0005745 | |||
| 1591 | Ga0373960_0001077 | |||
| 1592 | Ga0373960_0023438 | |||
| 1593 | Ga0373960_0323101 | |||
| 1594 | Ga0373943_0000417 | |||
| 1595 | Ga0373943_0013438 | |||
| 1596 | Ga0373946_0001306 | |||
| 1597 | Ga0373946_0005513 | |||
| 1598 | Ga0373946_0019410 | |||
| 1599 | Ga0373946_0061121 | |||
| 1600 | Ga0373955_0002670 | |||
| 1601 | Ga0373955_0007047 | |||
| 1602 | Ga0373955_0012099 | |||
| 1603 | Ga0373942_0011858 | |||
| 1604 | Ga0373942_0017682 | |||
| 1605 | Ga0373961_0005861 | |||
| 1606 | Ga0373962_0001390 | |||
| 1607 | Ga0373962_0020639 | |||
| 1608 | Ga0316574_0033601 | |||
| 1609 | Ga0373924_0002381 | |||
| 1610 | Ga0373924_0017622 | |||
| 1611 | Ga0373931_0000089 | |||
| 1612 | Ga0373931_0022029 | |||
| 1613 | Ga0373935_0000037 | |||
| 1614 | Ga0373935_0015408 | |||
| 1615 | Ga0373935_0026462 | |||
| 1616 | Ga0373935_0175304 | |||
| 1617 | Ga0373927_0000700 | |||
| 1618 | Ga0373927_0044985 | |||
| 1619 | Ga0373927_0241634 | |||
| 1620 | Ga0373933_0001535 | |||
| 1621 | Ga0373933_0013152 | |||
| 1622 | Ga0373933_0013294 | |||
| 1623 | Ga0373933_0951591 | |||
| 1624 | Ga0373947_0000333 | |||
| 1625 | Ga0373947_0007823 | |||
| 1626 | Ga0373947_0122291 | |||
| 1627 | Ga0373947_0652924 | |||
| 1628 | Ga0373937_0000018 | |||
| 1629 | Ga0373937_0001938 | |||
| 1630 | Ga0373937_0007486 | |||
| 1631 | Ga0373937_0158069 | |||
| 1632 | Ga0373937_1589427 | |||
| 1633 | Ga0316584_0037455 | |||
| 1634 | Ga0373925_0003079 | |||
| 1635 | Ga0373925_0004485 | |||
| 1636 | Ga0373925_0020402 | |||
| 1637 | Ga0436364_0246124 | |||
| 1638 | Ga0436364_0741110 | |||
| 1639 | Ga0436365_1346123 | |||
| 1640 | Ga0436365_1822239 | |||
| 1641 | Ga0436360_0159932 | |||
| 1642 | Ga0436361_0031041 | |||
| 1643 | Ga0451800_0770855 | |||
| 1644 | Ga0451804_0516851 | |||
| 1645 | Ga0451577_1680239 | |||
| 1646 | Ga0466967_0928838 | |||
| 1647 | Ga0495592_0000055 | |||
| 1648 | Ga0495592_0056360 | |||
| 1649 | Ga0495603_0051326 | |||
| 1650 | Ga0495603_0726683 | |||
| 1651 | Ga0495629_0000715 | |||
| 1652 | Ga0495629_0004595 | |||
| 1653 | Ga0495629_0018872 | |||
| 1654 | Ga0495629_0024418 | |||
| 1655 | Ga0495629_0091826 | |||
| 1656 | Ga0495629_0200721 | |||
| 1657 | Ga0495641_0247329 | |||
| 1658 | Ga0495651_0000210 | |||
| 1659 | Ga0495651_0000469 | |||
| 1660 | Ga0495651_0004620 | |||
| 1661 | Ga0495653_0000003 | |||
| 1662 | Ga0495653_0000528 | |||
| 1663 | Ga0495653_0001294 | |||
| 1664 | Ga0495580_0220080 | |||
| 1665 | Ga0495580_0612863 | |||
| 1666 | Ga0495582_0004541 | |||
| 1667 | Ga0495582_0019173 | |||
| 1668 | Ga0495605_0085040 | |||
| 1669 | Ga0495639_0044935 | |||
| 1670 | Ga0495639_0087214 | |||
| 1671 | Ga0495662_0002357 | |||
| 1672 | Ga0495662_0175453 | |||
| 1673 | Ga0495662_0215187 | |||
| 1674 | Ga0495664_0000001 | |||
| 1675 | Ga0495664_0002815 | |||
| 1676 | Ga0495664_0020851 | |||
| 1677 | Ga0495584_0211306 | |||
| 1678 | Ga0495594_0218359 | |||
| 1679 | Ga0495608_0000012 | |||
| 1680 | Ga0495608_0052498 | |||
| 1681 | Ga0495608_0410299 | |||
| 1682 | Ga0495618_0000012 | |||
| 1683 | Ga0495618_0004183 | |||
| 1684 | Ga0495618_0025548 | |||
| 1685 | Ga0495618_0077712 | |||
| 1686 | Ga0495628_0000003 | |||
| 1687 | Ga0495628_0059123 | |||
| 1688 | Ga0495630_0000188 | |||
| 1689 | Ga0495630_0009769 | |||
| 1690 | Ga0495630_0106021 | |||
| 1691 | Ga0495666_0042911 | |||
| 1692 | Ga0495652_0000001 | |||
| 1693 | Ga0495652_0007567 | |||
| 1694 | Ga0495665_0085041 | |||
| 1695 | Ga0495665_0313586 | |||
| 1696 | Ga0495640_0000022 | |||
| 1697 | Ga0495640_0004486 | |||
| 1698 | Ga0495640_0017063 | |||
| 1699 | Ga0495640_0024843 | |||
| 1700 | Ga0495640_0457418 | |||
| 1701 | Ga0495586_0064814 | |||
| 1702 | Ga0495586_0279639 | |||
| 1703 | Ga0495586_0296414 | |||
| 1704 | Ga0495587_0000003 | |||
| 1705 | Ga0495587_0006458 | |||
| 1706 | Ga0495587_0007819 | |||
| 1707 | Ga0495598_0171847 | |||
| 1708 | Ga0495609_0085018 | |||
| 1709 | Ga0495621_0046407 | |||
| 1710 | Ga0495645_0000004 | |||
| 1711 | Ga0495645_0045284 | |||
| 1712 | Ga0495645_0137530 | |||
| 1713 | Ga0495667_0000001 | |||
| 1714 | Ga0495667_0002575 | |||
| 1715 | Ga0495667_0008025 | |||
| 1716 | Ga0495634_0000012 | |||
| 1717 | Ga0495634_0005822 | |||
| 1718 | Ga0495634_0023237 | |||
| 1719 | Ga0495634_0043987 | |||
| 1720 | Ga0495625_0341665 | |||
| 1721 | Ga0495635_0000011 | |||
| 1722 | Ga0495635_0010126 | |||
| 1723 | Ga0495635_0021148 | |||
| 1724 | Ga0495635_0251842 | |||
| 1725 | Ga0495635_0767855 | |||
| 1726 | Ga0495588_0101284 | |||
| 1727 | Ga0495657_0000086 | |||
| 1728 | Ga0495657_0004107 | |||
| 1729 | Ga0495657_0163989 | |||
| 1730 | Ga0495599_0000004 | |||
| 1731 | Ga0495599_0026597 | |||
| 1732 | Ga0495599_0068271 | |||
| 1733 | Ga0495623_0000044 | |||
| 1734 | Ga0495623_0001286 | |||
| 1735 | Ga0495623_0146057 | |||
| 1736 | Ga0495646_0000010 | |||
| 1737 | Ga0495646_0002714 | |||
| 1738 | Ga0495646_0023303 | |||
| 1739 | Ga0495647_0543163 | |||
| 1740 | Ga0495658_0004603 | |||
| 1741 | Ga0495669_0202376 | |||
| 1742 | Ga0495613_0006333 | |||
| 1743 | Ga0495613_0029810 | |||
| 1744 | Ga0495613_0057372 | |||
| 1745 | Ga0495613_0442717 | |||
| 1746 | Ga0495624_0035675 | |||
| 1747 | Ga0495624_0072494 | |||
| 1748 | Ga0495624_0085440 | |||
| 1749 | Ga0495624_0224708 | |||
| 1750 | Ga0495600_0000026 | |||
| 1751 | Ga0495600_0013079 | |||
| 1752 | Ga0495600_0051085 | |||
| 1753 | Ga0495581_0011911 | |||
| 1754 | Ga0495581_0052904 | |||
| 1755 | Ga0495581_0064733 | |||
| 1756 | Ga0495604_0000010 | |||
| 1757 | Ga0495604_0000186 | |||
| 1758 | Ga0495604_0008654 | |||
| 1759 | Ga0495674_0000001 | |||
| 1760 | Ga0495674_0041939 | |||
| 1761 | Ga0495674_0207135 | |||
| 1762 | Ga0495674_0701794 | |||
| 1763 | Ga0495676_0062812 | |||
| 1764 | Ga0495676_0117646 | |||
| 1765 | Ga0495680_0000527 | |||
| 1766 | Ga0495680_0010600 | |||
| 1767 | Ga0495680_0034946 | |||
| 1768 | Ga0495680_0050611 | |||
| 1769 | Ga0495675_0000009 | |||
| 1770 | Ga0495675_0005457 | |||
| 1771 | Ga0495675_0014129 | |||
| 1772 | Ga0495684_0000005 | |||
| 1773 | Ga0495684_0002670 | |||
| 1774 | Ga0495684_0014505 | |||
| 1775 | Ga0495684_0060437 | |||
| 1776 | Ga0495684_0192799 | |||
| 1777 | Ga0495593_0002803 | |||
| 1778 | Ga0495593_0008599 | |||
| 1779 | Ga0495593_0023096 | |||
| 1780 | Ga0495593_0024339 | |||
| 1781 | Ga0495602_0000002 | |||
| 1782 | Ga0495602_0004101 | |||
| 1783 | Ga0495614_0111023 | |||
| 1784 | Ga0496100_0000200 | |||
| 1785 | Ga0496100_0114661 | |||
| 1786 | Ga0496100_0179265 | |||
| 1787 | Ga0496101_0000339 | |||
| 1788 | Ga0496101_0003678 | |||
| 1789 | Ga0496102_0000729 | |||
| 1790 | Ga0496102_0461011 | |||
| 1791 | Ga0496102_1759116 | |||
| 1792 | Ga0496102_1763337 | |||
| 1793 | Ga0496103_0001639 | |||
| 1794 | Ga0496103_0131869 | |||
| 1795 | Ga0496103_0144988 | |||
| 1796 | Ga0496104_0025091 | |||
| 1797 | Ga0496104_0051617 | |||
| 1798 | Ga0496104_0058138 | |||
| 1799 | Ga0496104_0132483 | |||
| 1800 | Ga0496104_1270707 | |||
| 1801 | Ga0496105_0006563 | |||
| 1802 | Ga0496105_0253056 | |||
| 1803 | Ga0496105_0579927 | |||
| 1804 | Ga0496106_0000202 | |||
| 1805 | Ga0496106_0042328 | |||
| 1806 | Ga0496106_0173583 | |||
| 1807 | Ga0496107_0000066 | |||
| 1808 | Ga0496107_0074818 | |||
| 1809 | Ga0496107_0238732 | |||
| 1810 | Ga0496108_0009303 | |||
| 1811 | Ga0496108_0266257 | |||
| 1812 | Ga0496108_0354504 | |||
| 1813 | Ga0496108_1124738 | |||
| 1814 | Ga0496109_0000595 | |||
| 1815 | Ga0496109_0024011 | |||
| 1816 | Ga0496109_0071247 | |||
| 1817 | Ga0496109_0117181 | |||
| 1818 | Ga0496109_0907720 | |||
| 1819 | Ga0496110_0026354 | |||
| 1820 | Ga0496110_0187973 | |||
| 1821 | Ga0496110_0375595 | |||
| 1822 | Ga0496110_0694837 | |||
| 1823 | Ga0496110_0998800 | |||
| 1824 | Ga0496110_1439933 | |||
| 1825 | Ga0496111_0111294 | |||
| 1826 | Ga0496111_0122303 | |||
| 1827 | Ga0496111_0795084 | |||
| 1828 | Ga0496112_0068357 | |||
| 1829 | Ga0496112_0191248 | |||
| 1830 | Ga0496112_0216209 | |||
| 1831 | Ga0496112_0345944 | |||
| 1832 | Ga0496112_0584216 | |||
| 1833 | Ga0496112_1756306 | |||
| 1834 | Ga0496113_0017489 | |||
| 1835 | Ga0496113_0110704 | |||
| 1836 | Ga0496113_1555826 | |||
| 1837 | Ga0496114_0003763 | |||
| 1838 | Ga0496114_0032917 | |||
| 1839 | Ga0496114_1201037 | |||
| 1840 | Ga0496115_0001197 | |||
| 1841 | Ga0496115_0286616 | |||
| 1842 | Ga0496115_0986787 | |||
| 1843 | Ga0496115_1030232 | |||
| 1844 | Ga0496125_0408489 | |||
| 1845 | Ga0501031_0032901 | |||
| 1846 | Ga0501031_0215411 | |||
| 1847 | Ga0501032_0137729 | |||
| 1848 | Ga0501033_0102149 | |||
| 1849 | Ga0501033_1195642 | |||
| 1850 | Ga0501034_0016864 | |||
| 1851 | Ga0501034_0019226 | |||
| 1852 | Ga0501034_0024657 | |||
| 1853 | Ga0501034_0069106 | |||
| 1854 | Ga0501034_0147992 | |||
| 1855 | Ga0501034_0243673 | |||
| 1856 | Ga0501034_0451423 | |||
| 1857 | Ga0501036_0000499 | |||
| 1858 | Ga0501036_0034109 | |||
| 1859 | Ga0501036_0117585 | |||
| 1860 | Ga0501036_0263546 | |||
| 1861 | Ga0501036_0432898 | |||
| 1862 | Ga0501037_0001469 | |||
| 1863 | Ga0501037_0027818 | |||
| 1864 | Ga0501037_0296534 | |||
| 1865 | Ga0501037_0337440 | |||
| 1866 | Ga0501038_0007219 | |||
| 1867 | Ga0501038_0031983 | |||
| 1868 | Ga0501038_0120091 | |||
| 1869 | Ga0501038_0127445 | |||
| 1870 | Ga0501039_0044518 | |||
| 1871 | Ga0501039_0103095 | |||
| 1872 | Ga0501041_0018919 | |||
| 1873 | Ga0501042_0041599 | |||
| 1874 | Ga0501042_0340503 | |||
| 1875 | Ga0501043_0013728 | |||
| 1876 | Ga0501043_0034880 | |||
| 1877 | Ga0501043_0071826 | |||
| 1878 | Ga0501043_0338896 | |||
| 1879 | Ga0501046_0162824 | |||
| 1880 | Ga0501046_0386763 | |||
| 1881 | Ga0501047_0004876 | |||
| 1882 | Ga0501047_0037297 | |||
| 1883 | Ga0501047_0148389 | |||
| 1884 | Ga0501047_0855428 | |||
| 1885 | Ga0501047_1279639 | |||
| 1886 | Ga0501048_0000256 | |||
| 1887 | Ga0501048_0275027 | |||
| 1888 | Ga0501048_0435954 | |||
| 1889 | Ga0501048_0547103 | |||
| 1890 | Ga0501048_0773617 | |||
| 1891 | Ga0501067_0040264 | |||
| 1892 | Ga0501068_0028486 | |||
| 1893 | Ga0501068_0071123 | |||
| 1894 | Ga0501069_0023506 | |||
| 1895 | Ga0501069_0049875 | |||
| 1896 | Ga0501070_0047545 | |||
| 1897 | Ga0501070_0155338 | |||
| 1898 | Ga0501070_0246398 | |||
| 1899 | Ga0501070_0384653 | |||
| 1900 | Ga0501070_0951723 | |||
| 1901 | Ga0501071_0011129 | |||
| 1902 | Ga0501072_0080556 | |||
| 1903 | Ga0501072_0676984 | |||
| 1904 | Ga0501072_1522850 | |||
| 1905 | Ga0501073_0006598 | |||
| 1906 | Ga0501073_0029982 | |||
| 1907 | Ga0501073_0038097 | |||
| 1908 | Ga0501073_0358835 | |||
| 1909 | Ga0501074_0015504 | |||
| 1910 | Ga0501074_0022972 | |||
| 1911 | Ga0501074_0024428 | |||
| 1912 | Ga0501074_0580375 | |||
| 1913 | Ga0501074_0860202 | |||
| 1914 | Ga0501075_0009305 | |||
| 1915 | Ga0501075_0168883 | |||
| 1916 | Ga0501076_0041602 | |||
| 1917 | Ga0501076_0381809 | |||
| 1918 | Ga0501077_0009748 | |||
| 1919 | Ga0501077_0416095 | |||
| 1920 | Ga0501079_0003629 | |||
| 1921 | Ga0501079_0014491 | |||
| 1922 | Ga0501079_0030013 | |||
| 1923 | Ga0501079_0077391 | |||
| 1924 | Ga0501079_0640827 | |||
| 1925 | Ga0501079_0663886 | |||
| 1926 | Ga0501079_1579006 | |||
| 1927 | Ga0501080_0004650 | |||
| 1928 | Ga0501080_0025085 | |||
| 1929 | Ga0501080_0103140 | |||
| 1930 | Ga0501080_0405265 | |||
| 1931 | Ga0501080_0882705 | |||
| 1932 | Ga0501081_0001079 | |||
| 1933 | Ga0501081_0102415 | |||
| 1934 | Ga0501081_1307438 | |||
| 1935 | Ga0501083_0034764 | |||
| 1936 | Ga0501083_0096860 | |||
| 1937 | Ga0501083_0116451 | |||
| 1938 | Ga0501083_0168299 | |||
| 1939 | Ga0501083_0890762 | |||
| 1940 | Ga0501035_0023528 | |||
| 1941 | Ga0501035_0041186 | |||
| 1942 | Ga0501035_0063169 | |||
| 1943 | Ga0501035_0521965 | |||
| 1944 | Ga0501035_0661745 | |||
| 1945 | Ga0501044_0002125 | |||
| 1946 | Ga0501044_0008679 | |||
| 1947 | Ga0501044_0031400 | |||
| 1948 | Ga0501044_0123677 | |||
| 1949 | Ga0501044_0369256 | |||
| 1950 | Ga0501044_0707733 | |||
| 1951 | Ga0501045_0127625 | |||
| 1952 | nmdc:mga03n38_115640_c1 | |||
| 1953 | nmdc:mga03n38_27245_c1 | |||
| 1954 | nmdc:mga03n38_399682_c1 | |||
| 1955 | nmdc:mga03n38_412477_c1 | |||
| 1956 | nmdc:mga00v17_155294_c1 | |||
| 1957 | nmdc:mga00v17_3029_c1 | |||
| 1958 | nmdc:mga0yw44_296849_c1 | |||
| 1959 | nmdc:mga0yw44_833269_c1 | |||
| 1960 | nmdc:mga0k408_239891_c1 | |||
| 1961 | nmdc:mga0k408_276835_c1 | |||
| 1962 | nmdc:mga0k408_48174_c1 | |||
| 1963 | nmdc:mga0k408_633758_c1 | |||
| 1964 | nmdc:mga06z11_316723_c1 | |||
| 1965 | nmdc:mga06z11_37907_c1 | |||
| 1966 | nmdc:mga06z11_94660_c1 | |||
| 1967 | nmdc:mga04h51_271192_c1 | |||
| 1968 | nmdc:mga04h51_470880_c1 | |||
| 1969 | nmdc:mga07m45_151233_c1 | |||
| 1970 | nmdc:mga07m45_172351_c1 | |||
| 1971 | nmdc:mga07m45_198932_c1 | |||
| 1972 | nmdc:mga07m45_57179_c1 | |||
| 1973 | nmdc:mga05p37_1740_c1 | |||
| 1974 | nmdc:mga05p37_586_c1 | |||
| 1975 | nmdc:mga05p37_6524_c1 | |||
| 1976 | nmdc:mga09592_1232001_c1 | |||
| 1977 | nmdc:mga09592_1499_c1 | |||
| 1978 | nmdc:mga09592_1648_c2 | |||
| 1979 | nmdc:mga09592_28653_c1 | |||
| 1980 | nmdc:mga0qj67_1143631_c1 | |||
| 1981 | nmdc:mga0qj67_22813_c1 | |||
| 1982 | nmdc:mga0qj67_243692_c1 | |||
| 1983 | nmdc:mga0qj67_2505_c1 | |||
| 1984 | nmdc:mga0qj67_27401_c1 | |||
| 1985 | nmdc:mga06r32_125606_c1 | |||
| 1986 | nmdc:mga06r32_1344_c1 | |||
| 1987 | nmdc:mga06r32_474653_c1 | |||
| 1988 | nmdc:mga06r32_546_c1 | |||
| 1989 | nmdc:mga08y16_1229_c1 | |||
| 1990 | nmdc:mga08y16_1436_c1 | |||
| 1991 | nmdc:mga08y16_184393_c1 | |||
| 1992 | nmdc:mga08y16_301796_c1 | |||
| 1993 | nmdc:mga08y16_3164_c1 | |||
| 1994 | nmdc:mga0n895_140547_c1 | |||
| 1995 | nmdc:mga0n895_1689686_c1 | |||
| 1996 | nmdc:mga0n895_216044_c1 | |||
| 1997 | nmdc:mga0n895_266_c1 | |||
| 1998 | nmdc:mga0n895_381_c1 | |||
| 1999 | nmdc:mga0n895_425224_c1 | |||
| 2000 | nmdc:mga0n895_61717_c1 | |||
| 2001 | nmdc:mga0rr50_1036263_c1 | |||
| 2002 | nmdc:mga0rr50_113055_c1 | |||
| 2003 | nmdc:mga0rr50_160465_c1 | |||
| 2004 | nmdc:mga0rr50_309080_c1 | |||
| 2005 | nmdc:mga08x19_154970_c1 | |||
| 2006 | nmdc:mga08x19_24_c1 | |||
| 2007 | nmdc:mga08x19_64234_c1 | |||
| 2008 | nmdc:mga08x19_92073_c1 | |||
| 2009 | nmdc:mga0a205_1323_c1 | |||
| 2010 | nmdc:mga0a205_160962_c2 | |||
| 2011 | nmdc:mga0a205_35007_c1 | |||
| 2012 | nmdc:mga0a205_391341_c1 | |||
| 2013 | Ga0495601_0000003 | |||
| 2014 | Ga0495601_0038047 | |||
| 2015 | Ga0495601_0177997 | |||
| 2016 | Ga0495612_0000009 | |||
| 2017 | Ga0495612_0011957 | |||
| 2018 | Ga0495595_0000011 | |||
| 2019 | Ga0495595_0001186 | |||
| 2020 | Ga0495595_0003151 | |||
| 2021 | Ga0495619_0000009 | |||
| 2022 | Ga0495619_0000266 | |||
| 2023 | Ga0495619_0000480 | |||
| 2024 | Ga0495619_0008444 | |||
| 2025 | Ga0495619_0065459 | |||
| 2026 | Ga0495619_0114837 | |||
| 2027 | Ga0500562_006913 | |||
| 2028 | Ga0500595_010769 | |||
| 2029 | Ga0500616_0051286 | |||
| 2030 | Ga0500616_0223204 | |||
| 2031 | Ga0500616_0229078 | |||
| 2032 | Ga0500616_0241942 | |||
| 2033 | Ga0501084_0021229 | |||
| 2034 | Ga0501084_0045457 | |||
| 2035 | Ga0501082_0009328 | |||
| 2036 | Ga0501082_0010492 | |||
| 2037 | Ga0501082_0176881 | |||
| 2038 | Ga0501082_0434740 | |||
| 2039 | Ga0501082_1162454 | |||
| 2040 | Ga0530510_0425742 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3luu-assembly1.cif.gz_A | crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution | 0.9241 | 8 | 98 |
| 2l6p-assembly1.cif.gz_A | nmr solution structure of the protein np_253742.1 | 0.8709 | 4 | 123 |
| 2l6n-assembly1.cif.gz_A | nmr solution structure of the protein yp_001092504.1 | 0.8667 | 1 | 121 |
| 5tul-assembly1.cif.gz_A | crystal structure of tetracycline destructase tet(55) | 0.8571 | 6 | 34 |
| 3luu-assembly1.cif.gz_A | crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution | 0.8354 | 8 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I040_171_337_2.110.10.10 | Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain | 0.949 | 8 | 33 | 2.110.10.10 |
| af_Q4DG53_507_629_2.40.128.630 | Mainly Beta;Beta Barrel;Lipocalin; | 0.9448 | 8 | 33 | 2.40.128.630 |
| af_Q9H1Z4_260_485_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.9312 | 8 | 33 | 2.130.10.10 |
| 3luuA00 | Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; | 0.9177 | 8 | 98 | 3.30.2020.30 |
| af_Q9P2S5_129_291_2.40.128.630 | Mainly Beta;Beta Barrel;Lipocalin; | 0.9149 | 8 | 33 | 2.40.128.630 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J7PTC3-F1-model_v4 | Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein | 0.9639 | 55 | 125 |
GO:0046872
|
| AF-A0A2E0VJM5-F1-model_v4 | 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 0.9565 | 7 | 122 |
GO:0016853
GO:0046872 |
| AF-A0A0H5BNS4-F1-model_v4 | Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein | 0.9541 | 1 | 125 |
GO:0046872
|
| AF-A0A840XW67-F1-model_v4 | DUF971 family protein | 0.9532 | 6 | 125 |
GO:0046872
|
| AF-A0A3B9TVQ7-F1-model_v4 | Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein | 0.9524 | 54 | 119 |
GO:0046872
|