F488378

General Info

Members Datasets Scaffolds Average Seq Length
1020 425 2040 127

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0354327|Ga0496100_0354327_611_1078
Length 155
Sequence MAAPPRLPSEHAGRLPSANRIWTAPMSSATTPPSKAPWPTELRLQKDRKTLVVSFEGGQSFELPAEYLRVRSPSAEVQGHSPAERRTVSGKRDVAILELHPVGNYAVRIVFDDLHSTGIFSWDYLFELGQNRERYWRDYLDELASKNLSRSPAAL

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
15 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
16 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
19 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
20 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
21 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
22 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
23 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
24 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
96 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
97 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
98 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
105 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
118 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
119 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
135 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
136 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
137 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
138 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
142 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
143 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
144 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
156 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
157 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
234 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
241 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
244 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
245 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
246 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
251 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
252 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
253 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
254 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
255 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
256 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
257 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
258 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
259 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
260 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
261 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
262 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
263 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
264 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
265 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
267 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
268 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
269 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
270 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
271 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
272 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
273 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
274 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
275 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
276 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
277 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
278 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
279 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
280 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
281 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
282 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
283 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
284 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
285 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
286 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
287 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
288 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
289 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
290 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
291 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
292 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
293 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
294 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
295 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
296 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
297 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
300 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
301 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
302 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
303 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
304 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
305 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
306 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
307 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
308 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
309 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
314 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
318 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
319 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
320 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
321 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
322 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
323 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
326 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
327 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
328 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
334 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
335 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
336 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
337 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
338 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
339 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
340 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
341 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
342 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
343 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
344 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
345 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
346 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
347 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
352 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
353 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
354 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
355 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
356 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
357 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
358 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
359 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
366 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
367 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
368 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
383 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
384 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
385 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
386 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
387 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
388 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
389 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
390 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
391 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
392 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
393 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
394 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
395 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
396 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
400 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
403 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
404 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
405 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
406 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
407 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
408 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
409 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
410 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
411 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
412 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
413 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
414 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
415 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
418 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
419 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
420 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
421 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
422 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
423 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
424 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
425 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.61
Nodule 0
Rhizoplane 6.18
Rhizosphere 88.63
Stem 0
Stem Tuber 0
Unclassified 12.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0354327 3300048903 Bacteria 1109
2 2214856897 2209111006 Bacteria 608
3 JGI24032J14994_100332 3300001430 Bacteria 2517
4 JGI24736J21556_1004771 3300001904 Bacteria 2304
5 JGI24741J21665_1010530 3300001915 Bacteria 1651
6 JGI24752J21851_1002786 3300001976 Bacteria 2323
7 JGI24746J21847_1000770 3300001977 Bacteria 4927
8 JGI24747J21853_1001243 3300001978 Bacteria 1873
9 JGI24739J22299_10001705 3300001989 Bacteria 8356
10 JGI24737J22298_10000400 3300001990 Bacteria 14807
11 JGI24743J22301_10003202 3300001991 Bacteria 2566
12 JGI24750J21931_1000217 3300002070 Bacteria 9762
13 JGI24745J21846_1000133 3300002073 Bacteria 5710
14 JGI24748J21848_1007832 3300002074 Bacteria 1254
15 JGI24738J21930_10000277 3300002075 Bacteria 14047
16 JGI24749J21850_1000938 3300002076 Bacteria 4150
17 JGI24744J21845_10000893 3300002077 Bacteria 5635
18 JGI24035J26624_1001143 3300002126 Bacteria 2514
19 JGI24033J26618_1000485 3300002155 Bacteria 3905
20 JGI24034J26672_10008370 3300002239 Bacteria 1511
21 JGI24742J22300_10002757 3300002244 Bacteria 2829
22 JGI24751J29686_10009751 3300002459 Bacteria 1978
23 JGI26129J50193_1007000 3300003349 Unclassified 813
24 JGI25405J52794_10036913 3300003911 Unclassified 1026
25 Ga0065716_1020057 3300005277 Bacteria 510
26 Ga0065704_10433854 3300005289 Bacteria 720
27 Ga0065712_10016781 3300005290 Bacteria 1486
28 Ga0065712_10071749 3300005290 Bacteria 5082
29 Ga0065715_10001161 3300005293 Bacteria 10533
30 Ga0065715_10057426 3300005293 Bacteria 947
31 Ga0065707_10097506 3300005295 Bacteria 3168
32 Ga0070676_10000813 3300005328 Bacteria 15426
33 Ga0070683_100000240 3300005329 Bacteria 37588
34 Ga0070683_100176267 3300005329 Bacteria 2029
35 Ga0070683_100330451 3300005329 Unclassified 1451
36 Ga0070690_100000428 3300005330 Bacteria 21329
37 Ga0070690_100296652 3300005330 Bacteria 1158
38 Ga0070690_100387098 3300005330 Bacteria 1024
39 Ga0070670_100005838 3300005331 Bacteria 10408
40 Ga0070670_100390145 3300005331 Bacteria 1228
41 Ga0070670_101156375 3300005331 Bacteria 706
42 Ga0070677_10000294 3300005333 Bacteria 17512
43 Ga0068869_100000595 3300005334 Bacteria 20312
44 Ga0068869_100371927 3300005334 Bacteria 1170
45 Ga0070666_10017675 3300005335 Bacteria 4575
46 Ga0070666_10104535 3300005335 Bacteria 1955
47 Ga0070666_10205982 3300005335 Bacteria 1384
48 Ga0070680_100568210 3300005336 Bacteria 972
49 Ga0070682_100000202 3300005337 Bacteria 44018
50 Ga0070682_100026737 3300005337 Bacteria 3456
51 Ga0070682_100546597 3300005337 Bacteria 906
52 Ga0068868_100000614 3300005338 Bacteria 23959
53 Ga0068868_100820452 3300005338 Unclassified 840
54 Ga0070660_100000223 3300005339 Bacteria 37464
55 Ga0070689_100000187 3300005340 Bacteria 37473
56 Ga0070689_100450987 3300005340 Bacteria 1094
57 Ga0070689_100484086 3300005340 Bacteria 1057
58 Ga0070691_10277813 3300005341 Bacteria 907
59 Ga0070687_100000200 3300005343 Bacteria 20836
60 Ga0070687_100214590 3300005343 Bacteria 1175
61 Ga0070687_100912825 3300005343 Bacteria 630
62 Ga0070687_101168946 3300005343 Bacteria 566
63 Ga0070661_100000298 3300005344 Bacteria 40083
64 Ga0070661_100493290 3300005344 Bacteria 979
65 Ga0070692_10000016 3300005345 Bacteria 34456
66 Ga0070668_100428935 3300005347 Bacteria 1133
67 Ga0070668_101600118 3300005347 Bacteria 597
68 Ga0070669_100001525 3300005353 Bacteria 16755
69 Ga0070669_100111462 3300005353 Bacteria 2077
70 Ga0070669_100125374 3300005353 Bacteria 1964
71 Ga0070675_100000215 3300005354 Bacteria 37364
72 Ga0070675_101108160 3300005354 Bacteria 728
73 Ga0070671_100000402 3300005355 Bacteria 29873
74 Ga0070671_100060569 3300005355 Bacteria 3151
75 Ga0070671_101750206 3300005355 Bacteria 552
76 Ga0070674_100000511 3300005356 Bacteria 19453
77 Ga0070674_100006921 3300005356 Bacteria 6648
78 Ga0070674_101510526 3300005356 Bacteria 604
79 Ga0070673_100000035 3300005364 Bacteria 57163
80 Ga0070673_100172304 3300005364 Unclassified 1848
81 Ga0070673_100431005 3300005364 Bacteria 1183
82 Ga0070673_100587785 3300005364 Unclassified 1014
83 Ga0070673_101052244 3300005364 Bacteria 759
84 Ga0070673_101179599 3300005364 Bacteria 717
85 Ga0070688_100000130 3300005365 Bacteria 40342
86 Ga0070688_100182500 3300005365 Bacteria 1457
87 Ga0070688_100516944 3300005365 Bacteria 903
88 Ga0070688_101457330 3300005365 Bacteria 556
89 Ga0070659_100003979 3300005366 Bacteria 10519
90 Ga0070659_100627990 3300005366 Bacteria 925
91 Ga0070667_100000712 3300005367 Bacteria 32083
92 Ga0070667_100117062 3300005367 Unclassified 2315
93 Ga0070703_10008655 3300005406 Bacteria 2863
94 Ga0070709_10186165 3300005434 Bacteria 1461
95 Ga0070709_11101585 3300005434 Bacteria 635
96 Ga0070714_100040701 3300005435 Bacteria 3918
97 Ga0070714_100156481 3300005435 Bacteria 2058
98 Ga0070713_100081434 3300005436 Bacteria 2762
99 Ga0070713_100342558 3300005436 Unclassified 1385
100 Ga0070713_100614198 3300005436 Bacteria 1034
101 Ga0070713_100970873 3300005436 Bacteria 819
102 Ga0070713_100978422 3300005436 Bacteria 816
103 Ga0070713_101040923 3300005436 Unclassified 790
104 Ga0070710_10020265 3300005437 Unclassified 3448
105 Ga0070710_10544320 3300005437 Unclassified 801
106 Ga0070701_10000081 3300005438 Bacteria 26416
107 Ga0070701_10187120 3300005438 Bacteria 1216
108 Ga0070711_100061646 3300005439 Bacteria 2611
109 Ga0070711_100076743 3300005439 Bacteria 2370
110 Ga0070711_100477342 3300005439 Unclassified 1024
111 Ga0070711_100684904 3300005439 Bacteria 862
112 Ga0070705_100002491 3300005440 Bacteria 9254
113 Ga0070700_100001353 3300005441 Bacteria 12190
114 Ga0070700_100719446 3300005441 Bacteria 796
115 Ga0070694_100000129 3300005444 Bacteria 37699
116 Ga0070708_100007439 3300005445 Bacteria 8766
117 Ga0070663_100001786 3300005455 Bacteria 11966
118 Ga0070663_101361711 3300005455 Unclassified 628
119 Ga0070678_100010388 3300005456 Bacteria 5684
120 Ga0070678_100012816 3300005456 Bacteria 5229
121 Ga0070678_100023973 3300005456 Bacteria 4076
122 Ga0070678_100029790 3300005456 Bacteria 3742
123 Ga0070662_100000933 3300005457 Bacteria 17890
124 Ga0070662_100164222 3300005457 Bacteria 1739
125 Ga0070662_100656567 3300005457 Bacteria 885
126 Ga0070662_101648905 3300005457 Bacteria 554
127 Ga0070681_10001286 3300005458 Bacteria 21879
128 Ga0070681_12049975 3300005458 Unclassified 500
129 Ga0068867_100000369 3300005459 Bacteria 29980
130 Ga0070685_10001791 3300005466 Bacteria 11233
131 Ga0070685_10049852 3300005466 Unclassified 2417
132 Ga0070685_10182056 3300005466 Bacteria 1353
133 Ga0070685_11131363 3300005466 Bacteria 593
134 Ga0070679_100000553 3300005530 Bacteria 31683
135 Ga0070679_100039247 3300005530 Bacteria 4706
136 Ga0070684_100000246 3300005535 Bacteria 37600
137 Ga0070684_100038423 3300005535 Bacteria 4112
138 Ga0070697_100343559 3300005536 Bacteria 1288
139 Ga0070697_100811724 3300005536 Unclassified 828
140 Ga0068853_100002121 3300005539 Bacteria 14740
141 Ga0068853_100545567 3300005539 Bacteria 1098
142 Ga0068853_101032569 3300005539 Bacteria 792
143 Ga0070672_100000157 3300005543 Bacteria 37598
144 Ga0070672_100290140 3300005543 Bacteria 1385
145 Ga0070686_100000260 3300005544 Bacteria 36083
146 Ga0070695_100009157 3300005545 Bacteria 5888
147 Ga0070696_100006359 3300005546 Bacteria 7905
148 Ga0070696_100267392 3300005546 Bacteria 1299
149 Ga0070693_100009423 3300005547 Bacteria 4854
150 Ga0070693_100642150 3300005547 Unclassified 771
151 Ga0070665_100014837 3300005548 Bacteria 7820
152 Ga0070665_101146719 3300005548 Unclassified 788
153 Ga0070704_100000171 3300005549 Bacteria 25774
154 Ga0070704_101425650 3300005549 Bacteria 636
155 Ga0068855_100005012 3300005563 Bacteria 16165
156 Ga0070664_100000269 3300005564 Bacteria 37475
157 Ga0070664_100293293 3300005564 Bacteria 1468
158 Ga0070664_100738133 3300005564 Unclassified 919
159 Ga0068857_100000174 3300005577 Bacteria 40766
160 Ga0068857_100282150 3300005577 Bacteria 1528
161 Ga0068857_101054664 3300005577 Bacteria 784
162 Ga0068854_100000211 3300005578 Bacteria 39059
163 Ga0068856_100000600 3300005614 Bacteria 39415
164 Ga0068856_100598569 3300005614 Unclassified 1123
165 Ga0068856_101863969 3300005614 Unclassified 613
166 Ga0070702_100000312 3300005615 Bacteria 16802
167 Ga0070702_100072607 3300005615 Unclassified 2037
168 Ga0070702_101450997 3300005615 Bacteria 563
169 Ga0068852_100003615 3300005616 Bacteria 10822
170 Ga0068859_100000894 3300005617 Bacteria 30361
171 Ga0068859_100404264 3300005617 Bacteria 1461
172 Ga0068859_100487381 3300005617 Bacteria 1328
173 Ga0068859_100553731 3300005617 Bacteria 1244
174 Ga0068859_100563362 3300005617 Bacteria 1233
175 Ga0068864_100000329 3300005618 Bacteria 41801
176 Ga0068864_100227774 3300005618 Bacteria 1722
177 Ga0068866_10341182 3300005718 Bacteria 949
178 Ga0068870_10000056 3300005840 Bacteria 36039
179 Ga0068870_10243906 3300005840 Bacteria 1111
180 Ga0068863_100000278 3300005841 Bacteria 53024
181 Ga0068863_100198453 3300005841 Bacteria 1929
182 Ga0068863_100590603 3300005841 Bacteria 1098
183 Ga0068858_100001048 3300005842 Bacteria 28582
184 Ga0068858_100182355 3300005842 Bacteria 1982
185 Ga0068858_100243060 3300005842 Bacteria 1708
186 Ga0068858_100817437 3300005842 Bacteria 909
187 Ga0068858_101282022 3300005842 Bacteria 721
188 Ga0068860_100000985 3300005843 Bacteria 31478
189 Ga0068860_100223025 3300005843 Unclassified 1831
190 Ga0068862_100000593 3300005844 Bacteria 37703
191 Ga0068862_100477351 3300005844 Bacteria 1180
192 Ga0081455_10114341 3300005937 Bacteria 2139
193 Ga0081540_1000008 3300005983 Bacteria 203702
194 Ga0070717_10289983 3300006028 Bacteria 1453
195 Ga0070717_10331433 3300006028 Unclassified 1358
196 Ga0070717_10610210 3300006028 Bacteria 990
197 Ga0075365_10979706 3300006038 Bacteria 596
198 Ga0075363_100634200 3300006048 Bacteria 642
199 Ga0075363_100655442 3300006048 Bacteria 632
200 Ga0075364_10035141 3300006051 Bacteria 3238
201 Ga0075364_10071044 3300006051 Bacteria 2292
202 Ga0075432_10000435 3300006058 Bacteria 12267
203 Ga0070715_10007119 3300006163 Bacteria 3839
204 Ga0070712_100459829 3300006175 Bacteria 1061
205 Ga0075362_10005903 3300006177 Bacteria 4521
206 Ga0075367_10047325 3300006178 Bacteria 2530
207 Ga0075367_10150782 3300006178 Bacteria 1443
208 Ga0075367_10256697 3300006178 Bacteria 1097
209 Ga0075367_10788310 3300006178 Bacteria 605
210 Ga0075427_10000061 3300006194 Bacteria 8226
211 Ga0075366_10016041 3300006195 Bacteria 4302
212 Ga0075366_10073912 3300006195 Bacteria 2032
213 Ga0075366_10554471 3300006195 Bacteria 712
214 Ga0075366_10713402 3300006195 Bacteria 623
215 Ga0075366_10882959 3300006195 Bacteria 557
216 Ga0097621_100000504 3300006237 Bacteria 27335
217 Ga0097621_100779752 3300006237 Unclassified 885
218 Ga0097621_101025508 3300006237 Bacteria 772
219 Ga0075370_10091733 3300006353 Bacteria 1753
220 Ga0075370_10478118 3300006353 Bacteria 751
221 Ga0068871_100000815 3300006358 Bacteria 20895
222 Ga0068871_100070338 3300006358 Bacteria 2876
223 Ga0068871_100076484 3300006358 Bacteria 2765
224 Ga0075428_100001096 3300006844 Bacteria 28836
225 Ga0075428_100001439 3300006844 Bacteria 25419
226 Ga0075430_100001275 3300006846 Bacteria 20297
227 Ga0075430_100061302 3300006846 Bacteria 3161
228 Ga0075430_100640127 3300006846 Bacteria 877
229 Ga0075431_100006467 3300006847 Bacteria 11636
230 Ga0075431_100011265 3300006847 Bacteria 9007
231 Ga0075431_100467799 3300006847 Bacteria 1255
232 Ga0075431_101225776 3300006847 Bacteria 713
233 Ga0075433_10011448 3300006852 Bacteria 7145
234 Ga0075433_10062959 3300006852 Bacteria 3249
235 Ga0075433_10328397 3300006852 Unclassified 1353
236 Ga0075433_11444506 3300006852 Bacteria 595
237 Ga0075434_100000244 3300006871 Bacteria 38039
238 Ga0075434_100007451 3300006871 Bacteria 10123
239 Ga0075434_100262160 3300006871 Unclassified 1747
240 Ga0075429_100000388 3300006880 Bacteria 32233
241 Ga0075429_100004065 3300006880 Bacteria 12537
242 Ga0075429_101006317 3300006880 Unclassified 729
243 Ga0075429_101405896 3300006880 Unclassified 608
244 Ga0075436_100105119 3300006914 Unclassified 1969
245 Ga0075436_100166843 3300006914 Unclassified 1554
246 Ga0075436_100259095 3300006914 Bacteria 1240
247 Ga0075436_100457545 3300006914 Bacteria 930
248 Ga0075436_100688626 3300006914 Unclassified 757
249 Ga0097620_100000894 3300006931 Bacteria 30361
250 Ga0097620_100404243 3300006931 Bacteria 1461
251 Ga0097620_100487484 3300006931 Bacteria 1328
252 Ga0097620_100553730 3300006931 Bacteria 1244
253 Ga0097620_100563363 3300006931 Bacteria 1233
254 Ga0075435_100223748 3300007076 Bacteria 1598
255 Ga0075435_100296359 3300007076 Bacteria 1383
256 Ga0075435_100488950 3300007076 Unclassified 1063
257 Ga0075435_100497848 3300007076 Unclassified 1053
258 Ga0075435_101353843 3300007076 Unclassified 624
259 Ga0099795_10009067 3300007788 Bacteria 2870
260 Ga0105251_10060586 3300009011 Bacteria 1781
261 Ga0105251_10143611 3300009011 Bacteria 1079
262 Ga0105250_10444335 3300009092 Bacteria 581
263 Ga0105240_10016606 3300009093 Bacteria 9959
264 Ga0105240_10170530 3300009093 Bacteria 2578
265 Ga0105240_11697185 3300009093 Unclassified 659
266 Ga0111539_10000835 3300009094 Bacteria 40036
267 Ga0111539_10001076 3300009094 Bacteria 36048
268 Ga0111539_10002315 3300009094 Bacteria 25343
269 Ga0111539_10105140 3300009094 Bacteria 3312
270 Ga0111539_10172234 3300009094 Bacteria 2529
271 Ga0105245_10000451 3300009098 Bacteria 37705
272 Ga0105245_10039669 3300009098 Unclassified 4191
273 Ga0105245_10580552 3300009098 Unclassified 1145
274 Ga0105247_10001016 3300009101 Bacteria 21159
275 Ga0105247_10015781 3300009101 Bacteria 4522
276 Ga0105247_10236818 3300009101 Unclassified 1242
277 Ga0114129_10003642 3300009147 Bacteria 21678
278 Ga0114129_10005725 3300009147 Bacteria 17605
279 Ga0114129_10006438 3300009147 Bacteria 16649
280 Ga0114129_10690800 3300009147 Bacteria 1312
281 Ga0114129_11055913 3300009147 Bacteria 1019
282 Ga0114129_11188478 3300009147 Bacteria 951
283 Ga0105243_10002173 3300009148 Bacteria 16567
284 Ga0105243_10105337 3300009148 Unclassified 2349
285 Ga0105243_10157922 3300009148 Bacteria 1952
286 Ga0105241_10001549 3300009174 Bacteria 17620
287 Ga0105241_10242485 3300009174 Bacteria 1524
288 Ga0105242_10000947 3300009176 Bacteria 22652
289 Ga0105242_10058894 3300009176 Bacteria 3151
290 Ga0105242_10229439 3300009176 Bacteria 1663
291 Ga0105248_10000837 3300009177 Bacteria 34570
292 Ga0105237_10022344 3300009545 Bacteria 6492
293 Ga0105237_10416353 3300009545 Bacteria 1349
294 Ga0105238_10102115 3300009551 Bacteria 2850
295 Ga0105238_10255872 3300009551 Bacteria 1730
296 Ga0105238_10933194 3300009551 Bacteria 887
297 Ga0105249_10000976 3300009553 Bacteria 25338
298 Ga0105249_10298822 3300009553 Bacteria 1614
299 Ga0105249_10387154 3300009553 Bacteria 1425
300 Ga0099796_10017285 3300010159 Bacteria 2144
301 Ga0105239_10040227 3300010375 Bacteria 5123
302 Ga0105239_10348910 3300010375 Bacteria 1671
303 Ga0105239_10895094 3300010375 Bacteria 1019
304 Ga0105239_11955925 3300010375 Bacteria 680
305 Ga0105246_10000100 3300011119 Bacteria 37689
306 Ga0105246_10262932 3300011119 Unclassified 1375
307 Ga0157325_1022502 3300012485 Bacteria 574
308 Ga0157315_1003623 3300012508 Unclassified 1054
309 Ga0157316_1007613 3300012510 Bacteria 925
310 Ga0157326_1025419 3300012513 Bacteria 756
311 Ga0157373_10125461 3300013100 Bacteria 1805
312 Ga0157371_10001676 3300013102 Bacteria 22625
313 Ga0157371_11018007 3300013102 Unclassified 632
314 Ga0157370_10264187 3300013104 Bacteria 1590
315 Ga0157374_10000956 3300013296 Bacteria 25071
316 Ga0157374_10231659 3300013296 Bacteria 1814
317 Ga0157374_10491830 3300013296 Bacteria 1231
318 Ga0157374_10526487 3300013296 Bacteria 1188
319 Ga0157378_10001544 3300013297 Bacteria 20818
320 Ga0157378_10126320 3300013297 Unclassified 2363
321 Ga0157378_10729447 3300013297 Bacteria 1012
322 Ga0163162_12556632 3300013306 Bacteria 587
323 Ga0157372_10026270 3300013307 Bacteria 6335
324 Ga0157375_10000464 3300013308 Bacteria 36915
325 Ga0157375_10232409 3300013308 Bacteria 2003
326 Ga0157375_10364612 3300013308 Bacteria 1611
327 Ga0163163_10003318 3300014325 Bacteria 13651
328 Ga0157380_10000145 3300014326 Bacteria 40211
329 Ga0157380_11689294 3300014326 Bacteria 690
330 Ga0157377_10000179 3300014745 Bacteria 36682
331 Ga0157379_10000067 3300014968 Bacteria 66051
332 Ga0157379_10164378 3300014968 Unclassified 2003
333 Ga0157379_11518984 3300014968 Bacteria 652
334 Ga0157376_10023037 3300014969 Unclassified 4866
335 Ga0157376_10244829 3300014969 Unclassified 1672
336 Ga0157376_11715251 3300014969 Bacteria 663
337 Ga0163161_10001462 3300017792 Bacteria 17455
338 Ga0163161_10050492 3300017792 Bacteria 3011
339 Ga0163161_10407560 3300017792 Bacteria 1091
340 Ga0213876_10176105 3300021384 Bacteria 1138
341 Ga0209233_1004623 3300025261 Bacteria 4654
342 Ga0207666_1000002 3300025271 Bacteria 62717
343 Ga0207673_1000015 3300025290 Bacteria 13527
344 Ga0207697_10000113 3300025315 Bacteria 37772
345 Ga0207697_10085892 3300025315 Bacteria 1330
346 Ga0207713_1102851 3300025735 Bacteria 983
347 Ga0207653_10001270 3300025885 Bacteria 8227
348 Ga0207682_10000094 3300025893 Bacteria 41188
349 Ga0207682_10001641 3300025893 Bacteria 10258
350 Ga0207642_10000337 3300025899 Bacteria 14044
351 Ga0207710_10000795 3300025900 Bacteria 17144
352 Ga0207710_10004197 3300025900 Bacteria 6314
353 Ga0207710_10022043 3300025900 Unclassified 2732
354 Ga0207688_10000074 3300025901 Bacteria 37681
355 Ga0207688_10057634 3300025901 Bacteria 2184
356 Ga0207688_10200449 3300025901 Bacteria 1196
357 Ga0207680_10010896 3300025903 Bacteria 4570
358 Ga0207680_10363425 3300025903 Bacteria 1018
359 Ga0207680_11187744 3300025903 Unclassified 544
360 Ga0207647_10000218 3300025904 Bacteria 46963
361 Ga0207685_10004360 3300025905 Bacteria 3587
362 Ga0207685_10036665 3300025905 Bacteria 1800
363 Ga0207699_10206091 3300025906 Bacteria 1335
364 Ga0207699_10655603 3300025906 Bacteria 767
365 Ga0207645_10000247 3300025907 Bacteria 44983
366 Ga0207645_10042103 3300025907 Bacteria 2923
367 Ga0207643_10000004 3300025908 Bacteria 187006
368 Ga0207643_10299968 3300025908 Bacteria 1000
369 Ga0207654_10000627 3300025911 Bacteria 19909
370 Ga0207654_10117741 3300025911 Unclassified 1663
371 Ga0207707_10000618 3300025912 Bacteria 35350
372 Ga0207695_10030828 3300025913 Bacteria 5899
373 Ga0207671_10011571 3300025914 Bacteria 7165
374 Ga0207671_10432590 3300025914 Bacteria 1047
375 Ga0207693_10011262 3300025915 Bacteria 7240
376 Ga0207693_10344841 3300025915 Bacteria 1166
377 Ga0207663_10119004 3300025916 Unclassified 1805
378 Ga0207663_10605393 3300025916 Bacteria 861
379 Ga0207663_11061123 3300025916 Bacteria 651
380 Ga0207663_11320139 3300025916 Bacteria 581
381 Ga0207660_10000741 3300025917 Bacteria 21651
382 Ga0207660_10232039 3300025917 Bacteria 1451
383 Ga0207660_10569458 3300025917 Bacteria 922
384 Ga0207662_10000119 3300025918 Bacteria 37770
385 Ga0207662_10090731 3300025918 Bacteria 1879
386 Ga0207662_10349438 3300025918 Bacteria 993
387 Ga0207662_10454914 3300025918 Bacteria 876
388 Ga0207657_10000316 3300025919 Bacteria 51145
389 Ga0207649_10000090 3300025920 Bacteria 75387
390 Ga0207652_10000847 3300025921 Bacteria 29115
391 Ga0207652_10049716 3300025921 Bacteria 3590
392 Ga0207681_10000370 3300025923 Bacteria 31836
393 Ga0207681_10080489 3300025923 Bacteria 2298
394 Ga0207681_10170983 3300025923 Bacteria 1647
395 Ga0207694_10100847 3300025924 Bacteria 2288
396 Ga0207694_10129130 3300025924 Bacteria 2025
397 Ga0207694_10193007 3300025924 Bacteria 1655
398 Ga0207650_10008243 3300025925 Bacteria 7114
399 Ga0207650_10521824 3300025925 Bacteria 994
400 Ga0207659_10000038 3300025926 Bacteria 93848
401 Ga0207659_10880873 3300025926 Unclassified 770
402 Ga0207687_10000784 3300025927 Bacteria 21392
403 Ga0207687_10265708 3300025927 Bacteria 1370
404 Ga0207687_10308593 3300025927 Bacteria 1277
405 Ga0207700_10187315 3300025928 Unclassified 1737
406 Ga0207700_10256142 3300025928 Bacteria 1497
407 Ga0207700_10312074 3300025928 Bacteria 1360
408 Ga0207700_10934574 3300025928 Unclassified 776
409 Ga0207664_10134950 3300025929 Bacteria 2082
410 Ga0207664_10631794 3300025929 Unclassified 962
411 Ga0207644_10001053 3300025931 Bacteria 17640
412 Ga0207644_10182832 3300025931 Bacteria 1644
413 Ga0207644_10514755 3300025931 Bacteria 988
414 Ga0207690_10000239 3300025932 Bacteria 39850
415 Ga0207690_10183222 3300025932 Bacteria 1578
416 Ga0207690_10566048 3300025932 Bacteria 925
417 Ga0207706_10000424 3300025933 Bacteria 45410
418 Ga0207706_10050735 3300025933 Bacteria 3666
419 Ga0207706_10193010 3300025933 Bacteria 1787
420 Ga0207706_10468322 3300025933 Bacteria 1089
421 Ga0207706_10875861 3300025933 Bacteria 759
422 Ga0207686_10001203 3300025934 Bacteria 15007
423 Ga0207686_10170038 3300025934 Unclassified 1536
424 Ga0207709_10000379 3300025935 Bacteria 44189
425 Ga0207709_10071000 3300025935 Unclassified 2210
426 Ga0207709_10383642 3300025935 Bacteria 1070
427 Ga0207670_10000176 3300025936 Bacteria 42483
428 Ga0207669_10000165 3300025937 Bacteria 31741
429 Ga0207669_10057031 3300025937 Bacteria 2375
430 Ga0207669_10194341 3300025937 Unclassified 1467
431 Ga0207669_11419668 3300025937 Bacteria 591
432 Ga0207704_10001709 3300025938 Bacteria 9819
433 Ga0207704_10037612 3300025938 Bacteria 2797
434 Ga0207704_10750806 3300025938 Bacteria 811
435 Ga0207665_10114251 3300025939 Bacteria 1900
436 Ga0207665_10364748 3300025939 Bacteria 1093
437 Ga0207665_10829070 3300025939 Unclassified 732
438 Ga0207691_10000358 3300025940 Bacteria 46095
439 Ga0207691_10030388 3300025940 Bacteria 5049
440 Ga0207711_10000780 3300025941 Bacteria 31295
441 Ga0207711_10123112 3300025941 Bacteria 2317
442 Ga0207689_10000479 3300025942 Bacteria 37696
443 Ga0207689_10013531 3300025942 Bacteria 6966
444 Ga0207661_10000604 3300025944 Bacteria 22956
445 Ga0207661_10146928 3300025944 Bacteria 2035
446 Ga0207661_11645855 3300025944 Bacteria 587
447 Ga0207679_10000139 3300025945 Bacteria 59804
448 Ga0207679_10846709 3300025945 Unclassified 835
449 Ga0207667_10003492 3300025949 Bacteria 19417
450 Ga0207667_11046741 3300025949 Unclassified 801
451 Ga0207651_10000072 3300025960 Bacteria 46009
452 Ga0207651_10073755 3300025960 Unclassified 2428
453 Ga0207651_10293347 3300025960 Bacteria 1349
454 Ga0207651_10573620 3300025960 Bacteria 983
455 Ga0207712_10000588 3300025961 Bacteria 29188
456 Ga0207712_10735930 3300025961 Bacteria 863
457 Ga0207712_10951283 3300025961 Bacteria 761
458 Ga0207668_10000168 3300025972 Bacteria 45205
459 Ga0207668_10070576 3300025972 Bacteria 2492
460 Ga0207668_10583842 3300025972 Bacteria 972
461 Ga0207668_11014867 3300025972 Bacteria 742
462 Ga0207640_10000242 3300025981 Bacteria 37007
463 Ga0207640_12096931 3300025981 Bacteria 513
464 Ga0207658_10000667 3300025986 Bacteria 29975
465 Ga0207677_10004440 3300026023 Bacteria 7533
466 Ga0207703_10000463 3300026035 Bacteria 42725
467 Ga0207703_10147628 3300026035 Bacteria 2047
468 Ga0207703_10965194 3300026035 Unclassified 817
469 Ga0207703_12043524 3300026035 Unclassified 549
470 Ga0207639_10002404 3300026041 Bacteria 12567
471 Ga0207678_10000447 3300026067 Bacteria 37597
472 Ga0207678_10025607 3300026067 Bacteria 5149
473 Ga0207708_10000293 3300026075 Bacteria 39298
474 Ga0207708_10167148 3300026075 Bacteria 1740
475 Ga0207708_10977867 3300026075 Unclassified 735
476 Ga0207702_10007213 3300026078 Bacteria 9510
477 Ga0207702_10501576 3300026078 Bacteria 1183
478 Ga0207641_10000724 3300026088 Bacteria 35413
479 Ga0207641_10876642 3300026088 Bacteria 890
480 Ga0207641_11028329 3300026088 Bacteria 821
481 Ga0207648_10000223 3300026089 Bacteria 61064
482 Ga0207648_10404594 3300026089 Bacteria 1237
483 Ga0207648_10418586 3300026089 Bacteria 1216
484 Ga0207676_10000392 3300026095 Bacteria 37207
485 Ga0207674_10000955 3300026116 Bacteria 37769
486 Ga0207674_10203822 3300026116 Bacteria 1927
487 Ga0207674_10945629 3300026116 Bacteria 830
488 Ga0207675_100000364 3300026118 Bacteria 43420
489 Ga0207675_100537267 3300026118 Bacteria 1167
490 Ga0207675_101020457 3300026118 Bacteria 846
491 Ga0207683_10000397 3300026121 Bacteria 39911
492 Ga0207683_10015258 3300026121 Bacteria 6538
493 Ga0207683_10033226 3300026121 Bacteria 4481
494 Ga0207698_10003705 3300026142 Bacteria 9239
495 Ga0209973_1016160 3300027252 Bacteria 949
496 Ga0209996_1018694 3300027395 Bacteria 964
497 Ga0209984_1012090 3300027424 Bacteria 1123
498 Ga0210002_1001181 3300027617 Unclassified 3640
499 Ga0209971_1037562 3300027682 Bacteria 1166
500 Ga0209998_10000535 3300027717 Bacteria 10223
501 Ga0209813_10239612 3300027866 Bacteria 685
502 Ga0209813_10435923 3300027866 Bacteria 534
503 Ga0209974_10001185 3300027876 Bacteria 9317
504 Ga0207428_10000272 3300027907 Bacteria 69872
505 Ga0207428_10000439 3300027907 Bacteria 50911
506 Ga0207428_10016728 3300027907 Bacteria 6308
507 Ga0207428_10620227 3300027907 Bacteria 778
508 Ga0268266_10008599 3300028379 Bacteria 9068
509 Ga0268265_10002666 3300028380 Bacteria 13234
510 Ga0268265_10068403 3300028380 Bacteria 2754
511 Ga0268265_10681146 3300028380 Bacteria 991
512 Ga0268264_10000890 3300028381 Bacteria 31465
513 Ga0265760_10135921 3300031090 Bacteria 798
514 Ga0265325_10000019 3300031241 Bacteria 125265
515 Ga0265325_10045188 3300031241 Bacteria 2290
516 Ga0265325_10275903 3300031241 Bacteria 755
517 Ga0265340_10023297 3300031247 Bacteria 3158
518 Ga0307408_101817597 3300031548 Unclassified 583
519 Ga0265313_10004790 3300031595 Bacteria 10192
520 Ga0265314_10000577 3300031711 Bacteria 46408
521 Ga0316576_10255584 3300031727 Bacteria 1315
522 Ga0307405_10644535 3300031731 Bacteria 870
523 Ga0307409_100305577 3300031995 Bacteria 1482
524 Ga0307416_102768684 3300032002 Bacteria 586
525 Ga0307415_100540982 3300032126 Bacteria 1026
526 Ga0373930_0008163 3300034816 Bacteria 1827
527 Ga0373930_0040686 3300034816 Bacteria 989
528 Ga0373948_0023739 3300034817 Bacteria 1191
529 Ga0373950_0005260 3300034818 Bacteria 1927
530 Ga0373950_0020954 3300034818 Bacteria 1153
531 Ga0373958_0008288 3300034819 Bacteria 1680
532 Ga0373959_0009193 3300034820 Bacteria 1698
533 Ga0373959_0040869 3300034820 Bacteria 972
534 Ga0373938_0000801 3300034957 Bacteria 5110
535 Ga0373938_0004620 3300034957 Bacteria 2310
536 Ga0373926_0030151 3300035083 Bacteria 1909
537 Ga0373928_0008041 3300035084 Bacteria 2042
538 Ga0373928_0106569 3300035084 Bacteria 737
539 Ga0373929_0026251 3300035085 Bacteria 1216
540 Ga0373934_0029917 3300035086 Bacteria 2129
541 Ga0373934_0131661 3300035086 Unclassified 1020
542 Ga0373940_0024844 3300035088 Bacteria 1556
543 Ga0373944_0005312 3300035089 Unclassified 3387
544 Ga0373944_0254141 3300035089 Bacteria 649
545 Ga0373949_0005655 3300035090 Bacteria 2782
546 Ga0373949_0015968 3300035090 Bacteria 1681
547 Ga0373951_0004903 3300035091 Bacteria 3140
548 Ga0373951_0005568 3300035091 Bacteria 2921
549 Ga0373952_0000491 3300035092 Bacteria 6857
550 Ga0373952_0069200 3300035092 Bacteria 879
551 Ga0373923_0001791 3300035111 Bacteria 6335
552 Ga0373923_0135138 3300035111 Bacteria 1111
553 Ga0373923_0252043 3300035111 Bacteria 826
554 Ga0373923_0454255 3300035111 Unclassified 621
555 Ga0373932_0010270 3300035112 Bacteria 2263
556 Ga0373936_0059436 3300035113 Bacteria 1558
557 Ga0373939_0000671 3300035114 Bacteria 8492
558 Ga0373939_0158875 3300035114 Bacteria 828
559 Ga0373941_0002421 3300035115 Bacteria 4103
560 Ga0373941_0002853 3300035115 Bacteria 3854
561 Ga0373945_0047206 3300035116 Bacteria 1574
562 Ga0373945_0058782 3300035116 Bacteria 1430
563 Ga0373945_0176927 3300035116 Bacteria 877
564 Ga0373953_0003123 3300035117 Bacteria 5108
565 Ga0373953_0203063 3300035117 Bacteria 857
566 Ga0373954_0010232 3300035118 Bacteria 4136
567 Ga0373954_0027582 3300035118 Bacteria 2608
568 Ga0373954_0037490 3300035118 Unclassified 2253
569 Ga0373957_0005354 3300035120 Bacteria 3973
570 Ga0373957_0005745 3300035120 Unclassified 3866
571 Ga0373960_0001077 3300035121 Bacteria 5890
572 Ga0373960_0023438 3300035121 Bacteria 1662
573 Ga0373960_0323101 3300035121 Bacteria 579
574 Ga0373943_0000417 3300035170 Bacteria 17965
575 Ga0373943_0013438 3300035170 Bacteria 3698
576 Ga0373946_0001306 3300035171 Bacteria 8620
577 Ga0373946_0005513 3300035171 Bacteria 4566
578 Ga0373946_0019410 3300035171 Bacteria 2619
579 Ga0373946_0061121 3300035171 Bacteria 1603
580 Ga0373955_0002670 3300035172 Bacteria 7801
581 Ga0373955_0007047 3300035172 Bacteria 5149
582 Ga0373955_0012099 3300035172 Unclassified 4139
583 Ga0373942_0011858 3300035207 Bacteria 2073
584 Ga0373942_0017682 3300035207 Bacteria 1760
585 Ga0373961_0005861 3300035241 Bacteria 2952
586 Ga0373962_0001390 3300035242 Bacteria 5708
587 Ga0373962_0020639 3300035242 Bacteria 1731
588 Ga0316574_0033601 3300035398 Bacteria 3122
589 Ga0373924_0002381 3300035410 Bacteria 6330
590 Ga0373924_0017622 3300035410 Bacteria 2742
591 Ga0373931_0000089 3300035691 Bacteria 42136
592 Ga0373931_0022029 3300035691 Bacteria 3202
593 Ga0373935_0000037 3300035692 Bacteria 51610
594 Ga0373935_0015408 3300035692 Bacteria 4621
595 Ga0373935_0026462 3300035692 Bacteria 3580
596 Ga0373935_0175304 3300035692 Bacteria 1469
597 Ga0373927_0000700 3300035695 Bacteria 25687
598 Ga0373927_0044985 3300035695 Bacteria 2856
599 Ga0373927_0241634 3300035695 Bacteria 1187
600 Ga0373933_0001535 3300035724 Bacteria 13497
601 Ga0373933_0013152 3300035724 Bacteria 4583
602 Ga0373933_0013294 3300035724 Unclassified 4560
603 Ga0373933_0951591 3300035724 Unclassified 566
604 Ga0373947_0000333 3300035725 Bacteria 26541
605 Ga0373947_0007823 3300035725 Bacteria 6174
606 Ga0373947_0122291 3300035725 Bacteria 1654
607 Ga0373947_0652924 3300035725 Unclassified 717
608 Ga0373937_0000018 3300036401 Bacteria 144056
609 Ga0373937_0001938 3300036401 Bacteria 17317
610 Ga0373937_0007486 3300036401 Bacteria 9449
611 Ga0373937_0158069 3300036401 Bacteria 2125
612 Ga0373937_1589427 3300036401 Unclassified 601
613 Ga0316584_0037455 3300036712 Bacteria 3604
614 Ga0373925_0003079 3300037068 Bacteria 13090
615 Ga0373925_0004485 3300037068 Bacteria 10548
616 Ga0373925_0020402 3300037068 Bacteria 4824
617 Ga0436364_0246124 3300037853 Bacteria 1586
618 Ga0436364_0741110 3300037853 Bacteria 1609
619 Ga0436365_1346123 3300039437 Bacteria 1329
620 Ga0436365_1822239 3300039437 Bacteria 4605
621 Ga0436360_0159932 3300039438 Bacteria 519
622 Ga0436361_0031041 3300039447 Bacteria 4242
623 Ga0451800_0770855 3300041459 Bacteria 530
624 Ga0451804_0516851 3300041463 Bacteria 731
625 Ga0451577_1680239 3300042876 Bacteria 559
626 Ga0466967_0928838 3300045976 Bacteria 866
627 Ga0495592_0000055 3300046454 Bacteria 106223
628 Ga0495592_0056360 3300046454 Unclassified 2904
629 Ga0495603_0051326 3300046455 Bacteria 2451
630 Ga0495603_0726683 3300046455 Bacteria 567
631 Ga0495629_0000715 3300046459 Bacteria 26888
632 Ga0495629_0004595 3300046459 Bacteria 10333
633 Ga0495629_0018872 3300046459 Bacteria 4930
634 Ga0495629_0024418 3300046459 Bacteria 4305
635 Ga0495629_0091826 3300046459 Unclassified 2119
636 Ga0495629_0200721 3300046459 Bacteria 1379
637 Ga0495641_0247329 3300046461 Bacteria 802
638 Ga0495651_0000210 3300046462 Bacteria 44718
639 Ga0495651_0000469 3300046462 Bacteria 31001
640 Ga0495651_0004620 3300046462 Bacteria 10528
641 Ga0495653_0000003 3300046463 Bacteria 377892
642 Ga0495653_0000528 3300046463 Bacteria 29299
643 Ga0495653_0001294 3300046463 Bacteria 19370
644 Ga0495580_0220080 3300046472 Bacteria 1305
645 Ga0495580_0612863 3300046472 Unclassified 718
646 Ga0495582_0004541 3300046473 Bacteria 7796
647 Ga0495582_0019173 3300046473 Bacteria 3742
648 Ga0495605_0085040 3300046474 Bacteria 1474
649 Ga0495639_0044935 3300046475 Unclassified 1998
650 Ga0495639_0087214 3300046475 Unclassified 1460
651 Ga0495662_0002357 3300046476 Bacteria 9522
652 Ga0495662_0175453 3300046476 Bacteria 1056
653 Ga0495662_0215187 3300046476 Bacteria 947
654 Ga0495664_0000001 3300046477 Bacteria 757730
655 Ga0495664_0002815 3300046477 Bacteria 9349
656 Ga0495664_0020851 3300046477 Bacteria 3783
657 Ga0495584_0211306 3300046491 Bacteria 986
658 Ga0495594_0218359 3300046499 Bacteria 1087
659 Ga0495608_0000012 3300046511 Bacteria 242758
660 Ga0495608_0052498 3300046511 Unclassified 2698
661 Ga0495608_0410299 3300046511 Bacteria 827
662 Ga0495618_0000012 3300046514 Bacteria 170881
663 Ga0495618_0004183 3300046514 Bacteria 8911
664 Ga0495618_0025548 3300046514 Unclassified 3666
665 Ga0495618_0077712 3300046514 Unclassified 2115
666 Ga0495628_0000003 3300046516 Bacteria 470339
667 Ga0495628_0059123 3300046516 Bacteria 3010
668 Ga0495630_0000188 3300046517 Bacteria 48229
669 Ga0495630_0009769 3300046517 Bacteria 6904
670 Ga0495630_0106021 3300046517 Bacteria 2128
671 Ga0495666_0042911 3300046526 Bacteria 2186
672 Ga0495652_0000001 3300046529 Bacteria 1045081
673 Ga0495652_0007567 3300046529 Bacteria 10012
674 Ga0495665_0085041 3300046531 Unclassified 1662
675 Ga0495665_0313586 3300046531 Bacteria 802
676 Ga0495640_0000022 3300046533 Bacteria 101825
677 Ga0495640_0004486 3300046533 Bacteria 11129
678 Ga0495640_0017063 3300046533 Bacteria 5418
679 Ga0495640_0024843 3300046533 Bacteria 4353
680 Ga0495640_0457418 3300046533 Bacteria 779
681 Ga0495586_0064814 3300046535 Bacteria 1991
682 Ga0495586_0279639 3300046535 Bacteria 955
683 Ga0495586_0296414 3300046535 Bacteria 926
684 Ga0495587_0000003 3300046536 Bacteria 424188
685 Ga0495587_0006458 3300046536 Bacteria 7640
686 Ga0495587_0007819 3300046536 Bacteria 6907
687 Ga0495598_0171847 3300046537 Bacteria 768
688 Ga0495609_0085018 3300046538 Unclassified 1380
689 Ga0495621_0046407 3300046539 Bacteria 1541
690 Ga0495645_0000004 3300046543 Bacteria 532661
691 Ga0495645_0045284 3300046543 Bacteria 3209
692 Ga0495645_0137530 3300046543 Bacteria 1707
693 Ga0495667_0000001 3300046559 Bacteria 834831
694 Ga0495667_0002575 3300046559 Bacteria 12117
695 Ga0495667_0008025 3300046559 Bacteria 7160
696 Ga0495634_0000012 3300046642 Bacteria 131341
697 Ga0495634_0005822 3300046642 Bacteria 9406
698 Ga0495634_0023237 3300046642 Bacteria 4360
699 Ga0495634_0043987 3300046642 Bacteria 3025
700 Ga0495625_0341665 3300046660 Bacteria 948
701 Ga0495635_0000011 3300046663 Bacteria 240094
702 Ga0495635_0010126 3300046663 Bacteria 6593
703 Ga0495635_0021148 3300046663 Bacteria 4534
704 Ga0495635_0251842 3300046663 Unclassified 1190
705 Ga0495635_0767855 3300046663 Bacteria 622
706 Ga0495588_0101284 3300046674 Unclassified 1513
707 Ga0495657_0000086 3300046675 Bacteria 81806
708 Ga0495657_0004107 3300046675 Bacteria 11678
709 Ga0495657_0163989 3300046675 Bacteria 1373
710 Ga0495599_0000004 3300046678 Bacteria 316231
711 Ga0495599_0026597 3300046678 Unclassified 3626
712 Ga0495599_0068271 3300046678 Bacteria 2219
713 Ga0495623_0000044 3300046679 Bacteria 77517
714 Ga0495623_0001286 3300046679 Bacteria 17039
715 Ga0495623_0146057 3300046679 Bacteria 1402
716 Ga0495646_0000010 3300046680 Bacteria 195319
717 Ga0495646_0002714 3300046680 Bacteria 10940
718 Ga0495646_0023303 3300046680 Bacteria 3898
719 Ga0495647_0543163 3300046681 Bacteria 543
720 Ga0495658_0004603 3300046683 Bacteria 6790
721 Ga0495669_0202376 3300046684 Bacteria 949
722 Ga0495613_0006333 3300046689 Bacteria 8853
723 Ga0495613_0029810 3300046689 Bacteria 4056
724 Ga0495613_0057372 3300046689 Unclassified 2859
725 Ga0495613_0442717 3300046689 Bacteria 881
726 Ga0495624_0035675 3300046690 Bacteria 3210
727 Ga0495624_0072494 3300046690 Unclassified 2142
728 Ga0495624_0085440 3300046690 Unclassified 1949
729 Ga0495624_0224708 3300046690 Bacteria 1138
730 Ga0495600_0000026 3300046809 Bacteria 91792
731 Ga0495600_0013079 3300046809 Bacteria 5207
732 Ga0495600_0051085 3300046809 Bacteria 2698
733 Ga0495581_0011911 3300047315 Bacteria 5032
734 Ga0495581_0052904 3300047315 Bacteria 2345
735 Ga0495581_0064733 3300047315 Unclassified 2112
736 Ga0495604_0000010 3300047317 Bacteria 312236
737 Ga0495604_0000186 3300047317 Bacteria 55450
738 Ga0495604_0008654 3300047317 Bacteria 8044
739 Ga0495674_0000001 3300047319 Bacteria 778665
740 Ga0495674_0041939 3300047319 Unclassified 4084
741 Ga0495674_0207135 3300047319 Bacteria 1625
742 Ga0495674_0701794 3300047319 Bacteria 794
743 Ga0495676_0062812 3300047321 Bacteria 2898
744 Ga0495676_0117646 3300047321 Bacteria 1938
745 Ga0495680_0000527 3300047322 Bacteria 43004
746 Ga0495680_0010600 3300047322 Bacteria 8219
747 Ga0495680_0034946 3300047322 Bacteria 4053
748 Ga0495680_0050611 3300047322 Bacteria 3247
749 Ga0495675_0000009 3300047444 Bacteria 154214
750 Ga0495675_0005457 3300047444 Bacteria 7755
751 Ga0495675_0014129 3300047444 Bacteria 5047
752 Ga0495684_0000005 3300047471 Bacteria 291932
753 Ga0495684_0002670 3300047471 Bacteria 14133
754 Ga0495684_0014505 3300047471 Bacteria 6064
755 Ga0495684_0060437 3300047471 Unclassified 2885
756 Ga0495684_0192799 3300047471 Bacteria 1506
757 Ga0495593_0002803 3300047673 Bacteria 10498
758 Ga0495593_0008599 3300047673 Bacteria 5936
759 Ga0495593_0023096 3300047673 Unclassified 3460
760 Ga0495593_0024339 3300047673 Bacteria 3357
761 Ga0495602_0000002 3300048088 Bacteria 422216
762 Ga0495602_0004101 3300048088 Bacteria 15167
763 Ga0495614_0111023 3300048089 Unclassified 1204
764 Ga0496100_0000200 3300048903 Bacteria 32909
765 Ga0496100_0114661 3300048903 Bacteria 1877
766 Ga0496100_0179265 3300048903 Unclassified 1531
767 Ga0496101_0000339 3300048904 Bacteria 31619
768 Ga0496101_0003678 3300048904 Bacteria 9571
769 Ga0496102_0000729 3300048905 Bacteria 32340
770 Ga0496102_0461011 3300048905 Bacteria 1192
771 Ga0496102_1759116 3300048905 Unclassified 537
772 Ga0496102_1763337 3300048905 Bacteria 536
773 Ga0496103_0001639 3300048906 Bacteria 14682
774 Ga0496103_0131869 3300048906 Bacteria 1596
775 Ga0496103_0144988 3300048906 Bacteria 1519
776 Ga0496104_0025091 3300048907 Bacteria 5493
777 Ga0496104_0051617 3300048907 Bacteria 3882
778 Ga0496104_0058138 3300048907 Bacteria 3660
779 Ga0496104_0132483 3300048907 Unclassified 2394
780 Ga0496104_1270707 3300048907 Bacteria 639
781 Ga0496105_0006563 3300048908 Bacteria 8951
782 Ga0496105_0253056 3300048908 Bacteria 1426
783 Ga0496105_0579927 3300048908 Bacteria 872
784 Ga0496106_0000202 3300048909 Bacteria 41819
785 Ga0496106_0042328 3300048909 Bacteria 3416
786 Ga0496106_0173583 3300048909 Bacteria 1709
787 Ga0496107_0000066 3300048910 Bacteria 52207
788 Ga0496107_0074818 3300048910 Bacteria 2464
789 Ga0496107_0238732 3300048910 Unclassified 1352
790 Ga0496108_0009303 3300048911 Bacteria 7954
791 Ga0496108_0266257 3300048911 Bacteria 1491
792 Ga0496108_0354504 3300048911 Bacteria 1280
793 Ga0496108_1124738 3300048911 Unclassified 666
794 Ga0496109_0000595 3300048912 Bacteria 30262
795 Ga0496109_0024011 3300048912 Bacteria 5416
796 Ga0496109_0071247 3300048912 Unclassified 3190
797 Ga0496109_0117181 3300048912 Bacteria 2479
798 Ga0496109_0907720 3300048912 Bacteria 819
799 Ga0496110_0026354 3300048913 Bacteria 4973
800 Ga0496110_0187973 3300048913 Bacteria 1876
801 Ga0496110_0375595 3300048913 Bacteria 1295
802 Ga0496110_0694837 3300048913 Unclassified 918
803 Ga0496110_0998800 3300048913 Unclassified 744
804 Ga0496110_1439933 3300048913 Bacteria 598
805 Ga0496111_0111294 3300048914 Bacteria 2017
806 Ga0496111_0122303 3300048914 Bacteria 1922
807 Ga0496111_0795084 3300048914 Unclassified 685
808 Ga0496112_0068357 3300048915 Bacteria 3508
809 Ga0496112_0191248 3300048915 Bacteria 2009
810 Ga0496112_0216209 3300048915 Bacteria 1873
811 Ga0496112_0345944 3300048915 Bacteria 1430
812 Ga0496112_0584216 3300048915 Bacteria 1049
813 Ga0496112_1756306 3300048915 Bacteria 532
814 Ga0496113_0017489 3300048916 Bacteria 4977
815 Ga0496113_0110704 3300048916 Bacteria 2137
816 Ga0496113_1555826 3300048916 Bacteria 509
817 Ga0496114_0003763 3300048917 Bacteria 11696
818 Ga0496114_0032917 3300048917 Unclassified 4269
819 Ga0496114_1201037 3300048917 Unclassified 644
820 Ga0496115_0001197 3300048918 Bacteria 18589
821 Ga0496115_0286616 3300048918 Bacteria 1351
822 Ga0496115_0986787 3300048918 Unclassified 644
823 Ga0496115_1030232 3300048918 Unclassified 627
824 Ga0496125_0408489 3300048928 Unclassified 791
825 Ga0501031_0032901 3300049568 Bacteria 3381
826 Ga0501031_0215411 3300049568 Bacteria 1251
827 Ga0501032_0137729 3300049569 Bacteria 1608
828 Ga0501033_0102149 3300049570 Bacteria 2091
829 Ga0501033_1195642 3300049570 Unclassified 503
830 Ga0501034_0016864 3300049571 Bacteria 7489
831 Ga0501034_0019226 3300049571 Bacteria 6992
832 Ga0501034_0024657 3300049571 Bacteria 6116
833 Ga0501034_0069106 3300049571 Bacteria 3543
834 Ga0501034_0147992 3300049571 Bacteria 2325
835 Ga0501034_0243673 3300049571 Bacteria 1743
836 Ga0501034_0451423 3300049571 Bacteria 1203
837 Ga0501036_0000499 3300049572 Bacteria 28121
838 Ga0501036_0034109 3300049572 Bacteria 4304
839 Ga0501036_0117585 3300049572 Bacteria 2245
840 Ga0501036_0263546 3300049572 Bacteria 1443
841 Ga0501036_0432898 3300049572 Bacteria 1096
842 Ga0501037_0001469 3300049573 Bacteria 17284
843 Ga0501037_0027818 3300049573 Bacteria 4179
844 Ga0501037_0296534 3300049573 Bacteria 1123
845 Ga0501037_0337440 3300049573 Bacteria 1041
846 Ga0501038_0007219 3300049574 Bacteria 10263
847 Ga0501038_0031983 3300049574 Bacteria 4646
848 Ga0501038_0120091 3300049574 Bacteria 2169
849 Ga0501038_0127445 3300049574 Bacteria 2093
850 Ga0501039_0044518 3300049575 Bacteria 3428
851 Ga0501039_0103095 3300049575 Bacteria 2227
852 Ga0501041_0018919 3300049577 Bacteria 4104
853 Ga0501042_0041599 3300049578 Bacteria 3269
854 Ga0501042_0340503 3300049578 Bacteria 1084
855 Ga0501043_0013728 3300049579 Bacteria 6337
856 Ga0501043_0034880 3300049579 Bacteria 3957
857 Ga0501043_0071826 3300049579 Bacteria 2718
858 Ga0501043_0338896 3300049579 Bacteria 1144
859 Ga0501046_0162824 3300049580 Bacteria 1677
860 Ga0501046_0386763 3300049580 Bacteria 1012
861 Ga0501047_0004876 3300049581 Bacteria 12602
862 Ga0501047_0037297 3300049581 Bacteria 4700
863 Ga0501047_0148389 3300049581 Bacteria 2221
864 Ga0501047_0855428 3300049581 Bacteria 723
865 Ga0501047_1279639 3300049581 Bacteria 547
866 Ga0501048_0000256 3300049582 Bacteria 35566
867 Ga0501048_0275027 3300049582 Bacteria 1197
868 Ga0501048_0435954 3300049582 Bacteria 938
869 Ga0501048_0547103 3300049582 Bacteria 830
870 Ga0501048_0773617 3300049582 Bacteria 690
871 Ga0501067_0040264 3300049583 Bacteria 2596
872 Ga0501068_0028486 3300049584 Bacteria 3303
873 Ga0501068_0071123 3300049584 Bacteria 2123
874 Ga0501069_0023506 3300049585 Bacteria 3361
875 Ga0501069_0049875 3300049585 Bacteria 2327
876 Ga0501070_0047545 3300049586 Bacteria 3565
877 Ga0501070_0155338 3300049586 Bacteria 1886
878 Ga0501070_0246398 3300049586 Bacteria 1462
879 Ga0501070_0384653 3300049586 Bacteria 1136
880 Ga0501070_0951723 3300049586 Bacteria 668
881 Ga0501071_0011129 3300049587 Bacteria 6049
882 Ga0501072_0080556 3300049588 Bacteria 2580
883 Ga0501072_0676984 3300049588 Bacteria 811
884 Ga0501072_1522850 3300049588 Unclassified 516
885 Ga0501073_0006598 3300049589 Bacteria 8638
886 Ga0501073_0029982 3300049589 Bacteria 3885
887 Ga0501073_0038097 3300049589 Bacteria 3412
888 Ga0501073_0358835 3300049589 Bacteria 1006
889 Ga0501074_0015504 3300049590 Bacteria 5539
890 Ga0501074_0022972 3300049590 Bacteria 4536
891 Ga0501074_0024428 3300049590 Bacteria 4393
892 Ga0501074_0580375 3300049590 Bacteria 793
893 Ga0501074_0860202 3300049590 Bacteria 638
894 Ga0501075_0009305 3300049591 Bacteria 6875
895 Ga0501075_0168883 3300049591 Bacteria 1669
896 Ga0501076_0041602 3300049592 Bacteria 3616
897 Ga0501076_0381809 3300049592 Bacteria 1158
898 Ga0501077_0009748 3300049593 Bacteria 5973
899 Ga0501077_0416095 3300049593 Bacteria 860
900 Ga0501079_0003629 3300049741 Bacteria 11361
901 Ga0501079_0014491 3300049741 Bacteria 6011
902 Ga0501079_0030013 3300049741 Bacteria 4177
903 Ga0501079_0077391 3300049741 Bacteria 2573
904 Ga0501079_0640827 3300049741 Bacteria 837
905 Ga0501079_0663886 3300049741 Bacteria 821
906 Ga0501079_1579006 3300049741 Bacteria 516
907 Ga0501080_0004650 3300049742 Bacteria 12241
908 Ga0501080_0025085 3300049742 Bacteria 5532
909 Ga0501080_0103140 3300049742 Bacteria 2645
910 Ga0501080_0405265 3300049742 Bacteria 1226
911 Ga0501080_0882705 3300049742 Bacteria 780
912 Ga0501081_0001079 3300049743 Bacteria 16435
913 Ga0501081_0102415 3300049743 Bacteria 2025
914 Ga0501081_1307438 3300049743 Bacteria 550
915 Ga0501083_0034764 3300049744 Bacteria 3445
916 Ga0501083_0096860 3300049744 Bacteria 1947
917 Ga0501083_0116451 3300049744 Bacteria 1754
918 Ga0501083_0168299 3300049744 Bacteria 1433
919 Ga0501083_0890762 3300049744 Unclassified 579
920 Ga0501035_0023528 3300049822 Bacteria 5652
921 Ga0501035_0041186 3300049822 Bacteria 4171
922 Ga0501035_0063169 3300049822 Bacteria 3294
923 Ga0501035_0521965 3300049822 Bacteria 976
924 Ga0501035_0661745 3300049822 Bacteria 846
925 Ga0501044_0002125 3300049823 Bacteria 22744
926 Ga0501044_0008679 3300049823 Bacteria 11123
927 Ga0501044_0031400 3300049823 Bacteria 5591
928 Ga0501044_0123677 3300049823 Bacteria 2585
929 Ga0501044_0369256 3300049823 Bacteria 1351
930 Ga0501044_0707733 3300049823 Bacteria 892
931 Ga0501045_0127625 3300049824 Bacteria 1890
932 nmdc:mga03n38_115640_c1 3300050490 Bacteria 1312
933 nmdc:mga03n38_27245_c1 3300050490 Bacteria 2369
934 nmdc:mga03n38_399682_c1 3300050490 Bacteria 756
935 nmdc:mga03n38_412477_c1 3300050490 Bacteria 745
936 nmdc:mga00v17_155294_c1 3300050491 Bacteria 1471
937 nmdc:mga00v17_3029_c1 3300050491 Bacteria 8638
938 nmdc:mga0yw44_296849_c1 3300050492 Bacteria 1082
939 nmdc:mga0yw44_833269_c1 3300050492 Bacteria 626
940 nmdc:mga0k408_239891_c1 3300050493 Bacteria 627
941 nmdc:mga0k408_276835_c1 3300050493 Bacteria 1002
942 nmdc:mga0k408_48174_c1 3300050493 Bacteria 2465
943 nmdc:mga0k408_633758_c1 3300050493 Bacteria 629
944 nmdc:mga06z11_316723_c1 3300050494 Bacteria 930
945 nmdc:mga06z11_37907_c1 3300050494 Bacteria 2390
946 nmdc:mga06z11_94660_c1 3300050494 Bacteria 1628
947 nmdc:mga04h51_271192_c1 3300050495 Bacteria 685
948 nmdc:mga04h51_470880_c1 3300050495 Bacteria 534
949 nmdc:mga07m45_151233_c1 3300050496 Bacteria 789
950 nmdc:mga07m45_172351_c1 3300050496 Bacteria 1258
951 nmdc:mga07m45_198932_c1 3300050496 Bacteria 1165
952 nmdc:mga07m45_57179_c1 3300050496 Bacteria 2205
953 nmdc:mga05p37_1740_c1 3300050507 Bacteria 25419
954 nmdc:mga05p37_586_c1 3300050507 Bacteria 40050
955 nmdc:mga05p37_6524_c1 3300050507 Bacteria 13764
956 nmdc:mga09592_1232001_c1 3300050508 Bacteria 617
957 nmdc:mga09592_1499_c1 3300050508 Bacteria 18808
958 nmdc:mga09592_1648_c2 3300050508 Bacteria 13068
959 nmdc:mga09592_28653_c1 3300050508 Bacteria 4628
960 nmdc:mga0qj67_1143631_c1 3300050509 Unclassified 607
961 nmdc:mga0qj67_22813_c1 3300050509 Bacteria 4808
962 nmdc:mga0qj67_243692_c1 3300050509 Unclassified 1458
963 nmdc:mga0qj67_2505_c1 3300050509 Bacteria 13107
964 nmdc:mga0qj67_27401_c1 3300050509 Bacteria 4417
965 nmdc:mga06r32_125606_c1 3300050510 Bacteria 2534
966 nmdc:mga06r32_1344_c1 3300050510 Bacteria 22203
967 nmdc:mga06r32_474653_c1 3300050510 Bacteria 1229
968 nmdc:mga06r32_546_c1 3300050510 Bacteria 32690
969 nmdc:mga08y16_1229_c1 3300050511 Bacteria 25351
970 nmdc:mga08y16_1436_c1 3300050511 Bacteria 23871
971 nmdc:mga08y16_184393_c1 3300050511 Bacteria 2166
972 nmdc:mga08y16_301796_c1 3300050511 Bacteria 1650
973 nmdc:mga08y16_3164_c1 3300050511 Bacteria 17060
974 nmdc:mga0n895_140547_c1 3300050512 Unclassified 2443
975 nmdc:mga0n895_1689686_c1 3300050512 Bacteria 596
976 nmdc:mga0n895_216044_c1 3300050512 Bacteria 1947
977 nmdc:mga0n895_266_c1 3300050512 Bacteria 34104
978 nmdc:mga0n895_381_c1 3300050512 Bacteria 30014
979 nmdc:mga0n895_425224_c1 3300050512 Bacteria 1342
980 nmdc:mga0n895_61717_c1 3300050512 Bacteria 3702
981 nmdc:mga0rr50_1036263_c1 3300050513 Unclassified 699
982 nmdc:mga0rr50_113055_c1 3300050513 Unclassified 2151
983 nmdc:mga0rr50_160465_c1 3300050513 Bacteria 1824
984 nmdc:mga0rr50_309080_c1 3300050513 Bacteria 1324
985 nmdc:mga08x19_154970_c1 3300050514 Unclassified 1553
986 nmdc:mga08x19_24_c1 3300050514 Bacteria 245940
987 nmdc:mga08x19_64234_c1 3300050514 Bacteria 2383
988 nmdc:mga08x19_92073_c1 3300050514 Bacteria 2002
989 nmdc:mga0a205_1323_c1 3300050515 Bacteria 20896
990 nmdc:mga0a205_160962_c2 3300050515 Bacteria 1762
991 nmdc:mga0a205_35007_c1 3300050515 Bacteria 4822
992 nmdc:mga0a205_391341_c1 3300050515 Bacteria 1254
993 Ga0495601_0000003 3300053077 Bacteria 493642
994 Ga0495601_0038047 3300053077 Bacteria 3007
995 Ga0495601_0177997 3300053077 Bacteria 1390
996 Ga0495612_0000009 3300053078 Bacteria 229858
997 Ga0495612_0011957 3300053078 Bacteria 3498
998 Ga0495595_0000011 3300053084 Bacteria 174945
999 Ga0495595_0001186 3300053084 Bacteria 10128
1000 Ga0495595_0003151 3300053084 Bacteria 6539
1001 Ga0495619_0000009 3300053085 Bacteria 305595
1002 Ga0495619_0000266 3300053085 Bacteria 38066
1003 Ga0495619_0000480 3300053085 Bacteria 26747
1004 Ga0495619_0008444 3300053085 Bacteria 6511
1005 Ga0495619_0065459 3300053085 Unclassified 2425
1006 Ga0495619_0114837 3300053085 Unclassified 1842
1007 Ga0500562_006913 3300053108 Bacteria 2864
1008 Ga0500595_010769 3300053119 Bacteria 3615
1009 Ga0500616_0051286 3300053153 Bacteria 2175
1010 Ga0500616_0223204 3300053153 Bacteria 820
1011 Ga0500616_0229078 3300053153 Bacteria 805
1012 Ga0500616_0241942 3300053153 Bacteria 775
1013 Ga0501084_0021229 3300054114 Bacteria 5414
1014 Ga0501084_0045457 3300054114 Bacteria 3676
1015 Ga0501082_0009328 3300060353 Bacteria 8459
1016 Ga0501082_0010492 3300060353 Bacteria 7971
1017 Ga0501082_0176881 3300060353 Bacteria 1856
1018 Ga0501082_0434740 3300060353 Bacteria 1146
1019 Ga0501082_1162454 3300060353 Bacteria 674
1020 Ga0530510_0425742 3300061734 Bacteria 1002
1021 Ga0496100_0354327
1022 2214856897
1023 JGI24032J14994_100332
1024 JGI24736J21556_1004771
1025 JGI24741J21665_1010530
1026 JGI24752J21851_1002786
1027 JGI24746J21847_1000770
1028 JGI24747J21853_1001243
1029 JGI24739J22299_10001705
1030 JGI24737J22298_10000400
1031 JGI24743J22301_10003202
1032 JGI24750J21931_1000217
1033 JGI24745J21846_1000133
1034 JGI24748J21848_1007832
1035 JGI24738J21930_10000277
1036 JGI24749J21850_1000938
1037 JGI24744J21845_10000893
1038 JGI24035J26624_1001143
1039 JGI24033J26618_1000485
1040 JGI24034J26672_10008370
1041 JGI24742J22300_10002757
1042 JGI24751J29686_10009751
1043 JGI26129J50193_1007000
1044 JGI25405J52794_10036913
1045 Ga0065716_1020057
1046 Ga0065704_10433854
1047 Ga0065712_10016781
1048 Ga0065712_10071749
1049 Ga0065715_10001161
1050 Ga0065715_10057426
1051 Ga0065707_10097506
1052 Ga0070676_10000813
1053 Ga0070683_100000240
1054 Ga0070683_100176267
1055 Ga0070683_100330451
1056 Ga0070690_100000428
1057 Ga0070690_100296652
1058 Ga0070690_100387098
1059 Ga0070670_100005838
1060 Ga0070670_100390145
1061 Ga0070670_101156375
1062 Ga0070677_10000294
1063 Ga0068869_100000595
1064 Ga0068869_100371927
1065 Ga0070666_10017675
1066 Ga0070666_10104535
1067 Ga0070666_10205982
1068 Ga0070680_100568210
1069 Ga0070682_100000202
1070 Ga0070682_100026737
1071 Ga0070682_100546597
1072 Ga0068868_100000614
1073 Ga0068868_100820452
1074 Ga0070660_100000223
1075 Ga0070689_100000187
1076 Ga0070689_100450987
1077 Ga0070689_100484086
1078 Ga0070691_10277813
1079 Ga0070687_100000200
1080 Ga0070687_100214590
1081 Ga0070687_100912825
1082 Ga0070687_101168946
1083 Ga0070661_100000298
1084 Ga0070661_100493290
1085 Ga0070692_10000016
1086 Ga0070668_100428935
1087 Ga0070668_101600118
1088 Ga0070669_100001525
1089 Ga0070669_100111462
1090 Ga0070669_100125374
1091 Ga0070675_100000215
1092 Ga0070675_101108160
1093 Ga0070671_100000402
1094 Ga0070671_100060569
1095 Ga0070671_101750206
1096 Ga0070674_100000511
1097 Ga0070674_100006921
1098 Ga0070674_101510526
1099 Ga0070673_100000035
1100 Ga0070673_100172304
1101 Ga0070673_100431005
1102 Ga0070673_100587785
1103 Ga0070673_101052244
1104 Ga0070673_101179599
1105 Ga0070688_100000130
1106 Ga0070688_100182500
1107 Ga0070688_100516944
1108 Ga0070688_101457330
1109 Ga0070659_100003979
1110 Ga0070659_100627990
1111 Ga0070667_100000712
1112 Ga0070667_100117062
1113 Ga0070703_10008655
1114 Ga0070709_10186165
1115 Ga0070709_11101585
1116 Ga0070714_100040701
1117 Ga0070714_100156481
1118 Ga0070713_100081434
1119 Ga0070713_100342558
1120 Ga0070713_100614198
1121 Ga0070713_100970873
1122 Ga0070713_100978422
1123 Ga0070713_101040923
1124 Ga0070710_10020265
1125 Ga0070710_10544320
1126 Ga0070701_10000081
1127 Ga0070701_10187120
1128 Ga0070711_100061646
1129 Ga0070711_100076743
1130 Ga0070711_100477342
1131 Ga0070711_100684904
1132 Ga0070705_100002491
1133 Ga0070700_100001353
1134 Ga0070700_100719446
1135 Ga0070694_100000129
1136 Ga0070708_100007439
1137 Ga0070663_100001786
1138 Ga0070663_101361711
1139 Ga0070678_100010388
1140 Ga0070678_100012816
1141 Ga0070678_100023973
1142 Ga0070678_100029790
1143 Ga0070662_100000933
1144 Ga0070662_100164222
1145 Ga0070662_100656567
1146 Ga0070662_101648905
1147 Ga0070681_10001286
1148 Ga0070681_12049975
1149 Ga0068867_100000369
1150 Ga0070685_10001791
1151 Ga0070685_10049852
1152 Ga0070685_10182056
1153 Ga0070685_11131363
1154 Ga0070679_100000553
1155 Ga0070679_100039247
1156 Ga0070684_100000246
1157 Ga0070684_100038423
1158 Ga0070697_100343559
1159 Ga0070697_100811724
1160 Ga0068853_100002121
1161 Ga0068853_100545567
1162 Ga0068853_101032569
1163 Ga0070672_100000157
1164 Ga0070672_100290140
1165 Ga0070686_100000260
1166 Ga0070695_100009157
1167 Ga0070696_100006359
1168 Ga0070696_100267392
1169 Ga0070693_100009423
1170 Ga0070693_100642150
1171 Ga0070665_100014837
1172 Ga0070665_101146719
1173 Ga0070704_100000171
1174 Ga0070704_101425650
1175 Ga0068855_100005012
1176 Ga0070664_100000269
1177 Ga0070664_100293293
1178 Ga0070664_100738133
1179 Ga0068857_100000174
1180 Ga0068857_100282150
1181 Ga0068857_101054664
1182 Ga0068854_100000211
1183 Ga0068856_100000600
1184 Ga0068856_100598569
1185 Ga0068856_101863969
1186 Ga0070702_100000312
1187 Ga0070702_100072607
1188 Ga0070702_101450997
1189 Ga0068852_100003615
1190 Ga0068859_100000894
1191 Ga0068859_100404264
1192 Ga0068859_100487381
1193 Ga0068859_100553731
1194 Ga0068859_100563362
1195 Ga0068864_100000329
1196 Ga0068864_100227774
1197 Ga0068866_10341182
1198 Ga0068870_10000056
1199 Ga0068870_10243906
1200 Ga0068863_100000278
1201 Ga0068863_100198453
1202 Ga0068863_100590603
1203 Ga0068858_100001048
1204 Ga0068858_100182355
1205 Ga0068858_100243060
1206 Ga0068858_100817437
1207 Ga0068858_101282022
1208 Ga0068860_100000985
1209 Ga0068860_100223025
1210 Ga0068862_100000593
1211 Ga0068862_100477351
1212 Ga0081455_10114341
1213 Ga0081540_1000008
1214 Ga0070717_10289983
1215 Ga0070717_10331433
1216 Ga0070717_10610210
1217 Ga0075365_10979706
1218 Ga0075363_100634200
1219 Ga0075363_100655442
1220 Ga0075364_10035141
1221 Ga0075364_10071044
1222 Ga0075432_10000435
1223 Ga0070715_10007119
1224 Ga0070712_100459829
1225 Ga0075362_10005903
1226 Ga0075367_10047325
1227 Ga0075367_10150782
1228 Ga0075367_10256697
1229 Ga0075367_10788310
1230 Ga0075427_10000061
1231 Ga0075366_10016041
1232 Ga0075366_10073912
1233 Ga0075366_10554471
1234 Ga0075366_10713402
1235 Ga0075366_10882959
1236 Ga0097621_100000504
1237 Ga0097621_100779752
1238 Ga0097621_101025508
1239 Ga0075370_10091733
1240 Ga0075370_10478118
1241 Ga0068871_100000815
1242 Ga0068871_100070338
1243 Ga0068871_100076484
1244 Ga0075428_100001096
1245 Ga0075428_100001439
1246 Ga0075430_100001275
1247 Ga0075430_100061302
1248 Ga0075430_100640127
1249 Ga0075431_100006467
1250 Ga0075431_100011265
1251 Ga0075431_100467799
1252 Ga0075431_101225776
1253 Ga0075433_10011448
1254 Ga0075433_10062959
1255 Ga0075433_10328397
1256 Ga0075433_11444506
1257 Ga0075434_100000244
1258 Ga0075434_100007451
1259 Ga0075434_100262160
1260 Ga0075429_100000388
1261 Ga0075429_100004065
1262 Ga0075429_101006317
1263 Ga0075429_101405896
1264 Ga0075436_100105119
1265 Ga0075436_100166843
1266 Ga0075436_100259095
1267 Ga0075436_100457545
1268 Ga0075436_100688626
1269 Ga0097620_100000894
1270 Ga0097620_100404243
1271 Ga0097620_100487484
1272 Ga0097620_100553730
1273 Ga0097620_100563363
1274 Ga0075435_100223748
1275 Ga0075435_100296359
1276 Ga0075435_100488950
1277 Ga0075435_100497848
1278 Ga0075435_101353843
1279 Ga0099795_10009067
1280 Ga0105251_10060586
1281 Ga0105251_10143611
1282 Ga0105250_10444335
1283 Ga0105240_10016606
1284 Ga0105240_10170530
1285 Ga0105240_11697185
1286 Ga0111539_10000835
1287 Ga0111539_10001076
1288 Ga0111539_10002315
1289 Ga0111539_10105140
1290 Ga0111539_10172234
1291 Ga0105245_10000451
1292 Ga0105245_10039669
1293 Ga0105245_10580552
1294 Ga0105247_10001016
1295 Ga0105247_10015781
1296 Ga0105247_10236818
1297 Ga0114129_10003642
1298 Ga0114129_10005725
1299 Ga0114129_10006438
1300 Ga0114129_10690800
1301 Ga0114129_11055913
1302 Ga0114129_11188478
1303 Ga0105243_10002173
1304 Ga0105243_10105337
1305 Ga0105243_10157922
1306 Ga0105241_10001549
1307 Ga0105241_10242485
1308 Ga0105242_10000947
1309 Ga0105242_10058894
1310 Ga0105242_10229439
1311 Ga0105248_10000837
1312 Ga0105237_10022344
1313 Ga0105237_10416353
1314 Ga0105238_10102115
1315 Ga0105238_10255872
1316 Ga0105238_10933194
1317 Ga0105249_10000976
1318 Ga0105249_10298822
1319 Ga0105249_10387154
1320 Ga0099796_10017285
1321 Ga0105239_10040227
1322 Ga0105239_10348910
1323 Ga0105239_10895094
1324 Ga0105239_11955925
1325 Ga0105246_10000100
1326 Ga0105246_10262932
1327 Ga0157325_1022502
1328 Ga0157315_1003623
1329 Ga0157316_1007613
1330 Ga0157326_1025419
1331 Ga0157373_10125461
1332 Ga0157371_10001676
1333 Ga0157371_11018007
1334 Ga0157370_10264187
1335 Ga0157374_10000956
1336 Ga0157374_10231659
1337 Ga0157374_10491830
1338 Ga0157374_10526487
1339 Ga0157378_10001544
1340 Ga0157378_10126320
1341 Ga0157378_10729447
1342 Ga0163162_12556632
1343 Ga0157372_10026270
1344 Ga0157375_10000464
1345 Ga0157375_10232409
1346 Ga0157375_10364612
1347 Ga0163163_10003318
1348 Ga0157380_10000145
1349 Ga0157380_11689294
1350 Ga0157377_10000179
1351 Ga0157379_10000067
1352 Ga0157379_10164378
1353 Ga0157379_11518984
1354 Ga0157376_10023037
1355 Ga0157376_10244829
1356 Ga0157376_11715251
1357 Ga0163161_10001462
1358 Ga0163161_10050492
1359 Ga0163161_10407560
1360 Ga0213876_10176105
1361 Ga0209233_1004623
1362 Ga0207666_1000002
1363 Ga0207673_1000015
1364 Ga0207697_10000113
1365 Ga0207697_10085892
1366 Ga0207713_1102851
1367 Ga0207653_10001270
1368 Ga0207682_10000094
1369 Ga0207682_10001641
1370 Ga0207642_10000337
1371 Ga0207710_10000795
1372 Ga0207710_10004197
1373 Ga0207710_10022043
1374 Ga0207688_10000074
1375 Ga0207688_10057634
1376 Ga0207688_10200449
1377 Ga0207680_10010896
1378 Ga0207680_10363425
1379 Ga0207680_11187744
1380 Ga0207647_10000218
1381 Ga0207685_10004360
1382 Ga0207685_10036665
1383 Ga0207699_10206091
1384 Ga0207699_10655603
1385 Ga0207645_10000247
1386 Ga0207645_10042103
1387 Ga0207643_10000004
1388 Ga0207643_10299968
1389 Ga0207654_10000627
1390 Ga0207654_10117741
1391 Ga0207707_10000618
1392 Ga0207695_10030828
1393 Ga0207671_10011571
1394 Ga0207671_10432590
1395 Ga0207693_10011262
1396 Ga0207693_10344841
1397 Ga0207663_10119004
1398 Ga0207663_10605393
1399 Ga0207663_11061123
1400 Ga0207663_11320139
1401 Ga0207660_10000741
1402 Ga0207660_10232039
1403 Ga0207660_10569458
1404 Ga0207662_10000119
1405 Ga0207662_10090731
1406 Ga0207662_10349438
1407 Ga0207662_10454914
1408 Ga0207657_10000316
1409 Ga0207649_10000090
1410 Ga0207652_10000847
1411 Ga0207652_10049716
1412 Ga0207681_10000370
1413 Ga0207681_10080489
1414 Ga0207681_10170983
1415 Ga0207694_10100847
1416 Ga0207694_10129130
1417 Ga0207694_10193007
1418 Ga0207650_10008243
1419 Ga0207650_10521824
1420 Ga0207659_10000038
1421 Ga0207659_10880873
1422 Ga0207687_10000784
1423 Ga0207687_10265708
1424 Ga0207687_10308593
1425 Ga0207700_10187315
1426 Ga0207700_10256142
1427 Ga0207700_10312074
1428 Ga0207700_10934574
1429 Ga0207664_10134950
1430 Ga0207664_10631794
1431 Ga0207644_10001053
1432 Ga0207644_10182832
1433 Ga0207644_10514755
1434 Ga0207690_10000239
1435 Ga0207690_10183222
1436 Ga0207690_10566048
1437 Ga0207706_10000424
1438 Ga0207706_10050735
1439 Ga0207706_10193010
1440 Ga0207706_10468322
1441 Ga0207706_10875861
1442 Ga0207686_10001203
1443 Ga0207686_10170038
1444 Ga0207709_10000379
1445 Ga0207709_10071000
1446 Ga0207709_10383642
1447 Ga0207670_10000176
1448 Ga0207669_10000165
1449 Ga0207669_10057031
1450 Ga0207669_10194341
1451 Ga0207669_11419668
1452 Ga0207704_10001709
1453 Ga0207704_10037612
1454 Ga0207704_10750806
1455 Ga0207665_10114251
1456 Ga0207665_10364748
1457 Ga0207665_10829070
1458 Ga0207691_10000358
1459 Ga0207691_10030388
1460 Ga0207711_10000780
1461 Ga0207711_10123112
1462 Ga0207689_10000479
1463 Ga0207689_10013531
1464 Ga0207661_10000604
1465 Ga0207661_10146928
1466 Ga0207661_11645855
1467 Ga0207679_10000139
1468 Ga0207679_10846709
1469 Ga0207667_10003492
1470 Ga0207667_11046741
1471 Ga0207651_10000072
1472 Ga0207651_10073755
1473 Ga0207651_10293347
1474 Ga0207651_10573620
1475 Ga0207712_10000588
1476 Ga0207712_10735930
1477 Ga0207712_10951283
1478 Ga0207668_10000168
1479 Ga0207668_10070576
1480 Ga0207668_10583842
1481 Ga0207668_11014867
1482 Ga0207640_10000242
1483 Ga0207640_12096931
1484 Ga0207658_10000667
1485 Ga0207677_10004440
1486 Ga0207703_10000463
1487 Ga0207703_10147628
1488 Ga0207703_10965194
1489 Ga0207703_12043524
1490 Ga0207639_10002404
1491 Ga0207678_10000447
1492 Ga0207678_10025607
1493 Ga0207708_10000293
1494 Ga0207708_10167148
1495 Ga0207708_10977867
1496 Ga0207702_10007213
1497 Ga0207702_10501576
1498 Ga0207641_10000724
1499 Ga0207641_10876642
1500 Ga0207641_11028329
1501 Ga0207648_10000223
1502 Ga0207648_10404594
1503 Ga0207648_10418586
1504 Ga0207676_10000392
1505 Ga0207674_10000955
1506 Ga0207674_10203822
1507 Ga0207674_10945629
1508 Ga0207675_100000364
1509 Ga0207675_100537267
1510 Ga0207675_101020457
1511 Ga0207683_10000397
1512 Ga0207683_10015258
1513 Ga0207683_10033226
1514 Ga0207698_10003705
1515 Ga0209973_1016160
1516 Ga0209996_1018694
1517 Ga0209984_1012090
1518 Ga0210002_1001181
1519 Ga0209971_1037562
1520 Ga0209998_10000535
1521 Ga0209813_10239612
1522 Ga0209813_10435923
1523 Ga0209974_10001185
1524 Ga0207428_10000272
1525 Ga0207428_10000439
1526 Ga0207428_10016728
1527 Ga0207428_10620227
1528 Ga0268266_10008599
1529 Ga0268265_10002666
1530 Ga0268265_10068403
1531 Ga0268265_10681146
1532 Ga0268264_10000890
1533 Ga0265760_10135921
1534 Ga0265325_10000019
1535 Ga0265325_10045188
1536 Ga0265325_10275903
1537 Ga0265340_10023297
1538 Ga0307408_101817597
1539 Ga0265313_10004790
1540 Ga0265314_10000577
1541 Ga0316576_10255584
1542 Ga0307405_10644535
1543 Ga0307409_100305577
1544 Ga0307416_102768684
1545 Ga0307415_100540982
1546 Ga0373930_0008163
1547 Ga0373930_0040686
1548 Ga0373948_0023739
1549 Ga0373950_0005260
1550 Ga0373950_0020954
1551 Ga0373958_0008288
1552 Ga0373959_0009193
1553 Ga0373959_0040869
1554 Ga0373938_0000801
1555 Ga0373938_0004620
1556 Ga0373926_0030151
1557 Ga0373928_0008041
1558 Ga0373928_0106569
1559 Ga0373929_0026251
1560 Ga0373934_0029917
1561 Ga0373934_0131661
1562 Ga0373940_0024844
1563 Ga0373944_0005312
1564 Ga0373944_0254141
1565 Ga0373949_0005655
1566 Ga0373949_0015968
1567 Ga0373951_0004903
1568 Ga0373951_0005568
1569 Ga0373952_0000491
1570 Ga0373952_0069200
1571 Ga0373923_0001791
1572 Ga0373923_0135138
1573 Ga0373923_0252043
1574 Ga0373923_0454255
1575 Ga0373932_0010270
1576 Ga0373936_0059436
1577 Ga0373939_0000671
1578 Ga0373939_0158875
1579 Ga0373941_0002421
1580 Ga0373941_0002853
1581 Ga0373945_0047206
1582 Ga0373945_0058782
1583 Ga0373945_0176927
1584 Ga0373953_0003123
1585 Ga0373953_0203063
1586 Ga0373954_0010232
1587 Ga0373954_0027582
1588 Ga0373954_0037490
1589 Ga0373957_0005354
1590 Ga0373957_0005745
1591 Ga0373960_0001077
1592 Ga0373960_0023438
1593 Ga0373960_0323101
1594 Ga0373943_0000417
1595 Ga0373943_0013438
1596 Ga0373946_0001306
1597 Ga0373946_0005513
1598 Ga0373946_0019410
1599 Ga0373946_0061121
1600 Ga0373955_0002670
1601 Ga0373955_0007047
1602 Ga0373955_0012099
1603 Ga0373942_0011858
1604 Ga0373942_0017682
1605 Ga0373961_0005861
1606 Ga0373962_0001390
1607 Ga0373962_0020639
1608 Ga0316574_0033601
1609 Ga0373924_0002381
1610 Ga0373924_0017622
1611 Ga0373931_0000089
1612 Ga0373931_0022029
1613 Ga0373935_0000037
1614 Ga0373935_0015408
1615 Ga0373935_0026462
1616 Ga0373935_0175304
1617 Ga0373927_0000700
1618 Ga0373927_0044985
1619 Ga0373927_0241634
1620 Ga0373933_0001535
1621 Ga0373933_0013152
1622 Ga0373933_0013294
1623 Ga0373933_0951591
1624 Ga0373947_0000333
1625 Ga0373947_0007823
1626 Ga0373947_0122291
1627 Ga0373947_0652924
1628 Ga0373937_0000018
1629 Ga0373937_0001938
1630 Ga0373937_0007486
1631 Ga0373937_0158069
1632 Ga0373937_1589427
1633 Ga0316584_0037455
1634 Ga0373925_0003079
1635 Ga0373925_0004485
1636 Ga0373925_0020402
1637 Ga0436364_0246124
1638 Ga0436364_0741110
1639 Ga0436365_1346123
1640 Ga0436365_1822239
1641 Ga0436360_0159932
1642 Ga0436361_0031041
1643 Ga0451800_0770855
1644 Ga0451804_0516851
1645 Ga0451577_1680239
1646 Ga0466967_0928838
1647 Ga0495592_0000055
1648 Ga0495592_0056360
1649 Ga0495603_0051326
1650 Ga0495603_0726683
1651 Ga0495629_0000715
1652 Ga0495629_0004595
1653 Ga0495629_0018872
1654 Ga0495629_0024418
1655 Ga0495629_0091826
1656 Ga0495629_0200721
1657 Ga0495641_0247329
1658 Ga0495651_0000210
1659 Ga0495651_0000469
1660 Ga0495651_0004620
1661 Ga0495653_0000003
1662 Ga0495653_0000528
1663 Ga0495653_0001294
1664 Ga0495580_0220080
1665 Ga0495580_0612863
1666 Ga0495582_0004541
1667 Ga0495582_0019173
1668 Ga0495605_0085040
1669 Ga0495639_0044935
1670 Ga0495639_0087214
1671 Ga0495662_0002357
1672 Ga0495662_0175453
1673 Ga0495662_0215187
1674 Ga0495664_0000001
1675 Ga0495664_0002815
1676 Ga0495664_0020851
1677 Ga0495584_0211306
1678 Ga0495594_0218359
1679 Ga0495608_0000012
1680 Ga0495608_0052498
1681 Ga0495608_0410299
1682 Ga0495618_0000012
1683 Ga0495618_0004183
1684 Ga0495618_0025548
1685 Ga0495618_0077712
1686 Ga0495628_0000003
1687 Ga0495628_0059123
1688 Ga0495630_0000188
1689 Ga0495630_0009769
1690 Ga0495630_0106021
1691 Ga0495666_0042911
1692 Ga0495652_0000001
1693 Ga0495652_0007567
1694 Ga0495665_0085041
1695 Ga0495665_0313586
1696 Ga0495640_0000022
1697 Ga0495640_0004486
1698 Ga0495640_0017063
1699 Ga0495640_0024843
1700 Ga0495640_0457418
1701 Ga0495586_0064814
1702 Ga0495586_0279639
1703 Ga0495586_0296414
1704 Ga0495587_0000003
1705 Ga0495587_0006458
1706 Ga0495587_0007819
1707 Ga0495598_0171847
1708 Ga0495609_0085018
1709 Ga0495621_0046407
1710 Ga0495645_0000004
1711 Ga0495645_0045284
1712 Ga0495645_0137530
1713 Ga0495667_0000001
1714 Ga0495667_0002575
1715 Ga0495667_0008025
1716 Ga0495634_0000012
1717 Ga0495634_0005822
1718 Ga0495634_0023237
1719 Ga0495634_0043987
1720 Ga0495625_0341665
1721 Ga0495635_0000011
1722 Ga0495635_0010126
1723 Ga0495635_0021148
1724 Ga0495635_0251842
1725 Ga0495635_0767855
1726 Ga0495588_0101284
1727 Ga0495657_0000086
1728 Ga0495657_0004107
1729 Ga0495657_0163989
1730 Ga0495599_0000004
1731 Ga0495599_0026597
1732 Ga0495599_0068271
1733 Ga0495623_0000044
1734 Ga0495623_0001286
1735 Ga0495623_0146057
1736 Ga0495646_0000010
1737 Ga0495646_0002714
1738 Ga0495646_0023303
1739 Ga0495647_0543163
1740 Ga0495658_0004603
1741 Ga0495669_0202376
1742 Ga0495613_0006333
1743 Ga0495613_0029810
1744 Ga0495613_0057372
1745 Ga0495613_0442717
1746 Ga0495624_0035675
1747 Ga0495624_0072494
1748 Ga0495624_0085440
1749 Ga0495624_0224708
1750 Ga0495600_0000026
1751 Ga0495600_0013079
1752 Ga0495600_0051085
1753 Ga0495581_0011911
1754 Ga0495581_0052904
1755 Ga0495581_0064733
1756 Ga0495604_0000010
1757 Ga0495604_0000186
1758 Ga0495604_0008654
1759 Ga0495674_0000001
1760 Ga0495674_0041939
1761 Ga0495674_0207135
1762 Ga0495674_0701794
1763 Ga0495676_0062812
1764 Ga0495676_0117646
1765 Ga0495680_0000527
1766 Ga0495680_0010600
1767 Ga0495680_0034946
1768 Ga0495680_0050611
1769 Ga0495675_0000009
1770 Ga0495675_0005457
1771 Ga0495675_0014129
1772 Ga0495684_0000005
1773 Ga0495684_0002670
1774 Ga0495684_0014505
1775 Ga0495684_0060437
1776 Ga0495684_0192799
1777 Ga0495593_0002803
1778 Ga0495593_0008599
1779 Ga0495593_0023096
1780 Ga0495593_0024339
1781 Ga0495602_0000002
1782 Ga0495602_0004101
1783 Ga0495614_0111023
1784 Ga0496100_0000200
1785 Ga0496100_0114661
1786 Ga0496100_0179265
1787 Ga0496101_0000339
1788 Ga0496101_0003678
1789 Ga0496102_0000729
1790 Ga0496102_0461011
1791 Ga0496102_1759116
1792 Ga0496102_1763337
1793 Ga0496103_0001639
1794 Ga0496103_0131869
1795 Ga0496103_0144988
1796 Ga0496104_0025091
1797 Ga0496104_0051617
1798 Ga0496104_0058138
1799 Ga0496104_0132483
1800 Ga0496104_1270707
1801 Ga0496105_0006563
1802 Ga0496105_0253056
1803 Ga0496105_0579927
1804 Ga0496106_0000202
1805 Ga0496106_0042328
1806 Ga0496106_0173583
1807 Ga0496107_0000066
1808 Ga0496107_0074818
1809 Ga0496107_0238732
1810 Ga0496108_0009303
1811 Ga0496108_0266257
1812 Ga0496108_0354504
1813 Ga0496108_1124738
1814 Ga0496109_0000595
1815 Ga0496109_0024011
1816 Ga0496109_0071247
1817 Ga0496109_0117181
1818 Ga0496109_0907720
1819 Ga0496110_0026354
1820 Ga0496110_0187973
1821 Ga0496110_0375595
1822 Ga0496110_0694837
1823 Ga0496110_0998800
1824 Ga0496110_1439933
1825 Ga0496111_0111294
1826 Ga0496111_0122303
1827 Ga0496111_0795084
1828 Ga0496112_0068357
1829 Ga0496112_0191248
1830 Ga0496112_0216209
1831 Ga0496112_0345944
1832 Ga0496112_0584216
1833 Ga0496112_1756306
1834 Ga0496113_0017489
1835 Ga0496113_0110704
1836 Ga0496113_1555826
1837 Ga0496114_0003763
1838 Ga0496114_0032917
1839 Ga0496114_1201037
1840 Ga0496115_0001197
1841 Ga0496115_0286616
1842 Ga0496115_0986787
1843 Ga0496115_1030232
1844 Ga0496125_0408489
1845 Ga0501031_0032901
1846 Ga0501031_0215411
1847 Ga0501032_0137729
1848 Ga0501033_0102149
1849 Ga0501033_1195642
1850 Ga0501034_0016864
1851 Ga0501034_0019226
1852 Ga0501034_0024657
1853 Ga0501034_0069106
1854 Ga0501034_0147992
1855 Ga0501034_0243673
1856 Ga0501034_0451423
1857 Ga0501036_0000499
1858 Ga0501036_0034109
1859 Ga0501036_0117585
1860 Ga0501036_0263546
1861 Ga0501036_0432898
1862 Ga0501037_0001469
1863 Ga0501037_0027818
1864 Ga0501037_0296534
1865 Ga0501037_0337440
1866 Ga0501038_0007219
1867 Ga0501038_0031983
1868 Ga0501038_0120091
1869 Ga0501038_0127445
1870 Ga0501039_0044518
1871 Ga0501039_0103095
1872 Ga0501041_0018919
1873 Ga0501042_0041599
1874 Ga0501042_0340503
1875 Ga0501043_0013728
1876 Ga0501043_0034880
1877 Ga0501043_0071826
1878 Ga0501043_0338896
1879 Ga0501046_0162824
1880 Ga0501046_0386763
1881 Ga0501047_0004876
1882 Ga0501047_0037297
1883 Ga0501047_0148389
1884 Ga0501047_0855428
1885 Ga0501047_1279639
1886 Ga0501048_0000256
1887 Ga0501048_0275027
1888 Ga0501048_0435954
1889 Ga0501048_0547103
1890 Ga0501048_0773617
1891 Ga0501067_0040264
1892 Ga0501068_0028486
1893 Ga0501068_0071123
1894 Ga0501069_0023506
1895 Ga0501069_0049875
1896 Ga0501070_0047545
1897 Ga0501070_0155338
1898 Ga0501070_0246398
1899 Ga0501070_0384653
1900 Ga0501070_0951723
1901 Ga0501071_0011129
1902 Ga0501072_0080556
1903 Ga0501072_0676984
1904 Ga0501072_1522850
1905 Ga0501073_0006598
1906 Ga0501073_0029982
1907 Ga0501073_0038097
1908 Ga0501073_0358835
1909 Ga0501074_0015504
1910 Ga0501074_0022972
1911 Ga0501074_0024428
1912 Ga0501074_0580375
1913 Ga0501074_0860202
1914 Ga0501075_0009305
1915 Ga0501075_0168883
1916 Ga0501076_0041602
1917 Ga0501076_0381809
1918 Ga0501077_0009748
1919 Ga0501077_0416095
1920 Ga0501079_0003629
1921 Ga0501079_0014491
1922 Ga0501079_0030013
1923 Ga0501079_0077391
1924 Ga0501079_0640827
1925 Ga0501079_0663886
1926 Ga0501079_1579006
1927 Ga0501080_0004650
1928 Ga0501080_0025085
1929 Ga0501080_0103140
1930 Ga0501080_0405265
1931 Ga0501080_0882705
1932 Ga0501081_0001079
1933 Ga0501081_0102415
1934 Ga0501081_1307438
1935 Ga0501083_0034764
1936 Ga0501083_0096860
1937 Ga0501083_0116451
1938 Ga0501083_0168299
1939 Ga0501083_0890762
1940 Ga0501035_0023528
1941 Ga0501035_0041186
1942 Ga0501035_0063169
1943 Ga0501035_0521965
1944 Ga0501035_0661745
1945 Ga0501044_0002125
1946 Ga0501044_0008679
1947 Ga0501044_0031400
1948 Ga0501044_0123677
1949 Ga0501044_0369256
1950 Ga0501044_0707733
1951 Ga0501045_0127625
1952 nmdc:mga03n38_115640_c1
1953 nmdc:mga03n38_27245_c1
1954 nmdc:mga03n38_399682_c1
1955 nmdc:mga03n38_412477_c1
1956 nmdc:mga00v17_155294_c1
1957 nmdc:mga00v17_3029_c1
1958 nmdc:mga0yw44_296849_c1
1959 nmdc:mga0yw44_833269_c1
1960 nmdc:mga0k408_239891_c1
1961 nmdc:mga0k408_276835_c1
1962 nmdc:mga0k408_48174_c1
1963 nmdc:mga0k408_633758_c1
1964 nmdc:mga06z11_316723_c1
1965 nmdc:mga06z11_37907_c1
1966 nmdc:mga06z11_94660_c1
1967 nmdc:mga04h51_271192_c1
1968 nmdc:mga04h51_470880_c1
1969 nmdc:mga07m45_151233_c1
1970 nmdc:mga07m45_172351_c1
1971 nmdc:mga07m45_198932_c1
1972 nmdc:mga07m45_57179_c1
1973 nmdc:mga05p37_1740_c1
1974 nmdc:mga05p37_586_c1
1975 nmdc:mga05p37_6524_c1
1976 nmdc:mga09592_1232001_c1
1977 nmdc:mga09592_1499_c1
1978 nmdc:mga09592_1648_c2
1979 nmdc:mga09592_28653_c1
1980 nmdc:mga0qj67_1143631_c1
1981 nmdc:mga0qj67_22813_c1
1982 nmdc:mga0qj67_243692_c1
1983 nmdc:mga0qj67_2505_c1
1984 nmdc:mga0qj67_27401_c1
1985 nmdc:mga06r32_125606_c1
1986 nmdc:mga06r32_1344_c1
1987 nmdc:mga06r32_474653_c1
1988 nmdc:mga06r32_546_c1
1989 nmdc:mga08y16_1229_c1
1990 nmdc:mga08y16_1436_c1
1991 nmdc:mga08y16_184393_c1
1992 nmdc:mga08y16_301796_c1
1993 nmdc:mga08y16_3164_c1
1994 nmdc:mga0n895_140547_c1
1995 nmdc:mga0n895_1689686_c1
1996 nmdc:mga0n895_216044_c1
1997 nmdc:mga0n895_266_c1
1998 nmdc:mga0n895_381_c1
1999 nmdc:mga0n895_425224_c1
2000 nmdc:mga0n895_61717_c1
2001 nmdc:mga0rr50_1036263_c1
2002 nmdc:mga0rr50_113055_c1
2003 nmdc:mga0rr50_160465_c1
2004 nmdc:mga0rr50_309080_c1
2005 nmdc:mga08x19_154970_c1
2006 nmdc:mga08x19_24_c1
2007 nmdc:mga08x19_64234_c1
2008 nmdc:mga08x19_92073_c1
2009 nmdc:mga0a205_1323_c1
2010 nmdc:mga0a205_160962_c2
2011 nmdc:mga0a205_35007_c1
2012 nmdc:mga0a205_391341_c1
2013 Ga0495601_0000003
2014 Ga0495601_0038047
2015 Ga0495601_0177997
2016 Ga0495612_0000009
2017 Ga0495612_0011957
2018 Ga0495595_0000011
2019 Ga0495595_0001186
2020 Ga0495595_0003151
2021 Ga0495619_0000009
2022 Ga0495619_0000266
2023 Ga0495619_0000480
2024 Ga0495619_0008444
2025 Ga0495619_0065459
2026 Ga0495619_0114837
2027 Ga0500562_006913
2028 Ga0500595_010769
2029 Ga0500616_0051286
2030 Ga0500616_0223204
2031 Ga0500616_0229078
2032 Ga0500616_0241942
2033 Ga0501084_0021229
2034 Ga0501084_0045457
2035 Ga0501082_0009328
2036 Ga0501082_0010492
2037 Ga0501082_0176881
2038 Ga0501082_0434740
2039 Ga0501082_1162454
2040 Ga0530510_0425742

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06155

GBBH-like_N

Gamma-butyrobetaine hydroxylase-like, N-terminal

42

126

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3luu-assembly1.cif.gz_A crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution 0.9241 8 98
2l6p-assembly1.cif.gz_A nmr solution structure of the protein np_253742.1 0.8709 4 123
2l6n-assembly1.cif.gz_A nmr solution structure of the protein yp_001092504.1 0.8667 1 121
5tul-assembly1.cif.gz_A crystal structure of tetracycline destructase tet(55) 0.8571 6 34
3luu-assembly1.cif.gz_A crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution 0.8354 8 98
ID Description Score Start End Superfamily
af_A4I040_171_337_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.949 8 33 2.110.10.10
af_Q4DG53_507_629_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.9448 8 33 2.40.128.630
af_Q9H1Z4_260_485_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9312 8 33 2.130.10.10
3luuA00 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.9177 8 98 3.30.2020.30
af_Q9P2S5_129_291_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.9149 8 33 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A7J7PTC3-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9639 55 125 GO:0046872
AF-A0A2E0VJM5-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9565 7 122 GO:0016853
GO:0046872
AF-A0A0H5BNS4-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9541 1 125 GO:0046872
AF-A0A840XW67-F1-model_v4 DUF971 family protein 0.9532 6 125 GO:0046872
AF-A0A3B9TVQ7-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9524 54 119 GO:0046872

Map