F488379
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1020 | 431 | 2040 | 286 |
Family's Representative Sequence
| Representative Sequence | 3300048928|Ga0496125_0017767|Ga0496125_0017767_3860_4867 |
| Length | 335 |
| Sequence | MKTIIKCRLRPSVDLALSTMPGSVYLSHQRVPERLRPLEGNPVMRLCTSAIALVVGLLVNPGAHASELPQRWVSAGGALTEWVVALGGESTLVGVDTTSQHPESVKALPSIGYQRQLSAEGILSLRPQVLIGTEEMGPPPVLAQVRGAGVQVEMFSAQADLPTLKGNLEHLGKLLGNEAKARRLFSGYEQALNQQKSAVVKAQTTQQAPGVLLLLGHAGGKPLIAGKDTAADWLLQQAGGHNLATHTGYKPFSAESLAGLSPDVLVFADRALTGEAARAALFKENPILAATPAAKNGRVVELDPTLLVGGLGPRLPQSLVKLSAGFYPSQAESAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 28 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 29 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 30 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 31 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 32 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 33 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 42 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 51 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 56 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 66 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 86 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 87 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 90 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 91 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 92 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 93 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 94 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 95 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 96 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 97 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 99 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 100 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 101 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 102 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 106 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 107 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 108 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 109 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 110 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 111 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 112 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 113 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 114 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 115 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 116 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 117 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 118 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 119 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 120 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 121 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 122 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 123 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 124 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 125 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 126 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 127 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 128 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 129 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 130 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 131 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 132 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 133 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 134 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 135 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 136 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 137 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 138 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 139 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 140 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 141 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 142 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 215 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 216 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 217 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 218 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 219 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 220 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 221 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 222 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 223 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 224 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 225 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 229 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 230 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 231 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 232 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 233 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 234 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 235 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 236 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 237 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 238 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 239 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 240 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 241 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 242 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 243 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 244 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 245 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 246 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 247 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 248 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 249 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 250 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 251 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 252 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 253 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 254 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 255 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 256 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 257 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 258 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 259 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 260 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 261 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 262 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 263 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 264 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 265 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 266 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 267 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 268 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 269 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 270 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 271 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 272 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 273 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 274 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 275 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 276 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 277 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 278 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 279 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 280 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 281 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 282 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 283 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 284 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 285 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 286 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 287 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 288 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 289 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 290 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 291 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 292 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 293 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 294 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 295 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 296 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 297 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 298 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 299 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 300 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 301 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 302 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 303 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 304 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 305 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 306 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 307 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 308 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 309 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 310 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 311 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 312 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 313 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 314 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 315 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 316 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 317 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 318 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 319 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 320 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 321 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 322 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 323 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 324 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 325 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 326 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 327 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 328 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 329 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 330 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 331 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 332 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 333 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 334 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 335 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 336 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 337 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 338 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 339 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 340 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 341 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 342 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 343 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 344 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 345 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 346 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 347 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 348 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 349 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 350 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 351 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 352 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 353 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 354 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 355 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 356 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 357 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 358 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 359 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 360 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 361 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 362 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 363 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 364 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 365 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 366 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 367 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 368 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 369 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 370 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 371 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 372 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 373 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 374 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 375 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 376 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 377 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 378 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 379 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 380 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 381 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 382 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 383 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 384 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 385 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 386 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 387 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 388 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 389 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 390 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 391 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 392 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 393 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 394 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 395 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 396 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 397 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 398 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 399 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 400 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 401 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 402 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 403 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 404 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 405 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 406 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 407 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 408 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 409 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 410 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 411 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 412 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 413 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 414 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 415 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 416 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 417 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 418 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 419 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 420 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 421 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 422 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 423 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 424 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 425 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 426 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 427 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 428 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 429 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 430 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 431 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.78 |
| Metatranscriptomes | 0 |
| Isolates | 19.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.9 |
| Nodule | 1.67 |
| Rhizoplane | 6.67 |
| Rhizosphere | 72.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496125_0017767 | 3300048928 | Bacteria | 6769 |
| 2 | MRS2a_Contig_732 | 2124908027 | Bacteria | 15161 |
| 3 | JGI25162J39368_1000495 | 3300002737 | Bacteria | 29917 |
| 4 | JGI25163J39215_1000771 | 3300002771 | Bacteria | 7883 |
| 5 | JGI25164J39214_1000199 | 3300002772 | Bacteria | 51070 |
| 6 | JGI25165J46597_1000357 | 3300003214 | Bacteria | 51070 |
| 7 | Ga0055538_1000087 | 3300003751 | Bacteria | 80121 |
| 8 | Ga0055539_1000131 | 3300003752 | Bacteria | 80121 |
| 9 | Ga0055533_1000134 | 3300003756 | Bacteria | 80121 |
| 10 | Ga0055532_1000247 | 3300003758 | Bacteria | 38860 |
| 11 | Ga0055525_1000253 | 3300003759 | Bacteria | 52619 |
| 12 | Ga0055536_1000308 | 3300003781 | Bacteria | 36820 |
| 13 | Ga0055536_1003749 | 3300003781 | Bacteria | 8040 |
| 14 | Ga0055530_10001166 | 3300003791 | Bacteria | 20378 |
| 15 | Ga0055530_10001277 | 3300003791 | Bacteria | 19022 |
| 16 | Ga0055530_10001378 | 3300003791 | Bacteria | 18008 |
| 17 | Ga0055540_1000850 | 3300003792 | Bacteria | 20432 |
| 18 | Ga0055540_1000888 | 3300003792 | Bacteria | 19711 |
| 19 | Ga0055540_1015263 | 3300003792 | Bacteria | 2247 |
| 20 | Ga0055531_10000593 | 3300003794 | Bacteria | 31596 |
| 21 | Ga0055541_1000086 | 3300003841 | Bacteria | 80121 |
| 22 | Ga0065714_10000659 | 3300005288 | Bacteria | 3125 |
| 23 | Ga0065714_10013314 | 3300005288 | Bacteria | 2884 |
| 24 | Ga0065714_10068377 | 3300005288 | Bacteria | 4766 |
| 25 | Ga0065714_10069407 | 3300005288 | Bacteria | 4221 |
| 26 | Ga0065714_10080849 | 3300005288 | Bacteria | 2408 |
| 27 | Ga0065704_10084008 | 3300005289 | Bacteria | 3374 |
| 28 | Ga0070670_100004257 | 3300005331 | Bacteria | 11969 |
| 29 | Ga0070670_100005003 | 3300005331 | Bacteria | 11154 |
| 30 | Ga0070661_100002878 | 3300005344 | Bacteria | 11838 |
| 31 | Ga0070661_100228279 | 3300005344 | Bacteria | 1430 |
| 32 | Ga0070669_100001802 | 3300005353 | Bacteria | 15411 |
| 33 | Ga0070669_100008090 | 3300005353 | Bacteria | 7515 |
| 34 | Ga0070674_100257168 | 3300005356 | Bacteria | 1374 |
| 35 | Ga0070662_100000361 | 3300005457 | Bacteria | 27165 |
| 36 | Ga0070662_100060541 | 3300005457 | Bacteria | 2761 |
| 37 | Ga0068853_100000313 | 3300005539 | Bacteria | 34037 |
| 38 | Ga0070665_100090861 | 3300005548 | Bacteria | 3059 |
| 39 | Ga0070664_100005028 | 3300005564 | Bacteria | 10595 |
| 40 | Ga0068854_100026910 | 3300005578 | Bacteria | 3957 |
| 41 | Ga0068851_10000002 | 3300005834 | Bacteria | 302756 |
| 42 | Ga0075364_10018756 | 3300006051 | Bacteria | 4337 |
| 43 | Ga0075364_10047874 | 3300006051 | Bacteria | 2786 |
| 44 | Ga0075432_10040942 | 3300006058 | Bacteria | 1617 |
| 45 | Ga0075432_10112133 | 3300006058 | Bacteria | 1017 |
| 46 | Ga0099823_1019775 | 3300006944 | Bacteria | 6406 |
| 47 | Ga0079104_1048302 | 3300006946 | Bacteria | 959 |
| 48 | Ga0105251_10002056 | 3300009011 | Bacteria | 16270 |
| 49 | Ga0105251_10002820 | 3300009011 | Bacteria | 13156 |
| 50 | Ga0105251_10002932 | 3300009011 | Bacteria | 12787 |
| 51 | Ga0105251_10003002 | 3300009011 | Bacteria | 12611 |
| 52 | Ga0105251_10013777 | 3300009011 | Bacteria | 4504 |
| 53 | Ga0105251_10055970 | 3300009011 | Bacteria | 1868 |
| 54 | Ga0105251_10104656 | 3300009011 | Bacteria | 1292 |
| 55 | Ga0105244_10005967 | 3300009036 | Bacteria | 7984 |
| 56 | Ga0105244_10006104 | 3300009036 | Bacteria | 7873 |
| 57 | Ga0105244_10009115 | 3300009036 | Bacteria | 6127 |
| 58 | Ga0105244_10009276 | 3300009036 | Bacteria | 6063 |
| 59 | Ga0105244_10010129 | 3300009036 | Bacteria | 5737 |
| 60 | Ga0105244_10011212 | 3300009036 | Bacteria | 5392 |
| 61 | Ga0105244_10016608 | 3300009036 | Bacteria | 4188 |
| 62 | Ga0105244_10024519 | 3300009036 | Bacteria | 3290 |
| 63 | Ga0105244_10040057 | 3300009036 | Bacteria | 2435 |
| 64 | Ga0105244_10053644 | 3300009036 | Bacteria | 2048 |
| 65 | Ga0105244_10055459 | 3300009036 | Bacteria | 2007 |
| 66 | Ga0105250_10001642 | 3300009092 | Bacteria | 11894 |
| 67 | Ga0105250_10004524 | 3300009092 | Bacteria | 6382 |
| 68 | Ga0105250_10004951 | 3300009092 | Bacteria | 6043 |
| 69 | Ga0105250_10014038 | 3300009092 | Bacteria | 3297 |
| 70 | Ga0105250_10015158 | 3300009092 | Bacteria | 3157 |
| 71 | Ga0105250_10017058 | 3300009092 | Bacteria | 2952 |
| 72 | Ga0105243_10001506 | 3300009148 | Bacteria | 20402 |
| 73 | Ga0105243_10022104 | 3300009148 | Bacteria | 4834 |
| 74 | Ga0105242_10000269 | 3300009176 | Bacteria | 41226 |
| 75 | Ga0105242_10091427 | 3300009176 | Bacteria | 2562 |
| 76 | Ga0105248_10315105 | 3300009177 | Bacteria | 1762 |
| 77 | Ga0105237_10007268 | 3300009545 | Bacteria | 12153 |
| 78 | Ga0105246_10003123 | 3300011119 | Bacteria | 10054 |
| 79 | Ga0105246_10006503 | 3300011119 | Bacteria | 7135 |
| 80 | Ga0105246_10405092 | 3300011119 | Bacteria | 1134 |
| 81 | Ga0157345_1000108 | 3300012498 | Bacteria | 15926 |
| 82 | Ga0157347_1000402 | 3300012502 | Bacteria | 2763 |
| 83 | Ga0157373_10004521 | 3300013100 | Bacteria | 10457 |
| 84 | Ga0157373_10006106 | 3300013100 | Bacteria | 9005 |
| 85 | Ga0157373_10011740 | 3300013100 | Bacteria | 6434 |
| 86 | Ga0157373_10013757 | 3300013100 | Bacteria | 5933 |
| 87 | Ga0157373_10015941 | 3300013100 | Bacteria | 5486 |
| 88 | Ga0157373_10066888 | 3300013100 | Bacteria | 2541 |
| 89 | Ga0157371_10022439 | 3300013102 | Bacteria | 4625 |
| 90 | Ga0157371_10073800 | 3300013102 | Bacteria | 2416 |
| 91 | Ga0157371_10340642 | 3300013102 | Bacteria | 1090 |
| 92 | Ga0157370_10009081 | 3300013104 | Bacteria | 10661 |
| 93 | Ga0157370_10137448 | 3300013104 | Bacteria | 2277 |
| 94 | Ga0157370_10216460 | 3300013104 | Bacteria | 1775 |
| 95 | Ga0157370_10257003 | 3300013104 | Bacteria | 1615 |
| 96 | Ga0157370_10387447 | 3300013104 | Bacteria | 1287 |
| 97 | Ga0157369_10019415 | 3300013105 | Bacteria | 7604 |
| 98 | Ga0157369_10034789 | 3300013105 | Bacteria | 5526 |
| 99 | Ga0157369_10038269 | 3300013105 | Bacteria | 5245 |
| 100 | Ga0157369_10064584 | 3300013105 | Bacteria | 3942 |
| 101 | Ga0157369_10075394 | 3300013105 | Bacteria | 3617 |
| 102 | Ga0157369_10141428 | 3300013105 | Bacteria | 2546 |
| 103 | Ga0157369_10190634 | 3300013105 | Bacteria | 2154 |
| 104 | Ga0163162_10001936 | 3300013306 | Bacteria | 19451 |
| 105 | Ga0163162_10085880 | 3300013306 | Bacteria | 3224 |
| 106 | Ga0157372_10001371 | 3300013307 | Bacteria | 26364 |
| 107 | Ga0157372_10004094 | 3300013307 | Bacteria | 15634 |
| 108 | Ga0157375_10004852 | 3300013308 | Bacteria | 11685 |
| 109 | Ga0157375_10009996 | 3300013308 | Bacteria | 8340 |
| 110 | Ga0157375_10050530 | 3300013308 | Bacteria | 4079 |
| 111 | Ga0182008_10002348 | 3300014497 | Bacteria | 11910 |
| 112 | Ga0182008_10002423 | 3300014497 | Bacteria | 11708 |
| 113 | Ga0182008_10006796 | 3300014497 | Bacteria | 6364 |
| 114 | Ga0182008_10018558 | 3300014497 | Bacteria | 3601 |
| 115 | Ga0182006_1001958 | 3300015261 | Bacteria | 11671 |
| 116 | Ga0182006_1002388 | 3300015261 | Bacteria | 10291 |
| 117 | Ga0182006_1009276 | 3300015261 | Bacteria | 4416 |
| 118 | Ga0182006_1010927 | 3300015261 | Bacteria | 4015 |
| 119 | Ga0182006_1059416 | 3300015261 | Bacteria | 1447 |
| 120 | Ga0182007_10002635 | 3300015262 | Bacteria | 8814 |
| 121 | Ga0182005_1009784 | 3300015265 | Bacteria | 2776 |
| 122 | Ga0163161_10010599 | 3300017792 | Bacteria | 6381 |
| 123 | Ga0163161_10016499 | 3300017792 | Bacteria | 5157 |
| 124 | Ga0163161_10023424 | 3300017792 | Bacteria | 4355 |
| 125 | Ga0163161_10025372 | 3300017792 | Bacteria | 4194 |
| 126 | Ga0163161_10053897 | 3300017792 | Bacteria | 2917 |
| 127 | Ga0163161_10243037 | 3300017792 | Bacteria | 1401 |
| 128 | Ga0209435_100608 | 3300025206 | Bacteria | 6553 |
| 129 | Ga0209760_100182 | 3300025207 | Bacteria | 33098 |
| 130 | Ga0209784_100124 | 3300025224 | Bacteria | 80335 |
| 131 | Ga0209566_100150 | 3300025225 | Bacteria | 80335 |
| 132 | Ga0209674_100173 | 3300025226 | Bacteria | 80335 |
| 133 | Ga0209147_100175 | 3300025229 | Bacteria | 80335 |
| 134 | Ga0209563_100149 | 3300025230 | Bacteria | 67046 |
| 135 | Ga0207427_100200 | 3300025231 | Bacteria | 57300 |
| 136 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 137 | Ga0209437_104516 | 3300025233 | Bacteria | 2445 |
| 138 | Ga0209258_100343 | 3300025242 | Bacteria | 68273 |
| 139 | Ga0209646_1000262 | 3300025246 | Bacteria | 51517 |
| 140 | Ga0209677_100122 | 3300025253 | Bacteria | 80335 |
| 141 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 142 | Ga0209676_1000076 | 3300025292 | Bacteria | 301393 |
| 143 | Ga0209676_1000914 | 3300025292 | Bacteria | 36872 |
| 144 | Ga0209050_1000063 | 3300025298 | Bacteria | 314955 |
| 145 | Ga0209050_1000679 | 3300025298 | Bacteria | 51314 |
| 146 | Ga0209050_1000943 | 3300025298 | Bacteria | 37904 |
| 147 | Ga0209051_1000045 | 3300025303 | Bacteria | 297882 |
| 148 | Ga0209051_1000484 | 3300025303 | Bacteria | 51314 |
| 149 | Ga0209051_1000700 | 3300025303 | Bacteria | 36865 |
| 150 | Ga0209257_1000680 | 3300025304 | Bacteria | 52899 |
| 151 | Ga0209257_1008505 | 3300025304 | Bacteria | 5807 |
| 152 | Ga0207656_10000030 | 3300025321 | Bacteria | 68725 |
| 153 | Ga0207696_1000047 | 3300025711 | Bacteria | 285005 |
| 154 | Ga0207696_1000065 | 3300025711 | Bacteria | 231818 |
| 155 | Ga0207696_1000656 | 3300025711 | Bacteria | 24732 |
| 156 | Ga0207696_1000890 | 3300025711 | Bacteria | 18585 |
| 157 | Ga0207696_1006147 | 3300025711 | Bacteria | 4880 |
| 158 | Ga0207696_1007822 | 3300025711 | Bacteria | 4143 |
| 159 | Ga0207696_1011015 | 3300025711 | Bacteria | 3283 |
| 160 | Ga0207696_1012815 | 3300025711 | Bacteria | 2949 |
| 161 | Ga0207696_1033135 | 3300025711 | Bacteria | 1550 |
| 162 | Ga0207655_1000957 | 3300025728 | Bacteria | 29826 |
| 163 | Ga0207655_1001804 | 3300025728 | Bacteria | 18533 |
| 164 | Ga0207655_1001982 | 3300025728 | Bacteria | 17456 |
| 165 | Ga0207655_1002049 | 3300025728 | Bacteria | 16995 |
| 166 | Ga0207655_1003080 | 3300025728 | Bacteria | 12679 |
| 167 | Ga0207655_1003592 | 3300025728 | Bacteria | 11469 |
| 168 | Ga0207655_1010675 | 3300025728 | Bacteria | 5552 |
| 169 | Ga0207655_1010735 | 3300025728 | Bacteria | 5530 |
| 170 | Ga0207655_1011077 | 3300025728 | Bacteria | 5405 |
| 171 | Ga0207655_1014471 | 3300025728 | Bacteria | 4457 |
| 172 | Ga0207655_1020818 | 3300025728 | Bacteria | 3354 |
| 173 | Ga0207655_1021800 | 3300025728 | Bacteria | 3235 |
| 174 | Ga0207655_1032113 | 3300025728 | Bacteria | 2405 |
| 175 | Ga0207713_1001322 | 3300025735 | Bacteria | 20331 |
| 176 | Ga0207713_1001708 | 3300025735 | Bacteria | 16945 |
| 177 | Ga0207713_1001824 | 3300025735 | Bacteria | 16277 |
| 178 | Ga0207713_1002434 | 3300025735 | Bacteria | 13571 |
| 179 | Ga0207713_1002481 | 3300025735 | Bacteria | 13414 |
| 180 | Ga0207713_1002578 | 3300025735 | Bacteria | 13094 |
| 181 | Ga0207713_1002627 | 3300025735 | Bacteria | 12926 |
| 182 | Ga0207713_1003903 | 3300025735 | Bacteria | 9927 |
| 183 | Ga0207713_1008889 | 3300025735 | Bacteria | 5722 |
| 184 | Ga0207713_1008913 | 3300025735 | Bacteria | 5711 |
| 185 | Ga0207713_1010305 | 3300025735 | Bacteria | 5186 |
| 186 | Ga0207713_1016788 | 3300025735 | Bacteria | 3703 |
| 187 | Ga0207713_1048675 | 3300025735 | Bacteria | 1705 |
| 188 | Ga0207671_10000060 | 3300025914 | Bacteria | 178435 |
| 189 | Ga0207649_10000023 | 3300025920 | Bacteria | 188467 |
| 190 | Ga0207681_10003036 | 3300025923 | Bacteria | 10555 |
| 191 | Ga0207681_10026706 | 3300025923 | Bacteria | 3727 |
| 192 | Ga0207650_10002221 | 3300025925 | Bacteria | 13562 |
| 193 | Ga0207650_10002862 | 3300025925 | Bacteria | 11918 |
| 194 | Ga0207706_10000600 | 3300025933 | Bacteria | 38298 |
| 195 | Ga0207706_10069638 | 3300025933 | Bacteria | 3094 |
| 196 | Ga0207686_10036537 | 3300025934 | Bacteria | 2958 |
| 197 | Ga0207709_10000030 | 3300025935 | Bacteria | 331710 |
| 198 | Ga0207709_10011840 | 3300025935 | Bacteria | 4811 |
| 199 | Ga0207709_10023284 | 3300025935 | Bacteria | 3524 |
| 200 | Ga0207679_10000017 | 3300025945 | Bacteria | 253004 |
| 201 | Ga0207639_10000420 | 3300026041 | Bacteria | 29390 |
| 202 | Ga0209281_1006811 | 3300027111 | Bacteria | 2930 |
| 203 | Ga0209281_1014165 | 3300027111 | Bacteria | 1695 |
| 204 | Ga0209389_1000112 | 3300027296 | Bacteria | 72373 |
| 205 | Ga0209371_1000094 | 3300027312 | Bacteria | 170815 |
| 206 | Ga0209371_1000463 | 3300027312 | Bacteria | 39930 |
| 207 | Ga0268266_10009045 | 3300028379 | Bacteria | 8804 |
| 208 | Ga0307517_10086497 | 3300028786 | Bacteria | 2615 |
| 209 | Ga0268256_1000083 | 3300030500 | Bacteria | 170829 |
| 210 | Ga0268256_1000335 | 3300030500 | Bacteria | 46059 |
| 211 | Ga0307511_10114580 | 3300030521 | Bacteria | 1698 |
| 212 | Ga0316177_1129951 | 3300030731 | Bacteria | 2870 |
| 213 | Ga0314311_1265431 | 3300030733 | Bacteria | 1787 |
| 214 | Ga0316178_1020704 | 3300030735 | Bacteria | 18013 |
| 215 | Ga0316183_1165638 | 3300030742 | Bacteria | 1960 |
| 216 | Ga0316181_1136229 | 3300030744 | Bacteria | 4016 |
| 217 | Ga0265316_10171930 | 3300031344 | Bacteria | 1616 |
| 218 | Ga0307509_10019083 | 3300031507 | Bacteria | 7841 |
| 219 | Ga0307408_100000013 | 3300031548 | Bacteria | 386212 |
| 220 | Ga0307408_100002504 | 3300031548 | Bacteria | 12850 |
| 221 | Ga0307408_100006863 | 3300031548 | Bacteria | 7547 |
| 222 | Ga0307408_100007662 | 3300031548 | Bacteria | 7140 |
| 223 | Ga0307408_100575058 | 3300031548 | Bacteria | 997 |
| 224 | Ga0307405_10000713 | 3300031731 | Bacteria | 12904 |
| 225 | Ga0307405_10001540 | 3300031731 | Bacteria | 9755 |
| 226 | Ga0307405_10008941 | 3300031731 | Bacteria | 5111 |
| 227 | Ga0307406_10019930 | 3300031901 | Bacteria | 3941 |
| 228 | Ga0307412_10004479 | 3300031911 | Bacteria | 7789 |
| 229 | Ga0307412_10031809 | 3300031911 | Bacteria | 3336 |
| 230 | Ga0307412_10052866 | 3300031911 | Bacteria | 2691 |
| 231 | Ga0307412_10145463 | 3300031911 | Bacteria | 1741 |
| 232 | Ga0307409_100016185 | 3300031995 | Bacteria | 4926 |
| 233 | Ga0307416_100028319 | 3300032002 | Bacteria | 4164 |
| 234 | Ga0307416_100224466 | 3300032002 | Bacteria | 1805 |
| 235 | Ga0307414_10018940 | 3300032004 | Bacteria | 4253 |
| 236 | Ga0307411_10035332 | 3300032005 | Bacteria | 3119 |
| 237 | Ga0307510_10021026 | 3300033180 | Bacteria | 7611 |
| 238 | Ga0237819_00468 | 3300038705 | Bacteria | 13755 |
| 239 | Ga0436363_0609281 | 3300039450 | Bacteria | 1469 |
| 240 | Ga0439438_000581 | 3300041405 | Bacteria | 16609 |
| 241 | Ga0439438_001902 | 3300041405 | Bacteria | 9138 |
| 242 | Ga0439438_003158 | 3300041405 | Bacteria | 6760 |
| 243 | Ga0439438_003951 | 3300041405 | Bacteria | 5835 |
| 244 | Ga0439438_015173 | 3300041405 | Bacteria | 2274 |
| 245 | Ga0439438_020811 | 3300041405 | Bacteria | 1837 |
| 246 | Ga0439447_000137 | 3300041407 | Bacteria | 24687 |
| 247 | Ga0439447_000812 | 3300041407 | Bacteria | 11460 |
| 248 | Ga0439447_006720 | 3300041407 | Bacteria | 3703 |
| 249 | Ga0439447_006854 | 3300041407 | Bacteria | 3659 |
| 250 | Ga0439447_008057 | 3300041407 | Bacteria | 3289 |
| 251 | Ga0439447_011798 | 3300041407 | Bacteria | 2532 |
| 252 | Ga0439466_0000506 | 3300041411 | Bacteria | 14755 |
| 253 | Ga0439466_0003235 | 3300041411 | Bacteria | 6347 |
| 254 | Ga0439466_0003565 | 3300041411 | Bacteria | 6013 |
| 255 | Ga0439466_0006784 | 3300041411 | Bacteria | 4344 |
| 256 | Ga0439466_0009328 | 3300041411 | Bacteria | 3670 |
| 257 | Ga0439466_0013689 | 3300041411 | Bacteria | 2966 |
| 258 | Ga0439465_0042481 | 3300041413 | Bacteria | 1473 |
| 259 | Ga0439431_0000700 | 3300041997 | Bacteria | 7211 |
| 260 | Ga0439431_0007872 | 3300041997 | Bacteria | 2384 |
| 261 | Ga0439437_000087 | 3300042000 | Bacteria | 6644 |
| 262 | Ga0439445_0015035 | 3300042004 | Bacteria | 1892 |
| 263 | Ga0439432_000810 | 3300042006 | Bacteria | 11664 |
| 264 | Ga0439432_001285 | 3300042006 | Bacteria | 9492 |
| 265 | Ga0439432_002646 | 3300042006 | Bacteria | 6705 |
| 266 | Ga0439432_010700 | 3300042006 | Bacteria | 3172 |
| 267 | Ga0439451_005890 | 3300042009 | Bacteria | 2504 |
| 268 | Ga0439451_007457 | 3300042009 | Bacteria | 2229 |
| 269 | Ga0439452_000738 | 3300042010 | Bacteria | 15697 |
| 270 | Ga0439452_000785 | 3300042010 | Bacteria | 15080 |
| 271 | Ga0439452_000922 | 3300042010 | Bacteria | 13338 |
| 272 | Ga0439452_001239 | 3300042010 | Bacteria | 10856 |
| 273 | Ga0439452_001978 | 3300042010 | Bacteria | 7840 |
| 274 | Ga0439452_005696 | 3300042010 | Bacteria | 3983 |
| 275 | Ga0439456_000171 | 3300042013 | Bacteria | 19308 |
| 276 | Ga0439456_003377 | 3300042013 | Bacteria | 3233 |
| 277 | Ga0439456_018683 | 3300042013 | Bacteria | 1455 |
| 278 | Ga0439456_026738 | 3300042013 | Bacteria | 1228 |
| 279 | Ga0439456_032386 | 3300042013 | Bacteria | 1123 |
| 280 | Ga0439463_000208 | 3300042016 | Bacteria | 15899 |
| 281 | Ga0450911_000020 | 3300042115 | Bacteria | 101786 |
| 282 | Ga0450911_002090 | 3300042115 | Bacteria | 4099 |
| 283 | Ga0450911_002565 | 3300042115 | Bacteria | 3515 |
| 284 | Ga0450898_000800 | 3300042134 | Bacteria | 3880 |
| 285 | Ga0450900_000840 | 3300042136 | Bacteria | 2700 |
| 286 | Ga0450902_000374 | 3300042137 | Bacteria | 5477 |
| 287 | Ga0450902_004374 | 3300042137 | Bacteria | 2101 |
| 288 | Ga0450902_012212 | 3300042137 | Bacteria | 1372 |
| 289 | Ga0450902_012604 | 3300042137 | Bacteria | 1354 |
| 290 | Ga0450902_026900 | 3300042137 | Bacteria | 963 |
| 291 | Ga0450903_001409 | 3300042138 | Bacteria | 4485 |
| 292 | Ga0450903_003317 | 3300042138 | Bacteria | 2793 |
| 293 | Ga0450904_000118 | 3300042139 | Bacteria | 17585 |
| 294 | Ga0450904_001259 | 3300042139 | Bacteria | 3757 |
| 295 | Ga0450904_001336 | 3300042139 | Bacteria | 3586 |
| 296 | Ga0450905_004849 | 3300042142 | Bacteria | 1795 |
| 297 | Ga0450905_008235 | 3300042142 | Bacteria | 1426 |
| 298 | Ga0450889_002098 | 3300042144 | Bacteria | 1998 |
| 299 | Ga0450906_000272 | 3300042145 | Bacteria | 10165 |
| 300 | Ga0450907_000242 | 3300042146 | Bacteria | 18794 |
| 301 | Ga0450910_003950 | 3300042147 | Bacteria | 1991 |
| 302 | Ga0450910_007825 | 3300042147 | Bacteria | 1495 |
| 303 | Ga0439446_0004382 | 3300042156 | Bacteria | 3578 |
| 304 | Ga0439446_0009157 | 3300042156 | Bacteria | 2644 |
| 305 | Ga0439446_0020211 | 3300042156 | Bacteria | 1874 |
| 306 | Ga0439446_0054183 | 3300042156 | Bacteria | 1202 |
| 307 | Ga0450908_004939 | 3300042184 | Bacteria | 2561 |
| 308 | Ga0450909_000164 | 3300042185 | Bacteria | 7235 |
| 309 | Ga0450909_000235 | 3300042185 | Bacteria | 6605 |
| 310 | Ga0450909_008321 | 3300042185 | Bacteria | 1509 |
| 311 | Ga0439434_0000282 | 3300042435 | Bacteria | 14538 |
| 312 | Ga0439434_0008772 | 3300042435 | Bacteria | 2970 |
| 313 | Ga0439464_0002337 | 3300042439 | Bacteria | 4650 |
| 314 | Ga0439464_0003349 | 3300042439 | Bacteria | 4034 |
| 315 | Ga0439460_0001620 | 3300042461 | Bacteria | 5330 |
| 316 | Ga0450893_0000287 | 3300042532 | Bacteria | 6881 |
| 317 | Ga0450893_0008905 | 3300042532 | Bacteria | 1638 |
| 318 | Ga0450893_0022127 | 3300042532 | Bacteria | 1100 |
| 319 | Ga0450901_000072 | 3300042533 | Bacteria | 10313 |
| 320 | Ga0439440_0000274 | 3300042993 | Bacteria | 8345 |
| 321 | Ga0495617_001874 | 3300046452 | Bacteria | 8874 |
| 322 | Ga0495617_004329 | 3300046452 | Bacteria | 5175 |
| 323 | Ga0495617_004596 | 3300046452 | Bacteria | 4998 |
| 324 | Ga0495617_007033 | 3300046452 | Bacteria | 3923 |
| 325 | Ga0495617_028313 | 3300046452 | Bacteria | 1883 |
| 326 | Ga0495627_001684 | 3300046453 | Bacteria | 12173 |
| 327 | Ga0495627_002013 | 3300046453 | Bacteria | 10447 |
| 328 | Ga0495627_002190 | 3300046453 | Bacteria | 9751 |
| 329 | Ga0495627_002800 | 3300046453 | Bacteria | 8097 |
| 330 | Ga0495627_003301 | 3300046453 | Bacteria | 7206 |
| 331 | Ga0495627_022199 | 3300046453 | Bacteria | 2091 |
| 332 | Ga0495627_033052 | 3300046453 | Bacteria | 1624 |
| 333 | Ga0495592_0020491 | 3300046454 | Bacteria | 5030 |
| 334 | Ga0495603_0006830 | 3300046455 | Bacteria | 6846 |
| 335 | Ga0495603_0010297 | 3300046455 | Bacteria | 5659 |
| 336 | Ga0495603_0159534 | 3300046455 | Bacteria | 1308 |
| 337 | Ga0495590_0007703 | 3300046457 | Bacteria | 4137 |
| 338 | Ga0495590_0017166 | 3300046457 | Bacteria | 2608 |
| 339 | Ga0495590_0032246 | 3300046457 | Bacteria | 1832 |
| 340 | Ga0495590_0039765 | 3300046457 | Bacteria | 1641 |
| 341 | Ga0495591_000140 | 3300046458 | Bacteria | 77847 |
| 342 | Ga0495591_000579 | 3300046458 | Bacteria | 27842 |
| 343 | Ga0495591_000695 | 3300046458 | Bacteria | 24531 |
| 344 | Ga0495591_001910 | 3300046458 | Bacteria | 12240 |
| 345 | Ga0495591_003387 | 3300046458 | Bacteria | 8262 |
| 346 | Ga0495591_004066 | 3300046458 | Bacteria | 7297 |
| 347 | Ga0495591_004138 | 3300046458 | Bacteria | 7206 |
| 348 | Ga0495591_005103 | 3300046458 | Bacteria | 6162 |
| 349 | Ga0495591_005177 | 3300046458 | Bacteria | 6110 |
| 350 | Ga0495591_007179 | 3300046458 | Bacteria | 4774 |
| 351 | Ga0495591_007343 | 3300046458 | Bacteria | 4701 |
| 352 | Ga0495591_009859 | 3300046458 | Bacteria | 3755 |
| 353 | Ga0495591_010497 | 3300046458 | Bacteria | 3587 |
| 354 | Ga0495591_014411 | 3300046458 | Bacteria | 2843 |
| 355 | Ga0495638_0007147 | 3300046460 | Bacteria | 8043 |
| 356 | Ga0495638_0007273 | 3300046460 | Bacteria | 7959 |
| 357 | Ga0495638_0007808 | 3300046460 | Bacteria | 7639 |
| 358 | Ga0495638_0012691 | 3300046460 | Bacteria | 5761 |
| 359 | Ga0495638_0013591 | 3300046460 | Bacteria | 5534 |
| 360 | Ga0495638_0017000 | 3300046460 | Bacteria | 4862 |
| 361 | Ga0495638_0025846 | 3300046460 | Bacteria | 3812 |
| 362 | Ga0495638_0026215 | 3300046460 | Bacteria | 3780 |
| 363 | Ga0495638_0030207 | 3300046460 | Bacteria | 3490 |
| 364 | Ga0495638_0071487 | 3300046460 | Bacteria | 2122 |
| 365 | Ga0495653_0001459 | 3300046463 | Bacteria | 18454 |
| 366 | Ga0495653_0001881 | 3300046463 | Bacteria | 16561 |
| 367 | Ga0495653_0067138 | 3300046463 | Bacteria | 2694 |
| 368 | Ga0495650_0005386 | 3300046471 | Bacteria | 8323 |
| 369 | Ga0495650_0007706 | 3300046471 | Bacteria | 6416 |
| 370 | Ga0495650_0008171 | 3300046471 | Bacteria | 6154 |
| 371 | Ga0495650_0012796 | 3300046471 | Bacteria | 4490 |
| 372 | Ga0495605_0003326 | 3300046474 | Bacteria | 9618 |
| 373 | Ga0495605_0019020 | 3300046474 | Bacteria | 3677 |
| 374 | Ga0495605_0037058 | 3300046474 | Bacteria | 2455 |
| 375 | Ga0495605_0069292 | 3300046474 | Bacteria | 1670 |
| 376 | Ga0495584_0003239 | 3300046491 | Bacteria | 9025 |
| 377 | Ga0495584_0003320 | 3300046491 | Bacteria | 8901 |
| 378 | Ga0495584_0005127 | 3300046491 | Bacteria | 6954 |
| 379 | Ga0495584_0006200 | 3300046491 | Bacteria | 6272 |
| 380 | Ga0495584_0008491 | 3300046491 | Bacteria | 5317 |
| 381 | Ga0495584_0012893 | 3300046491 | Bacteria | 4267 |
| 382 | Ga0495584_0041426 | 3300046491 | Bacteria | 2325 |
| 383 | Ga0495584_0246919 | 3300046491 | Bacteria | 907 |
| 384 | Ga0495585_0002449 | 3300046492 | Bacteria | 13293 |
| 385 | Ga0495585_0002772 | 3300046492 | Bacteria | 12212 |
| 386 | Ga0495585_0005338 | 3300046492 | Bacteria | 8109 |
| 387 | Ga0495585_0006306 | 3300046492 | Bacteria | 7368 |
| 388 | Ga0495585_0006542 | 3300046492 | Bacteria | 7212 |
| 389 | Ga0495585_0006599 | 3300046492 | Bacteria | 7173 |
| 390 | Ga0495585_0008163 | 3300046492 | Bacteria | 6360 |
| 391 | Ga0495585_0009406 | 3300046492 | Bacteria | 5862 |
| 392 | Ga0495585_0011303 | 3300046492 | Bacteria | 5286 |
| 393 | Ga0495585_0066048 | 3300046492 | Bacteria | 1981 |
| 394 | Ga0495585_0221948 | 3300046492 | Bacteria | 953 |
| 395 | Ga0495594_0107926 | 3300046499 | Bacteria | 1568 |
| 396 | Ga0495596_0004930 | 3300046500 | Bacteria | 6399 |
| 397 | Ga0495596_0007540 | 3300046500 | Bacteria | 4903 |
| 398 | Ga0495607_0000586 | 3300046501 | Bacteria | 35474 |
| 399 | Ga0495607_0002312 | 3300046501 | Bacteria | 15635 |
| 400 | Ga0495607_0008088 | 3300046501 | Bacteria | 7218 |
| 401 | Ga0495607_0008590 | 3300046501 | Bacteria | 6972 |
| 402 | Ga0495607_0014620 | 3300046501 | Bacteria | 5103 |
| 403 | Ga0495607_0024084 | 3300046501 | Bacteria | 3799 |
| 404 | Ga0495607_0034067 | 3300046501 | Bacteria | 3093 |
| 405 | Ga0495607_0060431 | 3300046501 | Bacteria | 2157 |
| 406 | Ga0495607_0110798 | 3300046501 | Bacteria | 1455 |
| 407 | Ga0495583_0004083 | 3300046506 | Bacteria | 10715 |
| 408 | Ga0495583_0006474 | 3300046506 | Bacteria | 7650 |
| 409 | Ga0495583_0007589 | 3300046506 | Bacteria | 6778 |
| 410 | Ga0495583_0015876 | 3300046506 | Bacteria | 4074 |
| 411 | Ga0495583_0071083 | 3300046506 | Bacteria | 1529 |
| 412 | Ga0495583_0093923 | 3300046506 | Bacteria | 1288 |
| 413 | Ga0495606_0001178 | 3300046507 | Bacteria | 36889 |
| 414 | Ga0495606_0003500 | 3300046507 | Bacteria | 16626 |
| 415 | Ga0495606_0005139 | 3300046507 | Bacteria | 12690 |
| 416 | Ga0495606_0005292 | 3300046507 | Bacteria | 12434 |
| 417 | Ga0495606_0007364 | 3300046507 | Bacteria | 9877 |
| 418 | Ga0495606_0008789 | 3300046507 | Bacteria | 8673 |
| 419 | Ga0495606_0009179 | 3300046507 | Bacteria | 8407 |
| 420 | Ga0495606_0011421 | 3300046507 | Bacteria | 7243 |
| 421 | Ga0495606_0015215 | 3300046507 | Bacteria | 5942 |
| 422 | Ga0495606_0020247 | 3300046507 | Bacteria | 4914 |
| 423 | Ga0495606_0042888 | 3300046507 | Bacteria | 3022 |
| 424 | Ga0495606_0067081 | 3300046507 | Bacteria | 2273 |
| 425 | Ga0495606_0110350 | 3300046507 | Bacteria | 1660 |
| 426 | Ga0495610_0007537 | 3300046512 | Bacteria | 7212 |
| 427 | Ga0495610_0008425 | 3300046512 | Bacteria | 6682 |
| 428 | Ga0495610_0008588 | 3300046512 | Bacteria | 6588 |
| 429 | Ga0495610_0010264 | 3300046512 | Bacteria | 5836 |
| 430 | Ga0495610_0013897 | 3300046512 | Bacteria | 4757 |
| 431 | Ga0495610_0014559 | 3300046512 | Bacteria | 4615 |
| 432 | Ga0495610_0016783 | 3300046512 | Bacteria | 4200 |
| 433 | Ga0495610_0019205 | 3300046512 | Bacteria | 3832 |
| 434 | Ga0495610_0046872 | 3300046512 | Bacteria | 2129 |
| 435 | Ga0495610_0083970 | 3300046512 | Bacteria | 1456 |
| 436 | Ga0495616_0002403 | 3300046513 | Bacteria | 12458 |
| 437 | Ga0495616_0004056 | 3300046513 | Bacteria | 9303 |
| 438 | Ga0495616_0006093 | 3300046513 | Bacteria | 7349 |
| 439 | Ga0495616_0008129 | 3300046513 | Bacteria | 6239 |
| 440 | Ga0495616_0010124 | 3300046513 | Bacteria | 5471 |
| 441 | Ga0495616_0027625 | 3300046513 | Bacteria | 3009 |
| 442 | Ga0495616_0049383 | 3300046513 | Bacteria | 2109 |
| 443 | Ga0495616_0055221 | 3300046513 | Bacteria | 1967 |
| 444 | Ga0495616_0086975 | 3300046513 | Bacteria | 1486 |
| 445 | Ga0495616_0102411 | 3300046513 | Bacteria | 1341 |
| 446 | Ga0495620_0000255 | 3300046515 | Bacteria | 39462 |
| 447 | Ga0495620_0002351 | 3300046515 | Bacteria | 10957 |
| 448 | Ga0495620_0003919 | 3300046515 | Bacteria | 8482 |
| 449 | Ga0495620_0005503 | 3300046515 | Bacteria | 7059 |
| 450 | Ga0495620_0006984 | 3300046515 | Bacteria | 6161 |
| 451 | Ga0495620_0007667 | 3300046515 | Bacteria | 5837 |
| 452 | Ga0495620_0020207 | 3300046515 | Bacteria | 3256 |
| 453 | Ga0495620_0040789 | 3300046515 | Bacteria | 2040 |
| 454 | Ga0495631_0001066 | 3300046518 | Bacteria | 17035 |
| 455 | Ga0495631_0001978 | 3300046518 | Bacteria | 11998 |
| 456 | Ga0495631_0016801 | 3300046518 | Bacteria | 3477 |
| 457 | Ga0495631_0016985 | 3300046518 | Bacteria | 3452 |
| 458 | Ga0495631_0052321 | 3300046518 | Bacteria | 1783 |
| 459 | Ga0495631_0088022 | 3300046518 | Bacteria | 1337 |
| 460 | Ga0495632_0000866 | 3300046519 | Bacteria | 26591 |
| 461 | Ga0495632_0002521 | 3300046519 | Bacteria | 13870 |
| 462 | Ga0495632_0005402 | 3300046519 | Bacteria | 8453 |
| 463 | Ga0495632_0005452 | 3300046519 | Bacteria | 8410 |
| 464 | Ga0495632_0005863 | 3300046519 | Bacteria | 8025 |
| 465 | Ga0495632_0012871 | 3300046519 | Bacteria | 4799 |
| 466 | Ga0495632_0017226 | 3300046519 | Bacteria | 3994 |
| 467 | Ga0495632_0017361 | 3300046519 | Bacteria | 3975 |
| 468 | Ga0495632_0019139 | 3300046519 | Bacteria | 3737 |
| 469 | Ga0495632_0032931 | 3300046519 | Bacteria | 2665 |
| 470 | Ga0495632_0034988 | 3300046519 | Bacteria | 2567 |
| 471 | Ga0495632_0065130 | 3300046519 | Bacteria | 1760 |
| 472 | Ga0495637_0001404 | 3300046520 | Bacteria | 14283 |
| 473 | Ga0495637_0003409 | 3300046520 | Bacteria | 8441 |
| 474 | Ga0495637_0005713 | 3300046520 | Bacteria | 6306 |
| 475 | Ga0495637_0005737 | 3300046520 | Bacteria | 6293 |
| 476 | Ga0495637_0005777 | 3300046520 | Bacteria | 6268 |
| 477 | Ga0495637_0007751 | 3300046520 | Bacteria | 5306 |
| 478 | Ga0495637_0010682 | 3300046520 | Bacteria | 4432 |
| 479 | Ga0495637_0014170 | 3300046520 | Bacteria | 3765 |
| 480 | Ga0495637_0027021 | 3300046520 | Bacteria | 2571 |
| 481 | Ga0495637_0032509 | 3300046520 | Bacteria | 2297 |
| 482 | Ga0495637_0033492 | 3300046520 | Bacteria | 2256 |
| 483 | Ga0495637_0091301 | 3300046520 | Bacteria | 1200 |
| 484 | Ga0495643_0001446 | 3300046522 | Bacteria | 21894 |
| 485 | Ga0495643_0002063 | 3300046522 | Bacteria | 16654 |
| 486 | Ga0495643_0002624 | 3300046522 | Bacteria | 13956 |
| 487 | Ga0495643_0003306 | 3300046522 | Bacteria | 11909 |
| 488 | Ga0495643_0009698 | 3300046522 | Bacteria | 5957 |
| 489 | Ga0495643_0011491 | 3300046522 | Bacteria | 5391 |
| 490 | Ga0495643_0015158 | 3300046522 | Bacteria | 4564 |
| 491 | Ga0495644_0011138 | 3300046523 | Bacteria | 3465 |
| 492 | Ga0495644_0033520 | 3300046523 | Bacteria | 1940 |
| 493 | Ga0495648_0001183 | 3300046524 | Bacteria | 26235 |
| 494 | Ga0495648_0002848 | 3300046524 | Bacteria | 15574 |
| 495 | Ga0495648_0005648 | 3300046524 | Bacteria | 10351 |
| 496 | Ga0495648_0009834 | 3300046524 | Bacteria | 7349 |
| 497 | Ga0495648_0009854 | 3300046524 | Bacteria | 7343 |
| 498 | Ga0495648_0009898 | 3300046524 | Bacteria | 7321 |
| 499 | Ga0495648_0013105 | 3300046524 | Bacteria | 6146 |
| 500 | Ga0495648_0018341 | 3300046524 | Bacteria | 4958 |
| 501 | Ga0495648_0018501 | 3300046524 | Bacteria | 4928 |
| 502 | Ga0495648_0031511 | 3300046524 | Bacteria | 3489 |
| 503 | Ga0495648_0044442 | 3300046524 | Bacteria | 2773 |
| 504 | Ga0495648_0044724 | 3300046524 | Bacteria | 2761 |
| 505 | Ga0495648_0048285 | 3300046524 | Bacteria | 2621 |
| 506 | Ga0495648_0091645 | 3300046524 | Bacteria | 1699 |
| 507 | Ga0495666_0014158 | 3300046526 | Bacteria | 3975 |
| 508 | Ga0495666_0076324 | 3300046526 | Bacteria | 1588 |
| 509 | Ga0495642_0000857 | 3300046528 | Bacteria | 14467 |
| 510 | Ga0495654_0001057 | 3300046530 | Bacteria | 20167 |
| 511 | Ga0495654_0001569 | 3300046530 | Bacteria | 15502 |
| 512 | Ga0495654_0001912 | 3300046530 | Bacteria | 13827 |
| 513 | Ga0495654_0002481 | 3300046530 | Bacteria | 11859 |
| 514 | Ga0495654_0005541 | 3300046530 | Bacteria | 7316 |
| 515 | Ga0495654_0007443 | 3300046530 | Bacteria | 6115 |
| 516 | Ga0495654_0013317 | 3300046530 | Bacteria | 4404 |
| 517 | Ga0495654_0015746 | 3300046530 | Bacteria | 4011 |
| 518 | Ga0495654_0018995 | 3300046530 | Bacteria | 3597 |
| 519 | Ga0495654_0027143 | 3300046530 | Bacteria | 2938 |
| 520 | Ga0495654_0027832 | 3300046530 | Bacteria | 2893 |
| 521 | Ga0495654_0027847 | 3300046530 | Bacteria | 2892 |
| 522 | Ga0495654_0033637 | 3300046530 | Bacteria | 2593 |
| 523 | Ga0495654_0037513 | 3300046530 | Bacteria | 2429 |
| 524 | Ga0495654_0039208 | 3300046530 | Bacteria | 2365 |
| 525 | Ga0495654_0052465 | 3300046530 | Bacteria | 1985 |
| 526 | Ga0495654_0102033 | 3300046530 | Bacteria | 1319 |
| 527 | Ga0495654_0105805 | 3300046530 | Bacteria | 1289 |
| 528 | Ga0495587_0142009 | 3300046536 | Bacteria | 1370 |
| 529 | Ga0495609_0001740 | 3300046538 | Bacteria | 14051 |
| 530 | Ga0495609_0001766 | 3300046538 | Bacteria | 13885 |
| 531 | Ga0495609_0008937 | 3300046538 | Bacteria | 4874 |
| 532 | Ga0495609_0009099 | 3300046538 | Bacteria | 4821 |
| 533 | Ga0495609_0009351 | 3300046538 | Bacteria | 4747 |
| 534 | Ga0495609_0016218 | 3300046538 | Bacteria | 3472 |
| 535 | Ga0495597_0000082 | 3300046542 | Bacteria | 83872 |
| 536 | Ga0495597_0002400 | 3300046542 | Bacteria | 11940 |
| 537 | Ga0495597_0007965 | 3300046542 | Bacteria | 5336 |
| 538 | Ga0495597_0009878 | 3300046542 | Bacteria | 4691 |
| 539 | Ga0495597_0012827 | 3300046542 | Bacteria | 4033 |
| 540 | Ga0495597_0027093 | 3300046542 | Bacteria | 2629 |
| 541 | Ga0495597_0027546 | 3300046542 | Bacteria | 2605 |
| 542 | Ga0495597_0073557 | 3300046542 | Bacteria | 1469 |
| 543 | Ga0495645_0032351 | 3300046543 | Bacteria | 3815 |
| 544 | Ga0495622_0000899 | 3300046557 | Bacteria | 16185 |
| 545 | Ga0495622_0013720 | 3300046557 | Bacteria | 3756 |
| 546 | Ga0495622_0112480 | 3300046557 | Bacteria | 1246 |
| 547 | Ga0495633_0005659 | 3300046558 | Bacteria | 7566 |
| 548 | Ga0495633_0017042 | 3300046558 | Bacteria | 3726 |
| 549 | Ga0495633_0019876 | 3300046558 | Bacteria | 3388 |
| 550 | Ga0495633_0020020 | 3300046558 | Bacteria | 3373 |
| 551 | Ga0495633_0126054 | 3300046558 | Bacteria | 1185 |
| 552 | Ga0495633_0174007 | 3300046558 | Bacteria | 992 |
| 553 | Ga0495656_0015291 | 3300046615 | Bacteria | 2894 |
| 554 | Ga0495668_0003427 | 3300046616 | Bacteria | 11898 |
| 555 | Ga0495668_0052805 | 3300046616 | Bacteria | 2248 |
| 556 | Ga0495668_0066406 | 3300046616 | Bacteria | 1985 |
| 557 | Ga0495668_0099882 | 3300046616 | Bacteria | 1587 |
| 558 | Ga0495634_0026616 | 3300046642 | Bacteria | 4035 |
| 559 | Ga0495611_0002544 | 3300046648 | Bacteria | 8283 |
| 560 | Ga0495611_0007231 | 3300046648 | Bacteria | 4718 |
| 561 | Ga0495611_0078175 | 3300046648 | Bacteria | 1518 |
| 562 | Ga0495611_0107975 | 3300046648 | Bacteria | 1294 |
| 563 | Ga0495611_0154899 | 3300046648 | Bacteria | 1070 |
| 564 | Ga0495625_0004144 | 3300046660 | Bacteria | 13829 |
| 565 | Ga0495625_0011356 | 3300046660 | Bacteria | 7270 |
| 566 | Ga0495625_0015229 | 3300046660 | Bacteria | 6099 |
| 567 | Ga0495625_0018922 | 3300046660 | Bacteria | 5360 |
| 568 | Ga0495625_0021239 | 3300046660 | Bacteria | 5001 |
| 569 | Ga0495625_0053996 | 3300046660 | Bacteria | 2871 |
| 570 | Ga0495625_0064315 | 3300046660 | Bacteria | 2587 |
| 571 | Ga0495625_0115552 | 3300046660 | Bacteria | 1831 |
| 572 | Ga0495625_0168697 | 3300046660 | Bacteria | 1462 |
| 573 | Ga0495659_0053883 | 3300046664 | Bacteria | 1470 |
| 574 | Ga0495661_0000411 | 3300046665 | Bacteria | 45524 |
| 575 | Ga0495661_0002655 | 3300046665 | Bacteria | 13694 |
| 576 | Ga0495661_0006043 | 3300046665 | Bacteria | 8534 |
| 577 | Ga0495661_0012703 | 3300046665 | Bacteria | 5683 |
| 578 | Ga0495661_0025021 | 3300046665 | Bacteria | 3862 |
| 579 | Ga0495661_0050474 | 3300046665 | Bacteria | 2518 |
| 580 | Ga0495661_0080611 | 3300046665 | Bacteria | 1878 |
| 581 | Ga0495661_0106660 | 3300046665 | Bacteria | 1567 |
| 582 | Ga0495661_0186236 | 3300046665 | Bacteria | 1096 |
| 583 | Ga0495588_0041205 | 3300046674 | Bacteria | 2357 |
| 584 | Ga0495646_0002737 | 3300046680 | Bacteria | 10893 |
| 585 | Ga0495669_0010885 | 3300046684 | Bacteria | 3850 |
| 586 | Ga0495669_0069560 | 3300046684 | Bacteria | 1602 |
| 587 | Ga0495613_0008543 | 3300046689 | Bacteria | 7601 |
| 588 | Ga0495624_0001930 | 3300046690 | Bacteria | 15786 |
| 589 | Ga0495670_0000895 | 3300046691 | Bacteria | 14403 |
| 590 | Ga0495670_0010897 | 3300046691 | Bacteria | 4467 |
| 591 | Ga0495670_0031330 | 3300046691 | Bacteria | 2642 |
| 592 | Ga0495670_0066230 | 3300046691 | Bacteria | 1822 |
| 593 | Ga0495670_0079337 | 3300046691 | Bacteria | 1670 |
| 594 | Ga0495671_0001316 | 3300046692 | Bacteria | 16871 |
| 595 | Ga0495671_0002041 | 3300046692 | Bacteria | 12920 |
| 596 | Ga0495671_0003350 | 3300046692 | Bacteria | 9883 |
| 597 | Ga0495671_0003777 | 3300046692 | Bacteria | 9205 |
| 598 | Ga0495671_0004555 | 3300046692 | Bacteria | 8258 |
| 599 | Ga0495671_0006663 | 3300046692 | Bacteria | 6655 |
| 600 | Ga0495671_0018009 | 3300046692 | Bacteria | 3756 |
| 601 | Ga0495671_0022058 | 3300046692 | Bacteria | 3338 |
| 602 | Ga0495671_0022429 | 3300046692 | Bacteria | 3309 |
| 603 | Ga0495671_0040751 | 3300046692 | Bacteria | 2341 |
| 604 | Ga0495671_0125269 | 3300046692 | Bacteria | 1253 |
| 605 | Ga0495671_0125741 | 3300046692 | Bacteria | 1250 |
| 606 | Ga0495649_0003078 | 3300046694 | Bacteria | 11414 |
| 607 | Ga0495649_0006322 | 3300046694 | Bacteria | 7372 |
| 608 | Ga0495649_0006616 | 3300046694 | Bacteria | 7201 |
| 609 | Ga0495649_0008373 | 3300046694 | Bacteria | 6223 |
| 610 | Ga0495649_0011498 | 3300046694 | Bacteria | 5187 |
| 611 | Ga0495649_0011575 | 3300046694 | Bacteria | 5168 |
| 612 | Ga0495649_0019089 | 3300046694 | Bacteria | 3851 |
| 613 | Ga0495649_0023473 | 3300046694 | Bacteria | 3446 |
| 614 | Ga0495649_0030388 | 3300046694 | Bacteria | 2983 |
| 615 | Ga0495649_0064068 | 3300046694 | Bacteria | 1974 |
| 616 | Ga0495649_0083703 | 3300046694 | Bacteria | 1704 |
| 617 | Ga0495649_0107685 | 3300046694 | Bacteria | 1479 |
| 618 | Ga0495589_0003711 | 3300046794 | Bacteria | 8232 |
| 619 | Ga0495589_0003751 | 3300046794 | Bacteria | 8177 |
| 620 | Ga0495589_0006327 | 3300046794 | Bacteria | 6253 |
| 621 | Ga0495589_0007543 | 3300046794 | Bacteria | 5699 |
| 622 | Ga0495589_0034071 | 3300046794 | Bacteria | 2556 |
| 623 | Ga0495589_0081385 | 3300046794 | Bacteria | 1575 |
| 624 | Ga0495600_0158902 | 3300046809 | Bacteria | 1461 |
| 625 | Ga0495660_0001487 | 3300046810 | Bacteria | 15871 |
| 626 | Ga0495660_0001572 | 3300046810 | Bacteria | 15348 |
| 627 | Ga0495660_0002323 | 3300046810 | Bacteria | 12191 |
| 628 | Ga0495660_0005625 | 3300046810 | Bacteria | 7492 |
| 629 | Ga0495660_0005849 | 3300046810 | Bacteria | 7338 |
| 630 | Ga0495660_0005914 | 3300046810 | Bacteria | 7286 |
| 631 | Ga0495660_0011373 | 3300046810 | Bacteria | 5167 |
| 632 | Ga0495660_0015737 | 3300046810 | Bacteria | 4367 |
| 633 | Ga0495660_0020393 | 3300046810 | Bacteria | 3799 |
| 634 | Ga0495660_0021086 | 3300046810 | Bacteria | 3733 |
| 635 | Ga0495660_0021563 | 3300046810 | Bacteria | 3689 |
| 636 | Ga0495660_0028328 | 3300046810 | Bacteria | 3166 |
| 637 | Ga0495660_0028697 | 3300046810 | Bacteria | 3141 |
| 638 | Ga0495660_0031156 | 3300046810 | Bacteria | 3000 |
| 639 | Ga0495660_0032698 | 3300046810 | Bacteria | 2920 |
| 640 | Ga0495660_0066586 | 3300046810 | Bacteria | 1920 |
| 641 | Ga0495660_0069461 | 3300046810 | Bacteria | 1872 |
| 642 | Ga0495604_0033629 | 3300047317 | Bacteria | 4057 |
| 643 | Ga0495636_0053938 | 3300047318 | Bacteria | 1688 |
| 644 | Ga0495672_0004155 | 3300047320 | Bacteria | 12028 |
| 645 | Ga0495672_0006267 | 3300047320 | Bacteria | 9263 |
| 646 | Ga0495672_0009832 | 3300047320 | Bacteria | 6881 |
| 647 | Ga0495672_0012131 | 3300047320 | Bacteria | 6031 |
| 648 | Ga0495672_0014870 | 3300047320 | Bacteria | 5307 |
| 649 | Ga0495672_0017964 | 3300047320 | Bacteria | 4711 |
| 650 | Ga0495672_0028092 | 3300047320 | Bacteria | 3565 |
| 651 | Ga0495672_0036894 | 3300047320 | Bacteria | 2996 |
| 652 | Ga0495672_0043478 | 3300047320 | Bacteria | 2701 |
| 653 | Ga0495672_0070534 | 3300047320 | Bacteria | 1979 |
| 654 | Ga0495676_0009590 | 3300047321 | Bacteria | 8812 |
| 655 | Ga0495676_0014910 | 3300047321 | Bacteria | 6940 |
| 656 | Ga0495680_0015051 | 3300047322 | Bacteria | 6681 |
| 657 | Ga0495683_0002818 | 3300047323 | Bacteria | 10299 |
| 658 | Ga0495683_0006617 | 3300047323 | Bacteria | 6319 |
| 659 | Ga0495683_0006882 | 3300047323 | Bacteria | 6180 |
| 660 | Ga0495683_0011089 | 3300047323 | Bacteria | 4749 |
| 661 | Ga0495683_0020628 | 3300047323 | Bacteria | 3398 |
| 662 | Ga0495687_004666 | 3300047443 | Bacteria | 9142 |
| 663 | Ga0495677_0001534 | 3300047445 | Bacteria | 9295 |
| 664 | Ga0495679_001694 | 3300047446 | Bacteria | 12224 |
| 665 | Ga0495679_002209 | 3300047446 | Bacteria | 10155 |
| 666 | Ga0495679_003346 | 3300047446 | Bacteria | 7745 |
| 667 | Ga0495679_003616 | 3300047446 | Bacteria | 7385 |
| 668 | Ga0495679_004676 | 3300047446 | Bacteria | 6233 |
| 669 | Ga0495679_006204 | 3300047446 | Bacteria | 5183 |
| 670 | Ga0495679_006216 | 3300047446 | Bacteria | 5176 |
| 671 | Ga0495679_006628 | 3300047446 | Bacteria | 4952 |
| 672 | Ga0495679_009587 | 3300047446 | Bacteria | 3863 |
| 673 | Ga0495685_022289 | 3300047447 | Bacteria | 2180 |
| 674 | Ga0495673_0001169 | 3300047469 | Bacteria | 22204 |
| 675 | Ga0495673_0001891 | 3300047469 | Bacteria | 15706 |
| 676 | Ga0495673_0005871 | 3300047469 | Bacteria | 7337 |
| 677 | Ga0495673_0009086 | 3300047469 | Bacteria | 5522 |
| 678 | Ga0495673_0011477 | 3300047469 | Bacteria | 4760 |
| 679 | Ga0495673_0013258 | 3300047469 | Bacteria | 4337 |
| 680 | Ga0495673_0016605 | 3300047469 | Bacteria | 3760 |
| 681 | Ga0495673_0016936 | 3300047469 | Bacteria | 3713 |
| 682 | Ga0495673_0020857 | 3300047469 | Bacteria | 3252 |
| 683 | Ga0495673_0050800 | 3300047469 | Bacteria | 1818 |
| 684 | Ga0495673_0055041 | 3300047469 | Bacteria | 1727 |
| 685 | Ga0495673_0059912 | 3300047469 | Bacteria | 1634 |
| 686 | Ga0495681_0001406 | 3300047470 | Bacteria | 18110 |
| 687 | Ga0495681_0002513 | 3300047470 | Bacteria | 13070 |
| 688 | Ga0495681_0004159 | 3300047470 | Bacteria | 9943 |
| 689 | Ga0495681_0004595 | 3300047470 | Bacteria | 9390 |
| 690 | Ga0495681_0005224 | 3300047470 | Bacteria | 8724 |
| 691 | Ga0495681_0005520 | 3300047470 | Bacteria | 8450 |
| 692 | Ga0495681_0006689 | 3300047470 | Bacteria | 7525 |
| 693 | Ga0495681_0008969 | 3300047470 | Bacteria | 6207 |
| 694 | Ga0495681_0016378 | 3300047470 | Bacteria | 4156 |
| 695 | Ga0495681_0016644 | 3300047470 | Bacteria | 4111 |
| 696 | Ga0495681_0018682 | 3300047470 | Bacteria | 3810 |
| 697 | Ga0495681_0021833 | 3300047470 | Bacteria | 3439 |
| 698 | Ga0495681_0025858 | 3300047470 | Bacteria | 3066 |
| 699 | Ga0495681_0040351 | 3300047470 | Bacteria | 2273 |
| 700 | Ga0495684_0006812 | 3300047471 | Bacteria | 8875 |
| 701 | Ga0495686_0004224 | 3300047472 | Bacteria | 11915 |
| 702 | Ga0495686_0006367 | 3300047472 | Bacteria | 9055 |
| 703 | Ga0495686_0010314 | 3300047472 | Bacteria | 6654 |
| 704 | Ga0495686_0011142 | 3300047472 | Bacteria | 6349 |
| 705 | Ga0495593_0035075 | 3300047673 | Bacteria | 2725 |
| 706 | Ga0495602_0011116 | 3300048088 | Bacteria | 9318 |
| 707 | Ga0495626_0001673 | 3300048091 | Bacteria | 17122 |
| 708 | Ga0495626_0002707 | 3300048091 | Bacteria | 11966 |
| 709 | Ga0495626_0002734 | 3300048091 | Bacteria | 11877 |
| 710 | Ga0495626_0005618 | 3300048091 | Bacteria | 7272 |
| 711 | Ga0495626_0007381 | 3300048091 | Bacteria | 6122 |
| 712 | Ga0495626_0038476 | 3300048091 | Bacteria | 2267 |
| 713 | Ga0495626_0064269 | 3300048091 | Bacteria | 1662 |
| 714 | Ga0496110_0012302 | 3300048913 | Bacteria | 7035 |
| 715 | Ga0496110_0052287 | 3300048913 | Bacteria | 3590 |
| 716 | Ga0496112_0041804 | 3300048915 | Bacteria | 4485 |
| 717 | Ga0496114_0003710 | 3300048917 | Bacteria | 11755 |
| 718 | Ga0496114_0008255 | 3300048917 | Bacteria | 8253 |
| 719 | Ga0496116_0008826 | 3300048919 | Bacteria | 8683 |
| 720 | Ga0496116_0010146 | 3300048919 | Bacteria | 7931 |
| 721 | Ga0496116_0014755 | 3300048919 | Bacteria | 6215 |
| 722 | Ga0496116_0015568 | 3300048919 | Bacteria | 6007 |
| 723 | Ga0496117_0003925 | 3300048920 | Bacteria | 16839 |
| 724 | Ga0496117_0004907 | 3300048920 | Bacteria | 14389 |
| 725 | Ga0496117_0006652 | 3300048920 | Bacteria | 11584 |
| 726 | Ga0496117_0011332 | 3300048920 | Bacteria | 7992 |
| 727 | Ga0496117_0014803 | 3300048920 | Bacteria | 6692 |
| 728 | Ga0496117_0016558 | 3300048920 | Bacteria | 6214 |
| 729 | Ga0496117_0022316 | 3300048920 | Bacteria | 5080 |
| 730 | Ga0496117_0023398 | 3300048920 | Bacteria | 4925 |
| 731 | Ga0496117_0030027 | 3300048920 | Bacteria | 4178 |
| 732 | Ga0496118_0004556 | 3300048921 | Bacteria | 16345 |
| 733 | Ga0496118_0008672 | 3300048921 | Bacteria | 10453 |
| 734 | Ga0496118_0009324 | 3300048921 | Bacteria | 9945 |
| 735 | Ga0496118_0010502 | 3300048921 | Bacteria | 9166 |
| 736 | Ga0496118_0014025 | 3300048921 | Bacteria | 7526 |
| 737 | Ga0496118_0014352 | 3300048921 | Bacteria | 7424 |
| 738 | Ga0496118_0017304 | 3300048921 | Bacteria | 6569 |
| 739 | Ga0496118_0056549 | 3300048921 | Bacteria | 2948 |
| 740 | Ga0496118_0113366 | 3300048921 | Bacteria | 1791 |
| 741 | Ga0496119_0000440 | 3300048922 | Bacteria | 57014 |
| 742 | Ga0496119_0013322 | 3300048922 | Bacteria | 6569 |
| 743 | Ga0496119_0014553 | 3300048922 | Bacteria | 6140 |
| 744 | Ga0496119_0015498 | 3300048922 | Bacteria | 5862 |
| 745 | Ga0496119_0018568 | 3300048922 | Bacteria | 5169 |
| 746 | Ga0496119_0139686 | 3300048922 | Bacteria | 1309 |
| 747 | Ga0496120_0007247 | 3300048923 | Bacteria | 8296 |
| 748 | Ga0496120_0012544 | 3300048923 | Bacteria | 5763 |
| 749 | Ga0496120_0024452 | 3300048923 | Bacteria | 3766 |
| 750 | Ga0496120_0026779 | 3300048923 | Bacteria | 3556 |
| 751 | Ga0496120_0030199 | 3300048923 | Bacteria | 3298 |
| 752 | Ga0496121_0006860 | 3300048924 | Bacteria | 13920 |
| 753 | Ga0496121_0015487 | 3300048924 | Bacteria | 7986 |
| 754 | Ga0496121_0015539 | 3300048924 | Bacteria | 7960 |
| 755 | Ga0496121_0099659 | 3300048924 | Bacteria | 2245 |
| 756 | Ga0496121_0194955 | 3300048924 | Bacteria | 1449 |
| 757 | Ga0496122_0010458 | 3300048925 | Bacteria | 9555 |
| 758 | Ga0496122_0020237 | 3300048925 | Bacteria | 6025 |
| 759 | Ga0496122_0020666 | 3300048925 | Bacteria | 5933 |
| 760 | Ga0496122_0023218 | 3300048925 | Bacteria | 5478 |
| 761 | Ga0496122_0027375 | 3300048925 | Bacteria | 4876 |
| 762 | Ga0496122_0027598 | 3300048925 | Bacteria | 4847 |
| 763 | Ga0496122_0028050 | 3300048925 | Bacteria | 4793 |
| 764 | Ga0496123_0003408 | 3300048926 | Bacteria | 17889 |
| 765 | Ga0496123_0012074 | 3300048926 | Bacteria | 7408 |
| 766 | Ga0496123_0012620 | 3300048926 | Bacteria | 7181 |
| 767 | Ga0496123_0041766 | 3300048926 | Bacteria | 3174 |
| 768 | Ga0496123_0048266 | 3300048926 | Bacteria | 2865 |
| 769 | Ga0496123_0051754 | 3300048926 | Bacteria | 2732 |
| 770 | Ga0496124_0000189 | 3300048927 | Bacteria | 121800 |
| 771 | Ga0496124_0004424 | 3300048927 | Bacteria | 16391 |
| 772 | Ga0496124_0004945 | 3300048927 | Bacteria | 15273 |
| 773 | Ga0496124_0005429 | 3300048927 | Bacteria | 14350 |
| 774 | Ga0496124_0016814 | 3300048927 | Bacteria | 6934 |
| 775 | Ga0496124_0016947 | 3300048927 | Bacteria | 6900 |
| 776 | Ga0496124_0064260 | 3300048927 | Bacteria | 3064 |
| 777 | Ga0496124_0067240 | 3300048927 | Bacteria | 2982 |
| 778 | Ga0496124_0070391 | 3300048927 | Bacteria | 2902 |
| 779 | Ga0496124_0104357 | 3300048927 | Bacteria | 2292 |
| 780 | Ga0496124_0123707 | 3300048927 | Bacteria | 2063 |
| 781 | Ga0496124_0125585 | 3300048927 | Bacteria | 2044 |
| 782 | Ga0496124_0248193 | 3300048927 | Bacteria | 1318 |
| 783 | Ga0496125_0004180 | 3300048928 | Bacteria | 16828 |
| 784 | Ga0496125_0009456 | 3300048928 | Bacteria | 10009 |
| 785 | Ga0496125_0013355 | 3300048928 | Bacteria | 8080 |
| 786 | Ga0496125_0022196 | 3300048928 | Bacteria | 5899 |
| 787 | Ga0496125_0024793 | 3300048928 | Bacteria | 5507 |
| 788 | Ga0496125_0040435 | 3300048928 | Bacteria | 4000 |
| 789 | Ga0496125_0041790 | 3300048928 | Bacteria | 3914 |
| 790 | Ga0496125_0059085 | 3300048928 | Bacteria | 3092 |
| 791 | Ga0496125_0116680 | 3300048928 | Bacteria | 1916 |
| 792 | Ga0496126_0006377 | 3300048929 | Bacteria | 13161 |
| 793 | Ga0496126_0024616 | 3300048929 | Bacteria | 5808 |
| 794 | Ga0496126_0034907 | 3300048929 | Bacteria | 4717 |
| 795 | Ga0496126_0153609 | 3300048929 | Bacteria | 1971 |
| 796 | Ga0495678_002933 | 3300049459 | Bacteria | 10900 |
| 797 | Ga0495678_003836 | 3300049459 | Bacteria | 9052 |
| 798 | Ga0495678_005611 | 3300049459 | Bacteria | 6866 |
| 799 | Ga0495678_006933 | 3300049459 | Bacteria | 5947 |
| 800 | Ga0495678_010226 | 3300049459 | Bacteria | 4571 |
| 801 | Ga0495678_010693 | 3300049459 | Bacteria | 4438 |
| 802 | Ga0495678_011333 | 3300049459 | Bacteria | 4272 |
| 803 | Ga0495678_020500 | 3300049459 | Bacteria | 2925 |
| 804 | Ga0495678_021618 | 3300049459 | Bacteria | 2829 |
| 805 | Ga0495678_025636 | 3300049459 | Bacteria | 2529 |
| 806 | Ga0495678_030419 | 3300049459 | Bacteria | 2259 |
| 807 | Ga0495678_036492 | 3300049459 | Bacteria | 2005 |
| 808 | Ga0495682_0002855 | 3300049460 | Bacteria | 7954 |
| 809 | Ga0495682_0004387 | 3300049460 | Bacteria | 6048 |
| 810 | Ga0495682_0006262 | 3300049460 | Bacteria | 4834 |
| 811 | Ga0495682_0006585 | 3300049460 | Bacteria | 4695 |
| 812 | Ga0495682_0035300 | 3300049460 | Bacteria | 1842 |
| 813 | Ga0495682_0047808 | 3300049460 | Bacteria | 1560 |
| 814 | Ga0495682_0077521 | 3300049460 | Bacteria | 1195 |
| 815 | Ga0501034_0001495 | 3300049571 | Bacteria | 30749 |
| 816 | Ga0501222_000388 | 3300049662 | Bacteria | 6691 |
| 817 | Ga0501241_000531 | 3300049758 | Bacteria | 8175 |
| 818 | nmdc:mga00v17_116573_c1 | 3300050491 | Bacteria | 1698 |
| 819 | Ga0500572_001594 | 3300053111 | Bacteria | 5998 |
| 820 | Ga0500659_0002555 | 3300053135 | Bacteria | 10921 |
| 821 | Ga0500568_0037628 | 3300053139 | Bacteria | 1962 |
| 822 | Ga0500586_034756 | 3300053145 | Bacteria | 1683 |
| 823 | Ga0500586_098279 | 3300053145 | Bacteria | 1026 |
| 824 | Ga0500634_0001344 | 3300053161 | Bacteria | 9440 |
| 825 | 2511255890 | 2511231004 | Bacteria | 6669789 |
| 826 | 2511264909 | 2511231006 | Bacteria | 6794709 |
| 827 | 2511280296 | 2511231008 | Bacteria | 6624100 |
| 828 | 2511292761 | 2511231010 | Bacteria | 6373152 |
| 829 | 2511295368 | 2511231011 | Bacteria | 6149768 |
| 830 | 2511329484 | 2511231016 | Bacteria | 6704427 |
| 831 | 2511340485 | 2511231018 | Bacteria | 6436256 |
| 832 | 2511342028 | 2511231019 | Bacteria | 6520662 |
| 833 | 2511361232 | 2511231022 | Bacteria | 6719296 |
| 834 | 2511368690 | 2511231023 | Bacteria | 6808468 |
| 835 | 2511376457 | 2511231024 | Bacteria | 5835885 |
| 836 | 2512324577 | 2512047018 | Bacteria | 6663241 |
| 837 | 2554817708 | 2554235132 | Bacteria | 6772433 |
| 838 | 2555246510 | 2554235231 | Bacteria | 5215788 |
| 839 | 2555672182 | 2554235341 | Bacteria | 6867980 |
| 840 | 2583794691 | 2582580891 | Bacteria | 6800976 |
| 841 | 2597860249 | 2597489887 | Bacteria | 6666321 |
| 842 | 2597865983 | 2597489888 | Bacteria | 6179543 |
| 843 | 2599358496 | 2599185160 | Bacteria | 6844013 |
| 844 | 2599364814 | 2599185161 | Bacteria | 6960462 |
| 845 | 2599371137 | 2599185162 | Bacteria | 6957254 |
| 846 | 2599377507 | 2599185163 | Bacteria | 6995158 |
| 847 | 2599383779 | 2599185164 | Bacteria | 6841688 |
| 848 | 2599390046 | 2599185165 | Bacteria | 6843250 |
| 849 | 2599396361 | 2599185166 | Bacteria | 6959206 |
| 850 | 2599401535 | 2599185167 | Bacteria | 6353609 |
| 851 | 2599408548 | 2599185168 | Bacteria | 6997636 |
| 852 | 2599453222 | 2599185179 | Bacteria | 6611171 |
| 853 | 2599465428 | 2599185181 | Bacteria | 6844519 |
| 854 | 2599471770 | 2599185182 | Bacteria | 6883168 |
| 855 | 2599486911 | 2599185185 | Bacteria | 6652270 |
| 856 | 2599494272 | 2599185186 | Bacteria | 6831633 |
| 857 | 2599505255 | 2599185188 | Bacteria | 6164180 |
| 858 | 2599509974 | 2599185189 | Bacteria | 5862825 |
| 859 | 2599515230 | 2599185190 | Bacteria | 6285678 |
| 860 | 2599520410 | 2599185191 | Bacteria | 6297582 |
| 861 | 2599615302 | 2599185212 | Bacteria | 6765997 |
| 862 | 2599806965 | 2599185257 | Bacteria | 6492581 |
| 863 | 2599881828 | 2599185288 | Bacteria | 6666191 |
| 864 | 2599889826 | 2599185289 | Bacteria | 6778765 |
| 865 | 2599894610 | 2599185290 | Bacteria | 6289611 |
| 866 | 2599901382 | 2599185291 | Bacteria | 6775623 |
| 867 | 2599934906 | 2599185300 | Bacteria | 6062622 |
| 868 | 2599945857 | 2599185302 | Bacteria | 5954930 |
| 869 | 2599949473 | 2599185303 | Bacteria | 6512725 |
| 870 | 2599956789 | 2599185304 | Bacteria | 5951361 |
| 871 | 2599963290 | 2599185305 | Bacteria | 6748700 |
| 872 | 2599967525 | 2599185306 | Bacteria | 6637356 |
| 873 | 2599980158 | 2599185308 | Bacteria | 6621546 |
| 874 | 2599986754 | 2599185309 | Bacteria | 5969593 |
| 875 | 2599991746 | 2599185310 | Bacteria | 6014457 |
| 876 | 2599997580 | 2599185311 | Bacteria | 6354990 |
| 877 | 2600002702 | 2599185312 | Bacteria | 5912071 |
| 878 | 2600008047 | 2599185313 | Bacteria | 6658188 |
| 879 | 2600014005 | 2599185314 | Bacteria | 6621749 |
| 880 | 2600021181 | 2599185315 | Bacteria | 6771107 |
| 881 | 2600026806 | 2599185316 | Bacteria | 6320029 |
| 882 | 2600033054 | 2599185317 | Bacteria | 6435722 |
| 883 | 2600037934 | 2599185318 | Bacteria | 6961590 |
| 884 | 2600043580 | 2599185319 | Bacteria | 6637840 |
| 885 | 2600050303 | 2599185320 | Bacteria | 5963263 |
| 886 | 2600056277 | 2599185321 | Bacteria | 6764560 |
| 887 | 2600061836 | 2599185322 | Bacteria | 6763055 |
| 888 | 2600067005 | 2599185323 | Bacteria | 6688755 |
| 889 | 2600074002 | 2599185324 | Bacteria | 6590677 |
| 890 | 2600080495 | 2599185325 | Bacteria | 6324919 |
| 891 | 2600211662 | 2599185356 | Bacteria | 6843884 |
| 892 | 2600362329 | 2600254930 | Bacteria | 6431253 |
| 893 | 2600444972 | 2600254954 | Bacteria | 5100516 |
| 894 | 2601694072 | 2600255296 | Bacteria | 5784754 |
| 895 | 2601771827 | 2600255313 | Bacteria | 6842543 |
| 896 | 2601800360 | 2600255318 | Bacteria | 6383414 |
| 897 | 2602012078 | 2600255389 | Bacteria | 5275336 |
| 898 | 2606078831 | 2603880185 | Bacteria | 6379190 |
| 899 | 2606125508 | 2603880199 | Bacteria | 6377649 |
| 900 | 2608380962 | 2606217733 | Bacteria | 6360972 |
| 901 | 2621297509 | 2619619299 | Bacteria | 6649820 |
| 902 | 2624482775 | 2623620443 | Bacteria | 6427864 |
| 903 | 2643844692 | 2643221565 | Bacteria | 6216018 |
| 904 | 2643869506 | 2643221571 | Bacteria | 6228673 |
| 905 | 2644284606 | 2643221650 | Bacteria | 7029547 |
| 906 | 2644621197 | 2643221713 | Bacteria | 6554480 |
| 907 | 2671094063 | 2667528170 | Bacteria | 6786960 |
| 908 | 2671100988 | 2667528171 | Bacteria | 6900659 |
| 909 | 2671130025 | 2667528176 | Bacteria | 6724917 |
| 910 | 2671773476 | 2671180172 | Bacteria | 6495783 |
| 911 | 2677895717 | 2675903420 | Bacteria | 6247433 |
| 912 | 2678265346 | 2675903515 | Bacteria | 6580491 |
| 913 | 2715752212 | 2713897148 | Bacteria | 5883533 |
| 914 | 2715758950 | 2713897149 | Bacteria | 6506249 |
| 915 | 2718635987 | 2718217725 | Bacteria | 5758958 |
| 916 | 2723250715 | 2721755607 | Bacteria | 5841722 |
| 917 | 2738672758 | 2738541265 | Bacteria | 6594665 |
| 918 | 2738751151 | 2738541282 | Bacteria | 6593925 |
| 919 | 2738811961 | 2738541294 | Bacteria | 6925949 |
| 920 | 2738860192 | 2738541303 | Bacteria | 6591772 |
| 921 | 2738899321 | 2738541309 | Bacteria | 6926455 |
| 922 | 2739290080 | 2738543020 | Bacteria | 5718238 |
| 923 | 2739295392 | 2738543021 | Bacteria | 5718241 |
| 924 | 2739316327 | 2738543025 | Bacteria | 6600348 |
| 925 | 2743739790 | 2740892503 | Bacteria | 6855563 |
| 926 | 2745005800 | 2744054620 | Bacteria | 6551379 |
| 927 | 2765586033 | 2765235841 | Bacteria | 6137024 |
| 928 | 2774121680 | 2773857670 | Bacteria | 6407454 |
| 929 | 2784262448 | 2784132063 | Bacteria | 6262788 |
| 930 | 2784316941 | 2784132072 | Bacteria | 6596533 |
| 931 | 2794598338 | 2791355520 | Bacteria | 5948615 |
| 932 | 2807406463 | 2806310737 | Bacteria | 5751088 |
| 933 | 2807454816 | 2806310745 | Bacteria | 5742165 |
| 934 | 2808906833 | 2808606373 | Bacteria | 4423627 |
| 935 | 2808952861 | 2808606381 | Bacteria | 6646461 |
| 936 | 2808959148 | 2808606382 | Bacteria | 6841132 |
| 937 | 2808977767 | 2808606385 | Bacteria | 6711065 |
| 938 | 2808992576 | 2808606388 | Bacteria | 6706662 |
| 939 | 2809219403 | 2808606445 | Bacteria | 6057339 |
| 940 | 2812370566 | 2811994881 | Bacteria | 6298475 |
| 941 | 2817493367 | 2816332298 | Bacteria | 6852809 |
| 942 | 2819659063 | 2818991456 | Bacteria | 6123676 |
| 943 | 2819700263 | 2818991464 | Bacteria | 6907494 |
| 944 | 2823422387 | 2823421272 | Bacteria | 5372474 |
| 945 | 2825655761 | 2825651385 | Bacteria | 6715909 |
| 946 | 2834033383 | 2834028612 | Bacteria | 6354979 |
| 947 | 2842808261 | 2842805378 | Bacteria | 5385175 |
| 948 | 2842831751 | 2842826826 | Bacteria | 5974129 |
| 949 | 2842837092 | 2842832357 | Bacteria | 5959113 |
| 950 | 2842843297 | 2842837860 | Bacteria | 6066181 |
| 951 | 2842847830 | 2842843487 | Bacteria | 6004777 |
| 952 | 2844666349 | 2844665904 | Bacteria | 6817974 |
| 953 | 2852618289 | 2852612431 | Bacteria | 6885235 |
| 954 | 2852663098 | 2852657418 | Bacteria | 6472974 |
| 955 | 2852673347 | 2852667396 | Bacteria | 6885555 |
| 956 | 2860872406 | 2860867994 | Bacteria | 5645326 |
| 957 | 2878034707 | 2878029506 | Bacteria | 6418441 |
| 958 | 2880235355 | 2880230671 | Bacteria | 6140320 |
| 959 | 2904523082 | 2904518522 | Bacteria | 6068986 |
| 960 | 2908451919 | 2908446538 | Bacteria | 6829095 |
| 961 | 2912968315 | 2912963787 | Bacteria | 5646108 |
| 962 | 2913041893 | 2913036834 | Bacteria | 6704877 |
| 963 | 2917076061 | 2917070673 | Bacteria | 6868303 |
| 964 | 2919067912 | 2919063839 | Bacteria | 6302690 |
| 965 | 2919159855 | 2919155634 | Bacteria | 4860545 |
| 966 | 2919390798 | 2919385768 | Bacteria | 5897293 |
| 967 | 2919461875 | 2919456309 | Bacteria | 6586567 |
| 968 | 2919487532 | 2919481497 | Bacteria | 6907839 |
| 969 | 2919491077 | 2919487758 | Bacteria | 5929766 |
| 970 | 2919506237 | 2919501602 | Bacteria | 5286340 |
| 971 | 2923158880 | 2923153595 | Bacteria | 6870622 |
| 972 | 2923524663 | 2923519811 | Bacteria | 6298479 |
| 973 | 2926067733 | 2926063275 | Bacteria | 5285848 |
| 974 | 2929149275 | 2929144301 | Bacteria | 6622272 |
| 975 | 2929194518 | 2929189879 | Bacteria | 5930554 |
| 976 | 2931373308 | 2931369376 | Bacteria | 6847892 |
| 977 | 2931395800 | 2931390751 | Bacteria | 6273349 |
| 978 | 2939654772 | 2939651529 | Bacteria | 5895393 |
| 979 | 2945931543 | 2945928738 | Bacteria | 6053221 |
| 980 | 2945968011 | 2945961074 | Bacteria | 7342064 |
| 981 | 2946007608 | 2946006987 | Bacteria | 6705746 |
| 982 | 2946033001 | 2946027586 | Bacteria | 6049274 |
| 983 | 2947233757 | 2947233263 | Bacteria | 6439278 |
| 984 | 2969309523 | 2969304461 | Bacteria | 6601805 |
| 985 | 2974294741 | 2974289157 | Bacteria | 6080362 |
| 986 | 2984287293 | 2984286254 | Bacteria | 6702062 |
| 987 | 2998144776 | 2998139840 | Bacteria | 6073514 |
| 988 | 3007254155 | 3007252601 | Bacteria | 4559114 |
| 989 | 3007317107 | 3007315729 | Bacteria | 5076637 |
| 990 | 3007398505 | 3007395558 | Bacteria | 6755444 |
| 991 | 3007425193 | 3007419365 | Bacteria | 7026924 |
| 992 | 3007516531 | 3007511990 | Bacteria | 6481491 |
| 993 | 3007724076 | 3007718800 | Bacteria | 5971527 |
| 994 | 3007805489 | 3007803356 | Bacteria | 5931491 |
| 995 | 3007859987 | 3007855910 | Bacteria | 5637581 |
| 996 | 3007866233 | 3007861166 | Bacteria | 6045338 |
| 997 | 3007871067 | 3007866637 | Bacteria | 5899198 |
| 998 | 8015692966 | 8015687852 | Bacteria | 6613826 |
| 999 | 8019775409 | 8019769354 | Bacteria | 6924660 |
| 1000 | 8029996119 | 8029995093 | Bacteria | 5990776 |
| 1001 | 8034966595 | 8034962539 | Bacteria | 4884839 |
| 1002 | 8052495401 | 8052494512 | Bacteria | 5765634 |
| 1003 | 8054288963 | 8054285046 | Bacteria | 6919322 |
| 1004 | 8054353152 | 8054347763 | Bacteria | 5901107 |
| 1005 | 8054508301 | 8054503363 | Bacteria | 6101651 |
| 1006 | 8054933746 | 8054929484 | Bacteria | 5599761 |
| 1007 | 8055776213 | 8055770955 | Bacteria | 6827675 |
| 1008 | 8055823247 | 8055817908 | Bacteria | 6609162 |
| 1009 | 8055882456 | 8055878733 | Bacteria | 5907058 |
| 1010 | 8056117053 | 8056115690 | Bacteria | 5527654 |
| 1011 | 8056125242 | 8056120720 | Bacteria | 5758328 |
| 1012 | 8056136658 | 8056131705 | Bacteria | 6107031 |
| 1013 | 8056138219 | 8056137416 | Bacteria | 6147080 |
| 1014 | 8056150682 | 8056148874 | Bacteria | 6479865 |
| 1015 | 8056162947 | 8056161164 | Bacteria | 6106669 |
| 1016 | 8056171791 | 8056166840 | Bacteria | 5820959 |
| 1017 | 8056172473 | 8056172158 | Bacteria | 6133900 |
| 1018 | 8056180012 | 8056177738 | Bacteria | 6748268 |
| 1019 | 8056571801 | 8056569372 | Bacteria | 5997322 |
| 1020 | 8057805062 | 8057798959 | Bacteria | 6713499 |
| 1021 | Ga0496125_0017767 | |||
| 1022 | MRS2a_Contig_732 | |||
| 1023 | JGI25162J39368_1000495 | |||
| 1024 | JGI25163J39215_1000771 | |||
| 1025 | JGI25164J39214_1000199 | |||
| 1026 | JGI25165J46597_1000357 | |||
| 1027 | Ga0055538_1000087 | |||
| 1028 | Ga0055539_1000131 | |||
| 1029 | Ga0055533_1000134 | |||
| 1030 | Ga0055532_1000247 | |||
| 1031 | Ga0055525_1000253 | |||
| 1032 | Ga0055536_1000308 | |||
| 1033 | Ga0055536_1003749 | |||
| 1034 | Ga0055530_10001166 | |||
| 1035 | Ga0055530_10001277 | |||
| 1036 | Ga0055530_10001378 | |||
| 1037 | Ga0055540_1000850 | |||
| 1038 | Ga0055540_1000888 | |||
| 1039 | Ga0055540_1015263 | |||
| 1040 | Ga0055531_10000593 | |||
| 1041 | Ga0055541_1000086 | |||
| 1042 | Ga0065714_10000659 | |||
| 1043 | Ga0065714_10013314 | |||
| 1044 | Ga0065714_10068377 | |||
| 1045 | Ga0065714_10069407 | |||
| 1046 | Ga0065714_10080849 | |||
| 1047 | Ga0065704_10084008 | |||
| 1048 | Ga0070670_100004257 | |||
| 1049 | Ga0070670_100005003 | |||
| 1050 | Ga0070661_100002878 | |||
| 1051 | Ga0070661_100228279 | |||
| 1052 | Ga0070669_100001802 | |||
| 1053 | Ga0070669_100008090 | |||
| 1054 | Ga0070674_100257168 | |||
| 1055 | Ga0070662_100000361 | |||
| 1056 | Ga0070662_100060541 | |||
| 1057 | Ga0068853_100000313 | |||
| 1058 | Ga0070665_100090861 | |||
| 1059 | Ga0070664_100005028 | |||
| 1060 | Ga0068854_100026910 | |||
| 1061 | Ga0068851_10000002 | |||
| 1062 | Ga0075364_10018756 | |||
| 1063 | Ga0075364_10047874 | |||
| 1064 | Ga0075432_10040942 | |||
| 1065 | Ga0075432_10112133 | |||
| 1066 | Ga0099823_1019775 | |||
| 1067 | Ga0079104_1048302 | |||
| 1068 | Ga0105251_10002056 | |||
| 1069 | Ga0105251_10002820 | |||
| 1070 | Ga0105251_10002932 | |||
| 1071 | Ga0105251_10003002 | |||
| 1072 | Ga0105251_10013777 | |||
| 1073 | Ga0105251_10055970 | |||
| 1074 | Ga0105251_10104656 | |||
| 1075 | Ga0105244_10005967 | |||
| 1076 | Ga0105244_10006104 | |||
| 1077 | Ga0105244_10009115 | |||
| 1078 | Ga0105244_10009276 | |||
| 1079 | Ga0105244_10010129 | |||
| 1080 | Ga0105244_10011212 | |||
| 1081 | Ga0105244_10016608 | |||
| 1082 | Ga0105244_10024519 | |||
| 1083 | Ga0105244_10040057 | |||
| 1084 | Ga0105244_10053644 | |||
| 1085 | Ga0105244_10055459 | |||
| 1086 | Ga0105250_10001642 | |||
| 1087 | Ga0105250_10004524 | |||
| 1088 | Ga0105250_10004951 | |||
| 1089 | Ga0105250_10014038 | |||
| 1090 | Ga0105250_10015158 | |||
| 1091 | Ga0105250_10017058 | |||
| 1092 | Ga0105243_10001506 | |||
| 1093 | Ga0105243_10022104 | |||
| 1094 | Ga0105242_10000269 | |||
| 1095 | Ga0105242_10091427 | |||
| 1096 | Ga0105248_10315105 | |||
| 1097 | Ga0105237_10007268 | |||
| 1098 | Ga0105246_10003123 | |||
| 1099 | Ga0105246_10006503 | |||
| 1100 | Ga0105246_10405092 | |||
| 1101 | Ga0157345_1000108 | |||
| 1102 | Ga0157347_1000402 | |||
| 1103 | Ga0157373_10004521 | |||
| 1104 | Ga0157373_10006106 | |||
| 1105 | Ga0157373_10011740 | |||
| 1106 | Ga0157373_10013757 | |||
| 1107 | Ga0157373_10015941 | |||
| 1108 | Ga0157373_10066888 | |||
| 1109 | Ga0157371_10022439 | |||
| 1110 | Ga0157371_10073800 | |||
| 1111 | Ga0157371_10340642 | |||
| 1112 | Ga0157370_10009081 | |||
| 1113 | Ga0157370_10137448 | |||
| 1114 | Ga0157370_10216460 | |||
| 1115 | Ga0157370_10257003 | |||
| 1116 | Ga0157370_10387447 | |||
| 1117 | Ga0157369_10019415 | |||
| 1118 | Ga0157369_10034789 | |||
| 1119 | Ga0157369_10038269 | |||
| 1120 | Ga0157369_10064584 | |||
| 1121 | Ga0157369_10075394 | |||
| 1122 | Ga0157369_10141428 | |||
| 1123 | Ga0157369_10190634 | |||
| 1124 | Ga0163162_10001936 | |||
| 1125 | Ga0163162_10085880 | |||
| 1126 | Ga0157372_10001371 | |||
| 1127 | Ga0157372_10004094 | |||
| 1128 | Ga0157375_10004852 | |||
| 1129 | Ga0157375_10009996 | |||
| 1130 | Ga0157375_10050530 | |||
| 1131 | Ga0182008_10002348 | |||
| 1132 | Ga0182008_10002423 | |||
| 1133 | Ga0182008_10006796 | |||
| 1134 | Ga0182008_10018558 | |||
| 1135 | Ga0182006_1001958 | |||
| 1136 | Ga0182006_1002388 | |||
| 1137 | Ga0182006_1009276 | |||
| 1138 | Ga0182006_1010927 | |||
| 1139 | Ga0182006_1059416 | |||
| 1140 | Ga0182007_10002635 | |||
| 1141 | Ga0182005_1009784 | |||
| 1142 | Ga0163161_10010599 | |||
| 1143 | Ga0163161_10016499 | |||
| 1144 | Ga0163161_10023424 | |||
| 1145 | Ga0163161_10025372 | |||
| 1146 | Ga0163161_10053897 | |||
| 1147 | Ga0163161_10243037 | |||
| 1148 | Ga0209435_100608 | |||
| 1149 | Ga0209760_100182 | |||
| 1150 | Ga0209784_100124 | |||
| 1151 | Ga0209566_100150 | |||
| 1152 | Ga0209674_100173 | |||
| 1153 | Ga0209147_100175 | |||
| 1154 | Ga0209563_100149 | |||
| 1155 | Ga0207427_100200 | |||
| 1156 | Ga0209437_100011 | |||
| 1157 | Ga0209437_104516 | |||
| 1158 | Ga0209258_100343 | |||
| 1159 | Ga0209646_1000262 | |||
| 1160 | Ga0209677_100122 | |||
| 1161 | Ga0209233_1000019 | |||
| 1162 | Ga0209676_1000076 | |||
| 1163 | Ga0209676_1000914 | |||
| 1164 | Ga0209050_1000063 | |||
| 1165 | Ga0209050_1000679 | |||
| 1166 | Ga0209050_1000943 | |||
| 1167 | Ga0209051_1000045 | |||
| 1168 | Ga0209051_1000484 | |||
| 1169 | Ga0209051_1000700 | |||
| 1170 | Ga0209257_1000680 | |||
| 1171 | Ga0209257_1008505 | |||
| 1172 | Ga0207656_10000030 | |||
| 1173 | Ga0207696_1000047 | |||
| 1174 | Ga0207696_1000065 | |||
| 1175 | Ga0207696_1000656 | |||
| 1176 | Ga0207696_1000890 | |||
| 1177 | Ga0207696_1006147 | |||
| 1178 | Ga0207696_1007822 | |||
| 1179 | Ga0207696_1011015 | |||
| 1180 | Ga0207696_1012815 | |||
| 1181 | Ga0207696_1033135 | |||
| 1182 | Ga0207655_1000957 | |||
| 1183 | Ga0207655_1001804 | |||
| 1184 | Ga0207655_1001982 | |||
| 1185 | Ga0207655_1002049 | |||
| 1186 | Ga0207655_1003080 | |||
| 1187 | Ga0207655_1003592 | |||
| 1188 | Ga0207655_1010675 | |||
| 1189 | Ga0207655_1010735 | |||
| 1190 | Ga0207655_1011077 | |||
| 1191 | Ga0207655_1014471 | |||
| 1192 | Ga0207655_1020818 | |||
| 1193 | Ga0207655_1021800 | |||
| 1194 | Ga0207655_1032113 | |||
| 1195 | Ga0207713_1001322 | |||
| 1196 | Ga0207713_1001708 | |||
| 1197 | Ga0207713_1001824 | |||
| 1198 | Ga0207713_1002434 | |||
| 1199 | Ga0207713_1002481 | |||
| 1200 | Ga0207713_1002578 | |||
| 1201 | Ga0207713_1002627 | |||
| 1202 | Ga0207713_1003903 | |||
| 1203 | Ga0207713_1008889 | |||
| 1204 | Ga0207713_1008913 | |||
| 1205 | Ga0207713_1010305 | |||
| 1206 | Ga0207713_1016788 | |||
| 1207 | Ga0207713_1048675 | |||
| 1208 | Ga0207671_10000060 | |||
| 1209 | Ga0207649_10000023 | |||
| 1210 | Ga0207681_10003036 | |||
| 1211 | Ga0207681_10026706 | |||
| 1212 | Ga0207650_10002221 | |||
| 1213 | Ga0207650_10002862 | |||
| 1214 | Ga0207706_10000600 | |||
| 1215 | Ga0207706_10069638 | |||
| 1216 | Ga0207686_10036537 | |||
| 1217 | Ga0207709_10000030 | |||
| 1218 | Ga0207709_10011840 | |||
| 1219 | Ga0207709_10023284 | |||
| 1220 | Ga0207679_10000017 | |||
| 1221 | Ga0207639_10000420 | |||
| 1222 | Ga0209281_1006811 | |||
| 1223 | Ga0209281_1014165 | |||
| 1224 | Ga0209389_1000112 | |||
| 1225 | Ga0209371_1000094 | |||
| 1226 | Ga0209371_1000463 | |||
| 1227 | Ga0268266_10009045 | |||
| 1228 | Ga0307517_10086497 | |||
| 1229 | Ga0268256_1000083 | |||
| 1230 | Ga0268256_1000335 | |||
| 1231 | Ga0307511_10114580 | |||
| 1232 | Ga0316177_1129951 | |||
| 1233 | Ga0314311_1265431 | |||
| 1234 | Ga0316178_1020704 | |||
| 1235 | Ga0316183_1165638 | |||
| 1236 | Ga0316181_1136229 | |||
| 1237 | Ga0265316_10171930 | |||
| 1238 | Ga0307509_10019083 | |||
| 1239 | Ga0307408_100000013 | |||
| 1240 | Ga0307408_100002504 | |||
| 1241 | Ga0307408_100006863 | |||
| 1242 | Ga0307408_100007662 | |||
| 1243 | Ga0307408_100575058 | |||
| 1244 | Ga0307405_10000713 | |||
| 1245 | Ga0307405_10001540 | |||
| 1246 | Ga0307405_10008941 | |||
| 1247 | Ga0307406_10019930 | |||
| 1248 | Ga0307412_10004479 | |||
| 1249 | Ga0307412_10031809 | |||
| 1250 | Ga0307412_10052866 | |||
| 1251 | Ga0307412_10145463 | |||
| 1252 | Ga0307409_100016185 | |||
| 1253 | Ga0307416_100028319 | |||
| 1254 | Ga0307416_100224466 | |||
| 1255 | Ga0307414_10018940 | |||
| 1256 | Ga0307411_10035332 | |||
| 1257 | Ga0307510_10021026 | |||
| 1258 | Ga0237819_00468 | |||
| 1259 | Ga0436363_0609281 | |||
| 1260 | Ga0439438_000581 | |||
| 1261 | Ga0439438_001902 | |||
| 1262 | Ga0439438_003158 | |||
| 1263 | Ga0439438_003951 | |||
| 1264 | Ga0439438_015173 | |||
| 1265 | Ga0439438_020811 | |||
| 1266 | Ga0439447_000137 | |||
| 1267 | Ga0439447_000812 | |||
| 1268 | Ga0439447_006720 | |||
| 1269 | Ga0439447_006854 | |||
| 1270 | Ga0439447_008057 | |||
| 1271 | Ga0439447_011798 | |||
| 1272 | Ga0439466_0000506 | |||
| 1273 | Ga0439466_0003235 | |||
| 1274 | Ga0439466_0003565 | |||
| 1275 | Ga0439466_0006784 | |||
| 1276 | Ga0439466_0009328 | |||
| 1277 | Ga0439466_0013689 | |||
| 1278 | Ga0439465_0042481 | |||
| 1279 | Ga0439431_0000700 | |||
| 1280 | Ga0439431_0007872 | |||
| 1281 | Ga0439437_000087 | |||
| 1282 | Ga0439445_0015035 | |||
| 1283 | Ga0439432_000810 | |||
| 1284 | Ga0439432_001285 | |||
| 1285 | Ga0439432_002646 | |||
| 1286 | Ga0439432_010700 | |||
| 1287 | Ga0439451_005890 | |||
| 1288 | Ga0439451_007457 | |||
| 1289 | Ga0439452_000738 | |||
| 1290 | Ga0439452_000785 | |||
| 1291 | Ga0439452_000922 | |||
| 1292 | Ga0439452_001239 | |||
| 1293 | Ga0439452_001978 | |||
| 1294 | Ga0439452_005696 | |||
| 1295 | Ga0439456_000171 | |||
| 1296 | Ga0439456_003377 | |||
| 1297 | Ga0439456_018683 | |||
| 1298 | Ga0439456_026738 | |||
| 1299 | Ga0439456_032386 | |||
| 1300 | Ga0439463_000208 | |||
| 1301 | Ga0450911_000020 | |||
| 1302 | Ga0450911_002090 | |||
| 1303 | Ga0450911_002565 | |||
| 1304 | Ga0450898_000800 | |||
| 1305 | Ga0450900_000840 | |||
| 1306 | Ga0450902_000374 | |||
| 1307 | Ga0450902_004374 | |||
| 1308 | Ga0450902_012212 | |||
| 1309 | Ga0450902_012604 | |||
| 1310 | Ga0450902_026900 | |||
| 1311 | Ga0450903_001409 | |||
| 1312 | Ga0450903_003317 | |||
| 1313 | Ga0450904_000118 | |||
| 1314 | Ga0450904_001259 | |||
| 1315 | Ga0450904_001336 | |||
| 1316 | Ga0450905_004849 | |||
| 1317 | Ga0450905_008235 | |||
| 1318 | Ga0450889_002098 | |||
| 1319 | Ga0450906_000272 | |||
| 1320 | Ga0450907_000242 | |||
| 1321 | Ga0450910_003950 | |||
| 1322 | Ga0450910_007825 | |||
| 1323 | Ga0439446_0004382 | |||
| 1324 | Ga0439446_0009157 | |||
| 1325 | Ga0439446_0020211 | |||
| 1326 | Ga0439446_0054183 | |||
| 1327 | Ga0450908_004939 | |||
| 1328 | Ga0450909_000164 | |||
| 1329 | Ga0450909_000235 | |||
| 1330 | Ga0450909_008321 | |||
| 1331 | Ga0439434_0000282 | |||
| 1332 | Ga0439434_0008772 | |||
| 1333 | Ga0439464_0002337 | |||
| 1334 | Ga0439464_0003349 | |||
| 1335 | Ga0439460_0001620 | |||
| 1336 | Ga0450893_0000287 | |||
| 1337 | Ga0450893_0008905 | |||
| 1338 | Ga0450893_0022127 | |||
| 1339 | Ga0450901_000072 | |||
| 1340 | Ga0439440_0000274 | |||
| 1341 | Ga0495617_001874 | |||
| 1342 | Ga0495617_004329 | |||
| 1343 | Ga0495617_004596 | |||
| 1344 | Ga0495617_007033 | |||
| 1345 | Ga0495617_028313 | |||
| 1346 | Ga0495627_001684 | |||
| 1347 | Ga0495627_002013 | |||
| 1348 | Ga0495627_002190 | |||
| 1349 | Ga0495627_002800 | |||
| 1350 | Ga0495627_003301 | |||
| 1351 | Ga0495627_022199 | |||
| 1352 | Ga0495627_033052 | |||
| 1353 | Ga0495592_0020491 | |||
| 1354 | Ga0495603_0006830 | |||
| 1355 | Ga0495603_0010297 | |||
| 1356 | Ga0495603_0159534 | |||
| 1357 | Ga0495590_0007703 | |||
| 1358 | Ga0495590_0017166 | |||
| 1359 | Ga0495590_0032246 | |||
| 1360 | Ga0495590_0039765 | |||
| 1361 | Ga0495591_000140 | |||
| 1362 | Ga0495591_000579 | |||
| 1363 | Ga0495591_000695 | |||
| 1364 | Ga0495591_001910 | |||
| 1365 | Ga0495591_003387 | |||
| 1366 | Ga0495591_004066 | |||
| 1367 | Ga0495591_004138 | |||
| 1368 | Ga0495591_005103 | |||
| 1369 | Ga0495591_005177 | |||
| 1370 | Ga0495591_007179 | |||
| 1371 | Ga0495591_007343 | |||
| 1372 | Ga0495591_009859 | |||
| 1373 | Ga0495591_010497 | |||
| 1374 | Ga0495591_014411 | |||
| 1375 | Ga0495638_0007147 | |||
| 1376 | Ga0495638_0007273 | |||
| 1377 | Ga0495638_0007808 | |||
| 1378 | Ga0495638_0012691 | |||
| 1379 | Ga0495638_0013591 | |||
| 1380 | Ga0495638_0017000 | |||
| 1381 | Ga0495638_0025846 | |||
| 1382 | Ga0495638_0026215 | |||
| 1383 | Ga0495638_0030207 | |||
| 1384 | Ga0495638_0071487 | |||
| 1385 | Ga0495653_0001459 | |||
| 1386 | Ga0495653_0001881 | |||
| 1387 | Ga0495653_0067138 | |||
| 1388 | Ga0495650_0005386 | |||
| 1389 | Ga0495650_0007706 | |||
| 1390 | Ga0495650_0008171 | |||
| 1391 | Ga0495650_0012796 | |||
| 1392 | Ga0495605_0003326 | |||
| 1393 | Ga0495605_0019020 | |||
| 1394 | Ga0495605_0037058 | |||
| 1395 | Ga0495605_0069292 | |||
| 1396 | Ga0495584_0003239 | |||
| 1397 | Ga0495584_0003320 | |||
| 1398 | Ga0495584_0005127 | |||
| 1399 | Ga0495584_0006200 | |||
| 1400 | Ga0495584_0008491 | |||
| 1401 | Ga0495584_0012893 | |||
| 1402 | Ga0495584_0041426 | |||
| 1403 | Ga0495584_0246919 | |||
| 1404 | Ga0495585_0002449 | |||
| 1405 | Ga0495585_0002772 | |||
| 1406 | Ga0495585_0005338 | |||
| 1407 | Ga0495585_0006306 | |||
| 1408 | Ga0495585_0006542 | |||
| 1409 | Ga0495585_0006599 | |||
| 1410 | Ga0495585_0008163 | |||
| 1411 | Ga0495585_0009406 | |||
| 1412 | Ga0495585_0011303 | |||
| 1413 | Ga0495585_0066048 | |||
| 1414 | Ga0495585_0221948 | |||
| 1415 | Ga0495594_0107926 | |||
| 1416 | Ga0495596_0004930 | |||
| 1417 | Ga0495596_0007540 | |||
| 1418 | Ga0495607_0000586 | |||
| 1419 | Ga0495607_0002312 | |||
| 1420 | Ga0495607_0008088 | |||
| 1421 | Ga0495607_0008590 | |||
| 1422 | Ga0495607_0014620 | |||
| 1423 | Ga0495607_0024084 | |||
| 1424 | Ga0495607_0034067 | |||
| 1425 | Ga0495607_0060431 | |||
| 1426 | Ga0495607_0110798 | |||
| 1427 | Ga0495583_0004083 | |||
| 1428 | Ga0495583_0006474 | |||
| 1429 | Ga0495583_0007589 | |||
| 1430 | Ga0495583_0015876 | |||
| 1431 | Ga0495583_0071083 | |||
| 1432 | Ga0495583_0093923 | |||
| 1433 | Ga0495606_0001178 | |||
| 1434 | Ga0495606_0003500 | |||
| 1435 | Ga0495606_0005139 | |||
| 1436 | Ga0495606_0005292 | |||
| 1437 | Ga0495606_0007364 | |||
| 1438 | Ga0495606_0008789 | |||
| 1439 | Ga0495606_0009179 | |||
| 1440 | Ga0495606_0011421 | |||
| 1441 | Ga0495606_0015215 | |||
| 1442 | Ga0495606_0020247 | |||
| 1443 | Ga0495606_0042888 | |||
| 1444 | Ga0495606_0067081 | |||
| 1445 | Ga0495606_0110350 | |||
| 1446 | Ga0495610_0007537 | |||
| 1447 | Ga0495610_0008425 | |||
| 1448 | Ga0495610_0008588 | |||
| 1449 | Ga0495610_0010264 | |||
| 1450 | Ga0495610_0013897 | |||
| 1451 | Ga0495610_0014559 | |||
| 1452 | Ga0495610_0016783 | |||
| 1453 | Ga0495610_0019205 | |||
| 1454 | Ga0495610_0046872 | |||
| 1455 | Ga0495610_0083970 | |||
| 1456 | Ga0495616_0002403 | |||
| 1457 | Ga0495616_0004056 | |||
| 1458 | Ga0495616_0006093 | |||
| 1459 | Ga0495616_0008129 | |||
| 1460 | Ga0495616_0010124 | |||
| 1461 | Ga0495616_0027625 | |||
| 1462 | Ga0495616_0049383 | |||
| 1463 | Ga0495616_0055221 | |||
| 1464 | Ga0495616_0086975 | |||
| 1465 | Ga0495616_0102411 | |||
| 1466 | Ga0495620_0000255 | |||
| 1467 | Ga0495620_0002351 | |||
| 1468 | Ga0495620_0003919 | |||
| 1469 | Ga0495620_0005503 | |||
| 1470 | Ga0495620_0006984 | |||
| 1471 | Ga0495620_0007667 | |||
| 1472 | Ga0495620_0020207 | |||
| 1473 | Ga0495620_0040789 | |||
| 1474 | Ga0495631_0001066 | |||
| 1475 | Ga0495631_0001978 | |||
| 1476 | Ga0495631_0016801 | |||
| 1477 | Ga0495631_0016985 | |||
| 1478 | Ga0495631_0052321 | |||
| 1479 | Ga0495631_0088022 | |||
| 1480 | Ga0495632_0000866 | |||
| 1481 | Ga0495632_0002521 | |||
| 1482 | Ga0495632_0005402 | |||
| 1483 | Ga0495632_0005452 | |||
| 1484 | Ga0495632_0005863 | |||
| 1485 | Ga0495632_0012871 | |||
| 1486 | Ga0495632_0017226 | |||
| 1487 | Ga0495632_0017361 | |||
| 1488 | Ga0495632_0019139 | |||
| 1489 | Ga0495632_0032931 | |||
| 1490 | Ga0495632_0034988 | |||
| 1491 | Ga0495632_0065130 | |||
| 1492 | Ga0495637_0001404 | |||
| 1493 | Ga0495637_0003409 | |||
| 1494 | Ga0495637_0005713 | |||
| 1495 | Ga0495637_0005737 | |||
| 1496 | Ga0495637_0005777 | |||
| 1497 | Ga0495637_0007751 | |||
| 1498 | Ga0495637_0010682 | |||
| 1499 | Ga0495637_0014170 | |||
| 1500 | Ga0495637_0027021 | |||
| 1501 | Ga0495637_0032509 | |||
| 1502 | Ga0495637_0033492 | |||
| 1503 | Ga0495637_0091301 | |||
| 1504 | Ga0495643_0001446 | |||
| 1505 | Ga0495643_0002063 | |||
| 1506 | Ga0495643_0002624 | |||
| 1507 | Ga0495643_0003306 | |||
| 1508 | Ga0495643_0009698 | |||
| 1509 | Ga0495643_0011491 | |||
| 1510 | Ga0495643_0015158 | |||
| 1511 | Ga0495644_0011138 | |||
| 1512 | Ga0495644_0033520 | |||
| 1513 | Ga0495648_0001183 | |||
| 1514 | Ga0495648_0002848 | |||
| 1515 | Ga0495648_0005648 | |||
| 1516 | Ga0495648_0009834 | |||
| 1517 | Ga0495648_0009854 | |||
| 1518 | Ga0495648_0009898 | |||
| 1519 | Ga0495648_0013105 | |||
| 1520 | Ga0495648_0018341 | |||
| 1521 | Ga0495648_0018501 | |||
| 1522 | Ga0495648_0031511 | |||
| 1523 | Ga0495648_0044442 | |||
| 1524 | Ga0495648_0044724 | |||
| 1525 | Ga0495648_0048285 | |||
| 1526 | Ga0495648_0091645 | |||
| 1527 | Ga0495666_0014158 | |||
| 1528 | Ga0495666_0076324 | |||
| 1529 | Ga0495642_0000857 | |||
| 1530 | Ga0495654_0001057 | |||
| 1531 | Ga0495654_0001569 | |||
| 1532 | Ga0495654_0001912 | |||
| 1533 | Ga0495654_0002481 | |||
| 1534 | Ga0495654_0005541 | |||
| 1535 | Ga0495654_0007443 | |||
| 1536 | Ga0495654_0013317 | |||
| 1537 | Ga0495654_0015746 | |||
| 1538 | Ga0495654_0018995 | |||
| 1539 | Ga0495654_0027143 | |||
| 1540 | Ga0495654_0027832 | |||
| 1541 | Ga0495654_0027847 | |||
| 1542 | Ga0495654_0033637 | |||
| 1543 | Ga0495654_0037513 | |||
| 1544 | Ga0495654_0039208 | |||
| 1545 | Ga0495654_0052465 | |||
| 1546 | Ga0495654_0102033 | |||
| 1547 | Ga0495654_0105805 | |||
| 1548 | Ga0495587_0142009 | |||
| 1549 | Ga0495609_0001740 | |||
| 1550 | Ga0495609_0001766 | |||
| 1551 | Ga0495609_0008937 | |||
| 1552 | Ga0495609_0009099 | |||
| 1553 | Ga0495609_0009351 | |||
| 1554 | Ga0495609_0016218 | |||
| 1555 | Ga0495597_0000082 | |||
| 1556 | Ga0495597_0002400 | |||
| 1557 | Ga0495597_0007965 | |||
| 1558 | Ga0495597_0009878 | |||
| 1559 | Ga0495597_0012827 | |||
| 1560 | Ga0495597_0027093 | |||
| 1561 | Ga0495597_0027546 | |||
| 1562 | Ga0495597_0073557 | |||
| 1563 | Ga0495645_0032351 | |||
| 1564 | Ga0495622_0000899 | |||
| 1565 | Ga0495622_0013720 | |||
| 1566 | Ga0495622_0112480 | |||
| 1567 | Ga0495633_0005659 | |||
| 1568 | Ga0495633_0017042 | |||
| 1569 | Ga0495633_0019876 | |||
| 1570 | Ga0495633_0020020 | |||
| 1571 | Ga0495633_0126054 | |||
| 1572 | Ga0495633_0174007 | |||
| 1573 | Ga0495656_0015291 | |||
| 1574 | Ga0495668_0003427 | |||
| 1575 | Ga0495668_0052805 | |||
| 1576 | Ga0495668_0066406 | |||
| 1577 | Ga0495668_0099882 | |||
| 1578 | Ga0495634_0026616 | |||
| 1579 | Ga0495611_0002544 | |||
| 1580 | Ga0495611_0007231 | |||
| 1581 | Ga0495611_0078175 | |||
| 1582 | Ga0495611_0107975 | |||
| 1583 | Ga0495611_0154899 | |||
| 1584 | Ga0495625_0004144 | |||
| 1585 | Ga0495625_0011356 | |||
| 1586 | Ga0495625_0015229 | |||
| 1587 | Ga0495625_0018922 | |||
| 1588 | Ga0495625_0021239 | |||
| 1589 | Ga0495625_0053996 | |||
| 1590 | Ga0495625_0064315 | |||
| 1591 | Ga0495625_0115552 | |||
| 1592 | Ga0495625_0168697 | |||
| 1593 | Ga0495659_0053883 | |||
| 1594 | Ga0495661_0000411 | |||
| 1595 | Ga0495661_0002655 | |||
| 1596 | Ga0495661_0006043 | |||
| 1597 | Ga0495661_0012703 | |||
| 1598 | Ga0495661_0025021 | |||
| 1599 | Ga0495661_0050474 | |||
| 1600 | Ga0495661_0080611 | |||
| 1601 | Ga0495661_0106660 | |||
| 1602 | Ga0495661_0186236 | |||
| 1603 | Ga0495588_0041205 | |||
| 1604 | Ga0495646_0002737 | |||
| 1605 | Ga0495669_0010885 | |||
| 1606 | Ga0495669_0069560 | |||
| 1607 | Ga0495613_0008543 | |||
| 1608 | Ga0495624_0001930 | |||
| 1609 | Ga0495670_0000895 | |||
| 1610 | Ga0495670_0010897 | |||
| 1611 | Ga0495670_0031330 | |||
| 1612 | Ga0495670_0066230 | |||
| 1613 | Ga0495670_0079337 | |||
| 1614 | Ga0495671_0001316 | |||
| 1615 | Ga0495671_0002041 | |||
| 1616 | Ga0495671_0003350 | |||
| 1617 | Ga0495671_0003777 | |||
| 1618 | Ga0495671_0004555 | |||
| 1619 | Ga0495671_0006663 | |||
| 1620 | Ga0495671_0018009 | |||
| 1621 | Ga0495671_0022058 | |||
| 1622 | Ga0495671_0022429 | |||
| 1623 | Ga0495671_0040751 | |||
| 1624 | Ga0495671_0125269 | |||
| 1625 | Ga0495671_0125741 | |||
| 1626 | Ga0495649_0003078 | |||
| 1627 | Ga0495649_0006322 | |||
| 1628 | Ga0495649_0006616 | |||
| 1629 | Ga0495649_0008373 | |||
| 1630 | Ga0495649_0011498 | |||
| 1631 | Ga0495649_0011575 | |||
| 1632 | Ga0495649_0019089 | |||
| 1633 | Ga0495649_0023473 | |||
| 1634 | Ga0495649_0030388 | |||
| 1635 | Ga0495649_0064068 | |||
| 1636 | Ga0495649_0083703 | |||
| 1637 | Ga0495649_0107685 | |||
| 1638 | Ga0495589_0003711 | |||
| 1639 | Ga0495589_0003751 | |||
| 1640 | Ga0495589_0006327 | |||
| 1641 | Ga0495589_0007543 | |||
| 1642 | Ga0495589_0034071 | |||
| 1643 | Ga0495589_0081385 | |||
| 1644 | Ga0495600_0158902 | |||
| 1645 | Ga0495660_0001487 | |||
| 1646 | Ga0495660_0001572 | |||
| 1647 | Ga0495660_0002323 | |||
| 1648 | Ga0495660_0005625 | |||
| 1649 | Ga0495660_0005849 | |||
| 1650 | Ga0495660_0005914 | |||
| 1651 | Ga0495660_0011373 | |||
| 1652 | Ga0495660_0015737 | |||
| 1653 | Ga0495660_0020393 | |||
| 1654 | Ga0495660_0021086 | |||
| 1655 | Ga0495660_0021563 | |||
| 1656 | Ga0495660_0028328 | |||
| 1657 | Ga0495660_0028697 | |||
| 1658 | Ga0495660_0031156 | |||
| 1659 | Ga0495660_0032698 | |||
| 1660 | Ga0495660_0066586 | |||
| 1661 | Ga0495660_0069461 | |||
| 1662 | Ga0495604_0033629 | |||
| 1663 | Ga0495636_0053938 | |||
| 1664 | Ga0495672_0004155 | |||
| 1665 | Ga0495672_0006267 | |||
| 1666 | Ga0495672_0009832 | |||
| 1667 | Ga0495672_0012131 | |||
| 1668 | Ga0495672_0014870 | |||
| 1669 | Ga0495672_0017964 | |||
| 1670 | Ga0495672_0028092 | |||
| 1671 | Ga0495672_0036894 | |||
| 1672 | Ga0495672_0043478 | |||
| 1673 | Ga0495672_0070534 | |||
| 1674 | Ga0495676_0009590 | |||
| 1675 | Ga0495676_0014910 | |||
| 1676 | Ga0495680_0015051 | |||
| 1677 | Ga0495683_0002818 | |||
| 1678 | Ga0495683_0006617 | |||
| 1679 | Ga0495683_0006882 | |||
| 1680 | Ga0495683_0011089 | |||
| 1681 | Ga0495683_0020628 | |||
| 1682 | Ga0495687_004666 | |||
| 1683 | Ga0495677_0001534 | |||
| 1684 | Ga0495679_001694 | |||
| 1685 | Ga0495679_002209 | |||
| 1686 | Ga0495679_003346 | |||
| 1687 | Ga0495679_003616 | |||
| 1688 | Ga0495679_004676 | |||
| 1689 | Ga0495679_006204 | |||
| 1690 | Ga0495679_006216 | |||
| 1691 | Ga0495679_006628 | |||
| 1692 | Ga0495679_009587 | |||
| 1693 | Ga0495685_022289 | |||
| 1694 | Ga0495673_0001169 | |||
| 1695 | Ga0495673_0001891 | |||
| 1696 | Ga0495673_0005871 | |||
| 1697 | Ga0495673_0009086 | |||
| 1698 | Ga0495673_0011477 | |||
| 1699 | Ga0495673_0013258 | |||
| 1700 | Ga0495673_0016605 | |||
| 1701 | Ga0495673_0016936 | |||
| 1702 | Ga0495673_0020857 | |||
| 1703 | Ga0495673_0050800 | |||
| 1704 | Ga0495673_0055041 | |||
| 1705 | Ga0495673_0059912 | |||
| 1706 | Ga0495681_0001406 | |||
| 1707 | Ga0495681_0002513 | |||
| 1708 | Ga0495681_0004159 | |||
| 1709 | Ga0495681_0004595 | |||
| 1710 | Ga0495681_0005224 | |||
| 1711 | Ga0495681_0005520 | |||
| 1712 | Ga0495681_0006689 | |||
| 1713 | Ga0495681_0008969 | |||
| 1714 | Ga0495681_0016378 | |||
| 1715 | Ga0495681_0016644 | |||
| 1716 | Ga0495681_0018682 | |||
| 1717 | Ga0495681_0021833 | |||
| 1718 | Ga0495681_0025858 | |||
| 1719 | Ga0495681_0040351 | |||
| 1720 | Ga0495684_0006812 | |||
| 1721 | Ga0495686_0004224 | |||
| 1722 | Ga0495686_0006367 | |||
| 1723 | Ga0495686_0010314 | |||
| 1724 | Ga0495686_0011142 | |||
| 1725 | Ga0495593_0035075 | |||
| 1726 | Ga0495602_0011116 | |||
| 1727 | Ga0495626_0001673 | |||
| 1728 | Ga0495626_0002707 | |||
| 1729 | Ga0495626_0002734 | |||
| 1730 | Ga0495626_0005618 | |||
| 1731 | Ga0495626_0007381 | |||
| 1732 | Ga0495626_0038476 | |||
| 1733 | Ga0495626_0064269 | |||
| 1734 | Ga0496110_0012302 | |||
| 1735 | Ga0496110_0052287 | |||
| 1736 | Ga0496112_0041804 | |||
| 1737 | Ga0496114_0003710 | |||
| 1738 | Ga0496114_0008255 | |||
| 1739 | Ga0496116_0008826 | |||
| 1740 | Ga0496116_0010146 | |||
| 1741 | Ga0496116_0014755 | |||
| 1742 | Ga0496116_0015568 | |||
| 1743 | Ga0496117_0003925 | |||
| 1744 | Ga0496117_0004907 | |||
| 1745 | Ga0496117_0006652 | |||
| 1746 | Ga0496117_0011332 | |||
| 1747 | Ga0496117_0014803 | |||
| 1748 | Ga0496117_0016558 | |||
| 1749 | Ga0496117_0022316 | |||
| 1750 | Ga0496117_0023398 | |||
| 1751 | Ga0496117_0030027 | |||
| 1752 | Ga0496118_0004556 | |||
| 1753 | Ga0496118_0008672 | |||
| 1754 | Ga0496118_0009324 | |||
| 1755 | Ga0496118_0010502 | |||
| 1756 | Ga0496118_0014025 | |||
| 1757 | Ga0496118_0014352 | |||
| 1758 | Ga0496118_0017304 | |||
| 1759 | Ga0496118_0056549 | |||
| 1760 | Ga0496118_0113366 | |||
| 1761 | Ga0496119_0000440 | |||
| 1762 | Ga0496119_0013322 | |||
| 1763 | Ga0496119_0014553 | |||
| 1764 | Ga0496119_0015498 | |||
| 1765 | Ga0496119_0018568 | |||
| 1766 | Ga0496119_0139686 | |||
| 1767 | Ga0496120_0007247 | |||
| 1768 | Ga0496120_0012544 | |||
| 1769 | Ga0496120_0024452 | |||
| 1770 | Ga0496120_0026779 | |||
| 1771 | Ga0496120_0030199 | |||
| 1772 | Ga0496121_0006860 | |||
| 1773 | Ga0496121_0015487 | |||
| 1774 | Ga0496121_0015539 | |||
| 1775 | Ga0496121_0099659 | |||
| 1776 | Ga0496121_0194955 | |||
| 1777 | Ga0496122_0010458 | |||
| 1778 | Ga0496122_0020237 | |||
| 1779 | Ga0496122_0020666 | |||
| 1780 | Ga0496122_0023218 | |||
| 1781 | Ga0496122_0027375 | |||
| 1782 | Ga0496122_0027598 | |||
| 1783 | Ga0496122_0028050 | |||
| 1784 | Ga0496123_0003408 | |||
| 1785 | Ga0496123_0012074 | |||
| 1786 | Ga0496123_0012620 | |||
| 1787 | Ga0496123_0041766 | |||
| 1788 | Ga0496123_0048266 | |||
| 1789 | Ga0496123_0051754 | |||
| 1790 | Ga0496124_0000189 | |||
| 1791 | Ga0496124_0004424 | |||
| 1792 | Ga0496124_0004945 | |||
| 1793 | Ga0496124_0005429 | |||
| 1794 | Ga0496124_0016814 | |||
| 1795 | Ga0496124_0016947 | |||
| 1796 | Ga0496124_0064260 | |||
| 1797 | Ga0496124_0067240 | |||
| 1798 | Ga0496124_0070391 | |||
| 1799 | Ga0496124_0104357 | |||
| 1800 | Ga0496124_0123707 | |||
| 1801 | Ga0496124_0125585 | |||
| 1802 | Ga0496124_0248193 | |||
| 1803 | Ga0496125_0004180 | |||
| 1804 | Ga0496125_0009456 | |||
| 1805 | Ga0496125_0013355 | |||
| 1806 | Ga0496125_0022196 | |||
| 1807 | Ga0496125_0024793 | |||
| 1808 | Ga0496125_0040435 | |||
| 1809 | Ga0496125_0041790 | |||
| 1810 | Ga0496125_0059085 | |||
| 1811 | Ga0496125_0116680 | |||
| 1812 | Ga0496126_0006377 | |||
| 1813 | Ga0496126_0024616 | |||
| 1814 | Ga0496126_0034907 | |||
| 1815 | Ga0496126_0153609 | |||
| 1816 | Ga0495678_002933 | |||
| 1817 | Ga0495678_003836 | |||
| 1818 | Ga0495678_005611 | |||
| 1819 | Ga0495678_006933 | |||
| 1820 | Ga0495678_010226 | |||
| 1821 | Ga0495678_010693 | |||
| 1822 | Ga0495678_011333 | |||
| 1823 | Ga0495678_020500 | |||
| 1824 | Ga0495678_021618 | |||
| 1825 | Ga0495678_025636 | |||
| 1826 | Ga0495678_030419 | |||
| 1827 | Ga0495678_036492 | |||
| 1828 | Ga0495682_0002855 | |||
| 1829 | Ga0495682_0004387 | |||
| 1830 | Ga0495682_0006262 | |||
| 1831 | Ga0495682_0006585 | |||
| 1832 | Ga0495682_0035300 | |||
| 1833 | Ga0495682_0047808 | |||
| 1834 | Ga0495682_0077521 | |||
| 1835 | Ga0501034_0001495 | |||
| 1836 | Ga0501222_000388 | |||
| 1837 | Ga0501241_000531 | |||
| 1838 | nmdc:mga00v17_116573_c1 | |||
| 1839 | Ga0500572_001594 | |||
| 1840 | Ga0500659_0002555 | |||
| 1841 | Ga0500568_0037628 | |||
| 1842 | Ga0500586_034756 | |||
| 1843 | Ga0500586_098279 | |||
| 1844 | Ga0500634_0001344 | |||
| 1845 | 2511255890 | |||
| 1846 | 2511264909 | |||
| 1847 | 2511280296 | |||
| 1848 | 2511292761 | |||
| 1849 | 2511295368 | |||
| 1850 | 2511329484 | |||
| 1851 | 2511340485 | |||
| 1852 | 2511342028 | |||
| 1853 | 2511361232 | |||
| 1854 | 2511368690 | |||
| 1855 | 2511376457 | |||
| 1856 | 2512324577 | |||
| 1857 | 2554817708 | |||
| 1858 | 2555246510 | |||
| 1859 | 2555672182 | |||
| 1860 | 2583794691 | |||
| 1861 | 2597860249 | |||
| 1862 | 2597865983 | |||
| 1863 | 2599358496 | |||
| 1864 | 2599364814 | |||
| 1865 | 2599371137 | |||
| 1866 | 2599377507 | |||
| 1867 | 2599383779 | |||
| 1868 | 2599390046 | |||
| 1869 | 2599396361 | |||
| 1870 | 2599401535 | |||
| 1871 | 2599408548 | |||
| 1872 | 2599453222 | |||
| 1873 | 2599465428 | |||
| 1874 | 2599471770 | |||
| 1875 | 2599486911 | |||
| 1876 | 2599494272 | |||
| 1877 | 2599505255 | |||
| 1878 | 2599509974 | |||
| 1879 | 2599515230 | |||
| 1880 | 2599520410 | |||
| 1881 | 2599615302 | |||
| 1882 | 2599806965 | |||
| 1883 | 2599881828 | |||
| 1884 | 2599889826 | |||
| 1885 | 2599894610 | |||
| 1886 | 2599901382 | |||
| 1887 | 2599934906 | |||
| 1888 | 2599945857 | |||
| 1889 | 2599949473 | |||
| 1890 | 2599956789 | |||
| 1891 | 2599963290 | |||
| 1892 | 2599967525 | |||
| 1893 | 2599980158 | |||
| 1894 | 2599986754 | |||
| 1895 | 2599991746 | |||
| 1896 | 2599997580 | |||
| 1897 | 2600002702 | |||
| 1898 | 2600008047 | |||
| 1899 | 2600014005 | |||
| 1900 | 2600021181 | |||
| 1901 | 2600026806 | |||
| 1902 | 2600033054 | |||
| 1903 | 2600037934 | |||
| 1904 | 2600043580 | |||
| 1905 | 2600050303 | |||
| 1906 | 2600056277 | |||
| 1907 | 2600061836 | |||
| 1908 | 2600067005 | |||
| 1909 | 2600074002 | |||
| 1910 | 2600080495 | |||
| 1911 | 2600211662 | |||
| 1912 | 2600362329 | |||
| 1913 | 2600444972 | |||
| 1914 | 2601694072 | |||
| 1915 | 2601771827 | |||
| 1916 | 2601800360 | |||
| 1917 | 2602012078 | |||
| 1918 | 2606078831 | |||
| 1919 | 2606125508 | |||
| 1920 | 2608380962 | |||
| 1921 | 2621297509 | |||
| 1922 | 2624482775 | |||
| 1923 | 2643844692 | |||
| 1924 | 2643869506 | |||
| 1925 | 2644284606 | |||
| 1926 | 2644621197 | |||
| 1927 | 2671094063 | |||
| 1928 | 2671100988 | |||
| 1929 | 2671130025 | |||
| 1930 | 2671773476 | |||
| 1931 | 2677895717 | |||
| 1932 | 2678265346 | |||
| 1933 | 2715752212 | |||
| 1934 | 2715758950 | |||
| 1935 | 2718635987 | |||
| 1936 | 2723250715 | |||
| 1937 | 2738672758 | |||
| 1938 | 2738751151 | |||
| 1939 | 2738811961 | |||
| 1940 | 2738860192 | |||
| 1941 | 2738899321 | |||
| 1942 | 2739290080 | |||
| 1943 | 2739295392 | |||
| 1944 | 2739316327 | |||
| 1945 | 2743739790 | |||
| 1946 | 2745005800 | |||
| 1947 | 2765586033 | |||
| 1948 | 2774121680 | |||
| 1949 | 2784262448 | |||
| 1950 | 2784316941 | |||
| 1951 | 2794598338 | |||
| 1952 | 2807406463 | |||
| 1953 | 2807454816 | |||
| 1954 | 2808906833 | |||
| 1955 | 2808952861 | |||
| 1956 | 2808959148 | |||
| 1957 | 2808977767 | |||
| 1958 | 2808992576 | |||
| 1959 | 2809219403 | |||
| 1960 | 2812370566 | |||
| 1961 | 2817493367 | |||
| 1962 | 2819659063 | |||
| 1963 | 2819700263 | |||
| 1964 | 2823422387 | |||
| 1965 | 2825655761 | |||
| 1966 | 2834033383 | |||
| 1967 | 2842808261 | |||
| 1968 | 2842831751 | |||
| 1969 | 2842837092 | |||
| 1970 | 2842843297 | |||
| 1971 | 2842847830 | |||
| 1972 | 2844666349 | |||
| 1973 | 2852618289 | |||
| 1974 | 2852663098 | |||
| 1975 | 2852673347 | |||
| 1976 | 2860872406 | |||
| 1977 | 2878034707 | |||
| 1978 | 2880235355 | |||
| 1979 | 2904523082 | |||
| 1980 | 2908451919 | |||
| 1981 | 2912968315 | |||
| 1982 | 2913041893 | |||
| 1983 | 2917076061 | |||
| 1984 | 2919067912 | |||
| 1985 | 2919159855 | |||
| 1986 | 2919390798 | |||
| 1987 | 2919461875 | |||
| 1988 | 2919487532 | |||
| 1989 | 2919491077 | |||
| 1990 | 2919506237 | |||
| 1991 | 2923158880 | |||
| 1992 | 2923524663 | |||
| 1993 | 2926067733 | |||
| 1994 | 2929149275 | |||
| 1995 | 2929194518 | |||
| 1996 | 2931373308 | |||
| 1997 | 2931395800 | |||
| 1998 | 2939654772 | |||
| 1999 | 2945931543 | |||
| 2000 | 2945968011 | |||
| 2001 | 2946007608 | |||
| 2002 | 2946033001 | |||
| 2003 | 2947233757 | |||
| 2004 | 2969309523 | |||
| 2005 | 2974294741 | |||
| 2006 | 2984287293 | |||
| 2007 | 2998144776 | |||
| 2008 | 3007254155 | |||
| 2009 | 3007317107 | |||
| 2010 | 3007398505 | |||
| 2011 | 3007425193 | |||
| 2012 | 3007516531 | |||
| 2013 | 3007724076 | |||
| 2014 | 3007805489 | |||
| 2015 | 3007859987 | |||
| 2016 | 3007866233 | |||
| 2017 | 3007871067 | |||
| 2018 | 8015692966 | |||
| 2019 | 8019775409 | |||
| 2020 | 8029996119 | |||
| 2021 | 8034966595 | |||
| 2022 | 8052495401 | |||
| 2023 | 8054288963 | |||
| 2024 | 8054353152 | |||
| 2025 | 8054508301 | |||
| 2026 | 8054933746 | |||
| 2027 | 8055776213 | |||
| 2028 | 8055823247 | |||
| 2029 | 8055882456 | |||
| 2030 | 8056117053 | |||
| 2031 | 8056125242 | |||
| 2032 | 8056136658 | |||
| 2033 | 8056138219 | |||
| 2034 | 8056150682 | |||
| 2035 | 8056162947 | |||
| 2036 | 8056171791 | |||
| 2037 | 8056172473 | |||
| 2038 | 8056180012 | |||
| 2039 | 8056571801 | |||
| 2040 | 8057805062 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2r79-assembly1.cif.gz_A | crystal structure of a periplasmic heme binding protein from pseudomonas aeruginosa | 0.8969 | 33 | 273 |
| 5b51-assembly1.cif.gz_A | crystal structure of heme binding protein hmut r242a mutant | 0.8532 | 73 | 272 |
| 5b4z-assembly1.cif.gz_A | crystal structure of heme binding protein hmut h141a mutant | 0.8519 | 73 | 272 |
| 5az3-assembly1.cif.gz_A | crystal structure of heme binding protein hmut | 0.8481 | 73 | 272 |
| 5b50-assembly1.cif.gz_A | crystal structure of heme binding protein hmut y240a | 0.8424 | 73 | 272 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2r79A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9884 | 137 | 273 | 3.40.50.1980 |
| 2r79A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8802 | 137 | 273 | 3.40.50.1980 |
| 5cr9A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8696 | 104 | 271 | 3.40.50.1980 |
| 5cr9A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8366 | 104 | 271 | 3.40.50.1980 |
| 2r7aD02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8228 | 144 | 273 | 3.40.50.1980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5E6ZIE6-F1-model_v4 | Hemin-binding periplasmic protein HmuT | 0.9903 | 77 | 273 |
|
| AF-A0A5E6ZIE6-F1-model_v4 | Hemin-binding periplasmic protein HmuT | 0.9428 | 77 | 273 |
|
| AF-A0A5E7AB77-F1-model_v4 | Hemin-binding periplasmic protein HmuT | 0.9111 | 38 | 274 |
|
| AF-A0A5N8T9K3-F1-model_v4 | Hemin ABC transporter substrate-binding protein | 0.8973 | 73 | 276 |
|
| AF-A0A523F2V4-F1-model_v4 | Hemin ABC transporter substrate-binding protein | 0.8859 | 73 | 275 |
|