F488381

General Info

Members Datasets Scaffolds Average Seq Length
1020 422 1015 209

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0011656|Ga0501072_0011656_5916_6638
Length 240
Sequence VDKSGQNQTPAEAQFSDLLFVLSRKRKPAMPSDAMVHVIDDDEAVRDSLEFLFKSAKVGVRTYDSAKRFLSELPQPRSGCIVTDVRMPDVSGIDLLKQLRELGVALPVIVITGHGDIPLAVEAMKLGASEFLEKPFDDELLLTAVRSALEKQADHDNRDAERLKISTRLGTLSNRERQVLEGLSAGLPNKTIAYDLGISPRTVEIYRANLMTKMEANSLSDLVRMVVIAGILDSPGKKPR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
4 2643221662 Devosia sp. Root413D1 Isolate Unclassified
5 2643221674 Devosia sp. Root436 Isolate Unclassified
6 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
7 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
8 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
9 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
10 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
11 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
12 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
19 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
65 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
134 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
135 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
221 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
222 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
226 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
229 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
234 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
235 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
241 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
242 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
243 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
244 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
245 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
246 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
247 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
248 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
249 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
250 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
251 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
256 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
257 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
260 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
261 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
262 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
263 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
264 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
265 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
266 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
271 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
278 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
281 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
282 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
283 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
284 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
285 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
286 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
287 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
288 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
289 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
295 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
299 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
303 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
304 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
308 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
309 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
310 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
313 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
318 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
319 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
320 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
321 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
324 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
356 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
359 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
360 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
361 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
377 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
378 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
379 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
380 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
381 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
385 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
386 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
387 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
388 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
389 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
394 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
395 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
396 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
397 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
398 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
399 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
400 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
401 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
402 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
403 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
404 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
405 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
406 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
407 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
408 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
409 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
410 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
411 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
412 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
415 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
416 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
417 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
418 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
419 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
420 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
421 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
422 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.2
Nodule 0.1
Rhizoplane 5.1
Rhizosphere 87.55
Stem 0
Stem Tuber 0
Unclassified 2.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1582902 2162886007 Bacteria 1303
2 2214939635 2209111006 Bacteria 6484
3 ARSoilYngRDRAFT_c00360 3300000042 Bacteria 6220
4 ARcpr5yngRDRAFT_c000225 3300000043 Bacteria 8599
5 ARSoilOldRDRAFT_c000119 3300000044 Bacteria 13959
6 ARCol0yngRDRAFT_1000365 3300000652 Bacteria 6323
7 JGI24743J22301_10019881 3300001991 Bacteria 1277
8 JGI24751J29686_10025198 3300002459 Bacteria 1235
9 JGI25153J46596_10000066 3300003215 Bacteria 123268
10 rootH1_10041760 3300003323 Bacteria 7568
11 rootH1_10064975 3300003323 Bacteria 4551
12 rootH1_10087342 3300003323 Bacteria 5162
13 JGI25404J52841_10010937 3300003659 Bacteria 1953
14 JGI25405J52794_10017989 3300003911 Bacteria 1408
15 Ga0065717_1002139 3300005276 Bacteria 2763
16 Ga0065716_1001608 3300005277 Bacteria 5290
17 Ga0065704_10105710 3300005289 Bacteria 2103
18 Ga0065712_10106759 3300005290 Bacteria 1910
19 Ga0065715_10144144 3300005293 Bacteria 1761
20 Ga0065715_10282375 3300005293 Bacteria 1083
21 Ga0065707_10090693 3300005295 Bacteria 4087
22 Ga0070658_10002045 3300005327 Bacteria 16922
23 Ga0070658_10103966 3300005327 Bacteria 2349
24 Ga0070658_10129207 3300005327 Bacteria 2105
25 Ga0070676_10031086 3300005328 Bacteria 3048
26 Ga0070676_10061003 3300005328 Bacteria 2241
27 Ga0070683_100025834 3300005329 Bacteria 5281
28 Ga0070683_100043381 3300005329 Bacteria 4145
29 Ga0070683_100109225 3300005329 Bacteria 2609
30 Ga0070690_100033018 3300005330 Bacteria 3237
31 Ga0070670_100011983 3300005331 Bacteria 7416
32 Ga0070670_100044592 3300005331 Bacteria 3813
33 Ga0070670_100061110 3300005331 Bacteria 3234
34 Ga0070670_100290620 3300005331 Bacteria 1428
35 Ga0070670_101122698 3300005331 Bacteria 717
36 Ga0070677_10001526 3300005333 Bacteria 7326
37 Ga0070677_10266966 3300005333 Bacteria 856
38 Ga0068869_100252571 3300005334 Bacteria 1409
39 Ga0070666_10149784 3300005335 Bacteria 1628
40 Ga0070666_10178099 3300005335 Bacteria 1490
41 Ga0070682_100137007 3300005337 Bacteria 1664
42 Ga0070682_100261629 3300005337 Bacteria 1252
43 Ga0068868_100498174 3300005338 Bacteria 1067
44 Ga0070660_100014238 3300005339 Bacteria 5727
45 Ga0070660_100044880 3300005339 Bacteria 3382
46 Ga0070660_100146623 3300005339 Bacteria 1896
47 Ga0070660_100192648 3300005339 Bacteria 1652
48 Ga0070660_100418205 3300005339 Bacteria 1110
49 Ga0070689_100021788 3300005340 Bacteria 4775
50 Ga0070689_100228563 3300005340 Bacteria 1528
51 Ga0070691_10003914 3300005341 Bacteria 6736
52 Ga0070687_100109504 3300005343 Bacteria 1561
53 Ga0070687_100133269 3300005343 Bacteria 1437
54 Ga0070687_100200186 3300005343 Bacteria 1209
55 Ga0070661_100015548 3300005344 Bacteria 5371
56 Ga0070692_10060793 3300005345 Bacteria 1990
57 Ga0070692_10367334 3300005345 Bacteria 899
58 Ga0070668_100101877 3300005347 Bacteria 2276
59 Ga0070668_100114077 3300005347 Bacteria 2153
60 Ga0070668_100437240 3300005347 Bacteria 1122
61 Ga0070669_100043124 3300005353 Bacteria 3284
62 Ga0070669_100219278 3300005353 Bacteria 1504
63 Ga0070669_100535922 3300005353 Bacteria 975
64 Ga0070669_100628275 3300005353 Bacteria 902
65 Ga0070675_100007200 3300005354 Bacteria 8575
66 Ga0070675_100087493 3300005354 Bacteria 2605
67 Ga0070675_100192444 3300005354 Bacteria 1768
68 Ga0070675_100439072 3300005354 Bacteria 1169
69 Ga0070671_100066953 3300005355 Bacteria 2994
70 Ga0070671_100260281 3300005355 Bacteria 1474
71 Ga0070674_100121467 3300005356 Bacteria 1934
72 Ga0070674_100252788 3300005356 Bacteria 1385
73 Ga0070673_100286459 3300005364 Bacteria 1446
74 Ga0070688_100025018 3300005365 Bacteria 3530
75 Ga0070688_100043897 3300005365 Bacteria 2756
76 Ga0070659_100008537 3300005366 Bacteria 7485
77 Ga0070659_100070471 3300005366 Bacteria 2777
78 Ga0070659_100105105 3300005366 Bacteria 2275
79 Ga0070659_100127450 3300005366 Bacteria 2065
80 Ga0070659_100378869 3300005366 Bacteria 1191
81 Ga0070667_100352910 3300005367 Bacteria 1332
82 Ga0070667_100454556 3300005367 Bacteria 1170
83 Ga0070667_100925546 3300005367 Bacteria 812
84 Ga0070703_10069324 3300005406 Bacteria 1174
85 Ga0070709_10138150 3300005434 Bacteria 1671
86 Ga0070714_100142045 3300005435 Bacteria 2156
87 Ga0070713_100029053 3300005436 Bacteria 4373
88 Ga0070713_100850202 3300005436 Bacteria 876
89 Ga0070710_10340530 3300005437 Bacteria 990
90 Ga0070701_10041651 3300005438 Bacteria 2342
91 Ga0070701_10063229 3300005438 Bacteria 1958
92 Ga0070705_100438681 3300005440 Bacteria 977
93 Ga0070705_100519450 3300005440 Bacteria 907
94 Ga0070700_100065559 3300005441 Bacteria 2303
95 Ga0070700_100165045 3300005441 Bacteria 1528
96 Ga0070700_100561300 3300005441 Bacteria 888
97 Ga0070708_100625087 3300005445 Bacteria 1015
98 Ga0070663_100093127 3300005455 Bacteria 2235
99 Ga0070663_100250830 3300005455 Bacteria 1401
100 Ga0070678_100034450 3300005456 Bacteria 3527
101 Ga0070678_100041947 3300005456 Bacteria 3248
102 Ga0070678_100129976 3300005456 Bacteria 1999
103 Ga0070662_100009002 3300005457 Bacteria 6514
104 Ga0070662_100062866 3300005457 Bacteria 2714
105 Ga0070662_100146150 3300005457 Bacteria 1837
106 Ga0070662_100433034 3300005457 Bacteria 1089
107 Ga0070681_10027494 3300005458 Bacteria 5718
108 Ga0070681_10286633 3300005458 Bacteria 1557
109 Ga0068867_100045681 3300005459 Bacteria 3214
110 Ga0068867_100052549 3300005459 Bacteria 3007
111 Ga0068867_100428595 3300005459 Bacteria 1122
112 Ga0068867_100445852 3300005459 Bacteria 1102
113 Ga0070685_10011297 3300005466 Bacteria 4675
114 Ga0070685_10206135 3300005466 Bacteria 1281
115 Ga0070679_100129273 3300005530 Bacteria 2507
116 Ga0070679_100208362 3300005530 Bacteria 1919
117 Ga0070679_100360469 3300005530 Bacteria 1401
118 Ga0070684_100051620 3300005535 Bacteria 3573
119 Ga0070684_100098312 3300005535 Bacteria 2611
120 Ga0070684_100124505 3300005535 Bacteria 2320
121 Ga0070684_100154153 3300005535 Bacteria 2083
122 Ga0070684_100236131 3300005535 Bacteria 1670
123 Ga0068853_100012357 3300005539 Bacteria 6948
124 Ga0068853_100073544 3300005539 Bacteria 2980
125 Ga0068853_100126317 3300005539 Bacteria 2285
126 Ga0068853_100201445 3300005539 Bacteria 1812
127 Ga0070672_100145172 3300005543 Bacteria 1960
128 Ga0070672_100194921 3300005543 Bacteria 1693
129 Ga0070672_100205077 3300005543 Bacteria 1649
130 Ga0070672_100290929 3300005543 Bacteria 1383
131 Ga0070672_100297961 3300005543 Bacteria 1366
132 Ga0070686_100021445 3300005544 Bacteria 3841
133 Ga0070686_100255154 3300005544 Bacteria 1283
134 Ga0070686_100258167 3300005544 Bacteria 1276
135 Ga0070686_100270070 3300005544 Bacteria 1250
136 Ga0070686_100480662 3300005544 Bacteria 960
137 Ga0070695_100013226 3300005545 Bacteria 4957
138 Ga0070696_100088229 3300005546 Bacteria 2204
139 Ga0070693_100427682 3300005547 Bacteria 924
140 Ga0070665_100064426 3300005548 Bacteria 3675
141 Ga0070665_100384903 3300005548 Bacteria 1410
142 Ga0070665_100600274 3300005548 Bacteria 1114
143 Ga0070665_100795005 3300005548 Bacteria 959
144 Ga0070665_100966555 3300005548 Bacteria 864
145 Ga0068855_100011710 3300005563 Bacteria 10600
146 Ga0068855_100269792 3300005563 Bacteria 1892
147 Ga0068855_100287977 3300005563 Bacteria 1822
148 Ga0070664_100061077 3300005564 Bacteria 3211
149 Ga0070664_100085255 3300005564 Bacteria 2728
150 Ga0070664_100104300 3300005564 Bacteria 2469
151 Ga0070664_100178405 3300005564 Bacteria 1887
152 Ga0070664_100403758 3300005564 Bacteria 1250
153 Ga0068857_100029926 3300005577 Bacteria 4805
154 Ga0068857_100206704 3300005577 Bacteria 1791
155 Ga0068854_100010290 3300005578 Bacteria 6062
156 Ga0068854_100067161 3300005578 Bacteria 2612
157 Ga0068856_100034732 3300005614 Bacteria 4939
158 Ga0068856_100212373 3300005614 Bacteria 1950
159 Ga0068856_100390563 3300005614 Bacteria 1411
160 Ga0068856_100501928 3300005614 Bacteria 1234
161 Ga0070702_100056799 3300005615 Bacteria 2262
162 Ga0068852_100001655 3300005616 Bacteria 15194
163 Ga0068852_100008530 3300005616 Bacteria 7561
164 Ga0068852_100104184 3300005616 Bacteria 2567
165 Ga0068852_100141351 3300005616 Bacteria 2228
166 Ga0068852_100932758 3300005616 Bacteria 886
167 Ga0068859_100144709 3300005617 Bacteria 2451
168 Ga0068859_100275925 3300005617 Bacteria 1773
169 Ga0068859_100343898 3300005617 Bacteria 1586
170 Ga0068864_100100636 3300005618 Bacteria 2562
171 Ga0068864_100145190 3300005618 Bacteria 2144
172 Ga0068864_100446564 3300005618 Bacteria 1236
173 Ga0068866_10079475 3300005718 Bacteria 1757
174 Ga0068866_10124912 3300005718 Bacteria 1455
175 Ga0068866_10404741 3300005718 Bacteria 881
176 Ga0068861_100091363 3300005719 Bacteria 2403
177 Ga0068861_100595517 3300005719 Bacteria 1014
178 Ga0068861_100653010 3300005719 Bacteria 972
179 Ga0068870_10281964 3300005840 Bacteria 1042
180 Ga0068863_100301030 3300005841 Bacteria 1556
181 Ga0068858_100060995 3300005842 Bacteria 3486
182 Ga0068858_100242083 3300005842 Bacteria 1712
183 Ga0068858_100357213 3300005842 Bacteria 1400
184 Ga0068860_100246815 3300005843 Bacteria 1737
185 Ga0068860_100435755 3300005843 Bacteria 1301
186 Ga0068860_101073231 3300005843 Bacteria 824
187 Ga0068862_100057501 3300005844 Bacteria 3335
188 Ga0068862_100495492 3300005844 Bacteria 1159
189 Ga0068862_100657071 3300005844 Bacteria 1012
190 Ga0068862_100883331 3300005844 Bacteria 878
191 Ga0081455_10004090 3300005937 Bacteria 16515
192 Ga0081455_10008578 3300005937 Bacteria 10608
193 Ga0081455_10014407 3300005937 Bacteria 7755
194 Ga0081455_10248818 3300005937 Bacteria 1301
195 Ga0081538_10061201 3300005981 Bacteria 2157
196 Ga0081540_1000462 3300005983 Bacteria 40336
197 Ga0081539_10006052 3300005985 Bacteria 11849
198 Ga0070717_10916994 3300006028 Bacteria 798
199 Ga0075365_10091217 3300006038 Bacteria 2076
200 Ga0075365_10167953 3300006038 Bacteria 1531
201 Ga0075365_10221661 3300006038 Bacteria 1327
202 Ga0075365_10228041 3300006038 Bacteria 1307
203 Ga0075365_10342195 3300006038 Bacteria 1054
204 Ga0075368_10037214 3300006042 Bacteria 1902
205 Ga0075368_10040390 3300006042 Bacteria 1832
206 Ga0075368_10107303 3300006042 Bacteria 1150
207 Ga0075363_100035329 3300006048 Bacteria 2615
208 Ga0075363_100143012 3300006048 Bacteria 1348
209 Ga0075364_10413132 3300006051 Bacteria 921
210 Ga0075432_10006405 3300006058 Bacteria 4006
211 Ga0070715_10146164 3300006163 Bacteria 1154
212 Ga0070715_10328261 3300006163 Bacteria 828
213 Ga0070712_100830729 3300006175 Bacteria 794
214 Ga0075362_10003309 3300006177 Bacteria 5614
215 Ga0075362_10094065 3300006177 Bacteria 1394
216 Ga0075367_10002551 3300006178 Bacteria 8362
217 Ga0075367_10092400 3300006178 Bacteria 1842
218 Ga0075369_10008060 3300006186 Bacteria 4039
219 Ga0075427_10000106 3300006194 Bacteria 7138
220 Ga0075366_10006005 3300006195 Bacteria 6616
221 Ga0075366_10020275 3300006195 Bacteria 3856
222 Ga0075366_10068103 3300006195 Bacteria 2118
223 Ga0075366_10109524 3300006195 Bacteria 1661
224 Ga0097621_101075032 3300006237 Bacteria 754
225 Ga0075370_10008430 3300006353 Bacteria 5304
226 Ga0068871_100225212 3300006358 Bacteria 1626
227 Ga0068871_100238983 3300006358 Bacteria 1579
228 Ga0075428_100167486 3300006844 Bacteria 2383
229 Ga0075428_100724069 3300006844 Unclassified 1059
230 Ga0075430_100001330 3300006846 Bacteria 19963
231 Ga0075433_10067681 3300006852 Bacteria 3135
232 Ga0075433_10085555 3300006852 Bacteria 2783
233 Ga0075433_10171968 3300006852 Bacteria 1928
234 Ga0075434_100000576 3300006871 Bacteria 28251
235 Ga0075434_100019269 3300006871 Bacteria 6601
236 Ga0075434_100103936 3300006871 Bacteria 2849
237 Ga0075434_100242820 3300006871 Bacteria 1821
238 Ga0075434_100717564 3300006871 Bacteria 1017
239 Ga0075434_100770009 3300006871 Bacteria 979
240 Ga0075429_100007164 3300006880 Bacteria 9677
241 Ga0068865_100389395 3300006881 Bacteria 1139
242 Ga0068865_100467606 3300006881 Bacteria 1046
243 Ga0068865_100698612 3300006881 Bacteria 866
244 Ga0075436_100072041 3300006914 Bacteria 2390
245 Ga0097620_100144727 3300006931 Bacteria 2451
246 Ga0097620_100275924 3300006931 Bacteria 1773
247 Ga0097620_100343880 3300006931 Bacteria 1586
248 Ga0075435_100120409 3300007076 Bacteria 2190
249 Ga0075435_100154816 3300007076 Bacteria 1928
250 Ga0075435_100440179 3300007076 Bacteria 1123
251 Ga0075435_100486817 3300007076 Bacteria 1066
252 Ga0105244_10093715 3300009036 Bacteria 1475
253 Ga0105240_10069912 3300009093 Bacteria 4345
254 Ga0105240_10093427 3300009093 Bacteria 3671
255 Ga0105240_10238265 3300009093 Bacteria 2111
256 Ga0111539_10000503 3300009094 Bacteria 49808
257 Ga0111539_10012946 3300009094 Bacteria 10439
258 Ga0111539_10032473 3300009094 Bacteria 6338
259 Ga0111539_10048837 3300009094 Bacteria 5050
260 Ga0111539_10367883 3300009094 Bacteria 1673
261 Ga0111539_10484944 3300009094 Bacteria 1440
262 Ga0111539_10909214 3300009094 Bacteria 1024
263 Ga0111539_11066113 3300009094 Bacteria 939
264 Ga0111539_11320194 3300009094 Bacteria 837
265 Ga0105245_10594066 3300009098 Bacteria 1133
266 Ga0105245_10743314 3300009098 Bacteria 1016
267 Ga0105247_10035298 3300009101 Bacteria 3048
268 Ga0105247_10061991 3300009101 Bacteria 2319
269 Ga0105247_10237445 3300009101 Bacteria 1240
270 Ga0105247_10364322 3300009101 Bacteria 1020
271 Ga0114129_10000621 3300009147 Bacteria 44041
272 Ga0114129_10028547 3300009147 Bacteria 7906
273 Ga0114129_10099148 3300009147 Bacteria 4032
274 Ga0105243_10083172 3300009148 Bacteria 2618
275 Ga0105243_10172090 3300009148 Bacteria 1877
276 Ga0105243_10677574 3300009148 Bacteria 1002
277 Ga0105243_10900518 3300009148 Bacteria 880
278 Ga0105241_10014840 3300009174 Bacteria 5703
279 Ga0105241_10040950 3300009174 Unclassified 3498
280 Ga0105241_10404082 3300009174 Bacteria 1199
281 Ga0105241_10580444 3300009174 Bacteria 1010
282 Ga0105242_10566651 3300009176 Bacteria 1092
283 Ga0105242_10652459 3300009176 Bacteria 1023
284 Ga0105248_10000015 3300009177 Bacteria 322959
285 Ga0105248_10434349 3300009177 Bacteria 1479
286 Ga0105248_10603722 3300009177 Bacteria 1238
287 Ga0105248_10766508 3300009177 Bacteria 1089
288 Ga0105237_10222456 3300009545 Bacteria 1888
289 Ga0105237_10836595 3300009545 Bacteria 927
290 Ga0105237_10870155 3300009545 Bacteria 908
291 Ga0105238_10001373 3300009551 Bacteria 24416
292 Ga0105238_10039590 3300009551 Bacteria 4779
293 Ga0105238_10239050 3300009551 Bacteria 1794
294 Ga0105238_10294446 3300009551 Bacteria 1606
295 Ga0105249_10132531 3300009553 Bacteria 2381
296 Ga0105249_10177884 3300009553 Bacteria 2068
297 Ga0105249_10387775 3300009553 Bacteria 1424
298 Ga0105249_10620383 3300009553 Bacteria 1137
299 Ga0105249_10786199 3300009553 Bacteria 1015
300 Ga0105239_10022682 3300010375 Bacteria 6920
301 Ga0105239_10031440 3300010375 Bacteria 5838
302 Ga0105239_10119753 3300010375 Bacteria 2922
303 Ga0105239_10224844 3300010375 Bacteria 2105
304 Ga0105239_10592715 3300010375 Bacteria 1264
305 Ga0105239_10979124 3300010375 Bacteria 972
306 Ga0105239_11506093 3300010375 Bacteria 777
307 Ga0105246_10087145 3300011119 Bacteria 2240
308 Ga0105246_10093612 3300011119 Bacteria 2171
309 Ga0105246_10116104 3300011119 Bacteria 1975
310 Ga0105246_10185487 3300011119 Bacteria 1606
311 Ga0157329_1000769 3300012491 Bacteria 1412
312 Ga0157341_1000699 3300012494 Bacteria 1794
313 Ga0157339_1002176 3300012505 Bacteria 1298
314 Ga0157373_10002425 3300013100 Bacteria 14185
315 Ga0157373_10013179 3300013100 Bacteria 6068
316 Ga0157373_10057799 3300013100 Bacteria 2751
317 Ga0157371_10016668 3300013102 Bacteria 5476
318 Ga0157370_10013414 3300013104 Bacteria 8442
319 Ga0157370_10082033 3300013104 Bacteria 3033
320 Ga0157369_10021559 3300013105 Bacteria 7206
321 Ga0157369_10036888 3300013105 Bacteria 5354
322 Ga0157374_10454642 3300013296 Bacteria 1282
323 Ga0157374_10600383 3300013296 Bacteria 1111
324 Ga0157378_10013498 3300013297 Bacteria 7144
325 Ga0157378_10133492 3300013297 Bacteria 2300
326 Ga0157378_10244302 3300013297 Bacteria 1716
327 Ga0157378_10279934 3300013297 Bacteria 1607
328 Ga0163162_10079200 3300013306 Bacteria 3352
329 Ga0163162_10091938 3300013306 Bacteria 3117
330 Ga0163162_10655107 3300013306 Bacteria 1174
331 Ga0163162_10739960 3300013306 Bacteria 1103
332 Ga0157372_10014547 3300013307 Bacteria 8418
333 Ga0157372_10024794 3300013307 Bacteria 6518
334 Ga0157372_10400010 3300013307 Bacteria 1600
335 Ga0157372_10462668 3300013307 Bacteria 1478
336 Ga0157372_11391142 3300013307 Bacteria 809
337 Ga0157372_11391193 3300013307 Bacteria 809
338 Ga0157375_10011914 3300013308 Bacteria 7694
339 Ga0157375_10147638 3300013308 Bacteria 2483
340 Ga0157375_10415941 3300013308 Bacteria 1511
341 Ga0157375_10626621 3300013308 Bacteria 1233
342 Ga0157375_10630389 3300013308 Bacteria 1229
343 Ga0157375_10685619 3300013308 Bacteria 1179
344 Ga0163163_10003968 3300014325 Bacteria 12634
345 Ga0163163_10160285 3300014325 Bacteria 2295
346 Ga0163163_10227792 3300014325 Bacteria 1913
347 Ga0163163_10383831 3300014325 Bacteria 1462
348 Ga0163163_10400319 3300014325 Bacteria 1431
349 Ga0163163_10516990 3300014325 Bacteria 1256
350 Ga0163163_10691932 3300014325 Bacteria 1083
351 Ga0157380_10036059 3300014326 Bacteria 3825
352 Ga0157377_10149221 3300014745 Bacteria 1444
353 Ga0157377_10330354 3300014745 Bacteria 1016
354 Ga0157379_10001600 3300014968 Bacteria 18672
355 Ga0157379_10258154 3300014968 Bacteria 1583
356 Ga0157379_10337997 3300014968 Bacteria 1377
357 Ga0157376_10009435 3300014969 Bacteria 7085
358 Ga0157376_10189844 3300014969 Bacteria 1883
359 Ga0157376_10381715 3300014969 Bacteria 1357
360 Ga0157376_11157280 3300014969 Bacteria 801
361 Ga0163161_10041795 3300017792 Bacteria 3295
362 Ga0213872_10146057 3300021361 Bacteria 1035
363 Ga0213876_10079150 3300021384 Bacteria 1737
364 Ga0207666_1000236 3300025271 Bacteria 8137
365 Ga0209564_1012585 3300025295 Bacteria 3675
366 Ga0209758_1000028 3300025297 Bacteria 530102
367 Ga0209758_1008245 3300025297 Bacteria 6821
368 Ga0207697_10003202 3300025315 Bacteria 8143
369 Ga0207697_10158588 3300025315 Bacteria 986
370 Ga0207656_10077017 3300025321 Bacteria 1492
371 Ga0207653_10009654 3300025885 Bacteria 3008
372 Ga0207682_10000200 3300025893 Bacteria 27225
373 Ga0207682_10345867 3300025893 Bacteria 700
374 Ga0207692_10106713 3300025898 Bacteria 1547
375 Ga0207642_10023803 3300025899 Bacteria 2452
376 Ga0207710_10055447 3300025900 Bacteria 1787
377 Ga0207710_10093045 3300025900 Bacteria 1414
378 Ga0207688_10007988 3300025901 Bacteria 5757
379 Ga0207688_10181349 3300025901 Bacteria 1256
380 Ga0207680_10123522 3300025903 Bacteria 1696
381 Ga0207680_10183061 3300025903 Bacteria 1418
382 Ga0207647_10023709 3300025904 Bacteria 4054
383 Ga0207647_10026302 3300025904 Bacteria 3810
384 Ga0207647_10113400 3300025904 Bacteria 1602
385 Ga0207699_10530629 3300025906 Bacteria 852
386 Ga0207645_10005680 3300025907 Bacteria 9012
387 Ga0207645_10037887 3300025907 Bacteria 3094
388 Ga0207645_10077209 3300025907 Bacteria 2134
389 Ga0207645_10148439 3300025907 Bacteria 1529
390 Ga0207654_10504301 3300025911 Bacteria 855
391 Ga0207654_10505547 3300025911 Bacteria 854
392 Ga0207707_10016195 3300025912 Bacteria 6504
393 Ga0207695_10080968 3300025913 Bacteria 3288
394 Ga0207695_10166367 3300025913 Bacteria 2133
395 Ga0207695_10333573 3300025913 Bacteria 1405
396 Ga0207660_10066532 3300025917 Bacteria 2607
397 Ga0207660_10500188 3300025917 Bacteria 986
398 Ga0207662_10000420 3300025918 Bacteria 18707
399 Ga0207662_10023087 3300025918 Bacteria 3571
400 Ga0207662_10038527 3300025918 Bacteria 2801
401 Ga0207657_10012000 3300025919 Bacteria 8569
402 Ga0207657_10022635 3300025919 Bacteria 5874
403 Ga0207657_10125508 3300025919 Bacteria 2108
404 Ga0207657_10127236 3300025919 Bacteria 2091
405 Ga0207657_10180131 3300025919 Bacteria 1708
406 Ga0207649_10008729 3300025920 Bacteria 5533
407 Ga0207649_10236070 3300025920 Bacteria 1310
408 Ga0207649_10258133 3300025920 Bacteria 1258
409 Ga0207652_10109912 3300025921 Bacteria 2444
410 Ga0207652_10113575 3300025921 Bacteria 2404
411 Ga0207652_10391066 3300025921 Bacteria 1255
412 Ga0207681_10008085 3300025923 Bacteria 6436
413 Ga0207681_10035662 3300025923 Bacteria 3279
414 Ga0207681_10107093 3300025923 Bacteria 2027
415 Ga0207681_10169527 3300025923 Bacteria 1654
416 Ga0207694_10023492 3300025924 Bacteria 4681
417 Ga0207694_10086104 3300025924 Bacteria 2474
418 Ga0207650_10007537 3300025925 Bacteria 7419
419 Ga0207650_10025926 3300025925 Bacteria 4179
420 Ga0207650_10268444 3300025925 Bacteria 1386
421 Ga0207659_10135529 3300025926 Bacteria 1905
422 Ga0207659_10671534 3300025926 Bacteria 886
423 Ga0207700_10041129 3300025928 Bacteria 3380
424 Ga0207700_10126700 3300025928 Bacteria 2078
425 Ga0207700_10645159 3300025928 Bacteria 944
426 Ga0207664_10184680 3300025929 Bacteria 1792
427 Ga0207644_10690734 3300025931 Bacteria 851
428 Ga0207690_10034354 3300025932 Bacteria 3267
429 Ga0207690_10182489 3300025932 Bacteria 1581
430 Ga0207690_10186348 3300025932 Bacteria 1566
431 Ga0207706_10007686 3300025933 Bacteria 9955
432 Ga0207706_10014123 3300025933 Bacteria 7241
433 Ga0207706_10028739 3300025933 Bacteria 4963
434 Ga0207706_10133769 3300025933 Bacteria 2181
435 Ga0207706_10262103 3300025933 Bacteria 1509
436 Ga0207706_10271376 3300025933 Bacteria 1480
437 Ga0207709_10028625 3300025935 Bacteria 3223
438 Ga0207709_10122222 3300025935 Bacteria 1760
439 Ga0207709_10148893 3300025935 Bacteria 1619
440 Ga0207670_10042397 3300025936 Bacteria 2998
441 Ga0207670_10412984 3300025936 Bacteria 1081
442 Ga0207669_10115992 3300025937 Bacteria 1806
443 Ga0207669_10353634 3300025937 Bacteria 1136
444 Ga0207704_10228037 3300025938 Bacteria 1383
445 Ga0207704_10263159 3300025938 Unclassified 1301
446 Ga0207704_10635147 3300025938 Bacteria 878
447 Ga0207691_10002205 3300025940 Bacteria 19054
448 Ga0207691_10089428 3300025940 Bacteria 2761
449 Ga0207691_10103003 3300025940 Bacteria 2546
450 Ga0207691_10163804 3300025940 Bacteria 1949
451 Ga0207711_10000003 3300025941 Bacteria 1042791
452 Ga0207711_10000005 3300025941 Bacteria 822972
453 Ga0207711_10000009 3300025941 Bacteria 580864
454 Ga0207711_10428611 3300025941 Bacteria 1230
455 Ga0207711_10433359 3300025941 Bacteria 1223
456 Ga0207689_10056790 3300025942 Bacteria 3221
457 Ga0207661_10465314 3300025944 Bacteria 1153
458 Ga0207679_10038500 3300025945 Bacteria 3407
459 Ga0207679_10052918 3300025945 Bacteria 2980
460 Ga0207679_10063654 3300025945 Bacteria 2754
461 Ga0207679_10144987 3300025945 Bacteria 1925
462 Ga0207679_10189046 3300025945 Bacteria 1710
463 Ga0207679_10244084 3300025945 Bacteria 1523
464 Ga0207679_10304856 3300025945 Bacteria 1374
465 Ga0207679_10477804 3300025945 Bacteria 1109
466 Ga0207667_10023210 3300025949 Bacteria 6832
467 Ga0207667_10159938 3300025949 Bacteria 2317
468 Ga0207667_10202131 3300025949 Bacteria 2038
469 Ga0207667_10387452 3300025949 Bacteria 1424
470 Ga0207651_10407723 3300025960 Bacteria 1157
471 Ga0207712_10019384 3300025961 Bacteria 4442
472 Ga0207712_10254036 3300025961 Bacteria 1422
473 Ga0207712_10345750 3300025961 Bacteria 1235
474 Ga0207668_10073093 3300025972 Bacteria 2456
475 Ga0207668_10095091 3300025972 Bacteria 2199
476 Ga0207668_10271288 3300025972 Bacteria 1387
477 Ga0207640_10077899 3300025981 Bacteria 2255
478 Ga0207640_10238338 3300025981 Bacteria 1404
479 Ga0207640_10639528 3300025981 Bacteria 905
480 Ga0207677_10268969 3300026023 Bacteria 1393
481 Ga0207703_10192184 3300026035 Bacteria 1809
482 Ga0207703_10656418 3300026035 Bacteria 995
483 Ga0207639_10070740 3300026041 Bacteria 2726
484 Ga0207639_10098738 3300026041 Bacteria 2354
485 Ga0207639_10104036 3300026041 Bacteria 2301
486 Ga0207639_10192759 3300026041 Bacteria 1742
487 Ga0207639_10261580 3300026041 Bacteria 1514
488 Ga0207639_10378085 3300026041 Bacteria 1271
489 Ga0207639_10570133 3300026041 Bacteria 1041
490 Ga0207678_10017130 3300026067 Bacteria 6362
491 Ga0207678_10084461 3300026067 Bacteria 2715
492 Ga0207678_10094504 3300026067 Bacteria 2554
493 Ga0207678_10442451 3300026067 Bacteria 1129
494 Ga0207708_10004234 3300026075 Bacteria 10566
495 Ga0207708_10011842 3300026075 Bacteria 6494
496 Ga0207708_10118713 3300026075 Bacteria 2060
497 Ga0207708_10351510 3300026075 Bacteria 1209
498 Ga0207702_10041088 3300026078 Bacteria 3877
499 Ga0207702_10061501 3300026078 Bacteria 3203
500 Ga0207702_10119602 3300026078 Bacteria 2355
501 Ga0207702_10288566 3300026078 Bacteria 1554
502 Ga0207702_10697731 3300026078 Bacteria 1000
503 Ga0207641_10409386 3300026088 Bacteria 1304
504 Ga0207648_10005468 3300026089 Bacteria 12798
505 Ga0207648_10023947 3300026089 Bacteria 5457
506 Ga0207648_10031830 3300026089 Bacteria 4661
507 Ga0207648_10174981 3300026089 Bacteria 1898
508 Ga0207676_10209472 3300026095 Bacteria 1728
509 Ga0207676_10542282 3300026095 Bacteria 1110
510 Ga0207674_10032125 3300026116 Bacteria 5507
511 Ga0207674_10131097 3300026116 Bacteria 2470
512 Ga0207674_10165816 3300026116 Bacteria 2163
513 Ga0207675_100017878 3300026118 Bacteria 6612
514 Ga0207675_100018667 3300026118 Bacteria 6473
515 Ga0207675_100104780 3300026118 Bacteria 2666
516 Ga0207675_100205047 3300026118 Bacteria 1895
517 Ga0207675_100222055 3300026118 Bacteria 1821
518 Ga0207683_10008639 3300026121 Bacteria 8708
519 Ga0207683_10240326 3300026121 Bacteria 1652
520 Ga0207683_10330990 3300026121 Bacteria 1396
521 Ga0207698_10068167 3300026142 Bacteria 2808
522 Ga0207698_10426081 3300026142 Bacteria 1274
523 Ga0209971_1021207 3300027682 Bacteria 1545
524 Ga0209998_10011871 3300027717 Bacteria 1808
525 Ga0209813_10044478 3300027866 Bacteria 1364
526 Ga0209974_10018046 3300027876 Unclassified 2339
527 Ga0207428_10000114 3300027907 Bacteria 109533
528 Ga0207428_10000780 3300027907 Bacteria 36098
529 Ga0207428_10063883 3300027907 Bacteria 2907
530 Ga0207428_10097457 3300027907 Bacteria 2276
531 Ga0207428_10148445 3300027907 Bacteria 1786
532 Ga0268266_10094215 3300028379 Bacteria 2628
533 Ga0268266_10478468 3300028379 Bacteria 1187
534 Ga0268266_11255547 3300028379 Bacteria 716
535 Ga0268265_10379727 3300028380 Bacteria 1299
536 Ga0268264_10181628 3300028381 Bacteria 1911
537 Ga0268264_10381276 3300028381 Bacteria 1350
538 Ga0265334_10098446 3300028573 Bacteria 1061
539 Ga0265318_10001593 3300028577 Bacteria 13116
540 Ga0265318_10035734 3300028577 Bacteria 1909
541 Ga0265338_10018968 3300028800 Bacteria 7332
542 Ga0265330_10113796 3300031235 Bacteria 1154
543 Ga0265330_10135036 3300031235 Bacteria 1049
544 Ga0265330_10148206 3300031235 Bacteria 997
545 Ga0265332_10053204 3300031238 Bacteria 1738
546 Ga0265325_10010515 3300031241 Bacteria 5354
547 Ga0265329_10015828 3300031242 Bacteria 2627
548 Ga0265340_10028355 3300031247 Bacteria 2817
549 Ga0265340_10040744 3300031247 Bacteria 2286
550 Ga0265340_10121949 3300031247 Bacteria 1199
551 Ga0265340_10185624 3300031247 Bacteria 939
552 Ga0265339_10001731 3300031249 Bacteria 16078
553 Ga0265339_10005432 3300031249 Bacteria 8490
554 Ga0265339_10093009 3300031249 Bacteria 1578
555 Ga0265331_10031059 3300031250 Bacteria 2656
556 Ga0265331_10060020 3300031250 Bacteria 1798
557 Ga0265316_10049879 3300031344 Bacteria 3295
558 Ga0265316_10333879 3300031344 Bacteria 1099
559 Ga0265316_10356950 3300031344 Bacteria 1057
560 Ga0307513_10336724 3300031456 Bacteria 1261
561 Ga0265313_10000044 3300031595 Bacteria 117063
562 Ga0265313_10022625 3300031595 Bacteria 3404
563 Ga0316579_10121039 3300031691 Bacteria 1258
564 Ga0265314_10045569 3300031711 Bacteria 3100
565 Ga0265314_10094791 3300031711 Bacteria 1934
566 Ga0265314_10101375 3300031711 Bacteria 1850
567 Ga0265314_10209167 3300031711 Bacteria 1147
568 Ga0265342_10181895 3300031712 Bacteria 1151
569 Ga0265342_10283987 3300031712 Bacteria 875
570 Ga0307516_10337816 3300031730 Bacteria 1174
571 Ga0307412_10355513 3300031911 Bacteria 1178
572 Ga0307409_100313677 3300031995 Bacteria 1465
573 Ga0307414_10058182 3300032004 Bacteria 2722
574 Ga0307414_10148159 3300032004 Bacteria 1847
575 Ga0307414_10154126 3300032004 Unclassified 1816
576 Ga0307414_10578982 3300032004 Bacteria 1004
577 Ga0373930_0001543 3300034816 Bacteria 3450
578 Ga0373930_0037291 3300034816 Bacteria 1023
579 Ga0373948_0026647 3300034817 Bacteria 1140
580 Ga0373950_0001403 3300034818 Bacteria 3135
581 Ga0373958_0000619 3300034819 Bacteria 4431
582 Ga0373958_0025252 3300034819 Bacteria 1130
583 Ga0373959_0001495 3300034820 Bacteria 3739
584 Ga0373938_0005414 3300034957 Bacteria 2168
585 Ga0373928_0001492 3300035084 Bacteria 4550
586 Ga0373928_0043024 3300035084 Bacteria 1044
587 Ga0373929_0003088 3300035085 Bacteria 3027
588 Ga0373940_0015579 3300035088 Bacteria 1872
589 Ga0373949_0004253 3300035090 Bacteria 3298
590 Ga0373949_0096340 3300035090 Bacteria 806
591 Ga0373952_0003160 3300035092 Bacteria 2965
592 Ga0373923_0120013 3300035111 Bacteria 1174
593 Ga0373932_0008968 3300035112 Bacteria 2398
594 Ga0373936_0069945 3300035113 Bacteria 1445
595 Ga0373939_0000722 3300035114 Bacteria 8181
596 Ga0373939_0210915 3300035114 Bacteria 739
597 Ga0373941_0002372 3300035115 Bacteria 4136
598 Ga0373945_0003731 3300035116 Bacteria 4802
599 Ga0373953_0122910 3300035117 Bacteria 1103
600 Ga0373956_0017190 3300035119 Bacteria 3047
601 Ga0373957_0070795 3300035120 Bacteria 1364
602 Ga0373960_0010670 3300035121 Bacteria 2248
603 Ga0373943_0052522 3300035170 Bacteria 2009
604 Ga0373943_0160975 3300035170 Bacteria 1222
605 Ga0373946_0011244 3300035171 Bacteria 3334
606 Ga0373946_0193624 3300035171 Bacteria 971
607 Ga0373955_0109805 3300035172 Bacteria 1594
608 Ga0373942_0001603 3300035207 Bacteria 5788
609 Ga0373961_0008986 3300035241 Bacteria 2437
610 Ga0373962_0001346 3300035242 Bacteria 5795
611 Ga0373962_0125778 3300035242 Bacteria 821
612 Ga0373931_0010237 3300035691 Bacteria 4504
613 Ga0373931_0017812 3300035691 Bacteria 3520
614 Ga0373931_0081951 3300035691 Bacteria 1782
615 Ga0373931_0165434 3300035691 Bacteria 1299
616 Ga0373935_0022191 3300035692 Bacteria 3890
617 Ga0373927_0054968 3300035695 Bacteria 2575
618 Ga0373927_0158928 3300035695 Bacteria 1480
619 Ga0373947_0006153 3300035725 Bacteria 6979
620 Ga0373947_0023121 3300035725 Bacteria 3613
621 Ga0373947_0073637 3300035725 Bacteria 2099
622 Ga0373937_0027365 3300036401 Bacteria 5155
623 Ga0373925_0004747 3300037068 Bacteria 10245
624 Ga0373925_0098904 3300037068 Bacteria 2240
625 Ga0373925_0110753 3300037068 Bacteria 2120
626 Ga0395899_0000137 3300037312 Bacteria 111924
627 Ga0395899_0037204 3300037312 Bacteria 3649
628 Ga0395899_0259027 3300037312 Bacteria 1190
629 Ga0395900_0000108 3300037418 Bacteria 147706
630 Ga0395900_0025260 3300037418 Bacteria 6081
631 Ga0395898_0027497 3300037466 Bacteria 5708
632 Ga0395898_0349692 3300037466 Bacteria 1409
633 Ga0395898_0833597 3300037466 Unclassified 862
634 Ga0395905_0009347 3300037471 Bacteria 9585
635 Ga0395905_0868756 3300037471 Bacteria 805
636 Ga0395901_0000050 3300038443 Bacteria 171046
637 Ga0395901_0009335 3300038443 Bacteria 9945
638 Ga0395901_0159813 3300038443 Bacteria 2366
639 Ga0436365_0018302 3300039437 Bacteria 5178
640 Ga0436361_1124544 3300039447 Bacteria 3019
641 Ga0436363_1605866 3300039450 Bacteria 5589
642 Ga0439453_0014235 3300041408 Bacteria 1361
643 Ga0439465_0020859 3300041413 Bacteria 2054
644 Ga0439465_0226623 3300041413 Bacteria 686
645 Ga0451806_251659 3300041462 Unclassified 742
646 Ga0451833_1389376 3300041491 Bacteria 721
647 Ga0451853_1492139 3300041512 Bacteria 1057
648 Ga0439443_006364 3300042003 Bacteria 1614
649 Ga0439448_0015604 3300042005 Bacteria 2302
650 Ga0439432_042708 3300042006 Bacteria 1433
651 Ga0439460_0010702 3300042461 Bacteria 2355
652 Ga0453684_0218063 3300044712 Bacteria 2212
653 Ga0453684_0569639 3300044712 Bacteria 1245
654 Ga0451576_0752684 3300045051 Bacteria 1023
655 Ga0466967_0109578 3300045976 Bacteria 2535
656 Ga0495627_062755 3300046453 Bacteria 1097
657 Ga0495592_0076095 3300046454 Bacteria 2436
658 Ga0495590_0043265 3300046457 Bacteria 1571
659 Ga0495629_0000401 3300046459 Bacteria 36430
660 Ga0495629_0090408 3300046459 Bacteria 2136
661 Ga0495629_0207070 3300046459 Unclassified 1355
662 Ga0495638_0096360 3300046460 Bacteria 1776
663 Ga0495641_0004844 3300046461 Bacteria 9352
664 Ga0495641_0029113 3300046461 Bacteria 2663
665 Ga0495651_0281516 3300046462 Bacteria 1123
666 Ga0495582_0361348 3300046473 Bacteria 836
667 Ga0495639_0056203 3300046475 Bacteria 1796
668 Ga0495639_0064197 3300046475 Bacteria 1687
669 Ga0495584_0031341 3300046491 Bacteria 2692
670 Ga0495584_0185278 3300046491 Bacteria 1058
671 Ga0495584_0333579 3300046491 Bacteria 770
672 Ga0495585_0082050 3300046492 Bacteria 1746
673 Ga0495594_0026038 3300046499 Bacteria 3145
674 Ga0495608_0077938 3300046511 Bacteria 2157
675 Ga0495618_0071945 3300046514 Bacteria 2200
676 Ga0495628_0024458 3300046516 Bacteria 4944
677 Ga0495628_0575487 3300046516 Bacteria 807
678 Ga0495630_0423142 3300046517 Bacteria 1020
679 Ga0495663_0129901 3300046525 Bacteria 849
680 Ga0495666_0010453 3300046526 Bacteria 4627
681 Ga0495652_0058677 3300046529 Bacteria 3258
682 Ga0495665_0028390 3300046531 Bacteria 3000
683 Ga0495665_0043243 3300046531 Bacteria 2396
684 Ga0495665_0092618 3300046531 Bacteria 1588
685 Ga0495665_0113151 3300046531 Bacteria 1423
686 Ga0495640_0040573 3300046533 Bacteria 3259
687 Ga0495587_0226065 3300046536 Bacteria 1055
688 Ga0495598_0009195 3300046537 Bacteria 2328
689 Ga0495598_0058399 3300046537 Bacteria 1183
690 Ga0495633_0127269 3300046558 Bacteria 1179
691 Ga0495656_0396620 3300046615 Bacteria 721
692 Ga0495634_0048969 3300046642 Bacteria 2843
693 Ga0495635_0008556 3300046663 Bacteria 7146
694 Ga0495659_0054852 3300046664 Bacteria 1459
695 Ga0495647_0008543 3300046681 Bacteria 3445
696 Ga0495658_0000265 3300046683 Bacteria 29770
697 Ga0495658_0022039 3300046683 Bacteria 3365
698 Ga0495613_0021477 3300046689 Bacteria 4811
699 Ga0495613_0058664 3300046689 Bacteria 2824
700 Ga0495613_0154209 3300046689 Bacteria 1637
701 Ga0495624_0235925 3300046690 Bacteria 1107
702 Ga0495670_0172382 3300046691 Bacteria 1140
703 Ga0495600_0145298 3300046809 Unclassified 1537
704 Ga0495660_0129760 3300046810 Bacteria 1266
705 Ga0495581_0082802 3300047315 Bacteria 1859
706 Ga0495581_0281187 3300047315 Bacteria 973
707 Ga0495604_0128590 3300047317 Bacteria 1823
708 Ga0495604_0240520 3300047317 Bacteria 1238
709 Ga0495674_0029493 3300047319 Bacteria 4995
710 Ga0495674_0029987 3300047319 Bacteria 4949
711 Ga0495676_0028968 3300047321 Bacteria 4720
712 Ga0495676_0134654 3300047321 Unclassified 1779
713 Ga0495680_0006959 3300047322 Bacteria 10435
714 Ga0495681_0168428 3300047470 Bacteria 908
715 Ga0495593_0003423 3300047673 Bacteria 9494
716 Ga0495593_0130270 3300047673 Unclassified 1277
717 Ga0495602_0451316 3300048088 Unclassified 907
718 Ga0495626_0156478 3300048091 Bacteria 958
719 Ga0496100_0037305 3300048903 Bacteria 3072
720 Ga0496100_0349203 3300048903 Bacteria 1117
721 Ga0496101_0038579 3300048904 Bacteria 3393
722 Ga0496101_0044812 3300048904 Bacteria 3166
723 Ga0496101_0874488 3300048904 Bacteria 708
724 Ga0496102_0017500 3300048905 Bacteria 6277
725 Ga0496102_0050186 3300048905 Bacteria 3798
726 Ga0496102_0201396 3300048905 Bacteria 1877
727 Ga0496102_0635764 3300048905 Bacteria 990
728 Ga0496103_0004512 3300048906 Bacteria 8436
729 Ga0496103_0471671 3300048906 Bacteria 804
730 Ga0496104_0011639 3300048907 Bacteria 7885
731 Ga0496104_0090470 3300048907 Bacteria 2924
732 Ga0496104_0121789 3300048907 Bacteria 2505
733 Ga0496104_0136526 3300048907 Bacteria 2356
734 Ga0496104_0701418 3300048907 Bacteria 920
735 Ga0496105_0004355 3300048908 Bacteria 10660
736 Ga0496105_0038287 3300048908 Bacteria 3950
737 Ga0496105_0154880 3300048908 Bacteria 1882
738 Ga0496106_0044848 3300048909 Bacteria 3320
739 Ga0496106_0046732 3300048909 Bacteria 3256
740 Ga0496106_0083540 3300048909 Bacteria 2456
741 Ga0496106_0119348 3300048909 Bacteria 2060
742 Ga0496106_0227089 3300048909 Bacteria 1490
743 Ga0496107_0013051 3300048910 Bacteria 5804
744 Ga0496107_0040423 3300048910 Bacteria 3347
745 Ga0496107_0145923 3300048910 Bacteria 1750
746 Ga0496107_0440364 3300048910 Bacteria 968
747 Ga0496108_0000500 3300048911 Bacteria 31075
748 Ga0496108_0058071 3300048911 Bacteria 3251
749 Ga0496108_0139528 3300048911 Bacteria 2088
750 Ga0496109_0000423 3300048912 Bacteria 37167
751 Ga0496109_0008666 3300048912 Bacteria 8656
752 Ga0496109_0043699 3300048912 Bacteria 4062
753 Ga0496109_0878775 3300048912 Bacteria 834
754 Ga0496110_0179448 3300048913 Bacteria 1922
755 Ga0496110_0247311 3300048913 Bacteria 1623
756 Ga0496110_0320106 3300048913 Bacteria 1413
757 Ga0496111_0013636 3300048914 Bacteria 5536
758 Ga0496111_0022126 3300048914 Bacteria 4447
759 Ga0496111_0613257 3300048914 Bacteria 796
760 Ga0496112_0161341 3300048915 Bacteria 2208
761 Ga0496112_0166700 3300048915 Bacteria 2169
762 Ga0496112_0365926 3300048915 Bacteria 1383
763 Ga0496112_0456718 3300048915 Bacteria 1215
764 Ga0496113_0002838 3300048916 Bacteria 10187
765 Ga0496114_0201432 3300048917 Bacteria 1743
766 Ga0496115_0058628 3300048918 Bacteria 3098
767 Ga0496115_0074139 3300048918 Bacteria 2763
768 Ga0496115_0152663 3300048918 Bacteria 1907
769 Ga0496115_0173322 3300048918 Bacteria 1784
770 Ga0496117_0018920 3300048920 Bacteria 5681
771 Ga0496118_0009347 3300048921 Bacteria 9930
772 Ga0496119_0181649 3300048922 Bacteria 1103
773 Ga0496120_0190083 3300048923 Bacteria 1002
774 Ga0496121_0091592 3300048924 Bacteria 2373
775 Ga0496122_0009621 3300048925 Bacteria 10124
776 Ga0496123_0011580 3300048926 Bacteria 7626
777 Ga0496124_0239028 3300048927 Bacteria 1352
778 Ga0501031_0019928 3300049568 Bacteria 4372
779 Ga0501031_0079720 3300049568 Bacteria 2134
780 Ga0501031_0285194 3300049568 Bacteria 1071
781 Ga0501032_0003009 3300049569 Bacteria 13080
782 Ga0501032_0035806 3300049569 Bacteria 3391
783 Ga0501032_0063717 3300049569 Bacteria 2468
784 Ga0501032_0177881 3300049569 Bacteria 1394
785 Ga0501032_0280731 3300049569 Bacteria 1078
786 Ga0501033_0012065 3300049570 Bacteria 6595
787 Ga0501033_0013087 3300049570 Bacteria 6323
788 Ga0501034_0006092 3300049571 Bacteria 13017
789 Ga0501034_0016923 3300049571 Bacteria 7475
790 Ga0501034_0023919 3300049571 Bacteria 6217
791 Ga0501034_0032939 3300049571 Bacteria 5262
792 Ga0501034_0180502 3300049571 Bacteria 2075
793 Ga0501034_0843963 3300049571 Bacteria 807
794 Ga0501036_0018194 3300049572 Bacteria 5884
795 Ga0501036_0081797 3300049572 Bacteria 2729
796 Ga0501036_0349591 3300049572 Bacteria 1234
797 Ga0501036_0400644 3300049572 Bacteria 1145
798 Ga0501036_0495736 3300049572 Bacteria 1016
799 Ga0501037_0005542 3300049573 Bacteria 9210
800 Ga0501037_0047366 3300049573 Bacteria 3150
801 Ga0501037_0120258 3300049573 Bacteria 1889
802 Ga0501037_0146057 3300049573 Bacteria 1692
803 Ga0501037_0476039 3300049573 Bacteria 849
804 Ga0501038_0008694 3300049574 Bacteria 9322
805 Ga0501038_0050643 3300049574 Bacteria 3587
806 Ga0501038_0055775 3300049574 Bacteria 3394
807 Ga0501038_0099164 3300049574 Bacteria 2429
808 Ga0501038_0101294 3300049574 Bacteria 2398
809 Ga0501038_0124853 3300049574 Bacteria 2119
810 Ga0501038_0141895 3300049574 Bacteria 1965
811 Ga0501038_0341746 3300049574 Bacteria 1167
812 Ga0501039_0039751 3300049575 Bacteria 3632
813 Ga0501039_0099656 3300049575 Bacteria 2267
814 Ga0501039_0206374 3300049575 Bacteria 1545
815 Ga0501039_0220391 3300049575 Bacteria 1491
816 Ga0501039_0234843 3300049575 Bacteria 1442
817 Ga0501040_0026969 3300049576 Bacteria 3865
818 Ga0501040_0037469 3300049576 Bacteria 3294
819 Ga0501040_0315857 3300049576 Bacteria 1117
820 Ga0501041_0013496 3300049577 Bacteria 4844
821 Ga0501041_0156811 3300049577 Bacteria 1422
822 Ga0501042_0104498 3300049578 Bacteria 2038
823 Ga0501042_0108909 3300049578 Bacteria 1994
824 Ga0501042_0196712 3300049578 Bacteria 1454
825 Ga0501042_0469204 3300049578 Bacteria 913
826 Ga0501043_0004706 3300049579 Bacteria 11062
827 Ga0501043_0263384 3300049579 Bacteria 1325
828 Ga0501043_0516445 3300049579 Bacteria 891
829 Ga0501043_0548204 3300049579 Bacteria 859
830 Ga0501046_0035794 3300049580 Bacteria 3999
831 Ga0501046_0044288 3300049580 Bacteria 3539
832 Ga0501046_0072386 3300049580 Bacteria 2676
833 Ga0501046_0199710 3300049580 Bacteria 1488
834 Ga0501046_0265638 3300049580 Bacteria 1260
835 Ga0501046_0345800 3300049580 Bacteria 1080
836 Ga0501047_0003479 3300049581 Bacteria 14883
837 Ga0501047_0019070 3300049581 Bacteria 6581
838 Ga0501047_0086573 3300049581 Bacteria 3011
839 Ga0501047_0124435 3300049581 Bacteria 2459
840 Ga0501047_0297701 3300049581 Bacteria 1456
841 Ga0501048_0020276 3300049582 Bacteria 4872
842 Ga0501048_0059739 3300049582 Bacteria 2702
843 Ga0501048_0119077 3300049582 Bacteria 1866
844 Ga0501048_0151176 3300049582 Bacteria 1642
845 Ga0501048_0264719 3300049582 Bacteria 1221
846 Ga0501067_0029425 3300049583 Bacteria 3044
847 Ga0501067_0048871 3300049583 Bacteria 2345
848 Ga0501067_0050746 3300049583 Bacteria 2299
849 Ga0501068_0026592 3300049584 Bacteria 3411
850 Ga0501068_0032227 3300049584 Bacteria 3116
851 Ga0501068_0068477 3300049584 Bacteria 2163
852 Ga0501068_0380693 3300049584 Bacteria 909
853 Ga0501068_0511333 3300049584 Bacteria 779
854 Ga0501069_0006105 3300049585 Bacteria 6286
855 Ga0501069_0141393 3300049585 Bacteria 1381
856 Ga0501069_0352814 3300049585 Bacteria 867
857 Ga0501070_0011792 3300049586 Bacteria 7382
858 Ga0501070_0055774 3300049586 Bacteria 3275
859 Ga0501070_0089148 3300049586 Bacteria 2553
860 Ga0501070_0368587 3300049586 Bacteria 1164
861 Ga0501070_0815161 3300049586 Bacteria 732
862 Ga0501071_0035441 3300049587 Bacteria 3554
863 Ga0501071_0047919 3300049587 Bacteria 3071
864 Ga0501071_0330625 3300049587 Bacteria 1158
865 Ga0501071_0682165 3300049587 Bacteria 791
866 Ga0501072_0011656 3300049588 Bacteria 6716
867 Ga0501072_0026974 3300049588 Bacteria 4483
868 Ga0501072_0033731 3300049588 Bacteria 4011
869 Ga0501072_0068309 3300049588 Bacteria 2805
870 Ga0501072_0755433 3300049588 Bacteria 763
871 Ga0501072_0783561 3300049588 Bacteria 747
872 Ga0501073_0002727 3300049589 Bacteria 13239
873 Ga0501073_0163041 3300049589 Bacteria 1544
874 Ga0501073_0481170 3300049589 Bacteria 858
875 Ga0501074_0002406 3300049590 Bacteria 13051
876 Ga0501074_0024213 3300049590 Bacteria 4412
877 Ga0501074_0047670 3300049590 Bacteria 3096
878 Ga0501074_0109856 3300049590 Bacteria 1973
879 Ga0501074_0196429 3300049590 Bacteria 1438
880 Ga0501074_0278837 3300049590 Bacteria 1188
881 Ga0501075_0058224 3300049591 Bacteria 2910
882 Ga0501075_0094095 3300049591 Bacteria 2274
883 Ga0501075_0103669 3300049591 Bacteria 2162
884 Ga0501075_0124727 3300049591 Bacteria 1960
885 Ga0501075_0456607 3300049591 Bacteria 974
886 Ga0501076_0048669 3300049592 Bacteria 3350
887 Ga0501076_0099441 3300049592 Bacteria 2343
888 Ga0501076_0214514 3300049592 Bacteria 1573
889 Ga0501076_0240920 3300049592 Bacteria 1480
890 Ga0501076_0273863 3300049592 Bacteria 1382
891 Ga0501077_0026393 3300049593 Bacteria 3686
892 Ga0501077_0038193 3300049593 Bacteria 3057
893 Ga0501077_0043636 3300049593 Bacteria 2850
894 Ga0501077_0060276 3300049593 Bacteria 2408
895 Ga0501077_0132833 3300049593 Bacteria 1578
896 Ga0501077_0366115 3300049593 Bacteria 920
897 Ga0501079_0014707 3300049741 Bacteria 5964
898 Ga0501079_0018315 3300049741 Bacteria 5352
899 Ga0501079_0026067 3300049741 Bacteria 4483
900 Ga0501079_0346649 3300049741 Bacteria 1163
901 Ga0501079_0395447 3300049741 Bacteria 1084
902 Ga0501079_0473176 3300049741 Bacteria 984
903 Ga0501080_0002491 3300049742 Bacteria 16116
904 Ga0501080_0034662 3300049742 Bacteria 4713
905 Ga0501080_0047241 3300049742 Bacteria 4007
906 Ga0501080_0133865 3300049742 Bacteria 2294
907 Ga0501080_0254339 3300049742 Bacteria 1601
908 Ga0501080_0302428 3300049742 Bacteria 1450
909 Ga0501080_0350370 3300049742 Bacteria 1333
910 Ga0501080_0492529 3300049742 Bacteria 1096
911 Ga0501081_0023102 3300049743 Bacteria 4166
912 Ga0501081_0032968 3300049743 Bacteria 3516
913 Ga0501081_0154907 3300049743 Bacteria 1648
914 Ga0501081_0218867 3300049743 Bacteria 1384
915 Ga0501083_0061919 3300049744 Bacteria 2498
916 Ga0501083_0066569 3300049744 Bacteria 2398
917 Ga0501083_0148457 3300049744 Bacteria 1535
918 Ga0501035_0002087 3300049822 Bacteria 19885
919 Ga0501035_0066862 3300049822 Bacteria 3190
920 Ga0501035_0150278 3300049822 Bacteria 2022
921 Ga0501035_0207445 3300049822 Bacteria 1678
922 Ga0501035_0330167 3300049822 Bacteria 1280
923 Ga0501035_0787545 3300049822 Bacteria 760
924 Ga0501044_0007150 3300049823 Bacteria 12278
925 Ga0501044_0008252 3300049823 Bacteria 11423
926 Ga0501044_0076517 3300049823 Bacteria 3396
927 Ga0501044_0136143 3300049823 Bacteria 2447
928 Ga0501044_0734229 3300049823 Bacteria 871
929 Ga0501045_0067841 3300049824 Bacteria 2620
930 Ga0501045_0129361 3300049824 Bacteria 1877
931 Ga0501045_0144958 3300049824 Bacteria 1766
932 Ga0501045_0245276 3300049824 Bacteria 1333
933 Ga0501045_0267857 3300049824 Bacteria 1272
934 Ga0501045_0347743 3300049824 Bacteria 1103
935 Ga0501045_0355179 3300049824 Bacteria 1091
936 nmdc:mga03683_6724_c1 3300050489 Bacteria 3954
937 nmdc:mga03n38_14159_c2 3300050490 Bacteria 2591
938 nmdc:mga03n38_99775_c1 3300050490 Bacteria 1399
939 nmdc:mga00v17_123433_c1 3300050491 Bacteria 1651
940 nmdc:mga00v17_202229_c1 3300050491 Bacteria 1284
941 nmdc:mga0yw44_116719_c1 3300050492 Bacteria 1716
942 nmdc:mga0yw44_5076_c1 3300050492 Bacteria 6151
943 nmdc:mga0yw44_89212_c1 3300050492 Bacteria 1945
944 nmdc:mga0k408_11813_c1 3300050493 Bacteria 4764
945 nmdc:mga0k408_23023_c1 3300050493 Bacteria 3511
946 nmdc:mga0k408_31378_c1 3300050493 Bacteria 3033
947 nmdc:mga0k408_5302_c1 3300050493 Bacteria 6848
948 nmdc:mga0k408_5967_c1 3300050493 Bacteria 6501
949 nmdc:mga06z11_161522_c1 3300050494 Bacteria 1281
950 nmdc:mga06z11_457316_c1 3300050494 Bacteria 772
951 nmdc:mga06z11_69648_c1 3300050494 Bacteria 1858
952 nmdc:mga07m45_12111_c1 3300050496 Bacteria 4552
953 nmdc:mga07m45_231716_c1 3300050496 Bacteria 1075
954 nmdc:mga07m45_63242_c1 3300050496 Bacteria 2099
955 nmdc:mga07m45_93628_c1 3300050496 Bacteria 1722
956 nmdc:mga05p37_19716_c1 3300050507 Bacteria 8159
957 nmdc:mga05p37_2557_c2 3300050507 Bacteria 17706
958 nmdc:mga05p37_54453_c1 3300050507 Bacteria 3437
959 nmdc:mga05p37_56_c3 3300050507 Bacteria 77819
960 nmdc:mga09592_976_c1 3300050508 Bacteria 22595
961 nmdc:mga0qj67_52793_c1 3300050509 Bacteria 3218
962 nmdc:mga06r32_268462_c1 3300050510 Bacteria 1693
963 nmdc:mga06r32_806_c1 3300050510 Bacteria 27804
964 nmdc:mga08y16_141077_c1 3300050511 Bacteria 2505
965 nmdc:mga08y16_206_c1 3300050511 Bacteria 46039
966 nmdc:mga08y16_22406_c1 3300050511 Bacteria 6668
967 nmdc:mga08y16_236347_c1 3300050511 Bacteria 1889
968 nmdc:mga08y16_31639_c1 3300050511 Bacteria 5564
969 nmdc:mga08y16_465793_c1 3300050511 Bacteria 1287
970 nmdc:mga0n895_12772_c1 3300050512 Bacteria 7542
971 nmdc:mga0n895_202634_c1 3300050512 Bacteria 2015
972 nmdc:mga0n895_45294_c1 3300050512 Bacteria 4292
973 nmdc:mga0n895_57984_c1 3300050512 Bacteria 3818
974 nmdc:mga0rr50_316396_c1 3300050513 Bacteria 1308
975 nmdc:mga0a205_19489_c1 3300050515 Bacteria 6396
976 nmdc:mga0a205_80_c1 3300050515 Bacteria 53083
977 nmdc:mga0a205_82248_c1 3300050515 Bacteria 3110
978 nmdc:mga0a205_89699_c2 3300050515 Bacteria 2415
979 nmdc:mga0sz30_116538_c1 3300050516 Bacteria 1173
980 Ga0495601_0038174 3300053077 Bacteria 3002
981 Ga0495601_0041938 3300053077 Bacteria 2870
982 Ga0495601_0316942 3300053077 Unclassified 1015
983 Ga0495612_0021700 3300053078 Bacteria 2576
984 Ga0495612_0068978 3300053078 Unclassified 1472
985 Ga0495612_0260275 3300053078 Bacteria 773
986 Ga0495595_0012363 3300053084 Bacteria 3587
987 Ga0495619_0000016 3300053085 Bacteria 231442
988 Ga0495619_0000164 3300053085 Bacteria 48672
989 Ga0495619_0017754 3300053085 Bacteria 4508
990 Ga0495619_0203405 3300053085 Unclassified 1371
991 Ga0500641_0010930 3300053096 Bacteria 3291
992 Ga0500652_081181 3300053131 Bacteria 1350
993 Ga0500577_0021827 3300053142 Bacteria 2115
994 Ga0500616_0032782 3300053153 Bacteria 2839
995 Ga0500639_131949 3300053163 Bacteria 1182
996 Ga0500645_007885 3300053730 Bacteria 3676
997 Ga0501084_0016732 3300054114 Bacteria 6090
998 Ga0501084_0066520 3300054114 Bacteria 3016
999 Ga0501084_0136403 3300054114 Bacteria 2065
1000 Ga0501084_0209256 3300054114 Bacteria 1646
1001 Ga0501084_0211154 3300054114 Bacteria 1638
1002 Ga0501084_0218223 3300054114 Bacteria 1609
1003 Ga0501084_0355074 3300054114 Bacteria 1238
1004 Ga0501082_0066474 3300060353 Bacteria 3105
1005 Ga0501082_0106355 3300060353 Bacteria 2427
1006 Ga0501082_0116348 3300060353 Bacteria 2315
1007 Ga0501082_0201883 3300060353 Bacteria 1730
1008 Ga0501082_0214611 3300060353 Bacteria 1674
1009 Ga0501082_0387777 3300060353 Bacteria 1219
1010 Ga0501082_0454576 3300060353 Bacteria 1119
1011 Ga0501082_0677847 3300060353 Bacteria 902
1012 Ga0530510_0028015 3300061734 Bacteria 4039
1013 Ga0530510_0055057 3300061734 Bacteria 2874
1014 Ga0530510_0073046 3300061734 Bacteria 2490
1015 Ga0530510_0273289 3300061734 Bacteria 1261

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048922 Ga0496119_0181649 Ga0496119_0181649_584_1084 163
2 3300049589 Ga0501073_0481170 Ga0501073_0481170_20_562 178
3 3300049586 Ga0501070_0815161 Ga0501070_0815161_56_601 180
4 3300048920 Ga0496117_0018920 Ga0496117_0018920_5026_5598 186
5 3300048921 Ga0496118_0009347 Ga0496118_0009347_5019_5591 186
6 3300048925 Ga0496122_0009621 Ga0496122_0009621_4496_5068 186
7 3300048926 Ga0496123_0011580 Ga0496123_0011580_2119_2691 186
8 3300005327 Ga0070658_10002045 Ga0070658_100020457 188
9 3300005339 Ga0070660_100146623 Ga0070660_1001466231 188
10 3300005344 Ga0070661_100015548 Ga0070661_1000155482 188
11 3300005530 Ga0070679_100360469 Ga0070679_1003604693 188
12 3300005539 Ga0068853_100073544 Ga0068853_1000735442 188
13 3300005614 Ga0068856_100034732 Ga0068856_1000347324 188
14 3300005616 Ga0068852_100001655 Ga0068852_1000016557 188
15 3300009093 Ga0105240_10069912 Ga0105240_100699122 188
16 3300009551 Ga0105238_10001373 Ga0105238_1000137318 188
17 3300010375 Ga0105239_10119753 Ga0105239_101197533 188
18 3300013100 Ga0157373_10057799 Ga0157373_100577991 188
19 3300013104 Ga0157370_10082033 Ga0157370_100820332 188
20 3300013105 Ga0157369_10021559 Ga0157369_100215598 188
21 3300025913 Ga0207695_10080968 Ga0207695_100809684 188
22 3300025919 Ga0207657_10127236 Ga0207657_101272361 188
23 3300025920 Ga0207649_10008729 Ga0207649_100087293 188
24 3300025924 Ga0207694_10086104 Ga0207694_100861044 188
25 3300025949 Ga0207667_10023210 Ga0207667_100232108 188
26 3300026041 Ga0207639_10104036 Ga0207639_101040363 188
27 3300026078 Ga0207702_10041088 Ga0207702_100410884 188
28 3300009094 Ga0111539_10909214 Ga0111539_109092142 190
29 3300009147 Ga0114129_10099148 Ga0114129_100991484 190
30 3300050507 nmdc:mga05p37_54453_c1 nmdc:mga05p37_54453_c1_1904_2518 190
31 3300050510 nmdc:mga06r32_268462_c1 nmdc:mga06r32_268462_c1_374_988 190
32 3300050511 nmdc:mga08y16_236347_c1 nmdc:mga08y16_236347_c1_116_730 190
33 3300060353 Ga0501082_0677847 Ga0501082_0677847_260_886 191
34 3300005347 Ga0070668_100101877 Ga0070668_1001018773 192
35 3300025923 Ga0207681_10169527 Ga0207681_101695273 192
36 3300025972 Ga0207668_10073093 Ga0207668_100730932 192
37 3300037471 Ga0395905_0868756 Ga0395905_0868756_11_622 192
38 3300047470 Ga0495681_0168428 Ga0495681_0168428_299_895 192
39 3300005937 Ga0081455_10008578 Ga0081455_100085789 193
40 3300005356 Ga0070674_100252788 Ga0070674_1002527881 194
41 3300009098 Ga0105245_10743314 Ga0105245_107433142 195
42 3300048906 Ga0496103_0471671 Ga0496103_0471671_70_723 195
43 3300048909 Ga0496106_0083540 Ga0496106_0083540_1077_1730 195
44 iso_pu_bacteria 2884960567 2884964059 195
45 3300005366 Ga0070659_100070471 Ga0070659_1000704712 196
46 3300005539 Ga0068853_100126317 Ga0068853_1001263172 196
47 3300005564 Ga0070664_100085255 Ga0070664_1000852552 196
48 3300013100 Ga0157373_10002425 Ga0157373_1000242511 196
49 3300013100 Ga0157373_10013179 Ga0157373_100131796 196
50 3300025932 Ga0207690_10034354 Ga0207690_100343543 196
51 3300025945 Ga0207679_10063654 Ga0207679_100636543 196
52 3300026041 Ga0207639_10070740 Ga0207639_100707403 196
53 3300026041 Ga0207639_10261580 Ga0207639_102615802 196
54 3300049568 Ga0501031_0285194 Ga0501031_0285194_361_1002 196
55 3300049588 Ga0501072_0783561 Ga0501072_0783561_15_656 196
56 3300060353 Ga0501082_0454576 Ga0501082_0454576_240_881 196
57 3300013306 Ga0163162_10079200 Ga0163162_100792002 197
58 3300013308 Ga0157375_10415941 Ga0157375_104159413 197
59 3300026118 Ga0207675_100222055 Ga0207675_1002220552 197
60 3300048905 Ga0496102_0050186 Ga0496102_0050186_1799_2395 197
61 3300049581 Ga0501047_0124435 Ga0501047_0124435_1765_2370 197
62 3300049583 Ga0501067_0050746 Ga0501067_0050746_29_634 197
63 3300049585 Ga0501069_0352814 Ga0501069_0352814_59_664 197
64 3300049586 Ga0501070_0368587 Ga0501070_0368587_315_920 197
65 3300049590 Ga0501074_0047670 Ga0501074_0047670_2102_2707 197
66 3300049742 Ga0501080_0302428 Ga0501080_0302428_441_1046 197
67 3300021361 Ga0213872_10146057 Ga0213872_101460572 198
68 3300039447 Ga0436361_1124544 Ga0436361_1124544_991_1590 198
69 3300048904 Ga0496101_0874488 Ga0496101_0874488_61_660 198
70 3300048909 Ga0496106_0119348 Ga0496106_0119348_658_1257 198
71 3300014968 Ga0157379_10001600 Ga0157379_100016008 199
72 3300035117 Ga0373953_0122910 Ga0373953_0122910_68_685 199
73 3300035119 Ga0373956_0017190 Ga0373956_0017190_396_1013 199
74 3300035120 Ga0373957_0070795 Ga0373957_0070795_718_1335 199
75 3300036401 Ga0373937_0027365 Ga0373937_0027365_2142_2759 199
76 3300046689 Ga0495613_0154209 Ga0495613_0154209_736_1353 199
77 3300005548 Ga0070665_100966555 Ga0070665_1009665552 200
78 3300025295 Ga0209564_1012585 Ga0209564_10125851 200
79 3300041462 Ga0451806_251659 Ga0451806_251659_111_728 200
80 3300049581 Ga0501047_0019070 Ga0501047_0019070_5187_5822 200
81 3300054114 Ga0501084_0355074 Ga0501084_0355074_571_1206 200
82 iso_pu_bacteria 2513237164 2514034812 200
83 iso_pu_bacteria 2643221662 2644350149 200
84 iso_pu_bacteria 2643221674 2644412670 200
85 3300005354 Ga0070675_100439072 Ga0070675_1004390722 201
86 3300005440 Ga0070705_100519450 Ga0070705_1005194501 201
87 3300005441 Ga0070700_100065559 Ga0070700_1000655592 201
88 3300005546 Ga0070696_100088229 Ga0070696_1000882292 201
89 3300005548 Ga0070665_100384903 Ga0070665_1003849032 201
90 3300005617 Ga0068859_100343898 Ga0068859_1003438984 201
91 3300006844 Ga0075428_100724069 Ga0075428_1007240692 201
92 3300006931 Ga0097620_100343880 Ga0097620_1003438804 201
93 3300009553 Ga0105249_10132531 Ga0105249_101325312 201
94 3300014325 Ga0163163_10691932 Ga0163163_106919322 201
95 3300025904 Ga0207647_10113400 Ga0207647_101134002 201
96 3300025923 Ga0207681_10107093 Ga0207681_101070933 201
97 3300028379 Ga0268266_10478468 Ga0268266_104784682 201
98 3300028573 Ga0265334_10098446 Ga0265334_100984462 201
99 3300031235 Ga0265330_10148206 Ga0265330_101482062 201
100 3300031241 Ga0265325_10010515 Ga0265325_100105154 201
101 3300031247 Ga0265340_10028355 Ga0265340_100283552 201
102 3300031249 Ga0265339_10001731 Ga0265339_1000173110 201
103 3300031249 Ga0265339_10093009 Ga0265339_100930093 201
104 3300031344 Ga0265316_10333879 Ga0265316_103338792 201
105 3300031691 Ga0316579_10121039 Ga0316579_101210392 201
106 3300031711 Ga0265314_10045569 Ga0265314_100455692 201
107 3300031712 Ga0265342_10181895 Ga0265342_101818952 201
108 3300037312 Ga0395899_0000137 Ga0395899_0000137_23803_24423 201
109 3300037418 Ga0395900_0000108 Ga0395900_0000108_33421_34041 201
110 3300037466 Ga0395898_0027497 Ga0395898_0027497_3270_3890 201
111 3300037471 Ga0395905_0009347 Ga0395905_0009347_3196_3816 201
112 3300038443 Ga0395901_0000050 Ga0395901_0000050_54279_54899 201
113 3300042003 Ga0439443_006364 Ga0439443_006364_85_690 201
114 3300042461 Ga0439460_0010702 Ga0439460_0010702_1336_1956 201
115 3300046516 Ga0495628_0024458 Ga0495628_0024458_4213_4818 201
116 3300046517 Ga0495630_0423142 Ga0495630_0423142_396_1001 201
117 3300047319 Ga0495674_0029987 Ga0495674_0029987_2278_2883 201
118 3300049581 Ga0501047_0086573 Ga0501047_0086573_949_1554 201
119 3300049593 Ga0501077_0366115 Ga0501077_0366115_284_904 201
120 3300049824 Ga0501045_0129361 Ga0501045_0129361_1122_1763 201
121 3300049824 Ga0501045_0144958 Ga0501045_0144958_212_832 201
122 3300054114 Ga0501084_0066520 Ga0501084_0066520_93_713 201
123 3300060353 Ga0501082_0214611 Ga0501082_0214611_930_1550 201
124 3300060353 Ga0501082_0387777 Ga0501082_0387777_71_676 201
125 3300005331 Ga0070670_101122698 Ga0070670_1011226981 202
126 3300005353 Ga0070669_100628275 Ga0070669_1006282751 202
127 3300005354 Ga0070675_100192444 Ga0070675_1001924442 202
128 3300005367 Ga0070667_100925546 Ga0070667_1009255461 202
129 3300005543 Ga0070672_100194921 Ga0070672_1001949212 202
130 3300005544 Ga0070686_100270070 Ga0070686_1002700702 202
131 3300006871 Ga0075434_100717564 Ga0075434_1007175641 202
132 3300006881 Ga0068865_100389395 Ga0068865_1003893952 202
133 3300021384 Ga0213876_10079150 Ga0213876_100791502 202
134 3300025940 Ga0207691_10103003 Ga0207691_101030032 202
135 3300027907 Ga0207428_10097457 Ga0207428_100974571 202
136 3300031456 Ga0307513_10336724 Ga0307513_103367242 202
137 3300039437 Ga0436365_0018302 Ga0436365_0018302_2693_3310 202
138 3300046531 Ga0495665_0028390 Ga0495665_0028390_1580_2206 202
139 3300049574 Ga0501038_0055775 Ga0501038_0055775_2766_3377 202
140 3300049574 Ga0501038_0124853 Ga0501038_0124853_98_706 202
141 3300049579 Ga0501043_0516445 Ga0501043_0516445_86_697 202
142 3300049580 Ga0501046_0072386 Ga0501046_0072386_1805_2416 202
143 3300049582 Ga0501048_0020276 Ga0501048_0020276_3810_4421 202
144 3300049583 Ga0501067_0029425 Ga0501067_0029425_1587_2195 202
145 3300049585 Ga0501069_0141393 Ga0501069_0141393_268_879 202
146 3300049587 Ga0501071_0047919 Ga0501071_0047919_332_952 202
147 3300049587 Ga0501071_0330625 Ga0501071_0330625_369_980 202
148 3300049588 Ga0501072_0068309 Ga0501072_0068309_1780_2391 202
149 3300049590 Ga0501074_0278837 Ga0501074_0278837_194_802 202
150 3300049591 Ga0501075_0124727 Ga0501075_0124727_745_1356 202
151 3300049592 Ga0501076_0214514 Ga0501076_0214514_115_726 202
152 3300049593 Ga0501077_0132833 Ga0501077_0132833_402_1013 202
153 3300049741 Ga0501079_0014707 Ga0501079_0014707_3917_4528 202
154 3300049742 Ga0501080_0034662 Ga0501080_0034662_445_1053 202
155 3300049742 Ga0501080_0492529 Ga0501080_0492529_95_706 202
156 3300049743 Ga0501081_0218867 Ga0501081_0218867_47_658 202
157 3300049744 Ga0501083_0066569 Ga0501083_0066569_1403_2011 202
158 3300049822 Ga0501035_0066862 Ga0501035_0066862_1419_2030 202
159 3300049824 Ga0501045_0347743 Ga0501045_0347743_467_1078 202
160 3300053142 Ga0500577_0021827 Ga0500577_0021827_1304_1924 202
161 3300053163 Ga0500639_131949 Ga0500639_131949_482_1147 202
162 3300054114 Ga0501084_0218223 Ga0501084_0218223_78_689 202
163 3300060353 Ga0501082_0066474 Ga0501082_0066474_1052_1660 202
164 3300060353 Ga0501082_0201883 Ga0501082_0201883_321_932 202
165 3300005329 Ga0070683_100043381 Ga0070683_1000433812 203
166 3300005434 Ga0070709_10138150 Ga0070709_101381502 203
167 3300005435 Ga0070714_100142045 Ga0070714_1001420453 203
168 3300005436 Ga0070713_100029053 Ga0070713_1000290534 203
169 3300005458 Ga0070681_10286633 Ga0070681_102866332 203
170 3300005535 Ga0070684_100154153 Ga0070684_1001541534 203
171 3300005577 Ga0068857_100206704 Ga0068857_1002067042 203
172 3300005616 Ga0068852_100141351 Ga0068852_1001413513 203
173 3300005718 Ga0068866_10404741 Ga0068866_104047411 203
174 3300005843 Ga0068860_101073231 Ga0068860_1010732312 203
175 3300005844 Ga0068862_100495492 Ga0068862_1004954921 203
176 3300005985 Ga0081539_10006052 Ga0081539_1000605210 203
177 3300009093 Ga0105240_10093427 Ga0105240_100934271 203
178 3300009094 Ga0111539_10484944 Ga0111539_104849442 203
179 3300009094 Ga0111539_11066113 Ga0111539_110661131 203
180 3300009094 Ga0111539_11320194 Ga0111539_113201941 203
181 3300009174 Ga0105241_10040950 Ga0105241_100409502 203
182 3300009176 Ga0105242_10566651 Ga0105242_105666512 203
183 3300009177 Ga0105248_10000015 Ga0105248_10000015199 203
184 3300009545 Ga0105237_10870155 Ga0105237_108701552 203
185 3300009551 Ga0105238_10294446 Ga0105238_102944462 203
186 3300010375 Ga0105239_10224844 Ga0105239_102248442 203
187 3300010375 Ga0105239_11506093 Ga0105239_115060932 203
188 3300013105 Ga0157369_10036888 Ga0157369_100368881 203
189 3300013306 Ga0163162_10739960 Ga0163162_107399601 203
190 3300013307 Ga0157372_11391142 Ga0157372_113911421 203
191 3300013307 Ga0157372_11391193 Ga0157372_113911931 203
192 3300013308 Ga0157375_10626621 Ga0157375_106266212 203
193 3300014325 Ga0163163_10383831 Ga0163163_103838311 203
194 3300014745 Ga0157377_10330354 Ga0157377_103303542 203
195 3300014969 Ga0157376_11157280 Ga0157376_111572801 203
196 3300025297 Ga0209758_1008245 Ga0209758_10082452 203
197 3300025906 Ga0207699_10530629 Ga0207699_105306292 203
198 3300025913 Ga0207695_10333573 Ga0207695_103335731 203
199 3300025928 Ga0207700_10041129 Ga0207700_100411294 203
200 3300025929 Ga0207664_10184680 Ga0207664_101846802 203
201 3300025938 Ga0207704_10228037 Ga0207704_102280371 203
202 3300025941 Ga0207711_10000003 Ga0207711_10000003930 203
203 3300025941 Ga0207711_10000005 Ga0207711_10000005203 203
204 3300025941 Ga0207711_10000009 Ga0207711_10000009452 203
205 3300025945 Ga0207679_10189046 Ga0207679_101890462 203
206 3300025981 Ga0207640_10639528 Ga0207640_106395282 203
207 3300026041 Ga0207639_10098738 Ga0207639_100987382 203
208 3300026075 Ga0207708_10118713 Ga0207708_101187133 203
209 3300026078 Ga0207702_10288566 Ga0207702_102885662 203
210 3300026116 Ga0207674_10165816 Ga0207674_101658162 203
211 3300028379 Ga0268266_11255547 Ga0268266_112555471 203
212 3300031247 Ga0265340_10185624 Ga0265340_101856242 203
213 3300037312 Ga0395899_0037204 Ga0395899_0037204_2067_2681 203
214 3300037418 Ga0395900_0025260 Ga0395900_0025260_4324_4938 203
215 3300038443 Ga0395901_0009335 Ga0395901_0009335_197_811 203
216 3300041408 Ga0439453_0014235 Ga0439453_0014235_143_760 203
217 3300042005 Ga0439448_0015604 Ga0439448_0015604_1461_2075 203
218 3300046491 Ga0495584_0031341 Ga0495584_0031341_1850_2464 203
219 3300046525 Ga0495663_0129901 Ga0495663_0129901_119_733 203
220 3300046558 Ga0495633_0127269 Ga0495633_0127269_235_849 203
221 3300046664 Ga0495659_0054852 Ga0495659_0054852_135_749 203
222 3300046691 Ga0495670_0172382 Ga0495670_0172382_89_703 203
223 3300048910 Ga0496107_0145923 Ga0496107_0145923_858_1472 203
224 3300048914 Ga0496111_0613257 Ga0496111_0613257_166_780 203
225 3300049568 Ga0501031_0079720 Ga0501031_0079720_946_1560 203
226 3300049569 Ga0501032_0063717 Ga0501032_0063717_1020_1634 203
227 3300049571 Ga0501034_0843963 Ga0501034_0843963_151_765 203
228 3300049572 Ga0501036_0349591 Ga0501036_0349591_95_718 203
229 3300049572 Ga0501036_0495736 Ga0501036_0495736_187_801 203
230 3300049573 Ga0501037_0146057 Ga0501037_0146057_659_1273 203
231 3300049573 Ga0501037_0476039 Ga0501037_0476039_75_698 203
232 3300049574 Ga0501038_0099164 Ga0501038_0099164_865_1488 203
233 3300049575 Ga0501039_0220391 Ga0501039_0220391_156_770 203
234 3300049576 Ga0501040_0026969 Ga0501040_0026969_2230_2853 203
235 3300049576 Ga0501040_0037469 Ga0501040_0037469_470_1084 203
236 3300049576 Ga0501040_0315857 Ga0501040_0315857_447_1061 203
237 3300049577 Ga0501041_0013496 Ga0501041_0013496_1771_2385 203
238 3300049577 Ga0501041_0156811 Ga0501041_0156811_513_1136 203
239 3300049578 Ga0501042_0104498 Ga0501042_0104498_1364_1978 203
240 3300049578 Ga0501042_0108909 Ga0501042_0108909_87_701 203
241 3300049578 Ga0501042_0196712 Ga0501042_0196712_482_1105 203
242 3300049580 Ga0501046_0044288 Ga0501046_0044288_2221_2835 203
243 3300049580 Ga0501046_0345800 Ga0501046_0345800_189_803 203
244 3300049582 Ga0501048_0264719 Ga0501048_0264719_283_897 203
245 3300049584 Ga0501068_0026592 Ga0501068_0026592_982_1596 203
246 3300049584 Ga0501068_0380693 Ga0501068_0380693_162_785 203
247 3300049587 Ga0501071_0035441 Ga0501071_0035441_1876_2499 203
248 3300049588 Ga0501072_0026974 Ga0501072_0026974_832_1455 203
249 3300049588 Ga0501072_0033731 Ga0501072_0033731_384_998 203
250 3300049589 Ga0501073_0163041 Ga0501073_0163041_173_784 203
251 3300049590 Ga0501074_0024213 Ga0501074_0024213_2222_2836 203
252 3300049590 Ga0501074_0109856 Ga0501074_0109856_873_1496 203
253 3300049591 Ga0501075_0058224 Ga0501075_0058224_923_1546 203
254 3300049591 Ga0501075_0094095 Ga0501075_0094095_578_1192 203
255 3300049591 Ga0501075_0456607 Ga0501075_0456607_256_870 203
256 3300049592 Ga0501076_0048669 Ga0501076_0048669_987_1610 203
257 3300049592 Ga0501076_0099441 Ga0501076_0099441_1405_2019 203
258 3300049592 Ga0501076_0273863 Ga0501076_0273863_448_1062 203
259 3300049593 Ga0501077_0026393 Ga0501077_0026393_3060_3674 203
260 3300049593 Ga0501077_0043636 Ga0501077_0043636_713_1336 203
261 3300049593 Ga0501077_0060276 Ga0501077_0060276_390_1004 203
262 3300049741 Ga0501079_0018315 Ga0501079_0018315_940_1554 203
263 3300049741 Ga0501079_0346649 Ga0501079_0346649_498_1112 203
264 3300049741 Ga0501079_0473176 Ga0501079_0473176_166_789 203
265 3300049742 Ga0501080_0047241 Ga0501080_0047241_2555_3169 203
266 3300049742 Ga0501080_0350370 Ga0501080_0350370_183_797 203
267 3300049743 Ga0501081_0023102 Ga0501081_0023102_406_1020 203
268 3300049743 Ga0501081_0032968 Ga0501081_0032968_2539_3153 203
269 3300049744 Ga0501083_0061919 Ga0501083_0061919_946_1560 203
270 3300049822 Ga0501035_0207445 Ga0501035_0207445_221_835 203
271 3300049822 Ga0501035_0330167 Ga0501035_0330167_338_961 203
272 3300049823 Ga0501044_0734229 Ga0501044_0734229_35_649 203
273 3300049824 Ga0501045_0067841 Ga0501045_0067841_1578_2201 203
274 3300049824 Ga0501045_0245276 Ga0501045_0245276_31_645 203
275 3300050511 nmdc:mga08y16_465793_c1 nmdc:mga08y16_465793_c1_259_873 203
276 3300053078 Ga0495612_0260275 Ga0495612_0260275_39_650 203
277 3300053131 Ga0500652_081181 Ga0500652_081181_377_1009 203
278 3300053730 Ga0500645_007885 Ga0500645_007885_601_1233 203
279 3300054114 Ga0501084_0016732 Ga0501084_0016732_1792_2415 203
280 3300054114 Ga0501084_0136403 Ga0501084_0136403_950_1564 203
281 3300060353 Ga0501082_0106355 Ga0501082_0106355_1066_1680 203
282 3300060353 Ga0501082_0116348 Ga0501082_0116348_426_1040 203
283 3300061734 Ga0530510_0028015 Ga0530510_0028015_860_1483 203
284 3300061734 Ga0530510_0273289 Ga0530510_0273289_199_813 203
285 3300003323 rootH1_10064975 rootH1_100649753 204
286 3300005327 Ga0070658_10103966 Ga0070658_101039663 204
287 3300005327 Ga0070658_10129207 Ga0070658_101292071 204
288 3300005328 Ga0070676_10031086 Ga0070676_100310862 204
289 3300005329 Ga0070683_100025834 Ga0070683_1000258345 204
290 3300005329 Ga0070683_100109225 Ga0070683_1001092252 204
291 3300005337 Ga0070682_100261629 Ga0070682_1002616291 204
292 3300005338 Ga0068868_100498174 Ga0068868_1004981742 204
293 3300005339 Ga0070660_100014238 Ga0070660_1000142386 204
294 3300005366 Ga0070659_100008537 Ga0070659_1000085372 204
295 3300005366 Ga0070659_100105105 Ga0070659_1001051052 204
296 3300005455 Ga0070663_100250830 Ga0070663_1002508302 204
297 3300005456 Ga0070678_100129976 Ga0070678_1001299763 204
298 3300005457 Ga0070662_100062866 Ga0070662_1000628664 204
299 3300005459 Ga0068867_100428595 Ga0068867_1004285951 204
300 3300005535 Ga0070684_100051620 Ga0070684_1000516205 204
301 3300005535 Ga0070684_100124505 Ga0070684_1001245053 204
302 3300005539 Ga0068853_100012357 Ga0068853_1000123575 204
303 3300005543 Ga0070672_100290929 Ga0070672_1002909292 204
304 3300005544 Ga0070686_100258167 Ga0070686_1002581671 204
305 3300005563 Ga0068855_100269792 Ga0068855_1002697923 204
306 3300005564 Ga0070664_100403758 Ga0070664_1004037581 204
307 3300005578 Ga0068854_100010290 Ga0068854_1000102904 204
308 3300005614 Ga0068856_100212373 Ga0068856_1002123732 204
309 3300005616 Ga0068852_100104184 Ga0068852_1001041841 204
310 3300005618 Ga0068864_100145190 Ga0068864_1001451903 204
311 3300006028 Ga0070717_10916994 Ga0070717_109169941 204
312 3300006038 Ga0075365_10221661 Ga0075365_102216612 204
313 3300006042 Ga0075368_10040390 Ga0075368_100403902 204
314 3300006048 Ga0075363_100035329 Ga0075363_1000353293 204
315 3300006178 Ga0075367_10002551 Ga0075367_100025512 204
316 3300006195 Ga0075366_10020275 Ga0075366_100202755 204
317 3300006195 Ga0075366_10068103 Ga0075366_100681032 204
318 3300006353 Ga0075370_10008430 Ga0075370_100084302 204
319 3300006914 Ga0075436_100072041 Ga0075436_1000720412 204
320 3300009093 Ga0105240_10238265 Ga0105240_102382653 204
321 3300009148 Ga0105243_10677574 Ga0105243_106775741 204
322 3300009551 Ga0105238_10039590 Ga0105238_100395904 204
323 3300009551 Ga0105238_10239050 Ga0105238_102390502 204
324 3300010375 Ga0105239_10022682 Ga0105239_100226827 204
325 3300011119 Ga0105246_10116104 Ga0105246_101161042 204
326 3300013307 Ga0157372_10014547 Ga0157372_100145473 204
327 3300025321 Ga0207656_10077017 Ga0207656_100770173 204
328 3300025907 Ga0207645_10077209 Ga0207645_100772092 204
329 3300025913 Ga0207695_10166367 Ga0207695_101663673 204
330 3300025919 Ga0207657_10012000 Ga0207657_100120006 204
331 3300025920 Ga0207649_10236070 Ga0207649_102360702 204
332 3300025924 Ga0207694_10023492 Ga0207694_100234923 204
333 3300025931 Ga0207644_10690734 Ga0207644_106907342 204
334 3300025932 Ga0207690_10186348 Ga0207690_101863482 204
335 3300025933 Ga0207706_10133769 Ga0207706_101337692 204
336 3300025940 Ga0207691_10163804 Ga0207691_101638042 204
337 3300025944 Ga0207661_10465314 Ga0207661_104653141 204
338 3300025945 Ga0207679_10244084 Ga0207679_102440843 204
339 3300025949 Ga0207667_10202131 Ga0207667_102021311 204
340 3300025981 Ga0207640_10238338 Ga0207640_102383382 204
341 3300026023 Ga0207677_10268969 Ga0207677_102689692 204
342 3300026041 Ga0207639_10192759 Ga0207639_101927593 204
343 3300026041 Ga0207639_10378085 Ga0207639_103780852 204
344 3300026041 Ga0207639_10570133 Ga0207639_105701332 204
345 3300026067 Ga0207678_10094504 Ga0207678_100945042 204
346 3300026078 Ga0207702_10119602 Ga0207702_101196023 204
347 3300026089 Ga0207648_10174981 Ga0207648_101749812 204
348 3300026118 Ga0207675_100104780 Ga0207675_1001047803 204
349 3300026142 Ga0207698_10426081 Ga0207698_104260811 204
350 3300027876 Ga0209974_10018046 Ga0209974_100180462 204
351 3300028800 Ga0265338_10018968 Ga0265338_100189686 204
352 3300031235 Ga0265330_10113796 Ga0265330_101137962 204
353 3300031249 Ga0265339_10005432 Ga0265339_100054327 204
354 3300031595 Ga0265313_10000044 Ga0265313_1000004493 204
355 3300031730 Ga0307516_10337816 Ga0307516_103378162 204
356 3300031911 Ga0307412_10355513 Ga0307412_103555132 204
357 3300031995 Ga0307409_100313677 Ga0307409_1003136772 204
358 3300032004 Ga0307414_10058182 Ga0307414_100581823 204
359 3300032004 Ga0307414_10148159 Ga0307414_101481592 204
360 3300032004 Ga0307414_10154126 Ga0307414_101541263 204
361 3300032004 Ga0307414_10578982 Ga0307414_105789822 204
362 3300034816 Ga0373930_0037291 Ga0373930_0037291_22_642 204
363 3300035084 Ga0373928_0043024 Ga0373928_0043024_213_833 204
364 3300035090 Ga0373949_0096340 Ga0373949_0096340_168_788 204
365 3300035691 Ga0373931_0081951 Ga0373931_0081951_733_1353 204
366 3300041413 Ga0439465_0020859 Ga0439465_0020859_92_715 204
367 3300041413 Ga0439465_0226623 Ga0439465_0226623_56_673 204
368 3300041491 Ga0451833_1389376 Ga0451833_1389376_19_651 204
369 3300042006 Ga0439432_042708 Ga0439432_042708_696_1319 204
370 3300045051 Ga0451576_0752684 Ga0451576_0752684_20_640 204
371 3300046491 Ga0495584_0185278 Ga0495584_0185278_306_935 204
372 3300048918 Ga0496115_0173322 Ga0496115_0173322_639_1265 204
373 3300048923 Ga0496120_0190083 Ga0496120_0190083_359_991 204
374 3300048924 Ga0496121_0091592 Ga0496121_0091592_1086_1718 204
375 3300048927 Ga0496124_0239028 Ga0496124_0239028_232_852 204
376 3300049569 Ga0501032_0177881 Ga0501032_0177881_348_968 204
377 3300049579 Ga0501043_0548204 Ga0501043_0548204_155_775 204
378 3300050490 nmdc:mga03n38_14159_c2 nmdc:mga03n38_14159_c2_1737_2363 204
379 3300050493 nmdc:mga0k408_11813_c1 nmdc:mga0k408_11813_c1_2955_3581 204
380 3300050493 nmdc:mga0k408_5302_c1 nmdc:mga0k408_5302_c1_5392_6027 204
381 3300050494 nmdc:mga06z11_161522_c1 nmdc:mga06z11_161522_c1_169_795 204
382 3300053153 Ga0500616_0032782 Ga0500616_0032782_2092_2715 204
383 iso_pu_bacteria 2895880812 2895886228 204
384 3300001991 JGI24743J22301_10019881 JGI24743J22301_100198812 205
385 3300003215 JGI25153J46596_10000066 JGI25153J46596_10000066121 205
386 3300003323 rootH1_10041760 rootH1_100417607 205
387 3300003323 rootH1_10087342 rootH1_100873422 205
388 3300005290 Ga0065712_10106759 Ga0065712_101067592 205
389 3300005331 Ga0070670_100044592 Ga0070670_1000445924 205
390 3300005331 Ga0070670_100061110 Ga0070670_1000611103 205
391 3300005333 Ga0070677_10001526 Ga0070677_100015264 205
392 3300005335 Ga0070666_10149784 Ga0070666_101497842 205
393 3300005340 Ga0070689_100021788 Ga0070689_1000217883 205
394 3300005343 Ga0070687_100133269 Ga0070687_1001332693 205
395 3300005353 Ga0070669_100043124 Ga0070669_1000431242 205
396 3300005354 Ga0070675_100007200 Ga0070675_10000720011 205
397 3300005355 Ga0070671_100260281 Ga0070671_1002602811 205
398 3300005456 Ga0070678_100034450 Ga0070678_1000344502 205
399 3300005457 Ga0070662_100146150 Ga0070662_1001461501 205
400 3300005457 Ga0070662_100433034 Ga0070662_1004330342 205
401 3300005459 Ga0068867_100052549 Ga0068867_1000525492 205
402 3300005466 Ga0070685_10011297 Ga0070685_100112972 205
403 3300005539 Ga0068853_100201445 Ga0068853_1002014452 205
404 3300005543 Ga0070672_100145172 Ga0070672_1001451722 205
405 3300005544 Ga0070686_100021445 Ga0070686_1000214455 205
406 3300005548 Ga0070665_100064426 Ga0070665_1000644263 205
407 3300005548 Ga0070665_100795005 Ga0070665_1007950052 205
408 3300005563 Ga0068855_100011710 Ga0068855_1000117108 205
409 3300005577 Ga0068857_100029926 Ga0068857_1000299262 205
410 3300005616 Ga0068852_100008530 Ga0068852_1000085305 205
411 3300005617 Ga0068859_100144709 Ga0068859_1001447093 205
412 3300005718 Ga0068866_10079475 Ga0068866_100794753 205
413 3300005719 Ga0068861_100595517 Ga0068861_1005955171 205
414 3300006881 Ga0068865_100698612 Ga0068865_1006986121 205
415 3300006931 Ga0097620_100144727 Ga0097620_1001447273 205
416 3300007076 Ga0075435_100440179 Ga0075435_1004401792 205
417 3300009098 Ga0105245_10594066 Ga0105245_105940662 205
418 3300009101 Ga0105247_10035298 Ga0105247_100352983 205
419 3300009101 Ga0105247_10237445 Ga0105247_102374452 205
420 3300009148 Ga0105243_10172090 Ga0105243_101720902 205
421 3300009174 Ga0105241_10014840 Ga0105241_100148405 205
422 3300009174 Ga0105241_10404082 Ga0105241_104040822 205
423 3300009177 Ga0105248_10434349 Ga0105248_104343492 205
424 3300009545 Ga0105237_10222456 Ga0105237_102224562 205
425 3300009553 Ga0105249_10387775 Ga0105249_103877751 205
426 3300009553 Ga0105249_10620383 Ga0105249_106203832 205
427 3300009553 Ga0105249_10786199 Ga0105249_107861992 205
428 3300011119 Ga0105246_10093612 Ga0105246_100936123 205
429 3300013102 Ga0157371_10016668 Ga0157371_100166686 205
430 3300013104 Ga0157370_10013414 Ga0157370_100134146 205
431 3300013297 Ga0157378_10013498 Ga0157378_1001349810 205
432 3300013306 Ga0163162_10091938 Ga0163162_100919383 205
433 3300013307 Ga0157372_10024794 Ga0157372_100247948 205
434 3300013308 Ga0157375_10011914 Ga0157375_100119149 205
435 3300013308 Ga0157375_10685619 Ga0157375_106856191 205
436 3300014325 Ga0163163_10160285 Ga0163163_101602852 205
437 3300014325 Ga0163163_10227792 Ga0163163_102277922 205
438 3300014325 Ga0163163_10400319 Ga0163163_104003192 205
439 3300014325 Ga0163163_10516990 Ga0163163_105169902 205
440 3300014969 Ga0157376_10009435 Ga0157376_100094353 205
441 3300014969 Ga0157376_10381715 Ga0157376_103817153 205
442 3300017792 Ga0163161_10041795 Ga0163161_100417952 205
443 3300025297 Ga0209758_1000028 Ga0209758_10000289 205
444 3300025893 Ga0207682_10000200 Ga0207682_1000020023 205
445 3300025899 Ga0207642_10023803 Ga0207642_100238033 205
446 3300025900 Ga0207710_10055447 Ga0207710_100554474 205
447 3300025901 Ga0207688_10007988 Ga0207688_100079886 205
448 3300025907 Ga0207645_10005680 Ga0207645_100056807 205
449 3300025918 Ga0207662_10023087 Ga0207662_100230872 205
450 3300025920 Ga0207649_10258133 Ga0207649_102581332 205
451 3300025923 Ga0207681_10008085 Ga0207681_100080855 205
452 3300025925 Ga0207650_10025926 Ga0207650_100259262 205
453 3300025925 Ga0207650_10268444 Ga0207650_102684442 205
454 3300025926 Ga0207659_10135529 Ga0207659_101355293 205
455 3300025926 Ga0207659_10671534 Ga0207659_106715341 205
456 3300025933 Ga0207706_10271376 Ga0207706_102713761 205
457 3300025935 Ga0207709_10122222 Ga0207709_101222223 205
458 3300025936 Ga0207670_10412984 Ga0207670_104129841 205
459 3300025938 Ga0207704_10263159 Ga0207704_102631592 205
460 3300025940 Ga0207691_10002205 Ga0207691_1000220515 205
461 3300025941 Ga0207711_10428611 Ga0207711_104286112 205
462 3300025942 Ga0207689_10056790 Ga0207689_100567902 205
463 3300025945 Ga0207679_10304856 Ga0207679_103048562 205
464 3300025945 Ga0207679_10477804 Ga0207679_104778042 205
465 3300025949 Ga0207667_10387452 Ga0207667_103874522 205
466 3300025960 Ga0207651_10407723 Ga0207651_104077232 205
467 3300025961 Ga0207712_10254036 Ga0207712_102540361 205
468 3300026067 Ga0207678_10442451 Ga0207678_104424511 205
469 3300026075 Ga0207708_10004234 Ga0207708_100042346 205
470 3300026075 Ga0207708_10351510 Ga0207708_103515102 205
471 3300026078 Ga0207702_10061501 Ga0207702_100615013 205
472 3300026089 Ga0207648_10005468 Ga0207648_100054684 205
473 3300026095 Ga0207676_10209472 Ga0207676_102094723 205
474 3300026095 Ga0207676_10542282 Ga0207676_105422822 205
475 3300026116 Ga0207674_10032125 Ga0207674_100321255 205
476 3300026118 Ga0207675_100205047 Ga0207675_1002050473 205
477 3300026121 Ga0207683_10008639 Ga0207683_100086398 205
478 3300026142 Ga0207698_10068167 Ga0207698_100681672 205
479 3300027682 Ga0209971_1021207 Ga0209971_10212071 205
480 3300028379 Ga0268266_10094215 Ga0268266_100942153 205
481 3300028577 Ga0265318_10001593 Ga0265318_100015932 205
482 3300028577 Ga0265318_10035734 Ga0265318_100357342 205
483 3300031235 Ga0265330_10135036 Ga0265330_101350362 205
484 3300031238 Ga0265332_10053204 Ga0265332_100532043 205
485 3300031242 Ga0265329_10015828 Ga0265329_100158283 205
486 3300031247 Ga0265340_10040744 Ga0265340_100407442 205
487 3300031247 Ga0265340_10121949 Ga0265340_101219492 205
488 3300031250 Ga0265331_10031059 Ga0265331_100310593 205
489 3300031250 Ga0265331_10060020 Ga0265331_100600203 205
490 3300031344 Ga0265316_10049879 Ga0265316_100498792 205
491 3300031344 Ga0265316_10356950 Ga0265316_103569502 205
492 3300031595 Ga0265313_10022625 Ga0265313_100226254 205
493 3300031711 Ga0265314_10094791 Ga0265314_100947912 205
494 3300031711 Ga0265314_10101375 Ga0265314_101013753 205
495 3300031711 Ga0265314_10209167 Ga0265314_102091672 205
496 3300031712 Ga0265342_10283987 Ga0265342_102839872 205
497 3300034819 Ga0373958_0025252 Ga0373958_0025252_466_1104 205
498 3300035114 Ga0373939_0210915 Ga0373939_0210915_25_669 205
499 3300035171 Ga0373946_0011244 Ga0373946_0011244_1822_2460 205
500 3300035692 Ga0373935_0022191 Ga0373935_0022191_960_1598 205
501 3300035695 Ga0373927_0054968 Ga0373927_0054968_1052_1690 205
502 3300035725 Ga0373947_0006153 Ga0373947_0006153_3335_3973 205
503 3300037068 Ga0373925_0004747 Ga0373925_0004747_5385_6023 205
504 3300037312 Ga0395899_0259027 Ga0395899_0259027_69_704 205
505 3300037466 Ga0395898_0349692 Ga0395898_0349692_671_1306 205
506 3300037466 Ga0395898_0833597 Ga0395898_0833597_112_831 205
507 3300038443 Ga0395901_0159813 Ga0395901_0159813_1002_1637 205
508 3300046459 Ga0495629_0000401 Ga0495629_0000401_18750_19388 205
509 3300046461 Ga0495641_0029113 Ga0495641_0029113_1229_1867 205
510 3300046462 Ga0495651_0281516 Ga0495651_0281516_35_673 205
511 3300046475 Ga0495639_0064197 Ga0495639_0064197_800_1438 205
512 3300046499 Ga0495594_0026038 Ga0495594_0026038_629_1267 205
513 3300046531 Ga0495665_0092618 Ga0495665_0092618_525_1163 205
514 3300046537 Ga0495598_0058399 Ga0495598_0058399_303_935 205
515 3300046615 Ga0495656_0396620 Ga0495656_0396620_17_649 205
516 3300046681 Ga0495647_0008543 Ga0495647_0008543_1439_2077 205
517 3300046683 Ga0495658_0000265 Ga0495658_0000265_11405_12043 205
518 3300046689 Ga0495613_0021477 Ga0495613_0021477_3006_3644 205
519 3300047321 Ga0495676_0028968 Ga0495676_0028968_2319_2957 205
520 3300047673 Ga0495593_0003423 Ga0495593_0003423_8539_9177 205
521 3300048904 Ga0496101_0044812 Ga0496101_0044812_1157_1801 205
522 3300048907 Ga0496104_0136526 Ga0496104_0136526_367_1011 205
523 3300048908 Ga0496105_0038287 Ga0496105_0038287_615_1259 205
524 3300048909 Ga0496106_0227089 Ga0496106_0227089_732_1376 205
525 3300048910 Ga0496107_0013051 Ga0496107_0013051_3069_3713 205
526 3300048911 Ga0496108_0058071 Ga0496108_0058071_2446_3084 205
527 3300048911 Ga0496108_0139528 Ga0496108_0139528_436_1080 205
528 3300048912 Ga0496109_0008666 Ga0496109_0008666_2711_3355 205
529 3300048912 Ga0496109_0043699 Ga0496109_0043699_1859_2503 205
530 3300048913 Ga0496110_0247311 Ga0496110_0247311_15_653 205
531 3300048914 Ga0496111_0022126 Ga0496111_0022126_53_691 205
532 3300048915 Ga0496112_0166700 Ga0496112_0166700_452_1096 205
533 3300048915 Ga0496112_0456718 Ga0496112_0456718_457_1095 205
534 3300048918 Ga0496115_0058628 Ga0496115_0058628_522_1166 205
535 3300049569 Ga0501032_0280731 Ga0501032_0280731_136_771 205
536 3300049571 Ga0501034_0016923 Ga0501034_0016923_848_1483 205
537 3300049571 Ga0501034_0032939 Ga0501034_0032939_821_1456 205
538 3300049571 Ga0501034_0180502 Ga0501034_0180502_1200_1835 205
539 3300049573 Ga0501037_0120258 Ga0501037_0120258_748_1383 205
540 3300049580 Ga0501046_0035794 Ga0501046_0035794_1320_1955 205
541 3300049582 Ga0501048_0151176 Ga0501048_0151176_645_1280 205
542 3300049583 Ga0501067_0048871 Ga0501067_0048871_1505_2140 205
543 3300049584 Ga0501068_0032227 Ga0501068_0032227_606_1241 205
544 3300049584 Ga0501068_0511333 Ga0501068_0511333_68_697 205
545 3300049586 Ga0501070_0089148 Ga0501070_0089148_981_1616 205
546 3300049588 Ga0501072_0755433 Ga0501072_0755433_67_696 205
547 3300049590 Ga0501074_0196429 Ga0501074_0196429_705_1340 205
548 3300049742 Ga0501080_0133865 Ga0501080_0133865_1438_2073 205
549 3300049744 Ga0501083_0148457 Ga0501083_0148457_367_984 205
550 3300049823 Ga0501044_0007150 Ga0501044_0007150_2325_2960 205
551 3300050512 nmdc:mga0n895_45294_c1 nmdc:mga0n895_45294_c1_1859_2503 205
552 3300053085 Ga0495619_0000164 Ga0495619_0000164_16739_17377 205
553 3300054114 Ga0501084_0211154 Ga0501084_0211154_504_1139 205
554 3300003659 JGI25404J52841_10010937 JGI25404J52841_100109373 206
555 3300005333 Ga0070677_10266966 Ga0070677_102669661 206
556 3300005339 Ga0070660_100044880 Ga0070660_1000448802 206
557 3300005457 Ga0070662_100009002 Ga0070662_1000090022 206
558 3300005458 Ga0070681_10027494 Ga0070681_100274942 206
559 3300005530 Ga0070679_100129273 Ga0070679_1001292732 206
560 3300005564 Ga0070664_100061077 Ga0070664_1000610773 206
561 3300005614 Ga0068856_100390563 Ga0068856_1003905632 206
562 3300005616 Ga0068852_100932758 Ga0068852_1009327582 206
563 3300005983 Ga0081540_1000462 Ga0081540_10004629 206
564 3300006177 Ga0075362_10003309 Ga0075362_100033095 206
565 3300006195 Ga0075366_10006005 Ga0075366_100060055 206
566 3300006358 Ga0068871_100225212 Ga0068871_1002252122 206
567 3300013307 Ga0157372_10462668 Ga0157372_104626681 206
568 3300025893 Ga0207682_10345867 Ga0207682_103458671 206
569 3300025911 Ga0207654_10505547 Ga0207654_105055471 206
570 3300025917 Ga0207660_10500188 Ga0207660_105001882 206
571 3300025919 Ga0207657_10125508 Ga0207657_101255081 206
572 3300025921 Ga0207652_10109912 Ga0207652_101099122 206
573 3300025933 Ga0207706_10014123 Ga0207706_100141235 206
574 3300025945 Ga0207679_10038500 Ga0207679_100385003 206
575 3300049569 Ga0501032_0003009 Ga0501032_0003009_5006_5677 206
576 3300049570 Ga0501033_0013087 Ga0501033_0013087_4765_5436 206
577 3300049571 Ga0501034_0006092 Ga0501034_0006092_5058_5729 206
578 3300049571 Ga0501034_0023919 Ga0501034_0023919_1848_2495 206
579 3300049572 Ga0501036_0018194 Ga0501036_0018194_3366_4037 206
580 3300049572 Ga0501036_0400644 Ga0501036_0400644_485_1117 206
581 3300049573 Ga0501037_0005542 Ga0501037_0005542_3226_3897 206
582 3300049574 Ga0501038_0008694 Ga0501038_0008694_4972_5643 206
583 3300049574 Ga0501038_0101294 Ga0501038_0101294_683_1330 206
584 3300049574 Ga0501038_0341746 Ga0501038_0341746_160_804 206
585 3300049575 Ga0501039_0099656 Ga0501039_0099656_1131_1802 206
586 3300049579 Ga0501043_0004706 Ga0501043_0004706_6879_7550 206
587 3300049579 Ga0501043_0263384 Ga0501043_0263384_304_951 206
588 3300049581 Ga0501047_0003479 Ga0501047_0003479_7404_8075 206
589 3300049581 Ga0501047_0297701 Ga0501047_0297701_58_705 206
590 3300049582 Ga0501048_0059739 Ga0501048_0059739_1733_2404 206
591 3300049584 Ga0501068_0068477 Ga0501068_0068477_1373_2044 206
592 3300049585 Ga0501069_0006105 Ga0501069_0006105_1744_2415 206
593 3300049586 Ga0501070_0011792 Ga0501070_0011792_821_1492 206
594 3300049589 Ga0501073_0002727 Ga0501073_0002727_5165_5836 206
595 3300049590 Ga0501074_0002406 Ga0501074_0002406_6448_7119 206
596 3300049592 Ga0501076_0240920 Ga0501076_0240920_295_939 206
597 3300049742 Ga0501080_0002491 Ga0501080_0002491_6762_7433 206
598 3300049742 Ga0501080_0254339 Ga0501080_0254339_789_1415 206
599 3300049822 Ga0501035_0002087 Ga0501035_0002087_6493_7164 206
600 3300049822 Ga0501035_0150278 Ga0501035_0150278_936_1583 206
601 3300049823 Ga0501044_0008252 Ga0501044_0008252_5274_5921 206
602 3300050489 nmdc:mga03683_6724_c1 nmdc:mga03683_6724_c1_2475_3119 206
603 3300050491 nmdc:mga00v17_123433_c1 nmdc:mga00v17_123433_c1_905_1549 206
604 3300050493 nmdc:mga0k408_5967_c1 nmdc:mga0k408_5967_c1_4587_5231 206
605 3300050496 nmdc:mga07m45_93628_c1 nmdc:mga07m45_93628_c1_369_1013 206
606 3300053077 Ga0495601_0316942 Ga0495601_0316942_119_757 206
607 3300053078 Ga0495612_0021700 Ga0495612_0021700_1928_2566 206
608 3300053085 Ga0495619_0203405 Ga0495619_0203405_518_1156 206
609 3300054114 Ga0501084_0209256 Ga0501084_0209256_894_1565 206
610 3300005530 Ga0070679_100208362 Ga0070679_1002083623 207
611 3300005843 Ga0068860_100435755 Ga0068860_1004357552 207
612 3300005937 Ga0081455_10248818 Ga0081455_102488182 207
613 3300005981 Ga0081538_10061201 Ga0081538_100612012 207
614 3300006038 Ga0075365_10167953 Ga0075365_101679533 207
615 3300006038 Ga0075365_10228041 Ga0075365_102280412 207
616 3300006042 Ga0075368_10037214 Ga0075368_100372144 207
617 3300006042 Ga0075368_10107303 Ga0075368_101073032 207
618 3300006048 Ga0075363_100143012 Ga0075363_1001430122 207
619 3300006051 Ga0075364_10413132 Ga0075364_104131322 207
620 3300006177 Ga0075362_10094065 Ga0075362_100940652 207
621 3300006178 Ga0075367_10092400 Ga0075367_100924002 207
622 3300006186 Ga0075369_10008060 Ga0075369_100080604 207
623 3300006195 Ga0075366_10109524 Ga0075366_101095242 207
624 3300006852 Ga0075433_10067681 Ga0075433_100676812 207
625 3300006871 Ga0075434_100019269 Ga0075434_1000192695 207
626 3300007076 Ga0075435_100486817 Ga0075435_1004868171 207
627 3300009094 Ga0111539_10048837 Ga0111539_100488375 207
628 3300011119 Ga0105246_10185487 Ga0105246_101854872 207
629 3300013297 Ga0157378_10133492 Ga0157378_101334922 207
630 3300013297 Ga0157378_10279934 Ga0157378_102799343 207
631 3300014968 Ga0157379_10258154 Ga0157379_102581542 207
632 3300014969 Ga0157376_10189844 Ga0157376_101898443 207
633 3300025921 Ga0207652_10391066 Ga0207652_103910662 207
634 3300027866 Ga0209813_10044478 Ga0209813_100444781 207
635 3300027907 Ga0207428_10148445 Ga0207428_101484452 207
636 3300035242 Ga0373962_0125778 Ga0373962_0125778_20_661 207
637 3300035691 Ga0373931_0165434 Ga0373931_0165434_172_813 207
638 3300044712 Ga0453684_0569639 Ga0453684_0569639_584_1222 207
639 3300045976 Ga0466967_0109578 Ga0466967_0109578_905_1555 207
640 3300046454 Ga0495592_0076095 Ga0495592_0076095_919_1563 207
641 3300046459 Ga0495629_0207070 Ga0495629_0207070_62_706 207
642 3300046511 Ga0495608_0077938 Ga0495608_0077938_1368_2012 207
643 3300046516 Ga0495628_0575487 Ga0495628_0575487_132_776 207
644 3300046529 Ga0495652_0058677 Ga0495652_0058677_1850_2494 207
645 3300046533 Ga0495640_0040573 Ga0495640_0040573_1873_2517 207
646 3300046642 Ga0495634_0048969 Ga0495634_0048969_1613_2257 207
647 3300046663 Ga0495635_0008556 Ga0495635_0008556_1571_2215 207
648 3300046809 Ga0495600_0145298 Ga0495600_0145298_185_829 207
649 3300047317 Ga0495604_0128590 Ga0495604_0128590_112_756 207
650 3300047319 Ga0495674_0029493 Ga0495674_0029493_3207_3851 207
651 3300047322 Ga0495680_0006959 Ga0495680_0006959_3599_4243 207
652 3300048088 Ga0495602_0451316 Ga0495602_0451316_118_753 207
653 3300048907 Ga0496104_0121789 Ga0496104_0121789_616_1257 207
654 3300048909 Ga0496106_0046732 Ga0496106_0046732_1993_2634 207
655 3300048913 Ga0496110_0320106 Ga0496110_0320106_150_791 207
656 3300049568 Ga0501031_0019928 Ga0501031_0019928_1171_1812 207
657 3300049569 Ga0501032_0035806 Ga0501032_0035806_1424_2065 207
658 3300049570 Ga0501033_0012065 Ga0501033_0012065_636_1277 207
659 3300049572 Ga0501036_0081797 Ga0501036_0081797_1367_2008 207
660 3300049573 Ga0501037_0047366 Ga0501037_0047366_2236_2877 207
661 3300049574 Ga0501038_0050643 Ga0501038_0050643_293_934 207
662 3300049575 Ga0501039_0039751 Ga0501039_0039751_976_1617 207
663 3300049575 Ga0501039_0206374 Ga0501039_0206374_885_1520 207
664 3300049578 Ga0501042_0469204 Ga0501042_0469204_197_859 207
665 3300049580 Ga0501046_0199710 Ga0501046_0199710_444_1085 207
666 3300049582 Ga0501048_0119077 Ga0501048_0119077_453_1094 207
667 3300049586 Ga0501070_0055774 Ga0501070_0055774_201_842 207
668 3300049588 Ga0501072_0011656 Ga0501072_0011656_5916_6638 207
669 3300049593 Ga0501077_0038193 Ga0501077_0038193_2049_2684 207
670 3300049741 Ga0501079_0026067 Ga0501079_0026067_3694_4329 207
671 3300049743 Ga0501081_0154907 Ga0501081_0154907_673_1308 207
672 3300049823 Ga0501044_0136143 Ga0501044_0136143_676_1317 207
673 3300050490 nmdc:mga03n38_99775_c1 nmdc:mga03n38_99775_c1_122_766 207
674 3300050491 nmdc:mga00v17_202229_c1 nmdc:mga00v17_202229_c1_21_665 207
675 3300050492 nmdc:mga0yw44_116719_c1 nmdc:mga0yw44_116719_c1_659_1303 207
676 3300050493 nmdc:mga0k408_23023_c1 nmdc:mga0k408_23023_c1_2357_3001 207
677 3300050493 nmdc:mga0k408_31378_c1 nmdc:mga0k408_31378_c1_677_1321 207
678 3300050494 nmdc:mga06z11_457316_c1 nmdc:mga06z11_457316_c1_40_684 207
679 3300050494 nmdc:mga06z11_69648_c1 nmdc:mga06z11_69648_c1_666_1310 207
680 3300050496 nmdc:mga07m45_12111_c1 nmdc:mga07m45_12111_c1_2912_3556 207
681 3300050496 nmdc:mga07m45_231716_c1 nmdc:mga07m45_231716_c1_105_749 207
682 3300050496 nmdc:mga07m45_63242_c1 nmdc:mga07m45_63242_c1_185_829 207
683 3300050511 nmdc:mga08y16_141077_c1 nmdc:mga08y16_141077_c1_1203_1844 207
684 3300050512 nmdc:mga0n895_202634_c1 nmdc:mga0n895_202634_c1_708_1349 207
685 3300050515 nmdc:mga0a205_19489_c1 nmdc:mga0a205_19489_c1_4524_5165 207
686 3300050516 nmdc:mga0sz30_116538_c1 nmdc:mga0sz30_116538_c1_400_1044 207
687 3300053077 Ga0495601_0038174 Ga0495601_0038174_1569_2213 207
688 3300053078 Ga0495612_0068978 Ga0495612_0068978_416_1060 207
689 3300053084 Ga0495595_0012363 Ga0495595_0012363_2199_2843 207
690 3300053085 Ga0495619_0000016 Ga0495619_0000016_16994_17638 207
691 3300053096 Ga0500641_0010930 Ga0500641_0010930_858_1502 207
692 2162886007 SwRhRL2b_contig_1582902 SwRhRL2b_0037.00006380 208
693 2209111006 2214939635 2214002959 208
694 3300000042 ARSoilYngRDRAFT_c00360 ARSoilYngRDRAFT_003603 208
695 3300000043 ARcpr5yngRDRAFT_c000225 ARcpr5yngRDRAFT_0002258 208
696 3300000044 ARSoilOldRDRAFT_c000119 ARSoilOldRDRAFT_00011911 208
697 3300000652 ARCol0yngRDRAFT_1000365 ARCol0yngRDRAFT_10003653 208
698 3300002459 JGI24751J29686_10025198 JGI24751J29686_100251982 208
699 3300003911 JGI25405J52794_10017989 JGI25405J52794_100179892 208
700 3300005276 Ga0065717_1002139 Ga0065717_10021392 208
701 3300005277 Ga0065716_1001608 Ga0065716_10016088 208
702 3300005289 Ga0065704_10105710 Ga0065704_101057102 208
703 3300005293 Ga0065715_10144144 Ga0065715_101441442 208
704 3300005293 Ga0065715_10282375 Ga0065715_102823751 208
705 3300005295 Ga0065707_10090693 Ga0065707_100906933 208
706 3300005328 Ga0070676_10061003 Ga0070676_100610032 208
707 3300005330 Ga0070690_100033018 Ga0070690_1000330182 208
708 3300005331 Ga0070670_100011983 Ga0070670_1000119837 208
709 3300005331 Ga0070670_100290620 Ga0070670_1002906203 208
710 3300005334 Ga0068869_100252571 Ga0068869_1002525712 208
711 3300005335 Ga0070666_10178099 Ga0070666_101780992 208
712 3300005337 Ga0070682_100137007 Ga0070682_1001370072 208
713 3300005339 Ga0070660_100192648 Ga0070660_1001926482 208
714 3300005339 Ga0070660_100418205 Ga0070660_1004182051 208
715 3300005340 Ga0070689_100228563 Ga0070689_1002285632 208
716 3300005341 Ga0070691_10003914 Ga0070691_100039145 208
717 3300005343 Ga0070687_100109504 Ga0070687_1001095042 208
718 3300005343 Ga0070687_100200186 Ga0070687_1002001862 208
719 3300005345 Ga0070692_10060793 Ga0070692_100607932 208
720 3300005345 Ga0070692_10367334 Ga0070692_103673342 208
721 3300005347 Ga0070668_100114077 Ga0070668_1001140772 208
722 3300005347 Ga0070668_100437240 Ga0070668_1004372402 208
723 3300005353 Ga0070669_100219278 Ga0070669_1002192782 208
724 3300005353 Ga0070669_100535922 Ga0070669_1005359221 208
725 3300005354 Ga0070675_100087493 Ga0070675_1000874933 208
726 3300005355 Ga0070671_100066953 Ga0070671_1000669533 208
727 3300005356 Ga0070674_100121467 Ga0070674_1001214672 208
728 3300005364 Ga0070673_100286459 Ga0070673_1002864591 208
729 3300005365 Ga0070688_100025018 Ga0070688_1000250183 208
730 3300005365 Ga0070688_100043897 Ga0070688_1000438974 208
731 3300005366 Ga0070659_100127450 Ga0070659_1001274502 208
732 3300005366 Ga0070659_100378869 Ga0070659_1003788692 208
733 3300005367 Ga0070667_100352910 Ga0070667_1003529102 208
734 3300005367 Ga0070667_100454556 Ga0070667_1004545562 208
735 3300005406 Ga0070703_10069324 Ga0070703_100693242 208
736 3300005436 Ga0070713_100850202 Ga0070713_1008502021 208
737 3300005437 Ga0070710_10340530 Ga0070710_103405302 208
738 3300005438 Ga0070701_10041651 Ga0070701_100416512 208
739 3300005438 Ga0070701_10063229 Ga0070701_100632292 208
740 3300005440 Ga0070705_100438681 Ga0070705_1004386812 208
741 3300005441 Ga0070700_100165045 Ga0070700_1001650451 208
742 3300005441 Ga0070700_100561300 Ga0070700_1005613001 208
743 3300005445 Ga0070708_100625087 Ga0070708_1006250872 208
744 3300005455 Ga0070663_100093127 Ga0070663_1000931272 208
745 3300005456 Ga0070678_100041947 Ga0070678_1000419471 208
746 3300005459 Ga0068867_100045681 Ga0068867_1000456811 208
747 3300005459 Ga0068867_100445852 Ga0068867_1004458522 208
748 3300005466 Ga0070685_10206135 Ga0070685_102061352 208
749 3300005535 Ga0070684_100098312 Ga0070684_1000983122 208
750 3300005535 Ga0070684_100236131 Ga0070684_1002361313 208
751 3300005543 Ga0070672_100205077 Ga0070672_1002050772 208
752 3300005543 Ga0070672_100297961 Ga0070672_1002979612 208
753 3300005544 Ga0070686_100255154 Ga0070686_1002551542 208
754 3300005544 Ga0070686_100480662 Ga0070686_1004806621 208
755 3300005545 Ga0070695_100013226 Ga0070695_1000132262 208
756 3300005547 Ga0070693_100427682 Ga0070693_1004276821 208
757 3300005548 Ga0070665_100600274 Ga0070665_1006002742 208
758 3300005563 Ga0068855_100287977 Ga0068855_1002879773 208
759 3300005564 Ga0070664_100104300 Ga0070664_1001043001 208
760 3300005564 Ga0070664_100178405 Ga0070664_1001784052 208
761 3300005578 Ga0068854_100067161 Ga0068854_1000671614 208
762 3300005614 Ga0068856_100501928 Ga0068856_1005019281 208
763 3300005615 Ga0070702_100056799 Ga0070702_1000567992 208
764 3300005617 Ga0068859_100275925 Ga0068859_1002759252 208
765 3300005618 Ga0068864_100100636 Ga0068864_1001006364 208
766 3300005618 Ga0068864_100446564 Ga0068864_1004465643 208
767 3300005718 Ga0068866_10124912 Ga0068866_101249122 208
768 3300005719 Ga0068861_100091363 Ga0068861_1000913632 208
769 3300005719 Ga0068861_100653010 Ga0068861_1006530101 208
770 3300005840 Ga0068870_10281964 Ga0068870_102819642 208
771 3300005841 Ga0068863_100301030 Ga0068863_1003010301 208
772 3300005842 Ga0068858_100060995 Ga0068858_1000609952 208
773 3300005842 Ga0068858_100242083 Ga0068858_1002420832 208
774 3300005842 Ga0068858_100357213 Ga0068858_1003572133 208
775 3300005843 Ga0068860_100246815 Ga0068860_1002468152 208
776 3300005844 Ga0068862_100057501 Ga0068862_1000575012 208
777 3300005844 Ga0068862_100657071 Ga0068862_1006570712 208
778 3300005844 Ga0068862_100883331 Ga0068862_1008833312 208
779 3300005937 Ga0081455_10004090 Ga0081455_1000409023 208
780 3300005937 Ga0081455_10014407 Ga0081455_100144077 208
781 3300006038 Ga0075365_10091217 Ga0075365_100912174 208
782 3300006038 Ga0075365_10342195 Ga0075365_103421952 208
783 3300006058 Ga0075432_10006405 Ga0075432_100064055 208
784 3300006163 Ga0070715_10146164 Ga0070715_101461642 208
785 3300006163 Ga0070715_10328261 Ga0070715_103282612 208
786 3300006175 Ga0070712_100830729 Ga0070712_1008307291 208
787 3300006194 Ga0075427_10000106 Ga0075427_100001067 208
788 3300006237 Ga0097621_101075032 Ga0097621_1010750321 208
789 3300006358 Ga0068871_100238983 Ga0068871_1002389832 208
790 3300006844 Ga0075428_100167486 Ga0075428_1001674862 208
791 3300006846 Ga0075430_100001330 Ga0075430_10000133013 208
792 3300006852 Ga0075433_10085555 Ga0075433_100855552 208
793 3300006852 Ga0075433_10171968 Ga0075433_101719682 208
794 3300006871 Ga0075434_100000576 Ga0075434_1000005766 208
795 3300006871 Ga0075434_100103936 Ga0075434_1001039364 208
796 3300006871 Ga0075434_100242820 Ga0075434_1002428201 208
797 3300006871 Ga0075434_100770009 Ga0075434_1007700091 208
798 3300006880 Ga0075429_100007164 Ga0075429_10000716410 208
799 3300006881 Ga0068865_100467606 Ga0068865_1004676062 208
800 3300006931 Ga0097620_100275924 Ga0097620_1002759242 208
801 3300007076 Ga0075435_100120409 Ga0075435_1001204093 208
802 3300007076 Ga0075435_100154816 Ga0075435_1001548162 208
803 3300009036 Ga0105244_10093715 Ga0105244_100937152 208
804 3300009094 Ga0111539_10000503 Ga0111539_1000050345 208
805 3300009094 Ga0111539_10012946 Ga0111539_100129464 208
806 3300009094 Ga0111539_10032473 Ga0111539_100324732 208
807 3300009094 Ga0111539_10367883 Ga0111539_103678832 208
808 3300009101 Ga0105247_10061991 Ga0105247_100619914 208
809 3300009101 Ga0105247_10364322 Ga0105247_103643221 208
810 3300009147 Ga0114129_10000621 Ga0114129_1000062115 208
811 3300009147 Ga0114129_10028547 Ga0114129_1002854712 208
812 3300009148 Ga0105243_10083172 Ga0105243_100831723 208
813 3300009148 Ga0105243_10900518 Ga0105243_109005181 208
814 3300009174 Ga0105241_10580444 Ga0105241_105804441 208
815 3300009176 Ga0105242_10652459 Ga0105242_106524592 208
816 3300009177 Ga0105248_10603722 Ga0105248_106037222 208
817 3300009177 Ga0105248_10766508 Ga0105248_107665082 208
818 3300009545 Ga0105237_10836595 Ga0105237_108365952 208
819 3300009553 Ga0105249_10177884 Ga0105249_101778842 208
820 3300010375 Ga0105239_10031440 Ga0105239_100314404 208
821 3300010375 Ga0105239_10592715 Ga0105239_105927152 208
822 3300010375 Ga0105239_10979124 Ga0105239_109791242 208
823 3300011119 Ga0105246_10087145 Ga0105246_100871452 208
824 3300012491 Ga0157329_1000769 Ga0157329_10007692 208
825 3300012494 Ga0157341_1000699 Ga0157341_10006992 208
826 3300012505 Ga0157339_1002176 Ga0157339_10021762 208
827 3300013296 Ga0157374_10454642 Ga0157374_104546422 208
828 3300013296 Ga0157374_10600383 Ga0157374_106003832 208
829 3300013297 Ga0157378_10244302 Ga0157378_102443022 208
830 3300013306 Ga0163162_10655107 Ga0163162_106551072 208
831 3300013307 Ga0157372_10400010 Ga0157372_104000102 208
832 3300013308 Ga0157375_10147638 Ga0157375_101476383 208
833 3300013308 Ga0157375_10630389 Ga0157375_106303892 208
834 3300014325 Ga0163163_10003968 Ga0163163_1000396814 208
835 3300014326 Ga0157380_10036059 Ga0157380_100360592 208
836 3300014745 Ga0157377_10149221 Ga0157377_101492212 208
837 3300014968 Ga0157379_10337997 Ga0157379_103379972 208
838 3300025271 Ga0207666_1000236 Ga0207666_10002364 208
839 3300025315 Ga0207697_10003202 Ga0207697_100032024 208
840 3300025315 Ga0207697_10158588 Ga0207697_101585881 208
841 3300025885 Ga0207653_10009654 Ga0207653_100096543 208
842 3300025898 Ga0207692_10106713 Ga0207692_101067131 208
843 3300025900 Ga0207710_10093045 Ga0207710_100930453 208
844 3300025901 Ga0207688_10181349 Ga0207688_101813492 208
845 3300025903 Ga0207680_10123522 Ga0207680_101235222 208
846 3300025903 Ga0207680_10183061 Ga0207680_101830612 208
847 3300025904 Ga0207647_10023709 Ga0207647_100237092 208
848 3300025904 Ga0207647_10026302 Ga0207647_100263022 208
849 3300025907 Ga0207645_10037887 Ga0207645_100378872 208
850 3300025907 Ga0207645_10148439 Ga0207645_101484392 208
851 3300025911 Ga0207654_10504301 Ga0207654_105043011 208
852 3300025912 Ga0207707_10016195 Ga0207707_100161957 208
853 3300025917 Ga0207660_10066532 Ga0207660_100665322 208
854 3300025918 Ga0207662_10000420 Ga0207662_100004205 208
855 3300025918 Ga0207662_10038527 Ga0207662_100385274 208
856 3300025919 Ga0207657_10022635 Ga0207657_100226353 208
857 3300025919 Ga0207657_10180131 Ga0207657_101801312 208
858 3300025921 Ga0207652_10113575 Ga0207652_101135752 208
859 3300025923 Ga0207681_10035662 Ga0207681_100356623 208
860 3300025925 Ga0207650_10007537 Ga0207650_100075372 208
861 3300025928 Ga0207700_10126700 Ga0207700_101267002 208
862 3300025928 Ga0207700_10645159 Ga0207700_106451592 208
863 3300025932 Ga0207690_10182489 Ga0207690_101824892 208
864 3300025933 Ga0207706_10007686 Ga0207706_100076866 208
865 3300025933 Ga0207706_10028739 Ga0207706_100287392 208
866 3300025933 Ga0207706_10262103 Ga0207706_102621033 208
867 3300025935 Ga0207709_10028625 Ga0207709_100286252 208
868 3300025935 Ga0207709_10148893 Ga0207709_101488932 208
869 3300025936 Ga0207670_10042397 Ga0207670_100423972 208
870 3300025937 Ga0207669_10115992 Ga0207669_101159922 208
871 3300025937 Ga0207669_10353634 Ga0207669_103536341 208
872 3300025938 Ga0207704_10635147 Ga0207704_106351471 208
873 3300025940 Ga0207691_10089428 Ga0207691_100894284 208
874 3300025941 Ga0207711_10433359 Ga0207711_104333592 208
875 3300025945 Ga0207679_10052918 Ga0207679_100529183 208
876 3300025945 Ga0207679_10144987 Ga0207679_101449874 208
877 3300025949 Ga0207667_10159938 Ga0207667_101599382 208
878 3300025961 Ga0207712_10019384 Ga0207712_100193842 208
879 3300025961 Ga0207712_10345750 Ga0207712_103457502 208
880 3300025972 Ga0207668_10095091 Ga0207668_100950912 208
881 3300025972 Ga0207668_10271288 Ga0207668_102712882 208
882 3300025981 Ga0207640_10077899 Ga0207640_100778992 208
883 3300026035 Ga0207703_10192184 Ga0207703_101921841 208
884 3300026035 Ga0207703_10656418 Ga0207703_106564182 208
885 3300026067 Ga0207678_10017130 Ga0207678_100171302 208
886 3300026067 Ga0207678_10084461 Ga0207678_100844612 208
887 3300026075 Ga0207708_10011842 Ga0207708_100118422 208
888 3300026078 Ga0207702_10697731 Ga0207702_106977312 208
889 3300026088 Ga0207641_10409386 Ga0207641_104093862 208
890 3300026089 Ga0207648_10023947 Ga0207648_100239475 208
891 3300026089 Ga0207648_10031830 Ga0207648_100318303 208
892 3300026116 Ga0207674_10131097 Ga0207674_101310973 208
893 3300026118 Ga0207675_100017878 Ga0207675_1000178785 208
894 3300026118 Ga0207675_100018667 Ga0207675_1000186678 208
895 3300026121 Ga0207683_10240326 Ga0207683_102403262 208
896 3300026121 Ga0207683_10330990 Ga0207683_103309902 208
897 3300027717 Ga0209998_10011871 Ga0209998_100118712 208
898 3300027907 Ga0207428_10000114 Ga0207428_1000011457 208
899 3300027907 Ga0207428_10000780 Ga0207428_1000078044 208
900 3300027907 Ga0207428_10063883 Ga0207428_100638834 208
901 3300028380 Ga0268265_10379727 Ga0268265_103797271 208
902 3300028381 Ga0268264_10181628 Ga0268264_101816282 208
903 3300028381 Ga0268264_10381276 Ga0268264_103812761 208
904 3300034816 Ga0373930_0001543 Ga0373930_0001543_282_908 208
905 3300034817 Ga0373948_0026647 Ga0373948_0026647_456_1082 208
906 3300034818 Ga0373950_0001403 Ga0373950_0001403_1614_2240 208
907 3300034819 Ga0373958_0000619 Ga0373958_0000619_2880_3506 208
908 3300034820 Ga0373959_0001495 Ga0373959_0001495_563_1189 208
909 3300034957 Ga0373938_0005414 Ga0373938_0005414_757_1383 208
910 3300035084 Ga0373928_0001492 Ga0373928_0001492_1907_2533 208
911 3300035085 Ga0373929_0003088 Ga0373929_0003088_896_1522 208
912 3300035088 Ga0373940_0015579 Ga0373940_0015579_620_1246 208
913 3300035090 Ga0373949_0004253 Ga0373949_0004253_363_989 208
914 3300035092 Ga0373952_0003160 Ga0373952_0003160_1015_1641 208
915 3300035111 Ga0373923_0120013 Ga0373923_0120013_297_941 208
916 3300035112 Ga0373932_0008968 Ga0373932_0008968_440_1066 208
917 3300035113 Ga0373936_0069945 Ga0373936_0069945_192_836 208
918 3300035114 Ga0373939_0000722 Ga0373939_0000722_3439_4065 208
919 3300035115 Ga0373941_0002372 Ga0373941_0002372_1166_1792 208
920 3300035116 Ga0373945_0003731 Ga0373945_0003731_4055_4699 208
921 3300035121 Ga0373960_0010670 Ga0373960_0010670_1598_2224 208
922 3300035170 Ga0373943_0052522 Ga0373943_0052522_413_1057 208
923 3300035170 Ga0373943_0160975 Ga0373943_0160975_358_996 208
924 3300035171 Ga0373946_0193624 Ga0373946_0193624_135_773 208
925 3300035172 Ga0373955_0109805 Ga0373955_0109805_45_695 208
926 3300035207 Ga0373942_0001603 Ga0373942_0001603_4665_5291 208
927 3300035241 Ga0373961_0008986 Ga0373961_0008986_920_1546 208
928 3300035242 Ga0373962_0001346 Ga0373962_0001346_3031_3657 208
929 3300035691 Ga0373931_0010237 Ga0373931_0010237_3422_4048 208
930 3300035691 Ga0373931_0017812 Ga0373931_0017812_1183_1809 208
931 3300035695 Ga0373927_0158928 Ga0373927_0158928_785_1429 208
932 3300035725 Ga0373947_0023121 Ga0373947_0023121_2938_3582 208
933 3300035725 Ga0373947_0073637 Ga0373947_0073637_648_1292 208
934 3300037068 Ga0373925_0098904 Ga0373925_0098904_818_1456 208
935 3300037068 Ga0373925_0110753 Ga0373925_0110753_880_1524 208
936 3300039450 Ga0436363_1605866 Ga0436363_1605866_1750_2400 208
937 3300041512 Ga0451853_1492139 Ga0451853_1492139_190_843 208
938 3300044712 Ga0453684_0218063 Ga0453684_0218063_61_687 208
939 3300046453 Ga0495627_062755 Ga0495627_062755_252_896 208
940 3300046457 Ga0495590_0043265 Ga0495590_0043265_882_1520 208
941 3300046459 Ga0495629_0090408 Ga0495629_0090408_772_1410 208
942 3300046460 Ga0495638_0096360 Ga0495638_0096360_333_971 208
943 3300046461 Ga0495641_0004844 Ga0495641_0004844_7087_7731 208
944 3300046473 Ga0495582_0361348 Ga0495582_0361348_121_765 208
945 3300046475 Ga0495639_0056203 Ga0495639_0056203_956_1600 208
946 3300046491 Ga0495584_0333579 Ga0495584_0333579_41_694 208
947 3300046492 Ga0495585_0082050 Ga0495585_0082050_243_887 208
948 3300046514 Ga0495618_0071945 Ga0495618_0071945_13_651 208
949 3300046526 Ga0495666_0010453 Ga0495666_0010453_2623_3267 208
950 3300046531 Ga0495665_0043243 Ga0495665_0043243_404_1048 208
951 3300046531 Ga0495665_0113151 Ga0495665_0113151_674_1318 208
952 3300046536 Ga0495587_0226065 Ga0495587_0226065_335_979 208
953 3300046537 Ga0495598_0009195 Ga0495598_0009195_1106_1759 208
954 3300046683 Ga0495658_0022039 Ga0495658_0022039_2561_3205 208
955 3300046689 Ga0495613_0058664 Ga0495613_0058664_1527_2171 208
956 3300046690 Ga0495624_0235925 Ga0495624_0235925_230_874 208
957 3300046810 Ga0495660_0129760 Ga0495660_0129760_555_1199 208
958 3300047315 Ga0495581_0082802 Ga0495581_0082802_349_993 208
959 3300047315 Ga0495581_0281187 Ga0495581_0281187_261_899 208
960 3300047317 Ga0495604_0240520 Ga0495604_0240520_382_1026 208
961 3300047321 Ga0495676_0134654 Ga0495676_0134654_384_1022 208
962 3300047673 Ga0495593_0130270 Ga0495593_0130270_522_1160 208
963 3300048091 Ga0495626_0156478 Ga0495626_0156478_58_711 208
964 3300048903 Ga0496100_0037305 Ga0496100_0037305_1860_2507 208
965 3300048903 Ga0496100_0349203 Ga0496100_0349203_123_770 208
966 3300048904 Ga0496101_0038579 Ga0496101_0038579_1866_2504 208
967 3300048905 Ga0496102_0017500 Ga0496102_0017500_2304_2942 208
968 3300048905 Ga0496102_0201396 Ga0496102_0201396_1155_1781 208
969 3300048905 Ga0496102_0635764 Ga0496102_0635764_192_839 208
970 3300048906 Ga0496103_0004512 Ga0496103_0004512_4454_5092 208
971 3300048907 Ga0496104_0011639 Ga0496104_0011639_370_1008 208
972 3300048907 Ga0496104_0090470 Ga0496104_0090470_1161_1814 208
973 3300048907 Ga0496104_0701418 Ga0496104_0701418_245_871 208
974 3300048908 Ga0496105_0004355 Ga0496105_0004355_5811_6449 208
975 3300048908 Ga0496105_0154880 Ga0496105_0154880_119_772 208
976 3300048909 Ga0496106_0044848 Ga0496106_0044848_1944_2582 208
977 3300048910 Ga0496107_0040423 Ga0496107_0040423_1379_2017 208
978 3300048910 Ga0496107_0440364 Ga0496107_0440364_168_815 208
979 3300048911 Ga0496108_0000500 Ga0496108_0000500_11861_12499 208
980 3300048912 Ga0496109_0000423 Ga0496109_0000423_17868_18506 208
981 3300048912 Ga0496109_0878775 Ga0496109_0878775_49_702 208
982 3300048913 Ga0496110_0179448 Ga0496110_0179448_134_772 208
983 3300048914 Ga0496111_0013636 Ga0496111_0013636_2157_2795 208
984 3300048915 Ga0496112_0161341 Ga0496112_0161341_1201_1839 208
985 3300048915 Ga0496112_0365926 Ga0496112_0365926_119_772 208
986 3300048916 Ga0496113_0002838 Ga0496113_0002838_5244_5882 208
987 3300048917 Ga0496114_0201432 Ga0496114_0201432_959_1612 208
988 3300048918 Ga0496115_0074139 Ga0496115_0074139_119_757 208
989 3300048918 Ga0496115_0152663 Ga0496115_0152663_1173_1811 208
990 3300049574 Ga0501038_0141895 Ga0501038_0141895_568_1212 208
991 3300049575 Ga0501039_0234843 Ga0501039_0234843_70_714 208
992 3300049580 Ga0501046_0265638 Ga0501046_0265638_359_1003 208
993 3300049587 Ga0501071_0682165 Ga0501071_0682165_18_662 208
994 3300049591 Ga0501075_0103669 Ga0501075_0103669_456_1100 208
995 3300049741 Ga0501079_0395447 Ga0501079_0395447_29_670 208
996 3300049822 Ga0501035_0787545 Ga0501035_0787545_51_698 208
997 3300049823 Ga0501044_0076517 Ga0501044_0076517_15_662 208
998 3300049824 Ga0501045_0267857 Ga0501045_0267857_467_1111 208
999 3300049824 Ga0501045_0355179 Ga0501045_0355179_295_939 208
1000 3300050492 nmdc:mga0yw44_5076_c1 nmdc:mga0yw44_5076_c1_3491_4135 208
1001 3300050492 nmdc:mga0yw44_89212_c1 nmdc:mga0yw44_89212_c1_975_1619 208
1002 3300050507 nmdc:mga05p37_19716_c1 nmdc:mga05p37_19716_c1_1812_2444 208
1003 3300050507 nmdc:mga05p37_2557_c2 nmdc:mga05p37_2557_c2_6035_6673 208
1004 3300050507 nmdc:mga05p37_56_c3 nmdc:mga05p37_56_c3_24685_25317 208
1005 3300050508 nmdc:mga09592_976_c1 nmdc:mga09592_976_c1_18059_18691 208
1006 3300050509 nmdc:mga0qj67_52793_c1 nmdc:mga0qj67_52793_c1_402_1034 208
1007 3300050510 nmdc:mga06r32_806_c1 nmdc:mga06r32_806_c1_17980_18612 208
1008 3300050511 nmdc:mga08y16_206_c1 nmdc:mga08y16_206_c1_20723_21355 208
1009 3300050511 nmdc:mga08y16_22406_c1 nmdc:mga08y16_22406_c1_415_1041 208
1010 3300050511 nmdc:mga08y16_31639_c1 nmdc:mga08y16_31639_c1_1335_1973 208
1011 3300050512 nmdc:mga0n895_12772_c1 nmdc:mga0n895_12772_c1_4124_4756 208
1012 3300050512 nmdc:mga0n895_57984_c1 nmdc:mga0n895_57984_c1_2184_2816 208
1013 3300050513 nmdc:mga0rr50_316396_c1 nmdc:mga0rr50_316396_c1_657_1289 208
1014 3300050515 nmdc:mga0a205_80_c1 nmdc:mga0a205_80_c1_31653_32285 208
1015 3300050515 nmdc:mga0a205_82248_c1 nmdc:mga0a205_82248_c1_971_1603 208
1016 3300050515 nmdc:mga0a205_89699_c2 nmdc:mga0a205_89699_c2_869_1495 208
1017 3300053077 Ga0495601_0041938 Ga0495601_0041938_1413_2057 208
1018 3300053085 Ga0495619_0017754 Ga0495619_0017754_810_1448 208
1019 3300061734 Ga0530510_0055057 Ga0530510_0055057_557_1201 208
1020 3300061734 Ga0530510_0073046 Ga0530510_0073046_872_1516 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

36

146

0.99

PF00196

GerE

Bacterial regulatory proteins, luxR family

170

226

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dck-assembly1.cif.gz_A structure of unphosphorylated fixj-n complexed with mn2+ 0.9662 7 122
1d5w-assembly1.cif.gz_A phosphorylated fixj receiver domain 0.9643 6 122
1xhf-assembly1.cif.gz_A crystal structure of the bef3-activated receiver domain of redox response regulator arca 0.9537 5 123
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9533 5 121
6kju-assembly1.cif.gz_A huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors 0.9525 143 199
ID Description Score Start End Superfamily
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9775 143 199 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9765 143 199 1.10.10.10
1dckB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9648 5 123 3.40.50.2300
af_P0DMC9_101_196_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9592 143 200 1.10.10.10
af_P0AFU4_2_125_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9552 6 122 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1H8JF02-F1-model_v4 Two component transcriptional regulator, LuxR family 0.9674 5 201 GO:0000160
GO:0003677
GO:0006355
AF-A0A317FC10-F1-model_v4 DNA-binding response regulator 0.9651 1 202 GO:0000160
GO:0003677
GO:0006355
AF-A0A6N6ZPD7-F1-model_v4 deleted 0.9574 1 204
AF-A0A258HL32-F1-model_v4 DNA-binding response regulator 0.9535 1 202 GO:0000160
GO:0003677
GO:0006355
AF-A0A1H8JF02-F1-model_v4 Two component transcriptional regulator, LuxR family 0.9532 5 201 GO:0000160
GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
88.17 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map