F488381
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1020 | 422 | 1015 | 209 |
Family's Representative Sequence
| Representative Sequence | 3300049588|Ga0501072_0011656|Ga0501072_0011656_5916_6638 |
| Length | 240 |
| Sequence | VDKSGQNQTPAEAQFSDLLFVLSRKRKPAMPSDAMVHVIDDDEAVRDSLEFLFKSAKVGVRTYDSAKRFLSELPQPRSGCIVTDVRMPDVSGIDLLKQLRELGVALPVIVITGHGDIPLAVEAMKLGASEFLEKPFDDELLLTAVRSALEKQADHDNRDAERLKISTRLGTLSNRERQVLEGLSAGLPNKTIAYDLGISPRTVEIYRANLMTKMEANSLSDLVRMVVIAGILDSPGKKPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 4 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 5 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 6 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 7 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 8 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 9 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 10 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 11 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 12 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 17 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 19 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 93 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 95 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 96 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 97 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 98 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 134 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 135 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 152 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 153 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 226 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 228 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 229 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 230 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 232 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 234 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 235 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 241 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 242 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 243 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 244 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 245 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 246 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 248 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 260 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 261 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 262 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 264 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 266 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 267 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 268 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 270 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 271 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 278 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 281 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 282 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 283 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 284 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 285 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 286 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 287 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 288 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 289 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 290 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 293 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 354 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 355 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 356 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 359 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 360 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 361 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 396 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 397 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 398 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 399 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 410 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 415 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 416 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 417 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 419 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 420 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.51 |
| Metatranscriptomes | 0 |
| Isolates | 0.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.2 |
| Nodule | 0.1 |
| Rhizoplane | 5.1 |
| Rhizosphere | 87.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1582902 | 2162886007 | Bacteria | 1303 |
| 2 | 2214939635 | 2209111006 | Bacteria | 6484 |
| 3 | ARSoilYngRDRAFT_c00360 | 3300000042 | Bacteria | 6220 |
| 4 | ARcpr5yngRDRAFT_c000225 | 3300000043 | Bacteria | 8599 |
| 5 | ARSoilOldRDRAFT_c000119 | 3300000044 | Bacteria | 13959 |
| 6 | ARCol0yngRDRAFT_1000365 | 3300000652 | Bacteria | 6323 |
| 7 | JGI24743J22301_10019881 | 3300001991 | Bacteria | 1277 |
| 8 | JGI24751J29686_10025198 | 3300002459 | Bacteria | 1235 |
| 9 | JGI25153J46596_10000066 | 3300003215 | Bacteria | 123268 |
| 10 | rootH1_10041760 | 3300003323 | Bacteria | 7568 |
| 11 | rootH1_10064975 | 3300003323 | Bacteria | 4551 |
| 12 | rootH1_10087342 | 3300003323 | Bacteria | 5162 |
| 13 | JGI25404J52841_10010937 | 3300003659 | Bacteria | 1953 |
| 14 | JGI25405J52794_10017989 | 3300003911 | Bacteria | 1408 |
| 15 | Ga0065717_1002139 | 3300005276 | Bacteria | 2763 |
| 16 | Ga0065716_1001608 | 3300005277 | Bacteria | 5290 |
| 17 | Ga0065704_10105710 | 3300005289 | Bacteria | 2103 |
| 18 | Ga0065712_10106759 | 3300005290 | Bacteria | 1910 |
| 19 | Ga0065715_10144144 | 3300005293 | Bacteria | 1761 |
| 20 | Ga0065715_10282375 | 3300005293 | Bacteria | 1083 |
| 21 | Ga0065707_10090693 | 3300005295 | Bacteria | 4087 |
| 22 | Ga0070658_10002045 | 3300005327 | Bacteria | 16922 |
| 23 | Ga0070658_10103966 | 3300005327 | Bacteria | 2349 |
| 24 | Ga0070658_10129207 | 3300005327 | Bacteria | 2105 |
| 25 | Ga0070676_10031086 | 3300005328 | Bacteria | 3048 |
| 26 | Ga0070676_10061003 | 3300005328 | Bacteria | 2241 |
| 27 | Ga0070683_100025834 | 3300005329 | Bacteria | 5281 |
| 28 | Ga0070683_100043381 | 3300005329 | Bacteria | 4145 |
| 29 | Ga0070683_100109225 | 3300005329 | Bacteria | 2609 |
| 30 | Ga0070690_100033018 | 3300005330 | Bacteria | 3237 |
| 31 | Ga0070670_100011983 | 3300005331 | Bacteria | 7416 |
| 32 | Ga0070670_100044592 | 3300005331 | Bacteria | 3813 |
| 33 | Ga0070670_100061110 | 3300005331 | Bacteria | 3234 |
| 34 | Ga0070670_100290620 | 3300005331 | Bacteria | 1428 |
| 35 | Ga0070670_101122698 | 3300005331 | Bacteria | 717 |
| 36 | Ga0070677_10001526 | 3300005333 | Bacteria | 7326 |
| 37 | Ga0070677_10266966 | 3300005333 | Bacteria | 856 |
| 38 | Ga0068869_100252571 | 3300005334 | Bacteria | 1409 |
| 39 | Ga0070666_10149784 | 3300005335 | Bacteria | 1628 |
| 40 | Ga0070666_10178099 | 3300005335 | Bacteria | 1490 |
| 41 | Ga0070682_100137007 | 3300005337 | Bacteria | 1664 |
| 42 | Ga0070682_100261629 | 3300005337 | Bacteria | 1252 |
| 43 | Ga0068868_100498174 | 3300005338 | Bacteria | 1067 |
| 44 | Ga0070660_100014238 | 3300005339 | Bacteria | 5727 |
| 45 | Ga0070660_100044880 | 3300005339 | Bacteria | 3382 |
| 46 | Ga0070660_100146623 | 3300005339 | Bacteria | 1896 |
| 47 | Ga0070660_100192648 | 3300005339 | Bacteria | 1652 |
| 48 | Ga0070660_100418205 | 3300005339 | Bacteria | 1110 |
| 49 | Ga0070689_100021788 | 3300005340 | Bacteria | 4775 |
| 50 | Ga0070689_100228563 | 3300005340 | Bacteria | 1528 |
| 51 | Ga0070691_10003914 | 3300005341 | Bacteria | 6736 |
| 52 | Ga0070687_100109504 | 3300005343 | Bacteria | 1561 |
| 53 | Ga0070687_100133269 | 3300005343 | Bacteria | 1437 |
| 54 | Ga0070687_100200186 | 3300005343 | Bacteria | 1209 |
| 55 | Ga0070661_100015548 | 3300005344 | Bacteria | 5371 |
| 56 | Ga0070692_10060793 | 3300005345 | Bacteria | 1990 |
| 57 | Ga0070692_10367334 | 3300005345 | Bacteria | 899 |
| 58 | Ga0070668_100101877 | 3300005347 | Bacteria | 2276 |
| 59 | Ga0070668_100114077 | 3300005347 | Bacteria | 2153 |
| 60 | Ga0070668_100437240 | 3300005347 | Bacteria | 1122 |
| 61 | Ga0070669_100043124 | 3300005353 | Bacteria | 3284 |
| 62 | Ga0070669_100219278 | 3300005353 | Bacteria | 1504 |
| 63 | Ga0070669_100535922 | 3300005353 | Bacteria | 975 |
| 64 | Ga0070669_100628275 | 3300005353 | Bacteria | 902 |
| 65 | Ga0070675_100007200 | 3300005354 | Bacteria | 8575 |
| 66 | Ga0070675_100087493 | 3300005354 | Bacteria | 2605 |
| 67 | Ga0070675_100192444 | 3300005354 | Bacteria | 1768 |
| 68 | Ga0070675_100439072 | 3300005354 | Bacteria | 1169 |
| 69 | Ga0070671_100066953 | 3300005355 | Bacteria | 2994 |
| 70 | Ga0070671_100260281 | 3300005355 | Bacteria | 1474 |
| 71 | Ga0070674_100121467 | 3300005356 | Bacteria | 1934 |
| 72 | Ga0070674_100252788 | 3300005356 | Bacteria | 1385 |
| 73 | Ga0070673_100286459 | 3300005364 | Bacteria | 1446 |
| 74 | Ga0070688_100025018 | 3300005365 | Bacteria | 3530 |
| 75 | Ga0070688_100043897 | 3300005365 | Bacteria | 2756 |
| 76 | Ga0070659_100008537 | 3300005366 | Bacteria | 7485 |
| 77 | Ga0070659_100070471 | 3300005366 | Bacteria | 2777 |
| 78 | Ga0070659_100105105 | 3300005366 | Bacteria | 2275 |
| 79 | Ga0070659_100127450 | 3300005366 | Bacteria | 2065 |
| 80 | Ga0070659_100378869 | 3300005366 | Bacteria | 1191 |
| 81 | Ga0070667_100352910 | 3300005367 | Bacteria | 1332 |
| 82 | Ga0070667_100454556 | 3300005367 | Bacteria | 1170 |
| 83 | Ga0070667_100925546 | 3300005367 | Bacteria | 812 |
| 84 | Ga0070703_10069324 | 3300005406 | Bacteria | 1174 |
| 85 | Ga0070709_10138150 | 3300005434 | Bacteria | 1671 |
| 86 | Ga0070714_100142045 | 3300005435 | Bacteria | 2156 |
| 87 | Ga0070713_100029053 | 3300005436 | Bacteria | 4373 |
| 88 | Ga0070713_100850202 | 3300005436 | Bacteria | 876 |
| 89 | Ga0070710_10340530 | 3300005437 | Bacteria | 990 |
| 90 | Ga0070701_10041651 | 3300005438 | Bacteria | 2342 |
| 91 | Ga0070701_10063229 | 3300005438 | Bacteria | 1958 |
| 92 | Ga0070705_100438681 | 3300005440 | Bacteria | 977 |
| 93 | Ga0070705_100519450 | 3300005440 | Bacteria | 907 |
| 94 | Ga0070700_100065559 | 3300005441 | Bacteria | 2303 |
| 95 | Ga0070700_100165045 | 3300005441 | Bacteria | 1528 |
| 96 | Ga0070700_100561300 | 3300005441 | Bacteria | 888 |
| 97 | Ga0070708_100625087 | 3300005445 | Bacteria | 1015 |
| 98 | Ga0070663_100093127 | 3300005455 | Bacteria | 2235 |
| 99 | Ga0070663_100250830 | 3300005455 | Bacteria | 1401 |
| 100 | Ga0070678_100034450 | 3300005456 | Bacteria | 3527 |
| 101 | Ga0070678_100041947 | 3300005456 | Bacteria | 3248 |
| 102 | Ga0070678_100129976 | 3300005456 | Bacteria | 1999 |
| 103 | Ga0070662_100009002 | 3300005457 | Bacteria | 6514 |
| 104 | Ga0070662_100062866 | 3300005457 | Bacteria | 2714 |
| 105 | Ga0070662_100146150 | 3300005457 | Bacteria | 1837 |
| 106 | Ga0070662_100433034 | 3300005457 | Bacteria | 1089 |
| 107 | Ga0070681_10027494 | 3300005458 | Bacteria | 5718 |
| 108 | Ga0070681_10286633 | 3300005458 | Bacteria | 1557 |
| 109 | Ga0068867_100045681 | 3300005459 | Bacteria | 3214 |
| 110 | Ga0068867_100052549 | 3300005459 | Bacteria | 3007 |
| 111 | Ga0068867_100428595 | 3300005459 | Bacteria | 1122 |
| 112 | Ga0068867_100445852 | 3300005459 | Bacteria | 1102 |
| 113 | Ga0070685_10011297 | 3300005466 | Bacteria | 4675 |
| 114 | Ga0070685_10206135 | 3300005466 | Bacteria | 1281 |
| 115 | Ga0070679_100129273 | 3300005530 | Bacteria | 2507 |
| 116 | Ga0070679_100208362 | 3300005530 | Bacteria | 1919 |
| 117 | Ga0070679_100360469 | 3300005530 | Bacteria | 1401 |
| 118 | Ga0070684_100051620 | 3300005535 | Bacteria | 3573 |
| 119 | Ga0070684_100098312 | 3300005535 | Bacteria | 2611 |
| 120 | Ga0070684_100124505 | 3300005535 | Bacteria | 2320 |
| 121 | Ga0070684_100154153 | 3300005535 | Bacteria | 2083 |
| 122 | Ga0070684_100236131 | 3300005535 | Bacteria | 1670 |
| 123 | Ga0068853_100012357 | 3300005539 | Bacteria | 6948 |
| 124 | Ga0068853_100073544 | 3300005539 | Bacteria | 2980 |
| 125 | Ga0068853_100126317 | 3300005539 | Bacteria | 2285 |
| 126 | Ga0068853_100201445 | 3300005539 | Bacteria | 1812 |
| 127 | Ga0070672_100145172 | 3300005543 | Bacteria | 1960 |
| 128 | Ga0070672_100194921 | 3300005543 | Bacteria | 1693 |
| 129 | Ga0070672_100205077 | 3300005543 | Bacteria | 1649 |
| 130 | Ga0070672_100290929 | 3300005543 | Bacteria | 1383 |
| 131 | Ga0070672_100297961 | 3300005543 | Bacteria | 1366 |
| 132 | Ga0070686_100021445 | 3300005544 | Bacteria | 3841 |
| 133 | Ga0070686_100255154 | 3300005544 | Bacteria | 1283 |
| 134 | Ga0070686_100258167 | 3300005544 | Bacteria | 1276 |
| 135 | Ga0070686_100270070 | 3300005544 | Bacteria | 1250 |
| 136 | Ga0070686_100480662 | 3300005544 | Bacteria | 960 |
| 137 | Ga0070695_100013226 | 3300005545 | Bacteria | 4957 |
| 138 | Ga0070696_100088229 | 3300005546 | Bacteria | 2204 |
| 139 | Ga0070693_100427682 | 3300005547 | Bacteria | 924 |
| 140 | Ga0070665_100064426 | 3300005548 | Bacteria | 3675 |
| 141 | Ga0070665_100384903 | 3300005548 | Bacteria | 1410 |
| 142 | Ga0070665_100600274 | 3300005548 | Bacteria | 1114 |
| 143 | Ga0070665_100795005 | 3300005548 | Bacteria | 959 |
| 144 | Ga0070665_100966555 | 3300005548 | Bacteria | 864 |
| 145 | Ga0068855_100011710 | 3300005563 | Bacteria | 10600 |
| 146 | Ga0068855_100269792 | 3300005563 | Bacteria | 1892 |
| 147 | Ga0068855_100287977 | 3300005563 | Bacteria | 1822 |
| 148 | Ga0070664_100061077 | 3300005564 | Bacteria | 3211 |
| 149 | Ga0070664_100085255 | 3300005564 | Bacteria | 2728 |
| 150 | Ga0070664_100104300 | 3300005564 | Bacteria | 2469 |
| 151 | Ga0070664_100178405 | 3300005564 | Bacteria | 1887 |
| 152 | Ga0070664_100403758 | 3300005564 | Bacteria | 1250 |
| 153 | Ga0068857_100029926 | 3300005577 | Bacteria | 4805 |
| 154 | Ga0068857_100206704 | 3300005577 | Bacteria | 1791 |
| 155 | Ga0068854_100010290 | 3300005578 | Bacteria | 6062 |
| 156 | Ga0068854_100067161 | 3300005578 | Bacteria | 2612 |
| 157 | Ga0068856_100034732 | 3300005614 | Bacteria | 4939 |
| 158 | Ga0068856_100212373 | 3300005614 | Bacteria | 1950 |
| 159 | Ga0068856_100390563 | 3300005614 | Bacteria | 1411 |
| 160 | Ga0068856_100501928 | 3300005614 | Bacteria | 1234 |
| 161 | Ga0070702_100056799 | 3300005615 | Bacteria | 2262 |
| 162 | Ga0068852_100001655 | 3300005616 | Bacteria | 15194 |
| 163 | Ga0068852_100008530 | 3300005616 | Bacteria | 7561 |
| 164 | Ga0068852_100104184 | 3300005616 | Bacteria | 2567 |
| 165 | Ga0068852_100141351 | 3300005616 | Bacteria | 2228 |
| 166 | Ga0068852_100932758 | 3300005616 | Bacteria | 886 |
| 167 | Ga0068859_100144709 | 3300005617 | Bacteria | 2451 |
| 168 | Ga0068859_100275925 | 3300005617 | Bacteria | 1773 |
| 169 | Ga0068859_100343898 | 3300005617 | Bacteria | 1586 |
| 170 | Ga0068864_100100636 | 3300005618 | Bacteria | 2562 |
| 171 | Ga0068864_100145190 | 3300005618 | Bacteria | 2144 |
| 172 | Ga0068864_100446564 | 3300005618 | Bacteria | 1236 |
| 173 | Ga0068866_10079475 | 3300005718 | Bacteria | 1757 |
| 174 | Ga0068866_10124912 | 3300005718 | Bacteria | 1455 |
| 175 | Ga0068866_10404741 | 3300005718 | Bacteria | 881 |
| 176 | Ga0068861_100091363 | 3300005719 | Bacteria | 2403 |
| 177 | Ga0068861_100595517 | 3300005719 | Bacteria | 1014 |
| 178 | Ga0068861_100653010 | 3300005719 | Bacteria | 972 |
| 179 | Ga0068870_10281964 | 3300005840 | Bacteria | 1042 |
| 180 | Ga0068863_100301030 | 3300005841 | Bacteria | 1556 |
| 181 | Ga0068858_100060995 | 3300005842 | Bacteria | 3486 |
| 182 | Ga0068858_100242083 | 3300005842 | Bacteria | 1712 |
| 183 | Ga0068858_100357213 | 3300005842 | Bacteria | 1400 |
| 184 | Ga0068860_100246815 | 3300005843 | Bacteria | 1737 |
| 185 | Ga0068860_100435755 | 3300005843 | Bacteria | 1301 |
| 186 | Ga0068860_101073231 | 3300005843 | Bacteria | 824 |
| 187 | Ga0068862_100057501 | 3300005844 | Bacteria | 3335 |
| 188 | Ga0068862_100495492 | 3300005844 | Bacteria | 1159 |
| 189 | Ga0068862_100657071 | 3300005844 | Bacteria | 1012 |
| 190 | Ga0068862_100883331 | 3300005844 | Bacteria | 878 |
| 191 | Ga0081455_10004090 | 3300005937 | Bacteria | 16515 |
| 192 | Ga0081455_10008578 | 3300005937 | Bacteria | 10608 |
| 193 | Ga0081455_10014407 | 3300005937 | Bacteria | 7755 |
| 194 | Ga0081455_10248818 | 3300005937 | Bacteria | 1301 |
| 195 | Ga0081538_10061201 | 3300005981 | Bacteria | 2157 |
| 196 | Ga0081540_1000462 | 3300005983 | Bacteria | 40336 |
| 197 | Ga0081539_10006052 | 3300005985 | Bacteria | 11849 |
| 198 | Ga0070717_10916994 | 3300006028 | Bacteria | 798 |
| 199 | Ga0075365_10091217 | 3300006038 | Bacteria | 2076 |
| 200 | Ga0075365_10167953 | 3300006038 | Bacteria | 1531 |
| 201 | Ga0075365_10221661 | 3300006038 | Bacteria | 1327 |
| 202 | Ga0075365_10228041 | 3300006038 | Bacteria | 1307 |
| 203 | Ga0075365_10342195 | 3300006038 | Bacteria | 1054 |
| 204 | Ga0075368_10037214 | 3300006042 | Bacteria | 1902 |
| 205 | Ga0075368_10040390 | 3300006042 | Bacteria | 1832 |
| 206 | Ga0075368_10107303 | 3300006042 | Bacteria | 1150 |
| 207 | Ga0075363_100035329 | 3300006048 | Bacteria | 2615 |
| 208 | Ga0075363_100143012 | 3300006048 | Bacteria | 1348 |
| 209 | Ga0075364_10413132 | 3300006051 | Bacteria | 921 |
| 210 | Ga0075432_10006405 | 3300006058 | Bacteria | 4006 |
| 211 | Ga0070715_10146164 | 3300006163 | Bacteria | 1154 |
| 212 | Ga0070715_10328261 | 3300006163 | Bacteria | 828 |
| 213 | Ga0070712_100830729 | 3300006175 | Bacteria | 794 |
| 214 | Ga0075362_10003309 | 3300006177 | Bacteria | 5614 |
| 215 | Ga0075362_10094065 | 3300006177 | Bacteria | 1394 |
| 216 | Ga0075367_10002551 | 3300006178 | Bacteria | 8362 |
| 217 | Ga0075367_10092400 | 3300006178 | Bacteria | 1842 |
| 218 | Ga0075369_10008060 | 3300006186 | Bacteria | 4039 |
| 219 | Ga0075427_10000106 | 3300006194 | Bacteria | 7138 |
| 220 | Ga0075366_10006005 | 3300006195 | Bacteria | 6616 |
| 221 | Ga0075366_10020275 | 3300006195 | Bacteria | 3856 |
| 222 | Ga0075366_10068103 | 3300006195 | Bacteria | 2118 |
| 223 | Ga0075366_10109524 | 3300006195 | Bacteria | 1661 |
| 224 | Ga0097621_101075032 | 3300006237 | Bacteria | 754 |
| 225 | Ga0075370_10008430 | 3300006353 | Bacteria | 5304 |
| 226 | Ga0068871_100225212 | 3300006358 | Bacteria | 1626 |
| 227 | Ga0068871_100238983 | 3300006358 | Bacteria | 1579 |
| 228 | Ga0075428_100167486 | 3300006844 | Bacteria | 2383 |
| 229 | Ga0075428_100724069 | 3300006844 | Unclassified | 1059 |
| 230 | Ga0075430_100001330 | 3300006846 | Bacteria | 19963 |
| 231 | Ga0075433_10067681 | 3300006852 | Bacteria | 3135 |
| 232 | Ga0075433_10085555 | 3300006852 | Bacteria | 2783 |
| 233 | Ga0075433_10171968 | 3300006852 | Bacteria | 1928 |
| 234 | Ga0075434_100000576 | 3300006871 | Bacteria | 28251 |
| 235 | Ga0075434_100019269 | 3300006871 | Bacteria | 6601 |
| 236 | Ga0075434_100103936 | 3300006871 | Bacteria | 2849 |
| 237 | Ga0075434_100242820 | 3300006871 | Bacteria | 1821 |
| 238 | Ga0075434_100717564 | 3300006871 | Bacteria | 1017 |
| 239 | Ga0075434_100770009 | 3300006871 | Bacteria | 979 |
| 240 | Ga0075429_100007164 | 3300006880 | Bacteria | 9677 |
| 241 | Ga0068865_100389395 | 3300006881 | Bacteria | 1139 |
| 242 | Ga0068865_100467606 | 3300006881 | Bacteria | 1046 |
| 243 | Ga0068865_100698612 | 3300006881 | Bacteria | 866 |
| 244 | Ga0075436_100072041 | 3300006914 | Bacteria | 2390 |
| 245 | Ga0097620_100144727 | 3300006931 | Bacteria | 2451 |
| 246 | Ga0097620_100275924 | 3300006931 | Bacteria | 1773 |
| 247 | Ga0097620_100343880 | 3300006931 | Bacteria | 1586 |
| 248 | Ga0075435_100120409 | 3300007076 | Bacteria | 2190 |
| 249 | Ga0075435_100154816 | 3300007076 | Bacteria | 1928 |
| 250 | Ga0075435_100440179 | 3300007076 | Bacteria | 1123 |
| 251 | Ga0075435_100486817 | 3300007076 | Bacteria | 1066 |
| 252 | Ga0105244_10093715 | 3300009036 | Bacteria | 1475 |
| 253 | Ga0105240_10069912 | 3300009093 | Bacteria | 4345 |
| 254 | Ga0105240_10093427 | 3300009093 | Bacteria | 3671 |
| 255 | Ga0105240_10238265 | 3300009093 | Bacteria | 2111 |
| 256 | Ga0111539_10000503 | 3300009094 | Bacteria | 49808 |
| 257 | Ga0111539_10012946 | 3300009094 | Bacteria | 10439 |
| 258 | Ga0111539_10032473 | 3300009094 | Bacteria | 6338 |
| 259 | Ga0111539_10048837 | 3300009094 | Bacteria | 5050 |
| 260 | Ga0111539_10367883 | 3300009094 | Bacteria | 1673 |
| 261 | Ga0111539_10484944 | 3300009094 | Bacteria | 1440 |
| 262 | Ga0111539_10909214 | 3300009094 | Bacteria | 1024 |
| 263 | Ga0111539_11066113 | 3300009094 | Bacteria | 939 |
| 264 | Ga0111539_11320194 | 3300009094 | Bacteria | 837 |
| 265 | Ga0105245_10594066 | 3300009098 | Bacteria | 1133 |
| 266 | Ga0105245_10743314 | 3300009098 | Bacteria | 1016 |
| 267 | Ga0105247_10035298 | 3300009101 | Bacteria | 3048 |
| 268 | Ga0105247_10061991 | 3300009101 | Bacteria | 2319 |
| 269 | Ga0105247_10237445 | 3300009101 | Bacteria | 1240 |
| 270 | Ga0105247_10364322 | 3300009101 | Bacteria | 1020 |
| 271 | Ga0114129_10000621 | 3300009147 | Bacteria | 44041 |
| 272 | Ga0114129_10028547 | 3300009147 | Bacteria | 7906 |
| 273 | Ga0114129_10099148 | 3300009147 | Bacteria | 4032 |
| 274 | Ga0105243_10083172 | 3300009148 | Bacteria | 2618 |
| 275 | Ga0105243_10172090 | 3300009148 | Bacteria | 1877 |
| 276 | Ga0105243_10677574 | 3300009148 | Bacteria | 1002 |
| 277 | Ga0105243_10900518 | 3300009148 | Bacteria | 880 |
| 278 | Ga0105241_10014840 | 3300009174 | Bacteria | 5703 |
| 279 | Ga0105241_10040950 | 3300009174 | Unclassified | 3498 |
| 280 | Ga0105241_10404082 | 3300009174 | Bacteria | 1199 |
| 281 | Ga0105241_10580444 | 3300009174 | Bacteria | 1010 |
| 282 | Ga0105242_10566651 | 3300009176 | Bacteria | 1092 |
| 283 | Ga0105242_10652459 | 3300009176 | Bacteria | 1023 |
| 284 | Ga0105248_10000015 | 3300009177 | Bacteria | 322959 |
| 285 | Ga0105248_10434349 | 3300009177 | Bacteria | 1479 |
| 286 | Ga0105248_10603722 | 3300009177 | Bacteria | 1238 |
| 287 | Ga0105248_10766508 | 3300009177 | Bacteria | 1089 |
| 288 | Ga0105237_10222456 | 3300009545 | Bacteria | 1888 |
| 289 | Ga0105237_10836595 | 3300009545 | Bacteria | 927 |
| 290 | Ga0105237_10870155 | 3300009545 | Bacteria | 908 |
| 291 | Ga0105238_10001373 | 3300009551 | Bacteria | 24416 |
| 292 | Ga0105238_10039590 | 3300009551 | Bacteria | 4779 |
| 293 | Ga0105238_10239050 | 3300009551 | Bacteria | 1794 |
| 294 | Ga0105238_10294446 | 3300009551 | Bacteria | 1606 |
| 295 | Ga0105249_10132531 | 3300009553 | Bacteria | 2381 |
| 296 | Ga0105249_10177884 | 3300009553 | Bacteria | 2068 |
| 297 | Ga0105249_10387775 | 3300009553 | Bacteria | 1424 |
| 298 | Ga0105249_10620383 | 3300009553 | Bacteria | 1137 |
| 299 | Ga0105249_10786199 | 3300009553 | Bacteria | 1015 |
| 300 | Ga0105239_10022682 | 3300010375 | Bacteria | 6920 |
| 301 | Ga0105239_10031440 | 3300010375 | Bacteria | 5838 |
| 302 | Ga0105239_10119753 | 3300010375 | Bacteria | 2922 |
| 303 | Ga0105239_10224844 | 3300010375 | Bacteria | 2105 |
| 304 | Ga0105239_10592715 | 3300010375 | Bacteria | 1264 |
| 305 | Ga0105239_10979124 | 3300010375 | Bacteria | 972 |
| 306 | Ga0105239_11506093 | 3300010375 | Bacteria | 777 |
| 307 | Ga0105246_10087145 | 3300011119 | Bacteria | 2240 |
| 308 | Ga0105246_10093612 | 3300011119 | Bacteria | 2171 |
| 309 | Ga0105246_10116104 | 3300011119 | Bacteria | 1975 |
| 310 | Ga0105246_10185487 | 3300011119 | Bacteria | 1606 |
| 311 | Ga0157329_1000769 | 3300012491 | Bacteria | 1412 |
| 312 | Ga0157341_1000699 | 3300012494 | Bacteria | 1794 |
| 313 | Ga0157339_1002176 | 3300012505 | Bacteria | 1298 |
| 314 | Ga0157373_10002425 | 3300013100 | Bacteria | 14185 |
| 315 | Ga0157373_10013179 | 3300013100 | Bacteria | 6068 |
| 316 | Ga0157373_10057799 | 3300013100 | Bacteria | 2751 |
| 317 | Ga0157371_10016668 | 3300013102 | Bacteria | 5476 |
| 318 | Ga0157370_10013414 | 3300013104 | Bacteria | 8442 |
| 319 | Ga0157370_10082033 | 3300013104 | Bacteria | 3033 |
| 320 | Ga0157369_10021559 | 3300013105 | Bacteria | 7206 |
| 321 | Ga0157369_10036888 | 3300013105 | Bacteria | 5354 |
| 322 | Ga0157374_10454642 | 3300013296 | Bacteria | 1282 |
| 323 | Ga0157374_10600383 | 3300013296 | Bacteria | 1111 |
| 324 | Ga0157378_10013498 | 3300013297 | Bacteria | 7144 |
| 325 | Ga0157378_10133492 | 3300013297 | Bacteria | 2300 |
| 326 | Ga0157378_10244302 | 3300013297 | Bacteria | 1716 |
| 327 | Ga0157378_10279934 | 3300013297 | Bacteria | 1607 |
| 328 | Ga0163162_10079200 | 3300013306 | Bacteria | 3352 |
| 329 | Ga0163162_10091938 | 3300013306 | Bacteria | 3117 |
| 330 | Ga0163162_10655107 | 3300013306 | Bacteria | 1174 |
| 331 | Ga0163162_10739960 | 3300013306 | Bacteria | 1103 |
| 332 | Ga0157372_10014547 | 3300013307 | Bacteria | 8418 |
| 333 | Ga0157372_10024794 | 3300013307 | Bacteria | 6518 |
| 334 | Ga0157372_10400010 | 3300013307 | Bacteria | 1600 |
| 335 | Ga0157372_10462668 | 3300013307 | Bacteria | 1478 |
| 336 | Ga0157372_11391142 | 3300013307 | Bacteria | 809 |
| 337 | Ga0157372_11391193 | 3300013307 | Bacteria | 809 |
| 338 | Ga0157375_10011914 | 3300013308 | Bacteria | 7694 |
| 339 | Ga0157375_10147638 | 3300013308 | Bacteria | 2483 |
| 340 | Ga0157375_10415941 | 3300013308 | Bacteria | 1511 |
| 341 | Ga0157375_10626621 | 3300013308 | Bacteria | 1233 |
| 342 | Ga0157375_10630389 | 3300013308 | Bacteria | 1229 |
| 343 | Ga0157375_10685619 | 3300013308 | Bacteria | 1179 |
| 344 | Ga0163163_10003968 | 3300014325 | Bacteria | 12634 |
| 345 | Ga0163163_10160285 | 3300014325 | Bacteria | 2295 |
| 346 | Ga0163163_10227792 | 3300014325 | Bacteria | 1913 |
| 347 | Ga0163163_10383831 | 3300014325 | Bacteria | 1462 |
| 348 | Ga0163163_10400319 | 3300014325 | Bacteria | 1431 |
| 349 | Ga0163163_10516990 | 3300014325 | Bacteria | 1256 |
| 350 | Ga0163163_10691932 | 3300014325 | Bacteria | 1083 |
| 351 | Ga0157380_10036059 | 3300014326 | Bacteria | 3825 |
| 352 | Ga0157377_10149221 | 3300014745 | Bacteria | 1444 |
| 353 | Ga0157377_10330354 | 3300014745 | Bacteria | 1016 |
| 354 | Ga0157379_10001600 | 3300014968 | Bacteria | 18672 |
| 355 | Ga0157379_10258154 | 3300014968 | Bacteria | 1583 |
| 356 | Ga0157379_10337997 | 3300014968 | Bacteria | 1377 |
| 357 | Ga0157376_10009435 | 3300014969 | Bacteria | 7085 |
| 358 | Ga0157376_10189844 | 3300014969 | Bacteria | 1883 |
| 359 | Ga0157376_10381715 | 3300014969 | Bacteria | 1357 |
| 360 | Ga0157376_11157280 | 3300014969 | Bacteria | 801 |
| 361 | Ga0163161_10041795 | 3300017792 | Bacteria | 3295 |
| 362 | Ga0213872_10146057 | 3300021361 | Bacteria | 1035 |
| 363 | Ga0213876_10079150 | 3300021384 | Bacteria | 1737 |
| 364 | Ga0207666_1000236 | 3300025271 | Bacteria | 8137 |
| 365 | Ga0209564_1012585 | 3300025295 | Bacteria | 3675 |
| 366 | Ga0209758_1000028 | 3300025297 | Bacteria | 530102 |
| 367 | Ga0209758_1008245 | 3300025297 | Bacteria | 6821 |
| 368 | Ga0207697_10003202 | 3300025315 | Bacteria | 8143 |
| 369 | Ga0207697_10158588 | 3300025315 | Bacteria | 986 |
| 370 | Ga0207656_10077017 | 3300025321 | Bacteria | 1492 |
| 371 | Ga0207653_10009654 | 3300025885 | Bacteria | 3008 |
| 372 | Ga0207682_10000200 | 3300025893 | Bacteria | 27225 |
| 373 | Ga0207682_10345867 | 3300025893 | Bacteria | 700 |
| 374 | Ga0207692_10106713 | 3300025898 | Bacteria | 1547 |
| 375 | Ga0207642_10023803 | 3300025899 | Bacteria | 2452 |
| 376 | Ga0207710_10055447 | 3300025900 | Bacteria | 1787 |
| 377 | Ga0207710_10093045 | 3300025900 | Bacteria | 1414 |
| 378 | Ga0207688_10007988 | 3300025901 | Bacteria | 5757 |
| 379 | Ga0207688_10181349 | 3300025901 | Bacteria | 1256 |
| 380 | Ga0207680_10123522 | 3300025903 | Bacteria | 1696 |
| 381 | Ga0207680_10183061 | 3300025903 | Bacteria | 1418 |
| 382 | Ga0207647_10023709 | 3300025904 | Bacteria | 4054 |
| 383 | Ga0207647_10026302 | 3300025904 | Bacteria | 3810 |
| 384 | Ga0207647_10113400 | 3300025904 | Bacteria | 1602 |
| 385 | Ga0207699_10530629 | 3300025906 | Bacteria | 852 |
| 386 | Ga0207645_10005680 | 3300025907 | Bacteria | 9012 |
| 387 | Ga0207645_10037887 | 3300025907 | Bacteria | 3094 |
| 388 | Ga0207645_10077209 | 3300025907 | Bacteria | 2134 |
| 389 | Ga0207645_10148439 | 3300025907 | Bacteria | 1529 |
| 390 | Ga0207654_10504301 | 3300025911 | Bacteria | 855 |
| 391 | Ga0207654_10505547 | 3300025911 | Bacteria | 854 |
| 392 | Ga0207707_10016195 | 3300025912 | Bacteria | 6504 |
| 393 | Ga0207695_10080968 | 3300025913 | Bacteria | 3288 |
| 394 | Ga0207695_10166367 | 3300025913 | Bacteria | 2133 |
| 395 | Ga0207695_10333573 | 3300025913 | Bacteria | 1405 |
| 396 | Ga0207660_10066532 | 3300025917 | Bacteria | 2607 |
| 397 | Ga0207660_10500188 | 3300025917 | Bacteria | 986 |
| 398 | Ga0207662_10000420 | 3300025918 | Bacteria | 18707 |
| 399 | Ga0207662_10023087 | 3300025918 | Bacteria | 3571 |
| 400 | Ga0207662_10038527 | 3300025918 | Bacteria | 2801 |
| 401 | Ga0207657_10012000 | 3300025919 | Bacteria | 8569 |
| 402 | Ga0207657_10022635 | 3300025919 | Bacteria | 5874 |
| 403 | Ga0207657_10125508 | 3300025919 | Bacteria | 2108 |
| 404 | Ga0207657_10127236 | 3300025919 | Bacteria | 2091 |
| 405 | Ga0207657_10180131 | 3300025919 | Bacteria | 1708 |
| 406 | Ga0207649_10008729 | 3300025920 | Bacteria | 5533 |
| 407 | Ga0207649_10236070 | 3300025920 | Bacteria | 1310 |
| 408 | Ga0207649_10258133 | 3300025920 | Bacteria | 1258 |
| 409 | Ga0207652_10109912 | 3300025921 | Bacteria | 2444 |
| 410 | Ga0207652_10113575 | 3300025921 | Bacteria | 2404 |
| 411 | Ga0207652_10391066 | 3300025921 | Bacteria | 1255 |
| 412 | Ga0207681_10008085 | 3300025923 | Bacteria | 6436 |
| 413 | Ga0207681_10035662 | 3300025923 | Bacteria | 3279 |
| 414 | Ga0207681_10107093 | 3300025923 | Bacteria | 2027 |
| 415 | Ga0207681_10169527 | 3300025923 | Bacteria | 1654 |
| 416 | Ga0207694_10023492 | 3300025924 | Bacteria | 4681 |
| 417 | Ga0207694_10086104 | 3300025924 | Bacteria | 2474 |
| 418 | Ga0207650_10007537 | 3300025925 | Bacteria | 7419 |
| 419 | Ga0207650_10025926 | 3300025925 | Bacteria | 4179 |
| 420 | Ga0207650_10268444 | 3300025925 | Bacteria | 1386 |
| 421 | Ga0207659_10135529 | 3300025926 | Bacteria | 1905 |
| 422 | Ga0207659_10671534 | 3300025926 | Bacteria | 886 |
| 423 | Ga0207700_10041129 | 3300025928 | Bacteria | 3380 |
| 424 | Ga0207700_10126700 | 3300025928 | Bacteria | 2078 |
| 425 | Ga0207700_10645159 | 3300025928 | Bacteria | 944 |
| 426 | Ga0207664_10184680 | 3300025929 | Bacteria | 1792 |
| 427 | Ga0207644_10690734 | 3300025931 | Bacteria | 851 |
| 428 | Ga0207690_10034354 | 3300025932 | Bacteria | 3267 |
| 429 | Ga0207690_10182489 | 3300025932 | Bacteria | 1581 |
| 430 | Ga0207690_10186348 | 3300025932 | Bacteria | 1566 |
| 431 | Ga0207706_10007686 | 3300025933 | Bacteria | 9955 |
| 432 | Ga0207706_10014123 | 3300025933 | Bacteria | 7241 |
| 433 | Ga0207706_10028739 | 3300025933 | Bacteria | 4963 |
| 434 | Ga0207706_10133769 | 3300025933 | Bacteria | 2181 |
| 435 | Ga0207706_10262103 | 3300025933 | Bacteria | 1509 |
| 436 | Ga0207706_10271376 | 3300025933 | Bacteria | 1480 |
| 437 | Ga0207709_10028625 | 3300025935 | Bacteria | 3223 |
| 438 | Ga0207709_10122222 | 3300025935 | Bacteria | 1760 |
| 439 | Ga0207709_10148893 | 3300025935 | Bacteria | 1619 |
| 440 | Ga0207670_10042397 | 3300025936 | Bacteria | 2998 |
| 441 | Ga0207670_10412984 | 3300025936 | Bacteria | 1081 |
| 442 | Ga0207669_10115992 | 3300025937 | Bacteria | 1806 |
| 443 | Ga0207669_10353634 | 3300025937 | Bacteria | 1136 |
| 444 | Ga0207704_10228037 | 3300025938 | Bacteria | 1383 |
| 445 | Ga0207704_10263159 | 3300025938 | Unclassified | 1301 |
| 446 | Ga0207704_10635147 | 3300025938 | Bacteria | 878 |
| 447 | Ga0207691_10002205 | 3300025940 | Bacteria | 19054 |
| 448 | Ga0207691_10089428 | 3300025940 | Bacteria | 2761 |
| 449 | Ga0207691_10103003 | 3300025940 | Bacteria | 2546 |
| 450 | Ga0207691_10163804 | 3300025940 | Bacteria | 1949 |
| 451 | Ga0207711_10000003 | 3300025941 | Bacteria | 1042791 |
| 452 | Ga0207711_10000005 | 3300025941 | Bacteria | 822972 |
| 453 | Ga0207711_10000009 | 3300025941 | Bacteria | 580864 |
| 454 | Ga0207711_10428611 | 3300025941 | Bacteria | 1230 |
| 455 | Ga0207711_10433359 | 3300025941 | Bacteria | 1223 |
| 456 | Ga0207689_10056790 | 3300025942 | Bacteria | 3221 |
| 457 | Ga0207661_10465314 | 3300025944 | Bacteria | 1153 |
| 458 | Ga0207679_10038500 | 3300025945 | Bacteria | 3407 |
| 459 | Ga0207679_10052918 | 3300025945 | Bacteria | 2980 |
| 460 | Ga0207679_10063654 | 3300025945 | Bacteria | 2754 |
| 461 | Ga0207679_10144987 | 3300025945 | Bacteria | 1925 |
| 462 | Ga0207679_10189046 | 3300025945 | Bacteria | 1710 |
| 463 | Ga0207679_10244084 | 3300025945 | Bacteria | 1523 |
| 464 | Ga0207679_10304856 | 3300025945 | Bacteria | 1374 |
| 465 | Ga0207679_10477804 | 3300025945 | Bacteria | 1109 |
| 466 | Ga0207667_10023210 | 3300025949 | Bacteria | 6832 |
| 467 | Ga0207667_10159938 | 3300025949 | Bacteria | 2317 |
| 468 | Ga0207667_10202131 | 3300025949 | Bacteria | 2038 |
| 469 | Ga0207667_10387452 | 3300025949 | Bacteria | 1424 |
| 470 | Ga0207651_10407723 | 3300025960 | Bacteria | 1157 |
| 471 | Ga0207712_10019384 | 3300025961 | Bacteria | 4442 |
| 472 | Ga0207712_10254036 | 3300025961 | Bacteria | 1422 |
| 473 | Ga0207712_10345750 | 3300025961 | Bacteria | 1235 |
| 474 | Ga0207668_10073093 | 3300025972 | Bacteria | 2456 |
| 475 | Ga0207668_10095091 | 3300025972 | Bacteria | 2199 |
| 476 | Ga0207668_10271288 | 3300025972 | Bacteria | 1387 |
| 477 | Ga0207640_10077899 | 3300025981 | Bacteria | 2255 |
| 478 | Ga0207640_10238338 | 3300025981 | Bacteria | 1404 |
| 479 | Ga0207640_10639528 | 3300025981 | Bacteria | 905 |
| 480 | Ga0207677_10268969 | 3300026023 | Bacteria | 1393 |
| 481 | Ga0207703_10192184 | 3300026035 | Bacteria | 1809 |
| 482 | Ga0207703_10656418 | 3300026035 | Bacteria | 995 |
| 483 | Ga0207639_10070740 | 3300026041 | Bacteria | 2726 |
| 484 | Ga0207639_10098738 | 3300026041 | Bacteria | 2354 |
| 485 | Ga0207639_10104036 | 3300026041 | Bacteria | 2301 |
| 486 | Ga0207639_10192759 | 3300026041 | Bacteria | 1742 |
| 487 | Ga0207639_10261580 | 3300026041 | Bacteria | 1514 |
| 488 | Ga0207639_10378085 | 3300026041 | Bacteria | 1271 |
| 489 | Ga0207639_10570133 | 3300026041 | Bacteria | 1041 |
| 490 | Ga0207678_10017130 | 3300026067 | Bacteria | 6362 |
| 491 | Ga0207678_10084461 | 3300026067 | Bacteria | 2715 |
| 492 | Ga0207678_10094504 | 3300026067 | Bacteria | 2554 |
| 493 | Ga0207678_10442451 | 3300026067 | Bacteria | 1129 |
| 494 | Ga0207708_10004234 | 3300026075 | Bacteria | 10566 |
| 495 | Ga0207708_10011842 | 3300026075 | Bacteria | 6494 |
| 496 | Ga0207708_10118713 | 3300026075 | Bacteria | 2060 |
| 497 | Ga0207708_10351510 | 3300026075 | Bacteria | 1209 |
| 498 | Ga0207702_10041088 | 3300026078 | Bacteria | 3877 |
| 499 | Ga0207702_10061501 | 3300026078 | Bacteria | 3203 |
| 500 | Ga0207702_10119602 | 3300026078 | Bacteria | 2355 |
| 501 | Ga0207702_10288566 | 3300026078 | Bacteria | 1554 |
| 502 | Ga0207702_10697731 | 3300026078 | Bacteria | 1000 |
| 503 | Ga0207641_10409386 | 3300026088 | Bacteria | 1304 |
| 504 | Ga0207648_10005468 | 3300026089 | Bacteria | 12798 |
| 505 | Ga0207648_10023947 | 3300026089 | Bacteria | 5457 |
| 506 | Ga0207648_10031830 | 3300026089 | Bacteria | 4661 |
| 507 | Ga0207648_10174981 | 3300026089 | Bacteria | 1898 |
| 508 | Ga0207676_10209472 | 3300026095 | Bacteria | 1728 |
| 509 | Ga0207676_10542282 | 3300026095 | Bacteria | 1110 |
| 510 | Ga0207674_10032125 | 3300026116 | Bacteria | 5507 |
| 511 | Ga0207674_10131097 | 3300026116 | Bacteria | 2470 |
| 512 | Ga0207674_10165816 | 3300026116 | Bacteria | 2163 |
| 513 | Ga0207675_100017878 | 3300026118 | Bacteria | 6612 |
| 514 | Ga0207675_100018667 | 3300026118 | Bacteria | 6473 |
| 515 | Ga0207675_100104780 | 3300026118 | Bacteria | 2666 |
| 516 | Ga0207675_100205047 | 3300026118 | Bacteria | 1895 |
| 517 | Ga0207675_100222055 | 3300026118 | Bacteria | 1821 |
| 518 | Ga0207683_10008639 | 3300026121 | Bacteria | 8708 |
| 519 | Ga0207683_10240326 | 3300026121 | Bacteria | 1652 |
| 520 | Ga0207683_10330990 | 3300026121 | Bacteria | 1396 |
| 521 | Ga0207698_10068167 | 3300026142 | Bacteria | 2808 |
| 522 | Ga0207698_10426081 | 3300026142 | Bacteria | 1274 |
| 523 | Ga0209971_1021207 | 3300027682 | Bacteria | 1545 |
| 524 | Ga0209998_10011871 | 3300027717 | Bacteria | 1808 |
| 525 | Ga0209813_10044478 | 3300027866 | Bacteria | 1364 |
| 526 | Ga0209974_10018046 | 3300027876 | Unclassified | 2339 |
| 527 | Ga0207428_10000114 | 3300027907 | Bacteria | 109533 |
| 528 | Ga0207428_10000780 | 3300027907 | Bacteria | 36098 |
| 529 | Ga0207428_10063883 | 3300027907 | Bacteria | 2907 |
| 530 | Ga0207428_10097457 | 3300027907 | Bacteria | 2276 |
| 531 | Ga0207428_10148445 | 3300027907 | Bacteria | 1786 |
| 532 | Ga0268266_10094215 | 3300028379 | Bacteria | 2628 |
| 533 | Ga0268266_10478468 | 3300028379 | Bacteria | 1187 |
| 534 | Ga0268266_11255547 | 3300028379 | Bacteria | 716 |
| 535 | Ga0268265_10379727 | 3300028380 | Bacteria | 1299 |
| 536 | Ga0268264_10181628 | 3300028381 | Bacteria | 1911 |
| 537 | Ga0268264_10381276 | 3300028381 | Bacteria | 1350 |
| 538 | Ga0265334_10098446 | 3300028573 | Bacteria | 1061 |
| 539 | Ga0265318_10001593 | 3300028577 | Bacteria | 13116 |
| 540 | Ga0265318_10035734 | 3300028577 | Bacteria | 1909 |
| 541 | Ga0265338_10018968 | 3300028800 | Bacteria | 7332 |
| 542 | Ga0265330_10113796 | 3300031235 | Bacteria | 1154 |
| 543 | Ga0265330_10135036 | 3300031235 | Bacteria | 1049 |
| 544 | Ga0265330_10148206 | 3300031235 | Bacteria | 997 |
| 545 | Ga0265332_10053204 | 3300031238 | Bacteria | 1738 |
| 546 | Ga0265325_10010515 | 3300031241 | Bacteria | 5354 |
| 547 | Ga0265329_10015828 | 3300031242 | Bacteria | 2627 |
| 548 | Ga0265340_10028355 | 3300031247 | Bacteria | 2817 |
| 549 | Ga0265340_10040744 | 3300031247 | Bacteria | 2286 |
| 550 | Ga0265340_10121949 | 3300031247 | Bacteria | 1199 |
| 551 | Ga0265340_10185624 | 3300031247 | Bacteria | 939 |
| 552 | Ga0265339_10001731 | 3300031249 | Bacteria | 16078 |
| 553 | Ga0265339_10005432 | 3300031249 | Bacteria | 8490 |
| 554 | Ga0265339_10093009 | 3300031249 | Bacteria | 1578 |
| 555 | Ga0265331_10031059 | 3300031250 | Bacteria | 2656 |
| 556 | Ga0265331_10060020 | 3300031250 | Bacteria | 1798 |
| 557 | Ga0265316_10049879 | 3300031344 | Bacteria | 3295 |
| 558 | Ga0265316_10333879 | 3300031344 | Bacteria | 1099 |
| 559 | Ga0265316_10356950 | 3300031344 | Bacteria | 1057 |
| 560 | Ga0307513_10336724 | 3300031456 | Bacteria | 1261 |
| 561 | Ga0265313_10000044 | 3300031595 | Bacteria | 117063 |
| 562 | Ga0265313_10022625 | 3300031595 | Bacteria | 3404 |
| 563 | Ga0316579_10121039 | 3300031691 | Bacteria | 1258 |
| 564 | Ga0265314_10045569 | 3300031711 | Bacteria | 3100 |
| 565 | Ga0265314_10094791 | 3300031711 | Bacteria | 1934 |
| 566 | Ga0265314_10101375 | 3300031711 | Bacteria | 1850 |
| 567 | Ga0265314_10209167 | 3300031711 | Bacteria | 1147 |
| 568 | Ga0265342_10181895 | 3300031712 | Bacteria | 1151 |
| 569 | Ga0265342_10283987 | 3300031712 | Bacteria | 875 |
| 570 | Ga0307516_10337816 | 3300031730 | Bacteria | 1174 |
| 571 | Ga0307412_10355513 | 3300031911 | Bacteria | 1178 |
| 572 | Ga0307409_100313677 | 3300031995 | Bacteria | 1465 |
| 573 | Ga0307414_10058182 | 3300032004 | Bacteria | 2722 |
| 574 | Ga0307414_10148159 | 3300032004 | Bacteria | 1847 |
| 575 | Ga0307414_10154126 | 3300032004 | Unclassified | 1816 |
| 576 | Ga0307414_10578982 | 3300032004 | Bacteria | 1004 |
| 577 | Ga0373930_0001543 | 3300034816 | Bacteria | 3450 |
| 578 | Ga0373930_0037291 | 3300034816 | Bacteria | 1023 |
| 579 | Ga0373948_0026647 | 3300034817 | Bacteria | 1140 |
| 580 | Ga0373950_0001403 | 3300034818 | Bacteria | 3135 |
| 581 | Ga0373958_0000619 | 3300034819 | Bacteria | 4431 |
| 582 | Ga0373958_0025252 | 3300034819 | Bacteria | 1130 |
| 583 | Ga0373959_0001495 | 3300034820 | Bacteria | 3739 |
| 584 | Ga0373938_0005414 | 3300034957 | Bacteria | 2168 |
| 585 | Ga0373928_0001492 | 3300035084 | Bacteria | 4550 |
| 586 | Ga0373928_0043024 | 3300035084 | Bacteria | 1044 |
| 587 | Ga0373929_0003088 | 3300035085 | Bacteria | 3027 |
| 588 | Ga0373940_0015579 | 3300035088 | Bacteria | 1872 |
| 589 | Ga0373949_0004253 | 3300035090 | Bacteria | 3298 |
| 590 | Ga0373949_0096340 | 3300035090 | Bacteria | 806 |
| 591 | Ga0373952_0003160 | 3300035092 | Bacteria | 2965 |
| 592 | Ga0373923_0120013 | 3300035111 | Bacteria | 1174 |
| 593 | Ga0373932_0008968 | 3300035112 | Bacteria | 2398 |
| 594 | Ga0373936_0069945 | 3300035113 | Bacteria | 1445 |
| 595 | Ga0373939_0000722 | 3300035114 | Bacteria | 8181 |
| 596 | Ga0373939_0210915 | 3300035114 | Bacteria | 739 |
| 597 | Ga0373941_0002372 | 3300035115 | Bacteria | 4136 |
| 598 | Ga0373945_0003731 | 3300035116 | Bacteria | 4802 |
| 599 | Ga0373953_0122910 | 3300035117 | Bacteria | 1103 |
| 600 | Ga0373956_0017190 | 3300035119 | Bacteria | 3047 |
| 601 | Ga0373957_0070795 | 3300035120 | Bacteria | 1364 |
| 602 | Ga0373960_0010670 | 3300035121 | Bacteria | 2248 |
| 603 | Ga0373943_0052522 | 3300035170 | Bacteria | 2009 |
| 604 | Ga0373943_0160975 | 3300035170 | Bacteria | 1222 |
| 605 | Ga0373946_0011244 | 3300035171 | Bacteria | 3334 |
| 606 | Ga0373946_0193624 | 3300035171 | Bacteria | 971 |
| 607 | Ga0373955_0109805 | 3300035172 | Bacteria | 1594 |
| 608 | Ga0373942_0001603 | 3300035207 | Bacteria | 5788 |
| 609 | Ga0373961_0008986 | 3300035241 | Bacteria | 2437 |
| 610 | Ga0373962_0001346 | 3300035242 | Bacteria | 5795 |
| 611 | Ga0373962_0125778 | 3300035242 | Bacteria | 821 |
| 612 | Ga0373931_0010237 | 3300035691 | Bacteria | 4504 |
| 613 | Ga0373931_0017812 | 3300035691 | Bacteria | 3520 |
| 614 | Ga0373931_0081951 | 3300035691 | Bacteria | 1782 |
| 615 | Ga0373931_0165434 | 3300035691 | Bacteria | 1299 |
| 616 | Ga0373935_0022191 | 3300035692 | Bacteria | 3890 |
| 617 | Ga0373927_0054968 | 3300035695 | Bacteria | 2575 |
| 618 | Ga0373927_0158928 | 3300035695 | Bacteria | 1480 |
| 619 | Ga0373947_0006153 | 3300035725 | Bacteria | 6979 |
| 620 | Ga0373947_0023121 | 3300035725 | Bacteria | 3613 |
| 621 | Ga0373947_0073637 | 3300035725 | Bacteria | 2099 |
| 622 | Ga0373937_0027365 | 3300036401 | Bacteria | 5155 |
| 623 | Ga0373925_0004747 | 3300037068 | Bacteria | 10245 |
| 624 | Ga0373925_0098904 | 3300037068 | Bacteria | 2240 |
| 625 | Ga0373925_0110753 | 3300037068 | Bacteria | 2120 |
| 626 | Ga0395899_0000137 | 3300037312 | Bacteria | 111924 |
| 627 | Ga0395899_0037204 | 3300037312 | Bacteria | 3649 |
| 628 | Ga0395899_0259027 | 3300037312 | Bacteria | 1190 |
| 629 | Ga0395900_0000108 | 3300037418 | Bacteria | 147706 |
| 630 | Ga0395900_0025260 | 3300037418 | Bacteria | 6081 |
| 631 | Ga0395898_0027497 | 3300037466 | Bacteria | 5708 |
| 632 | Ga0395898_0349692 | 3300037466 | Bacteria | 1409 |
| 633 | Ga0395898_0833597 | 3300037466 | Unclassified | 862 |
| 634 | Ga0395905_0009347 | 3300037471 | Bacteria | 9585 |
| 635 | Ga0395905_0868756 | 3300037471 | Bacteria | 805 |
| 636 | Ga0395901_0000050 | 3300038443 | Bacteria | 171046 |
| 637 | Ga0395901_0009335 | 3300038443 | Bacteria | 9945 |
| 638 | Ga0395901_0159813 | 3300038443 | Bacteria | 2366 |
| 639 | Ga0436365_0018302 | 3300039437 | Bacteria | 5178 |
| 640 | Ga0436361_1124544 | 3300039447 | Bacteria | 3019 |
| 641 | Ga0436363_1605866 | 3300039450 | Bacteria | 5589 |
| 642 | Ga0439453_0014235 | 3300041408 | Bacteria | 1361 |
| 643 | Ga0439465_0020859 | 3300041413 | Bacteria | 2054 |
| 644 | Ga0439465_0226623 | 3300041413 | Bacteria | 686 |
| 645 | Ga0451806_251659 | 3300041462 | Unclassified | 742 |
| 646 | Ga0451833_1389376 | 3300041491 | Bacteria | 721 |
| 647 | Ga0451853_1492139 | 3300041512 | Bacteria | 1057 |
| 648 | Ga0439443_006364 | 3300042003 | Bacteria | 1614 |
| 649 | Ga0439448_0015604 | 3300042005 | Bacteria | 2302 |
| 650 | Ga0439432_042708 | 3300042006 | Bacteria | 1433 |
| 651 | Ga0439460_0010702 | 3300042461 | Bacteria | 2355 |
| 652 | Ga0453684_0218063 | 3300044712 | Bacteria | 2212 |
| 653 | Ga0453684_0569639 | 3300044712 | Bacteria | 1245 |
| 654 | Ga0451576_0752684 | 3300045051 | Bacteria | 1023 |
| 655 | Ga0466967_0109578 | 3300045976 | Bacteria | 2535 |
| 656 | Ga0495627_062755 | 3300046453 | Bacteria | 1097 |
| 657 | Ga0495592_0076095 | 3300046454 | Bacteria | 2436 |
| 658 | Ga0495590_0043265 | 3300046457 | Bacteria | 1571 |
| 659 | Ga0495629_0000401 | 3300046459 | Bacteria | 36430 |
| 660 | Ga0495629_0090408 | 3300046459 | Bacteria | 2136 |
| 661 | Ga0495629_0207070 | 3300046459 | Unclassified | 1355 |
| 662 | Ga0495638_0096360 | 3300046460 | Bacteria | 1776 |
| 663 | Ga0495641_0004844 | 3300046461 | Bacteria | 9352 |
| 664 | Ga0495641_0029113 | 3300046461 | Bacteria | 2663 |
| 665 | Ga0495651_0281516 | 3300046462 | Bacteria | 1123 |
| 666 | Ga0495582_0361348 | 3300046473 | Bacteria | 836 |
| 667 | Ga0495639_0056203 | 3300046475 | Bacteria | 1796 |
| 668 | Ga0495639_0064197 | 3300046475 | Bacteria | 1687 |
| 669 | Ga0495584_0031341 | 3300046491 | Bacteria | 2692 |
| 670 | Ga0495584_0185278 | 3300046491 | Bacteria | 1058 |
| 671 | Ga0495584_0333579 | 3300046491 | Bacteria | 770 |
| 672 | Ga0495585_0082050 | 3300046492 | Bacteria | 1746 |
| 673 | Ga0495594_0026038 | 3300046499 | Bacteria | 3145 |
| 674 | Ga0495608_0077938 | 3300046511 | Bacteria | 2157 |
| 675 | Ga0495618_0071945 | 3300046514 | Bacteria | 2200 |
| 676 | Ga0495628_0024458 | 3300046516 | Bacteria | 4944 |
| 677 | Ga0495628_0575487 | 3300046516 | Bacteria | 807 |
| 678 | Ga0495630_0423142 | 3300046517 | Bacteria | 1020 |
| 679 | Ga0495663_0129901 | 3300046525 | Bacteria | 849 |
| 680 | Ga0495666_0010453 | 3300046526 | Bacteria | 4627 |
| 681 | Ga0495652_0058677 | 3300046529 | Bacteria | 3258 |
| 682 | Ga0495665_0028390 | 3300046531 | Bacteria | 3000 |
| 683 | Ga0495665_0043243 | 3300046531 | Bacteria | 2396 |
| 684 | Ga0495665_0092618 | 3300046531 | Bacteria | 1588 |
| 685 | Ga0495665_0113151 | 3300046531 | Bacteria | 1423 |
| 686 | Ga0495640_0040573 | 3300046533 | Bacteria | 3259 |
| 687 | Ga0495587_0226065 | 3300046536 | Bacteria | 1055 |
| 688 | Ga0495598_0009195 | 3300046537 | Bacteria | 2328 |
| 689 | Ga0495598_0058399 | 3300046537 | Bacteria | 1183 |
| 690 | Ga0495633_0127269 | 3300046558 | Bacteria | 1179 |
| 691 | Ga0495656_0396620 | 3300046615 | Bacteria | 721 |
| 692 | Ga0495634_0048969 | 3300046642 | Bacteria | 2843 |
| 693 | Ga0495635_0008556 | 3300046663 | Bacteria | 7146 |
| 694 | Ga0495659_0054852 | 3300046664 | Bacteria | 1459 |
| 695 | Ga0495647_0008543 | 3300046681 | Bacteria | 3445 |
| 696 | Ga0495658_0000265 | 3300046683 | Bacteria | 29770 |
| 697 | Ga0495658_0022039 | 3300046683 | Bacteria | 3365 |
| 698 | Ga0495613_0021477 | 3300046689 | Bacteria | 4811 |
| 699 | Ga0495613_0058664 | 3300046689 | Bacteria | 2824 |
| 700 | Ga0495613_0154209 | 3300046689 | Bacteria | 1637 |
| 701 | Ga0495624_0235925 | 3300046690 | Bacteria | 1107 |
| 702 | Ga0495670_0172382 | 3300046691 | Bacteria | 1140 |
| 703 | Ga0495600_0145298 | 3300046809 | Unclassified | 1537 |
| 704 | Ga0495660_0129760 | 3300046810 | Bacteria | 1266 |
| 705 | Ga0495581_0082802 | 3300047315 | Bacteria | 1859 |
| 706 | Ga0495581_0281187 | 3300047315 | Bacteria | 973 |
| 707 | Ga0495604_0128590 | 3300047317 | Bacteria | 1823 |
| 708 | Ga0495604_0240520 | 3300047317 | Bacteria | 1238 |
| 709 | Ga0495674_0029493 | 3300047319 | Bacteria | 4995 |
| 710 | Ga0495674_0029987 | 3300047319 | Bacteria | 4949 |
| 711 | Ga0495676_0028968 | 3300047321 | Bacteria | 4720 |
| 712 | Ga0495676_0134654 | 3300047321 | Unclassified | 1779 |
| 713 | Ga0495680_0006959 | 3300047322 | Bacteria | 10435 |
| 714 | Ga0495681_0168428 | 3300047470 | Bacteria | 908 |
| 715 | Ga0495593_0003423 | 3300047673 | Bacteria | 9494 |
| 716 | Ga0495593_0130270 | 3300047673 | Unclassified | 1277 |
| 717 | Ga0495602_0451316 | 3300048088 | Unclassified | 907 |
| 718 | Ga0495626_0156478 | 3300048091 | Bacteria | 958 |
| 719 | Ga0496100_0037305 | 3300048903 | Bacteria | 3072 |
| 720 | Ga0496100_0349203 | 3300048903 | Bacteria | 1117 |
| 721 | Ga0496101_0038579 | 3300048904 | Bacteria | 3393 |
| 722 | Ga0496101_0044812 | 3300048904 | Bacteria | 3166 |
| 723 | Ga0496101_0874488 | 3300048904 | Bacteria | 708 |
| 724 | Ga0496102_0017500 | 3300048905 | Bacteria | 6277 |
| 725 | Ga0496102_0050186 | 3300048905 | Bacteria | 3798 |
| 726 | Ga0496102_0201396 | 3300048905 | Bacteria | 1877 |
| 727 | Ga0496102_0635764 | 3300048905 | Bacteria | 990 |
| 728 | Ga0496103_0004512 | 3300048906 | Bacteria | 8436 |
| 729 | Ga0496103_0471671 | 3300048906 | Bacteria | 804 |
| 730 | Ga0496104_0011639 | 3300048907 | Bacteria | 7885 |
| 731 | Ga0496104_0090470 | 3300048907 | Bacteria | 2924 |
| 732 | Ga0496104_0121789 | 3300048907 | Bacteria | 2505 |
| 733 | Ga0496104_0136526 | 3300048907 | Bacteria | 2356 |
| 734 | Ga0496104_0701418 | 3300048907 | Bacteria | 920 |
| 735 | Ga0496105_0004355 | 3300048908 | Bacteria | 10660 |
| 736 | Ga0496105_0038287 | 3300048908 | Bacteria | 3950 |
| 737 | Ga0496105_0154880 | 3300048908 | Bacteria | 1882 |
| 738 | Ga0496106_0044848 | 3300048909 | Bacteria | 3320 |
| 739 | Ga0496106_0046732 | 3300048909 | Bacteria | 3256 |
| 740 | Ga0496106_0083540 | 3300048909 | Bacteria | 2456 |
| 741 | Ga0496106_0119348 | 3300048909 | Bacteria | 2060 |
| 742 | Ga0496106_0227089 | 3300048909 | Bacteria | 1490 |
| 743 | Ga0496107_0013051 | 3300048910 | Bacteria | 5804 |
| 744 | Ga0496107_0040423 | 3300048910 | Bacteria | 3347 |
| 745 | Ga0496107_0145923 | 3300048910 | Bacteria | 1750 |
| 746 | Ga0496107_0440364 | 3300048910 | Bacteria | 968 |
| 747 | Ga0496108_0000500 | 3300048911 | Bacteria | 31075 |
| 748 | Ga0496108_0058071 | 3300048911 | Bacteria | 3251 |
| 749 | Ga0496108_0139528 | 3300048911 | Bacteria | 2088 |
| 750 | Ga0496109_0000423 | 3300048912 | Bacteria | 37167 |
| 751 | Ga0496109_0008666 | 3300048912 | Bacteria | 8656 |
| 752 | Ga0496109_0043699 | 3300048912 | Bacteria | 4062 |
| 753 | Ga0496109_0878775 | 3300048912 | Bacteria | 834 |
| 754 | Ga0496110_0179448 | 3300048913 | Bacteria | 1922 |
| 755 | Ga0496110_0247311 | 3300048913 | Bacteria | 1623 |
| 756 | Ga0496110_0320106 | 3300048913 | Bacteria | 1413 |
| 757 | Ga0496111_0013636 | 3300048914 | Bacteria | 5536 |
| 758 | Ga0496111_0022126 | 3300048914 | Bacteria | 4447 |
| 759 | Ga0496111_0613257 | 3300048914 | Bacteria | 796 |
| 760 | Ga0496112_0161341 | 3300048915 | Bacteria | 2208 |
| 761 | Ga0496112_0166700 | 3300048915 | Bacteria | 2169 |
| 762 | Ga0496112_0365926 | 3300048915 | Bacteria | 1383 |
| 763 | Ga0496112_0456718 | 3300048915 | Bacteria | 1215 |
| 764 | Ga0496113_0002838 | 3300048916 | Bacteria | 10187 |
| 765 | Ga0496114_0201432 | 3300048917 | Bacteria | 1743 |
| 766 | Ga0496115_0058628 | 3300048918 | Bacteria | 3098 |
| 767 | Ga0496115_0074139 | 3300048918 | Bacteria | 2763 |
| 768 | Ga0496115_0152663 | 3300048918 | Bacteria | 1907 |
| 769 | Ga0496115_0173322 | 3300048918 | Bacteria | 1784 |
| 770 | Ga0496117_0018920 | 3300048920 | Bacteria | 5681 |
| 771 | Ga0496118_0009347 | 3300048921 | Bacteria | 9930 |
| 772 | Ga0496119_0181649 | 3300048922 | Bacteria | 1103 |
| 773 | Ga0496120_0190083 | 3300048923 | Bacteria | 1002 |
| 774 | Ga0496121_0091592 | 3300048924 | Bacteria | 2373 |
| 775 | Ga0496122_0009621 | 3300048925 | Bacteria | 10124 |
| 776 | Ga0496123_0011580 | 3300048926 | Bacteria | 7626 |
| 777 | Ga0496124_0239028 | 3300048927 | Bacteria | 1352 |
| 778 | Ga0501031_0019928 | 3300049568 | Bacteria | 4372 |
| 779 | Ga0501031_0079720 | 3300049568 | Bacteria | 2134 |
| 780 | Ga0501031_0285194 | 3300049568 | Bacteria | 1071 |
| 781 | Ga0501032_0003009 | 3300049569 | Bacteria | 13080 |
| 782 | Ga0501032_0035806 | 3300049569 | Bacteria | 3391 |
| 783 | Ga0501032_0063717 | 3300049569 | Bacteria | 2468 |
| 784 | Ga0501032_0177881 | 3300049569 | Bacteria | 1394 |
| 785 | Ga0501032_0280731 | 3300049569 | Bacteria | 1078 |
| 786 | Ga0501033_0012065 | 3300049570 | Bacteria | 6595 |
| 787 | Ga0501033_0013087 | 3300049570 | Bacteria | 6323 |
| 788 | Ga0501034_0006092 | 3300049571 | Bacteria | 13017 |
| 789 | Ga0501034_0016923 | 3300049571 | Bacteria | 7475 |
| 790 | Ga0501034_0023919 | 3300049571 | Bacteria | 6217 |
| 791 | Ga0501034_0032939 | 3300049571 | Bacteria | 5262 |
| 792 | Ga0501034_0180502 | 3300049571 | Bacteria | 2075 |
| 793 | Ga0501034_0843963 | 3300049571 | Bacteria | 807 |
| 794 | Ga0501036_0018194 | 3300049572 | Bacteria | 5884 |
| 795 | Ga0501036_0081797 | 3300049572 | Bacteria | 2729 |
| 796 | Ga0501036_0349591 | 3300049572 | Bacteria | 1234 |
| 797 | Ga0501036_0400644 | 3300049572 | Bacteria | 1145 |
| 798 | Ga0501036_0495736 | 3300049572 | Bacteria | 1016 |
| 799 | Ga0501037_0005542 | 3300049573 | Bacteria | 9210 |
| 800 | Ga0501037_0047366 | 3300049573 | Bacteria | 3150 |
| 801 | Ga0501037_0120258 | 3300049573 | Bacteria | 1889 |
| 802 | Ga0501037_0146057 | 3300049573 | Bacteria | 1692 |
| 803 | Ga0501037_0476039 | 3300049573 | Bacteria | 849 |
| 804 | Ga0501038_0008694 | 3300049574 | Bacteria | 9322 |
| 805 | Ga0501038_0050643 | 3300049574 | Bacteria | 3587 |
| 806 | Ga0501038_0055775 | 3300049574 | Bacteria | 3394 |
| 807 | Ga0501038_0099164 | 3300049574 | Bacteria | 2429 |
| 808 | Ga0501038_0101294 | 3300049574 | Bacteria | 2398 |
| 809 | Ga0501038_0124853 | 3300049574 | Bacteria | 2119 |
| 810 | Ga0501038_0141895 | 3300049574 | Bacteria | 1965 |
| 811 | Ga0501038_0341746 | 3300049574 | Bacteria | 1167 |
| 812 | Ga0501039_0039751 | 3300049575 | Bacteria | 3632 |
| 813 | Ga0501039_0099656 | 3300049575 | Bacteria | 2267 |
| 814 | Ga0501039_0206374 | 3300049575 | Bacteria | 1545 |
| 815 | Ga0501039_0220391 | 3300049575 | Bacteria | 1491 |
| 816 | Ga0501039_0234843 | 3300049575 | Bacteria | 1442 |
| 817 | Ga0501040_0026969 | 3300049576 | Bacteria | 3865 |
| 818 | Ga0501040_0037469 | 3300049576 | Bacteria | 3294 |
| 819 | Ga0501040_0315857 | 3300049576 | Bacteria | 1117 |
| 820 | Ga0501041_0013496 | 3300049577 | Bacteria | 4844 |
| 821 | Ga0501041_0156811 | 3300049577 | Bacteria | 1422 |
| 822 | Ga0501042_0104498 | 3300049578 | Bacteria | 2038 |
| 823 | Ga0501042_0108909 | 3300049578 | Bacteria | 1994 |
| 824 | Ga0501042_0196712 | 3300049578 | Bacteria | 1454 |
| 825 | Ga0501042_0469204 | 3300049578 | Bacteria | 913 |
| 826 | Ga0501043_0004706 | 3300049579 | Bacteria | 11062 |
| 827 | Ga0501043_0263384 | 3300049579 | Bacteria | 1325 |
| 828 | Ga0501043_0516445 | 3300049579 | Bacteria | 891 |
| 829 | Ga0501043_0548204 | 3300049579 | Bacteria | 859 |
| 830 | Ga0501046_0035794 | 3300049580 | Bacteria | 3999 |
| 831 | Ga0501046_0044288 | 3300049580 | Bacteria | 3539 |
| 832 | Ga0501046_0072386 | 3300049580 | Bacteria | 2676 |
| 833 | Ga0501046_0199710 | 3300049580 | Bacteria | 1488 |
| 834 | Ga0501046_0265638 | 3300049580 | Bacteria | 1260 |
| 835 | Ga0501046_0345800 | 3300049580 | Bacteria | 1080 |
| 836 | Ga0501047_0003479 | 3300049581 | Bacteria | 14883 |
| 837 | Ga0501047_0019070 | 3300049581 | Bacteria | 6581 |
| 838 | Ga0501047_0086573 | 3300049581 | Bacteria | 3011 |
| 839 | Ga0501047_0124435 | 3300049581 | Bacteria | 2459 |
| 840 | Ga0501047_0297701 | 3300049581 | Bacteria | 1456 |
| 841 | Ga0501048_0020276 | 3300049582 | Bacteria | 4872 |
| 842 | Ga0501048_0059739 | 3300049582 | Bacteria | 2702 |
| 843 | Ga0501048_0119077 | 3300049582 | Bacteria | 1866 |
| 844 | Ga0501048_0151176 | 3300049582 | Bacteria | 1642 |
| 845 | Ga0501048_0264719 | 3300049582 | Bacteria | 1221 |
| 846 | Ga0501067_0029425 | 3300049583 | Bacteria | 3044 |
| 847 | Ga0501067_0048871 | 3300049583 | Bacteria | 2345 |
| 848 | Ga0501067_0050746 | 3300049583 | Bacteria | 2299 |
| 849 | Ga0501068_0026592 | 3300049584 | Bacteria | 3411 |
| 850 | Ga0501068_0032227 | 3300049584 | Bacteria | 3116 |
| 851 | Ga0501068_0068477 | 3300049584 | Bacteria | 2163 |
| 852 | Ga0501068_0380693 | 3300049584 | Bacteria | 909 |
| 853 | Ga0501068_0511333 | 3300049584 | Bacteria | 779 |
| 854 | Ga0501069_0006105 | 3300049585 | Bacteria | 6286 |
| 855 | Ga0501069_0141393 | 3300049585 | Bacteria | 1381 |
| 856 | Ga0501069_0352814 | 3300049585 | Bacteria | 867 |
| 857 | Ga0501070_0011792 | 3300049586 | Bacteria | 7382 |
| 858 | Ga0501070_0055774 | 3300049586 | Bacteria | 3275 |
| 859 | Ga0501070_0089148 | 3300049586 | Bacteria | 2553 |
| 860 | Ga0501070_0368587 | 3300049586 | Bacteria | 1164 |
| 861 | Ga0501070_0815161 | 3300049586 | Bacteria | 732 |
| 862 | Ga0501071_0035441 | 3300049587 | Bacteria | 3554 |
| 863 | Ga0501071_0047919 | 3300049587 | Bacteria | 3071 |
| 864 | Ga0501071_0330625 | 3300049587 | Bacteria | 1158 |
| 865 | Ga0501071_0682165 | 3300049587 | Bacteria | 791 |
| 866 | Ga0501072_0011656 | 3300049588 | Bacteria | 6716 |
| 867 | Ga0501072_0026974 | 3300049588 | Bacteria | 4483 |
| 868 | Ga0501072_0033731 | 3300049588 | Bacteria | 4011 |
| 869 | Ga0501072_0068309 | 3300049588 | Bacteria | 2805 |
| 870 | Ga0501072_0755433 | 3300049588 | Bacteria | 763 |
| 871 | Ga0501072_0783561 | 3300049588 | Bacteria | 747 |
| 872 | Ga0501073_0002727 | 3300049589 | Bacteria | 13239 |
| 873 | Ga0501073_0163041 | 3300049589 | Bacteria | 1544 |
| 874 | Ga0501073_0481170 | 3300049589 | Bacteria | 858 |
| 875 | Ga0501074_0002406 | 3300049590 | Bacteria | 13051 |
| 876 | Ga0501074_0024213 | 3300049590 | Bacteria | 4412 |
| 877 | Ga0501074_0047670 | 3300049590 | Bacteria | 3096 |
| 878 | Ga0501074_0109856 | 3300049590 | Bacteria | 1973 |
| 879 | Ga0501074_0196429 | 3300049590 | Bacteria | 1438 |
| 880 | Ga0501074_0278837 | 3300049590 | Bacteria | 1188 |
| 881 | Ga0501075_0058224 | 3300049591 | Bacteria | 2910 |
| 882 | Ga0501075_0094095 | 3300049591 | Bacteria | 2274 |
| 883 | Ga0501075_0103669 | 3300049591 | Bacteria | 2162 |
| 884 | Ga0501075_0124727 | 3300049591 | Bacteria | 1960 |
| 885 | Ga0501075_0456607 | 3300049591 | Bacteria | 974 |
| 886 | Ga0501076_0048669 | 3300049592 | Bacteria | 3350 |
| 887 | Ga0501076_0099441 | 3300049592 | Bacteria | 2343 |
| 888 | Ga0501076_0214514 | 3300049592 | Bacteria | 1573 |
| 889 | Ga0501076_0240920 | 3300049592 | Bacteria | 1480 |
| 890 | Ga0501076_0273863 | 3300049592 | Bacteria | 1382 |
| 891 | Ga0501077_0026393 | 3300049593 | Bacteria | 3686 |
| 892 | Ga0501077_0038193 | 3300049593 | Bacteria | 3057 |
| 893 | Ga0501077_0043636 | 3300049593 | Bacteria | 2850 |
| 894 | Ga0501077_0060276 | 3300049593 | Bacteria | 2408 |
| 895 | Ga0501077_0132833 | 3300049593 | Bacteria | 1578 |
| 896 | Ga0501077_0366115 | 3300049593 | Bacteria | 920 |
| 897 | Ga0501079_0014707 | 3300049741 | Bacteria | 5964 |
| 898 | Ga0501079_0018315 | 3300049741 | Bacteria | 5352 |
| 899 | Ga0501079_0026067 | 3300049741 | Bacteria | 4483 |
| 900 | Ga0501079_0346649 | 3300049741 | Bacteria | 1163 |
| 901 | Ga0501079_0395447 | 3300049741 | Bacteria | 1084 |
| 902 | Ga0501079_0473176 | 3300049741 | Bacteria | 984 |
| 903 | Ga0501080_0002491 | 3300049742 | Bacteria | 16116 |
| 904 | Ga0501080_0034662 | 3300049742 | Bacteria | 4713 |
| 905 | Ga0501080_0047241 | 3300049742 | Bacteria | 4007 |
| 906 | Ga0501080_0133865 | 3300049742 | Bacteria | 2294 |
| 907 | Ga0501080_0254339 | 3300049742 | Bacteria | 1601 |
| 908 | Ga0501080_0302428 | 3300049742 | Bacteria | 1450 |
| 909 | Ga0501080_0350370 | 3300049742 | Bacteria | 1333 |
| 910 | Ga0501080_0492529 | 3300049742 | Bacteria | 1096 |
| 911 | Ga0501081_0023102 | 3300049743 | Bacteria | 4166 |
| 912 | Ga0501081_0032968 | 3300049743 | Bacteria | 3516 |
| 913 | Ga0501081_0154907 | 3300049743 | Bacteria | 1648 |
| 914 | Ga0501081_0218867 | 3300049743 | Bacteria | 1384 |
| 915 | Ga0501083_0061919 | 3300049744 | Bacteria | 2498 |
| 916 | Ga0501083_0066569 | 3300049744 | Bacteria | 2398 |
| 917 | Ga0501083_0148457 | 3300049744 | Bacteria | 1535 |
| 918 | Ga0501035_0002087 | 3300049822 | Bacteria | 19885 |
| 919 | Ga0501035_0066862 | 3300049822 | Bacteria | 3190 |
| 920 | Ga0501035_0150278 | 3300049822 | Bacteria | 2022 |
| 921 | Ga0501035_0207445 | 3300049822 | Bacteria | 1678 |
| 922 | Ga0501035_0330167 | 3300049822 | Bacteria | 1280 |
| 923 | Ga0501035_0787545 | 3300049822 | Bacteria | 760 |
| 924 | Ga0501044_0007150 | 3300049823 | Bacteria | 12278 |
| 925 | Ga0501044_0008252 | 3300049823 | Bacteria | 11423 |
| 926 | Ga0501044_0076517 | 3300049823 | Bacteria | 3396 |
| 927 | Ga0501044_0136143 | 3300049823 | Bacteria | 2447 |
| 928 | Ga0501044_0734229 | 3300049823 | Bacteria | 871 |
| 929 | Ga0501045_0067841 | 3300049824 | Bacteria | 2620 |
| 930 | Ga0501045_0129361 | 3300049824 | Bacteria | 1877 |
| 931 | Ga0501045_0144958 | 3300049824 | Bacteria | 1766 |
| 932 | Ga0501045_0245276 | 3300049824 | Bacteria | 1333 |
| 933 | Ga0501045_0267857 | 3300049824 | Bacteria | 1272 |
| 934 | Ga0501045_0347743 | 3300049824 | Bacteria | 1103 |
| 935 | Ga0501045_0355179 | 3300049824 | Bacteria | 1091 |
| 936 | nmdc:mga03683_6724_c1 | 3300050489 | Bacteria | 3954 |
| 937 | nmdc:mga03n38_14159_c2 | 3300050490 | Bacteria | 2591 |
| 938 | nmdc:mga03n38_99775_c1 | 3300050490 | Bacteria | 1399 |
| 939 | nmdc:mga00v17_123433_c1 | 3300050491 | Bacteria | 1651 |
| 940 | nmdc:mga00v17_202229_c1 | 3300050491 | Bacteria | 1284 |
| 941 | nmdc:mga0yw44_116719_c1 | 3300050492 | Bacteria | 1716 |
| 942 | nmdc:mga0yw44_5076_c1 | 3300050492 | Bacteria | 6151 |
| 943 | nmdc:mga0yw44_89212_c1 | 3300050492 | Bacteria | 1945 |
| 944 | nmdc:mga0k408_11813_c1 | 3300050493 | Bacteria | 4764 |
| 945 | nmdc:mga0k408_23023_c1 | 3300050493 | Bacteria | 3511 |
| 946 | nmdc:mga0k408_31378_c1 | 3300050493 | Bacteria | 3033 |
| 947 | nmdc:mga0k408_5302_c1 | 3300050493 | Bacteria | 6848 |
| 948 | nmdc:mga0k408_5967_c1 | 3300050493 | Bacteria | 6501 |
| 949 | nmdc:mga06z11_161522_c1 | 3300050494 | Bacteria | 1281 |
| 950 | nmdc:mga06z11_457316_c1 | 3300050494 | Bacteria | 772 |
| 951 | nmdc:mga06z11_69648_c1 | 3300050494 | Bacteria | 1858 |
| 952 | nmdc:mga07m45_12111_c1 | 3300050496 | Bacteria | 4552 |
| 953 | nmdc:mga07m45_231716_c1 | 3300050496 | Bacteria | 1075 |
| 954 | nmdc:mga07m45_63242_c1 | 3300050496 | Bacteria | 2099 |
| 955 | nmdc:mga07m45_93628_c1 | 3300050496 | Bacteria | 1722 |
| 956 | nmdc:mga05p37_19716_c1 | 3300050507 | Bacteria | 8159 |
| 957 | nmdc:mga05p37_2557_c2 | 3300050507 | Bacteria | 17706 |
| 958 | nmdc:mga05p37_54453_c1 | 3300050507 | Bacteria | 3437 |
| 959 | nmdc:mga05p37_56_c3 | 3300050507 | Bacteria | 77819 |
| 960 | nmdc:mga09592_976_c1 | 3300050508 | Bacteria | 22595 |
| 961 | nmdc:mga0qj67_52793_c1 | 3300050509 | Bacteria | 3218 |
| 962 | nmdc:mga06r32_268462_c1 | 3300050510 | Bacteria | 1693 |
| 963 | nmdc:mga06r32_806_c1 | 3300050510 | Bacteria | 27804 |
| 964 | nmdc:mga08y16_141077_c1 | 3300050511 | Bacteria | 2505 |
| 965 | nmdc:mga08y16_206_c1 | 3300050511 | Bacteria | 46039 |
| 966 | nmdc:mga08y16_22406_c1 | 3300050511 | Bacteria | 6668 |
| 967 | nmdc:mga08y16_236347_c1 | 3300050511 | Bacteria | 1889 |
| 968 | nmdc:mga08y16_31639_c1 | 3300050511 | Bacteria | 5564 |
| 969 | nmdc:mga08y16_465793_c1 | 3300050511 | Bacteria | 1287 |
| 970 | nmdc:mga0n895_12772_c1 | 3300050512 | Bacteria | 7542 |
| 971 | nmdc:mga0n895_202634_c1 | 3300050512 | Bacteria | 2015 |
| 972 | nmdc:mga0n895_45294_c1 | 3300050512 | Bacteria | 4292 |
| 973 | nmdc:mga0n895_57984_c1 | 3300050512 | Bacteria | 3818 |
| 974 | nmdc:mga0rr50_316396_c1 | 3300050513 | Bacteria | 1308 |
| 975 | nmdc:mga0a205_19489_c1 | 3300050515 | Bacteria | 6396 |
| 976 | nmdc:mga0a205_80_c1 | 3300050515 | Bacteria | 53083 |
| 977 | nmdc:mga0a205_82248_c1 | 3300050515 | Bacteria | 3110 |
| 978 | nmdc:mga0a205_89699_c2 | 3300050515 | Bacteria | 2415 |
| 979 | nmdc:mga0sz30_116538_c1 | 3300050516 | Bacteria | 1173 |
| 980 | Ga0495601_0038174 | 3300053077 | Bacteria | 3002 |
| 981 | Ga0495601_0041938 | 3300053077 | Bacteria | 2870 |
| 982 | Ga0495601_0316942 | 3300053077 | Unclassified | 1015 |
| 983 | Ga0495612_0021700 | 3300053078 | Bacteria | 2576 |
| 984 | Ga0495612_0068978 | 3300053078 | Unclassified | 1472 |
| 985 | Ga0495612_0260275 | 3300053078 | Bacteria | 773 |
| 986 | Ga0495595_0012363 | 3300053084 | Bacteria | 3587 |
| 987 | Ga0495619_0000016 | 3300053085 | Bacteria | 231442 |
| 988 | Ga0495619_0000164 | 3300053085 | Bacteria | 48672 |
| 989 | Ga0495619_0017754 | 3300053085 | Bacteria | 4508 |
| 990 | Ga0495619_0203405 | 3300053085 | Unclassified | 1371 |
| 991 | Ga0500641_0010930 | 3300053096 | Bacteria | 3291 |
| 992 | Ga0500652_081181 | 3300053131 | Bacteria | 1350 |
| 993 | Ga0500577_0021827 | 3300053142 | Bacteria | 2115 |
| 994 | Ga0500616_0032782 | 3300053153 | Bacteria | 2839 |
| 995 | Ga0500639_131949 | 3300053163 | Bacteria | 1182 |
| 996 | Ga0500645_007885 | 3300053730 | Bacteria | 3676 |
| 997 | Ga0501084_0016732 | 3300054114 | Bacteria | 6090 |
| 998 | Ga0501084_0066520 | 3300054114 | Bacteria | 3016 |
| 999 | Ga0501084_0136403 | 3300054114 | Bacteria | 2065 |
| 1000 | Ga0501084_0209256 | 3300054114 | Bacteria | 1646 |
| 1001 | Ga0501084_0211154 | 3300054114 | Bacteria | 1638 |
| 1002 | Ga0501084_0218223 | 3300054114 | Bacteria | 1609 |
| 1003 | Ga0501084_0355074 | 3300054114 | Bacteria | 1238 |
| 1004 | Ga0501082_0066474 | 3300060353 | Bacteria | 3105 |
| 1005 | Ga0501082_0106355 | 3300060353 | Bacteria | 2427 |
| 1006 | Ga0501082_0116348 | 3300060353 | Bacteria | 2315 |
| 1007 | Ga0501082_0201883 | 3300060353 | Bacteria | 1730 |
| 1008 | Ga0501082_0214611 | 3300060353 | Bacteria | 1674 |
| 1009 | Ga0501082_0387777 | 3300060353 | Bacteria | 1219 |
| 1010 | Ga0501082_0454576 | 3300060353 | Bacteria | 1119 |
| 1011 | Ga0501082_0677847 | 3300060353 | Bacteria | 902 |
| 1012 | Ga0530510_0028015 | 3300061734 | Bacteria | 4039 |
| 1013 | Ga0530510_0055057 | 3300061734 | Bacteria | 2874 |
| 1014 | Ga0530510_0073046 | 3300061734 | Bacteria | 2490 |
| 1015 | Ga0530510_0273289 | 3300061734 | Bacteria | 1261 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048922 | Ga0496119_0181649 | Ga0496119_0181649_584_1084 | 163 |
| 2 | 3300049589 | Ga0501073_0481170 | Ga0501073_0481170_20_562 | 178 |
| 3 | 3300049586 | Ga0501070_0815161 | Ga0501070_0815161_56_601 | 180 |
| 4 | 3300048920 | Ga0496117_0018920 | Ga0496117_0018920_5026_5598 | 186 |
| 5 | 3300048921 | Ga0496118_0009347 | Ga0496118_0009347_5019_5591 | 186 |
| 6 | 3300048925 | Ga0496122_0009621 | Ga0496122_0009621_4496_5068 | 186 |
| 7 | 3300048926 | Ga0496123_0011580 | Ga0496123_0011580_2119_2691 | 186 |
| 8 | 3300005327 | Ga0070658_10002045 | Ga0070658_100020457 | 188 |
| 9 | 3300005339 | Ga0070660_100146623 | Ga0070660_1001466231 | 188 |
| 10 | 3300005344 | Ga0070661_100015548 | Ga0070661_1000155482 | 188 |
| 11 | 3300005530 | Ga0070679_100360469 | Ga0070679_1003604693 | 188 |
| 12 | 3300005539 | Ga0068853_100073544 | Ga0068853_1000735442 | 188 |
| 13 | 3300005614 | Ga0068856_100034732 | Ga0068856_1000347324 | 188 |
| 14 | 3300005616 | Ga0068852_100001655 | Ga0068852_1000016557 | 188 |
| 15 | 3300009093 | Ga0105240_10069912 | Ga0105240_100699122 | 188 |
| 16 | 3300009551 | Ga0105238_10001373 | Ga0105238_1000137318 | 188 |
| 17 | 3300010375 | Ga0105239_10119753 | Ga0105239_101197533 | 188 |
| 18 | 3300013100 | Ga0157373_10057799 | Ga0157373_100577991 | 188 |
| 19 | 3300013104 | Ga0157370_10082033 | Ga0157370_100820332 | 188 |
| 20 | 3300013105 | Ga0157369_10021559 | Ga0157369_100215598 | 188 |
| 21 | 3300025913 | Ga0207695_10080968 | Ga0207695_100809684 | 188 |
| 22 | 3300025919 | Ga0207657_10127236 | Ga0207657_101272361 | 188 |
| 23 | 3300025920 | Ga0207649_10008729 | Ga0207649_100087293 | 188 |
| 24 | 3300025924 | Ga0207694_10086104 | Ga0207694_100861044 | 188 |
| 25 | 3300025949 | Ga0207667_10023210 | Ga0207667_100232108 | 188 |
| 26 | 3300026041 | Ga0207639_10104036 | Ga0207639_101040363 | 188 |
| 27 | 3300026078 | Ga0207702_10041088 | Ga0207702_100410884 | 188 |
| 28 | 3300009094 | Ga0111539_10909214 | Ga0111539_109092142 | 190 |
| 29 | 3300009147 | Ga0114129_10099148 | Ga0114129_100991484 | 190 |
| 30 | 3300050507 | nmdc:mga05p37_54453_c1 | nmdc:mga05p37_54453_c1_1904_2518 | 190 |
| 31 | 3300050510 | nmdc:mga06r32_268462_c1 | nmdc:mga06r32_268462_c1_374_988 | 190 |
| 32 | 3300050511 | nmdc:mga08y16_236347_c1 | nmdc:mga08y16_236347_c1_116_730 | 190 |
| 33 | 3300060353 | Ga0501082_0677847 | Ga0501082_0677847_260_886 | 191 |
| 34 | 3300005347 | Ga0070668_100101877 | Ga0070668_1001018773 | 192 |
| 35 | 3300025923 | Ga0207681_10169527 | Ga0207681_101695273 | 192 |
| 36 | 3300025972 | Ga0207668_10073093 | Ga0207668_100730932 | 192 |
| 37 | 3300037471 | Ga0395905_0868756 | Ga0395905_0868756_11_622 | 192 |
| 38 | 3300047470 | Ga0495681_0168428 | Ga0495681_0168428_299_895 | 192 |
| 39 | 3300005937 | Ga0081455_10008578 | Ga0081455_100085789 | 193 |
| 40 | 3300005356 | Ga0070674_100252788 | Ga0070674_1002527881 | 194 |
| 41 | 3300009098 | Ga0105245_10743314 | Ga0105245_107433142 | 195 |
| 42 | 3300048906 | Ga0496103_0471671 | Ga0496103_0471671_70_723 | 195 |
| 43 | 3300048909 | Ga0496106_0083540 | Ga0496106_0083540_1077_1730 | 195 |
| 44 | iso_pu_bacteria | 2884960567 | 2884964059 | 195 |
| 45 | 3300005366 | Ga0070659_100070471 | Ga0070659_1000704712 | 196 |
| 46 | 3300005539 | Ga0068853_100126317 | Ga0068853_1001263172 | 196 |
| 47 | 3300005564 | Ga0070664_100085255 | Ga0070664_1000852552 | 196 |
| 48 | 3300013100 | Ga0157373_10002425 | Ga0157373_1000242511 | 196 |
| 49 | 3300013100 | Ga0157373_10013179 | Ga0157373_100131796 | 196 |
| 50 | 3300025932 | Ga0207690_10034354 | Ga0207690_100343543 | 196 |
| 51 | 3300025945 | Ga0207679_10063654 | Ga0207679_100636543 | 196 |
| 52 | 3300026041 | Ga0207639_10070740 | Ga0207639_100707403 | 196 |
| 53 | 3300026041 | Ga0207639_10261580 | Ga0207639_102615802 | 196 |
| 54 | 3300049568 | Ga0501031_0285194 | Ga0501031_0285194_361_1002 | 196 |
| 55 | 3300049588 | Ga0501072_0783561 | Ga0501072_0783561_15_656 | 196 |
| 56 | 3300060353 | Ga0501082_0454576 | Ga0501082_0454576_240_881 | 196 |
| 57 | 3300013306 | Ga0163162_10079200 | Ga0163162_100792002 | 197 |
| 58 | 3300013308 | Ga0157375_10415941 | Ga0157375_104159413 | 197 |
| 59 | 3300026118 | Ga0207675_100222055 | Ga0207675_1002220552 | 197 |
| 60 | 3300048905 | Ga0496102_0050186 | Ga0496102_0050186_1799_2395 | 197 |
| 61 | 3300049581 | Ga0501047_0124435 | Ga0501047_0124435_1765_2370 | 197 |
| 62 | 3300049583 | Ga0501067_0050746 | Ga0501067_0050746_29_634 | 197 |
| 63 | 3300049585 | Ga0501069_0352814 | Ga0501069_0352814_59_664 | 197 |
| 64 | 3300049586 | Ga0501070_0368587 | Ga0501070_0368587_315_920 | 197 |
| 65 | 3300049590 | Ga0501074_0047670 | Ga0501074_0047670_2102_2707 | 197 |
| 66 | 3300049742 | Ga0501080_0302428 | Ga0501080_0302428_441_1046 | 197 |
| 67 | 3300021361 | Ga0213872_10146057 | Ga0213872_101460572 | 198 |
| 68 | 3300039447 | Ga0436361_1124544 | Ga0436361_1124544_991_1590 | 198 |
| 69 | 3300048904 | Ga0496101_0874488 | Ga0496101_0874488_61_660 | 198 |
| 70 | 3300048909 | Ga0496106_0119348 | Ga0496106_0119348_658_1257 | 198 |
| 71 | 3300014968 | Ga0157379_10001600 | Ga0157379_100016008 | 199 |
| 72 | 3300035117 | Ga0373953_0122910 | Ga0373953_0122910_68_685 | 199 |
| 73 | 3300035119 | Ga0373956_0017190 | Ga0373956_0017190_396_1013 | 199 |
| 74 | 3300035120 | Ga0373957_0070795 | Ga0373957_0070795_718_1335 | 199 |
| 75 | 3300036401 | Ga0373937_0027365 | Ga0373937_0027365_2142_2759 | 199 |
| 76 | 3300046689 | Ga0495613_0154209 | Ga0495613_0154209_736_1353 | 199 |
| 77 | 3300005548 | Ga0070665_100966555 | Ga0070665_1009665552 | 200 |
| 78 | 3300025295 | Ga0209564_1012585 | Ga0209564_10125851 | 200 |
| 79 | 3300041462 | Ga0451806_251659 | Ga0451806_251659_111_728 | 200 |
| 80 | 3300049581 | Ga0501047_0019070 | Ga0501047_0019070_5187_5822 | 200 |
| 81 | 3300054114 | Ga0501084_0355074 | Ga0501084_0355074_571_1206 | 200 |
| 82 | iso_pu_bacteria | 2513237164 | 2514034812 | 200 |
| 83 | iso_pu_bacteria | 2643221662 | 2644350149 | 200 |
| 84 | iso_pu_bacteria | 2643221674 | 2644412670 | 200 |
| 85 | 3300005354 | Ga0070675_100439072 | Ga0070675_1004390722 | 201 |
| 86 | 3300005440 | Ga0070705_100519450 | Ga0070705_1005194501 | 201 |
| 87 | 3300005441 | Ga0070700_100065559 | Ga0070700_1000655592 | 201 |
| 88 | 3300005546 | Ga0070696_100088229 | Ga0070696_1000882292 | 201 |
| 89 | 3300005548 | Ga0070665_100384903 | Ga0070665_1003849032 | 201 |
| 90 | 3300005617 | Ga0068859_100343898 | Ga0068859_1003438984 | 201 |
| 91 | 3300006844 | Ga0075428_100724069 | Ga0075428_1007240692 | 201 |
| 92 | 3300006931 | Ga0097620_100343880 | Ga0097620_1003438804 | 201 |
| 93 | 3300009553 | Ga0105249_10132531 | Ga0105249_101325312 | 201 |
| 94 | 3300014325 | Ga0163163_10691932 | Ga0163163_106919322 | 201 |
| 95 | 3300025904 | Ga0207647_10113400 | Ga0207647_101134002 | 201 |
| 96 | 3300025923 | Ga0207681_10107093 | Ga0207681_101070933 | 201 |
| 97 | 3300028379 | Ga0268266_10478468 | Ga0268266_104784682 | 201 |
| 98 | 3300028573 | Ga0265334_10098446 | Ga0265334_100984462 | 201 |
| 99 | 3300031235 | Ga0265330_10148206 | Ga0265330_101482062 | 201 |
| 100 | 3300031241 | Ga0265325_10010515 | Ga0265325_100105154 | 201 |
| 101 | 3300031247 | Ga0265340_10028355 | Ga0265340_100283552 | 201 |
| 102 | 3300031249 | Ga0265339_10001731 | Ga0265339_1000173110 | 201 |
| 103 | 3300031249 | Ga0265339_10093009 | Ga0265339_100930093 | 201 |
| 104 | 3300031344 | Ga0265316_10333879 | Ga0265316_103338792 | 201 |
| 105 | 3300031691 | Ga0316579_10121039 | Ga0316579_101210392 | 201 |
| 106 | 3300031711 | Ga0265314_10045569 | Ga0265314_100455692 | 201 |
| 107 | 3300031712 | Ga0265342_10181895 | Ga0265342_101818952 | 201 |
| 108 | 3300037312 | Ga0395899_0000137 | Ga0395899_0000137_23803_24423 | 201 |
| 109 | 3300037418 | Ga0395900_0000108 | Ga0395900_0000108_33421_34041 | 201 |
| 110 | 3300037466 | Ga0395898_0027497 | Ga0395898_0027497_3270_3890 | 201 |
| 111 | 3300037471 | Ga0395905_0009347 | Ga0395905_0009347_3196_3816 | 201 |
| 112 | 3300038443 | Ga0395901_0000050 | Ga0395901_0000050_54279_54899 | 201 |
| 113 | 3300042003 | Ga0439443_006364 | Ga0439443_006364_85_690 | 201 |
| 114 | 3300042461 | Ga0439460_0010702 | Ga0439460_0010702_1336_1956 | 201 |
| 115 | 3300046516 | Ga0495628_0024458 | Ga0495628_0024458_4213_4818 | 201 |
| 116 | 3300046517 | Ga0495630_0423142 | Ga0495630_0423142_396_1001 | 201 |
| 117 | 3300047319 | Ga0495674_0029987 | Ga0495674_0029987_2278_2883 | 201 |
| 118 | 3300049581 | Ga0501047_0086573 | Ga0501047_0086573_949_1554 | 201 |
| 119 | 3300049593 | Ga0501077_0366115 | Ga0501077_0366115_284_904 | 201 |
| 120 | 3300049824 | Ga0501045_0129361 | Ga0501045_0129361_1122_1763 | 201 |
| 121 | 3300049824 | Ga0501045_0144958 | Ga0501045_0144958_212_832 | 201 |
| 122 | 3300054114 | Ga0501084_0066520 | Ga0501084_0066520_93_713 | 201 |
| 123 | 3300060353 | Ga0501082_0214611 | Ga0501082_0214611_930_1550 | 201 |
| 124 | 3300060353 | Ga0501082_0387777 | Ga0501082_0387777_71_676 | 201 |
| 125 | 3300005331 | Ga0070670_101122698 | Ga0070670_1011226981 | 202 |
| 126 | 3300005353 | Ga0070669_100628275 | Ga0070669_1006282751 | 202 |
| 127 | 3300005354 | Ga0070675_100192444 | Ga0070675_1001924442 | 202 |
| 128 | 3300005367 | Ga0070667_100925546 | Ga0070667_1009255461 | 202 |
| 129 | 3300005543 | Ga0070672_100194921 | Ga0070672_1001949212 | 202 |
| 130 | 3300005544 | Ga0070686_100270070 | Ga0070686_1002700702 | 202 |
| 131 | 3300006871 | Ga0075434_100717564 | Ga0075434_1007175641 | 202 |
| 132 | 3300006881 | Ga0068865_100389395 | Ga0068865_1003893952 | 202 |
| 133 | 3300021384 | Ga0213876_10079150 | Ga0213876_100791502 | 202 |
| 134 | 3300025940 | Ga0207691_10103003 | Ga0207691_101030032 | 202 |
| 135 | 3300027907 | Ga0207428_10097457 | Ga0207428_100974571 | 202 |
| 136 | 3300031456 | Ga0307513_10336724 | Ga0307513_103367242 | 202 |
| 137 | 3300039437 | Ga0436365_0018302 | Ga0436365_0018302_2693_3310 | 202 |
| 138 | 3300046531 | Ga0495665_0028390 | Ga0495665_0028390_1580_2206 | 202 |
| 139 | 3300049574 | Ga0501038_0055775 | Ga0501038_0055775_2766_3377 | 202 |
| 140 | 3300049574 | Ga0501038_0124853 | Ga0501038_0124853_98_706 | 202 |
| 141 | 3300049579 | Ga0501043_0516445 | Ga0501043_0516445_86_697 | 202 |
| 142 | 3300049580 | Ga0501046_0072386 | Ga0501046_0072386_1805_2416 | 202 |
| 143 | 3300049582 | Ga0501048_0020276 | Ga0501048_0020276_3810_4421 | 202 |
| 144 | 3300049583 | Ga0501067_0029425 | Ga0501067_0029425_1587_2195 | 202 |
| 145 | 3300049585 | Ga0501069_0141393 | Ga0501069_0141393_268_879 | 202 |
| 146 | 3300049587 | Ga0501071_0047919 | Ga0501071_0047919_332_952 | 202 |
| 147 | 3300049587 | Ga0501071_0330625 | Ga0501071_0330625_369_980 | 202 |
| 148 | 3300049588 | Ga0501072_0068309 | Ga0501072_0068309_1780_2391 | 202 |
| 149 | 3300049590 | Ga0501074_0278837 | Ga0501074_0278837_194_802 | 202 |
| 150 | 3300049591 | Ga0501075_0124727 | Ga0501075_0124727_745_1356 | 202 |
| 151 | 3300049592 | Ga0501076_0214514 | Ga0501076_0214514_115_726 | 202 |
| 152 | 3300049593 | Ga0501077_0132833 | Ga0501077_0132833_402_1013 | 202 |
| 153 | 3300049741 | Ga0501079_0014707 | Ga0501079_0014707_3917_4528 | 202 |
| 154 | 3300049742 | Ga0501080_0034662 | Ga0501080_0034662_445_1053 | 202 |
| 155 | 3300049742 | Ga0501080_0492529 | Ga0501080_0492529_95_706 | 202 |
| 156 | 3300049743 | Ga0501081_0218867 | Ga0501081_0218867_47_658 | 202 |
| 157 | 3300049744 | Ga0501083_0066569 | Ga0501083_0066569_1403_2011 | 202 |
| 158 | 3300049822 | Ga0501035_0066862 | Ga0501035_0066862_1419_2030 | 202 |
| 159 | 3300049824 | Ga0501045_0347743 | Ga0501045_0347743_467_1078 | 202 |
| 160 | 3300053142 | Ga0500577_0021827 | Ga0500577_0021827_1304_1924 | 202 |
| 161 | 3300053163 | Ga0500639_131949 | Ga0500639_131949_482_1147 | 202 |
| 162 | 3300054114 | Ga0501084_0218223 | Ga0501084_0218223_78_689 | 202 |
| 163 | 3300060353 | Ga0501082_0066474 | Ga0501082_0066474_1052_1660 | 202 |
| 164 | 3300060353 | Ga0501082_0201883 | Ga0501082_0201883_321_932 | 202 |
| 165 | 3300005329 | Ga0070683_100043381 | Ga0070683_1000433812 | 203 |
| 166 | 3300005434 | Ga0070709_10138150 | Ga0070709_101381502 | 203 |
| 167 | 3300005435 | Ga0070714_100142045 | Ga0070714_1001420453 | 203 |
| 168 | 3300005436 | Ga0070713_100029053 | Ga0070713_1000290534 | 203 |
| 169 | 3300005458 | Ga0070681_10286633 | Ga0070681_102866332 | 203 |
| 170 | 3300005535 | Ga0070684_100154153 | Ga0070684_1001541534 | 203 |
| 171 | 3300005577 | Ga0068857_100206704 | Ga0068857_1002067042 | 203 |
| 172 | 3300005616 | Ga0068852_100141351 | Ga0068852_1001413513 | 203 |
| 173 | 3300005718 | Ga0068866_10404741 | Ga0068866_104047411 | 203 |
| 174 | 3300005843 | Ga0068860_101073231 | Ga0068860_1010732312 | 203 |
| 175 | 3300005844 | Ga0068862_100495492 | Ga0068862_1004954921 | 203 |
| 176 | 3300005985 | Ga0081539_10006052 | Ga0081539_1000605210 | 203 |
| 177 | 3300009093 | Ga0105240_10093427 | Ga0105240_100934271 | 203 |
| 178 | 3300009094 | Ga0111539_10484944 | Ga0111539_104849442 | 203 |
| 179 | 3300009094 | Ga0111539_11066113 | Ga0111539_110661131 | 203 |
| 180 | 3300009094 | Ga0111539_11320194 | Ga0111539_113201941 | 203 |
| 181 | 3300009174 | Ga0105241_10040950 | Ga0105241_100409502 | 203 |
| 182 | 3300009176 | Ga0105242_10566651 | Ga0105242_105666512 | 203 |
| 183 | 3300009177 | Ga0105248_10000015 | Ga0105248_10000015199 | 203 |
| 184 | 3300009545 | Ga0105237_10870155 | Ga0105237_108701552 | 203 |
| 185 | 3300009551 | Ga0105238_10294446 | Ga0105238_102944462 | 203 |
| 186 | 3300010375 | Ga0105239_10224844 | Ga0105239_102248442 | 203 |
| 187 | 3300010375 | Ga0105239_11506093 | Ga0105239_115060932 | 203 |
| 188 | 3300013105 | Ga0157369_10036888 | Ga0157369_100368881 | 203 |
| 189 | 3300013306 | Ga0163162_10739960 | Ga0163162_107399601 | 203 |
| 190 | 3300013307 | Ga0157372_11391142 | Ga0157372_113911421 | 203 |
| 191 | 3300013307 | Ga0157372_11391193 | Ga0157372_113911931 | 203 |
| 192 | 3300013308 | Ga0157375_10626621 | Ga0157375_106266212 | 203 |
| 193 | 3300014325 | Ga0163163_10383831 | Ga0163163_103838311 | 203 |
| 194 | 3300014745 | Ga0157377_10330354 | Ga0157377_103303542 | 203 |
| 195 | 3300014969 | Ga0157376_11157280 | Ga0157376_111572801 | 203 |
| 196 | 3300025297 | Ga0209758_1008245 | Ga0209758_10082452 | 203 |
| 197 | 3300025906 | Ga0207699_10530629 | Ga0207699_105306292 | 203 |
| 198 | 3300025913 | Ga0207695_10333573 | Ga0207695_103335731 | 203 |
| 199 | 3300025928 | Ga0207700_10041129 | Ga0207700_100411294 | 203 |
| 200 | 3300025929 | Ga0207664_10184680 | Ga0207664_101846802 | 203 |
| 201 | 3300025938 | Ga0207704_10228037 | Ga0207704_102280371 | 203 |
| 202 | 3300025941 | Ga0207711_10000003 | Ga0207711_10000003930 | 203 |
| 203 | 3300025941 | Ga0207711_10000005 | Ga0207711_10000005203 | 203 |
| 204 | 3300025941 | Ga0207711_10000009 | Ga0207711_10000009452 | 203 |
| 205 | 3300025945 | Ga0207679_10189046 | Ga0207679_101890462 | 203 |
| 206 | 3300025981 | Ga0207640_10639528 | Ga0207640_106395282 | 203 |
| 207 | 3300026041 | Ga0207639_10098738 | Ga0207639_100987382 | 203 |
| 208 | 3300026075 | Ga0207708_10118713 | Ga0207708_101187133 | 203 |
| 209 | 3300026078 | Ga0207702_10288566 | Ga0207702_102885662 | 203 |
| 210 | 3300026116 | Ga0207674_10165816 | Ga0207674_101658162 | 203 |
| 211 | 3300028379 | Ga0268266_11255547 | Ga0268266_112555471 | 203 |
| 212 | 3300031247 | Ga0265340_10185624 | Ga0265340_101856242 | 203 |
| 213 | 3300037312 | Ga0395899_0037204 | Ga0395899_0037204_2067_2681 | 203 |
| 214 | 3300037418 | Ga0395900_0025260 | Ga0395900_0025260_4324_4938 | 203 |
| 215 | 3300038443 | Ga0395901_0009335 | Ga0395901_0009335_197_811 | 203 |
| 216 | 3300041408 | Ga0439453_0014235 | Ga0439453_0014235_143_760 | 203 |
| 217 | 3300042005 | Ga0439448_0015604 | Ga0439448_0015604_1461_2075 | 203 |
| 218 | 3300046491 | Ga0495584_0031341 | Ga0495584_0031341_1850_2464 | 203 |
| 219 | 3300046525 | Ga0495663_0129901 | Ga0495663_0129901_119_733 | 203 |
| 220 | 3300046558 | Ga0495633_0127269 | Ga0495633_0127269_235_849 | 203 |
| 221 | 3300046664 | Ga0495659_0054852 | Ga0495659_0054852_135_749 | 203 |
| 222 | 3300046691 | Ga0495670_0172382 | Ga0495670_0172382_89_703 | 203 |
| 223 | 3300048910 | Ga0496107_0145923 | Ga0496107_0145923_858_1472 | 203 |
| 224 | 3300048914 | Ga0496111_0613257 | Ga0496111_0613257_166_780 | 203 |
| 225 | 3300049568 | Ga0501031_0079720 | Ga0501031_0079720_946_1560 | 203 |
| 226 | 3300049569 | Ga0501032_0063717 | Ga0501032_0063717_1020_1634 | 203 |
| 227 | 3300049571 | Ga0501034_0843963 | Ga0501034_0843963_151_765 | 203 |
| 228 | 3300049572 | Ga0501036_0349591 | Ga0501036_0349591_95_718 | 203 |
| 229 | 3300049572 | Ga0501036_0495736 | Ga0501036_0495736_187_801 | 203 |
| 230 | 3300049573 | Ga0501037_0146057 | Ga0501037_0146057_659_1273 | 203 |
| 231 | 3300049573 | Ga0501037_0476039 | Ga0501037_0476039_75_698 | 203 |
| 232 | 3300049574 | Ga0501038_0099164 | Ga0501038_0099164_865_1488 | 203 |
| 233 | 3300049575 | Ga0501039_0220391 | Ga0501039_0220391_156_770 | 203 |
| 234 | 3300049576 | Ga0501040_0026969 | Ga0501040_0026969_2230_2853 | 203 |
| 235 | 3300049576 | Ga0501040_0037469 | Ga0501040_0037469_470_1084 | 203 |
| 236 | 3300049576 | Ga0501040_0315857 | Ga0501040_0315857_447_1061 | 203 |
| 237 | 3300049577 | Ga0501041_0013496 | Ga0501041_0013496_1771_2385 | 203 |
| 238 | 3300049577 | Ga0501041_0156811 | Ga0501041_0156811_513_1136 | 203 |
| 239 | 3300049578 | Ga0501042_0104498 | Ga0501042_0104498_1364_1978 | 203 |
| 240 | 3300049578 | Ga0501042_0108909 | Ga0501042_0108909_87_701 | 203 |
| 241 | 3300049578 | Ga0501042_0196712 | Ga0501042_0196712_482_1105 | 203 |
| 242 | 3300049580 | Ga0501046_0044288 | Ga0501046_0044288_2221_2835 | 203 |
| 243 | 3300049580 | Ga0501046_0345800 | Ga0501046_0345800_189_803 | 203 |
| 244 | 3300049582 | Ga0501048_0264719 | Ga0501048_0264719_283_897 | 203 |
| 245 | 3300049584 | Ga0501068_0026592 | Ga0501068_0026592_982_1596 | 203 |
| 246 | 3300049584 | Ga0501068_0380693 | Ga0501068_0380693_162_785 | 203 |
| 247 | 3300049587 | Ga0501071_0035441 | Ga0501071_0035441_1876_2499 | 203 |
| 248 | 3300049588 | Ga0501072_0026974 | Ga0501072_0026974_832_1455 | 203 |
| 249 | 3300049588 | Ga0501072_0033731 | Ga0501072_0033731_384_998 | 203 |
| 250 | 3300049589 | Ga0501073_0163041 | Ga0501073_0163041_173_784 | 203 |
| 251 | 3300049590 | Ga0501074_0024213 | Ga0501074_0024213_2222_2836 | 203 |
| 252 | 3300049590 | Ga0501074_0109856 | Ga0501074_0109856_873_1496 | 203 |
| 253 | 3300049591 | Ga0501075_0058224 | Ga0501075_0058224_923_1546 | 203 |
| 254 | 3300049591 | Ga0501075_0094095 | Ga0501075_0094095_578_1192 | 203 |
| 255 | 3300049591 | Ga0501075_0456607 | Ga0501075_0456607_256_870 | 203 |
| 256 | 3300049592 | Ga0501076_0048669 | Ga0501076_0048669_987_1610 | 203 |
| 257 | 3300049592 | Ga0501076_0099441 | Ga0501076_0099441_1405_2019 | 203 |
| 258 | 3300049592 | Ga0501076_0273863 | Ga0501076_0273863_448_1062 | 203 |
| 259 | 3300049593 | Ga0501077_0026393 | Ga0501077_0026393_3060_3674 | 203 |
| 260 | 3300049593 | Ga0501077_0043636 | Ga0501077_0043636_713_1336 | 203 |
| 261 | 3300049593 | Ga0501077_0060276 | Ga0501077_0060276_390_1004 | 203 |
| 262 | 3300049741 | Ga0501079_0018315 | Ga0501079_0018315_940_1554 | 203 |
| 263 | 3300049741 | Ga0501079_0346649 | Ga0501079_0346649_498_1112 | 203 |
| 264 | 3300049741 | Ga0501079_0473176 | Ga0501079_0473176_166_789 | 203 |
| 265 | 3300049742 | Ga0501080_0047241 | Ga0501080_0047241_2555_3169 | 203 |
| 266 | 3300049742 | Ga0501080_0350370 | Ga0501080_0350370_183_797 | 203 |
| 267 | 3300049743 | Ga0501081_0023102 | Ga0501081_0023102_406_1020 | 203 |
| 268 | 3300049743 | Ga0501081_0032968 | Ga0501081_0032968_2539_3153 | 203 |
| 269 | 3300049744 | Ga0501083_0061919 | Ga0501083_0061919_946_1560 | 203 |
| 270 | 3300049822 | Ga0501035_0207445 | Ga0501035_0207445_221_835 | 203 |
| 271 | 3300049822 | Ga0501035_0330167 | Ga0501035_0330167_338_961 | 203 |
| 272 | 3300049823 | Ga0501044_0734229 | Ga0501044_0734229_35_649 | 203 |
| 273 | 3300049824 | Ga0501045_0067841 | Ga0501045_0067841_1578_2201 | 203 |
| 274 | 3300049824 | Ga0501045_0245276 | Ga0501045_0245276_31_645 | 203 |
| 275 | 3300050511 | nmdc:mga08y16_465793_c1 | nmdc:mga08y16_465793_c1_259_873 | 203 |
| 276 | 3300053078 | Ga0495612_0260275 | Ga0495612_0260275_39_650 | 203 |
| 277 | 3300053131 | Ga0500652_081181 | Ga0500652_081181_377_1009 | 203 |
| 278 | 3300053730 | Ga0500645_007885 | Ga0500645_007885_601_1233 | 203 |
| 279 | 3300054114 | Ga0501084_0016732 | Ga0501084_0016732_1792_2415 | 203 |
| 280 | 3300054114 | Ga0501084_0136403 | Ga0501084_0136403_950_1564 | 203 |
| 281 | 3300060353 | Ga0501082_0106355 | Ga0501082_0106355_1066_1680 | 203 |
| 282 | 3300060353 | Ga0501082_0116348 | Ga0501082_0116348_426_1040 | 203 |
| 283 | 3300061734 | Ga0530510_0028015 | Ga0530510_0028015_860_1483 | 203 |
| 284 | 3300061734 | Ga0530510_0273289 | Ga0530510_0273289_199_813 | 203 |
| 285 | 3300003323 | rootH1_10064975 | rootH1_100649753 | 204 |
| 286 | 3300005327 | Ga0070658_10103966 | Ga0070658_101039663 | 204 |
| 287 | 3300005327 | Ga0070658_10129207 | Ga0070658_101292071 | 204 |
| 288 | 3300005328 | Ga0070676_10031086 | Ga0070676_100310862 | 204 |
| 289 | 3300005329 | Ga0070683_100025834 | Ga0070683_1000258345 | 204 |
| 290 | 3300005329 | Ga0070683_100109225 | Ga0070683_1001092252 | 204 |
| 291 | 3300005337 | Ga0070682_100261629 | Ga0070682_1002616291 | 204 |
| 292 | 3300005338 | Ga0068868_100498174 | Ga0068868_1004981742 | 204 |
| 293 | 3300005339 | Ga0070660_100014238 | Ga0070660_1000142386 | 204 |
| 294 | 3300005366 | Ga0070659_100008537 | Ga0070659_1000085372 | 204 |
| 295 | 3300005366 | Ga0070659_100105105 | Ga0070659_1001051052 | 204 |
| 296 | 3300005455 | Ga0070663_100250830 | Ga0070663_1002508302 | 204 |
| 297 | 3300005456 | Ga0070678_100129976 | Ga0070678_1001299763 | 204 |
| 298 | 3300005457 | Ga0070662_100062866 | Ga0070662_1000628664 | 204 |
| 299 | 3300005459 | Ga0068867_100428595 | Ga0068867_1004285951 | 204 |
| 300 | 3300005535 | Ga0070684_100051620 | Ga0070684_1000516205 | 204 |
| 301 | 3300005535 | Ga0070684_100124505 | Ga0070684_1001245053 | 204 |
| 302 | 3300005539 | Ga0068853_100012357 | Ga0068853_1000123575 | 204 |
| 303 | 3300005543 | Ga0070672_100290929 | Ga0070672_1002909292 | 204 |
| 304 | 3300005544 | Ga0070686_100258167 | Ga0070686_1002581671 | 204 |
| 305 | 3300005563 | Ga0068855_100269792 | Ga0068855_1002697923 | 204 |
| 306 | 3300005564 | Ga0070664_100403758 | Ga0070664_1004037581 | 204 |
| 307 | 3300005578 | Ga0068854_100010290 | Ga0068854_1000102904 | 204 |
| 308 | 3300005614 | Ga0068856_100212373 | Ga0068856_1002123732 | 204 |
| 309 | 3300005616 | Ga0068852_100104184 | Ga0068852_1001041841 | 204 |
| 310 | 3300005618 | Ga0068864_100145190 | Ga0068864_1001451903 | 204 |
| 311 | 3300006028 | Ga0070717_10916994 | Ga0070717_109169941 | 204 |
| 312 | 3300006038 | Ga0075365_10221661 | Ga0075365_102216612 | 204 |
| 313 | 3300006042 | Ga0075368_10040390 | Ga0075368_100403902 | 204 |
| 314 | 3300006048 | Ga0075363_100035329 | Ga0075363_1000353293 | 204 |
| 315 | 3300006178 | Ga0075367_10002551 | Ga0075367_100025512 | 204 |
| 316 | 3300006195 | Ga0075366_10020275 | Ga0075366_100202755 | 204 |
| 317 | 3300006195 | Ga0075366_10068103 | Ga0075366_100681032 | 204 |
| 318 | 3300006353 | Ga0075370_10008430 | Ga0075370_100084302 | 204 |
| 319 | 3300006914 | Ga0075436_100072041 | Ga0075436_1000720412 | 204 |
| 320 | 3300009093 | Ga0105240_10238265 | Ga0105240_102382653 | 204 |
| 321 | 3300009148 | Ga0105243_10677574 | Ga0105243_106775741 | 204 |
| 322 | 3300009551 | Ga0105238_10039590 | Ga0105238_100395904 | 204 |
| 323 | 3300009551 | Ga0105238_10239050 | Ga0105238_102390502 | 204 |
| 324 | 3300010375 | Ga0105239_10022682 | Ga0105239_100226827 | 204 |
| 325 | 3300011119 | Ga0105246_10116104 | Ga0105246_101161042 | 204 |
| 326 | 3300013307 | Ga0157372_10014547 | Ga0157372_100145473 | 204 |
| 327 | 3300025321 | Ga0207656_10077017 | Ga0207656_100770173 | 204 |
| 328 | 3300025907 | Ga0207645_10077209 | Ga0207645_100772092 | 204 |
| 329 | 3300025913 | Ga0207695_10166367 | Ga0207695_101663673 | 204 |
| 330 | 3300025919 | Ga0207657_10012000 | Ga0207657_100120006 | 204 |
| 331 | 3300025920 | Ga0207649_10236070 | Ga0207649_102360702 | 204 |
| 332 | 3300025924 | Ga0207694_10023492 | Ga0207694_100234923 | 204 |
| 333 | 3300025931 | Ga0207644_10690734 | Ga0207644_106907342 | 204 |
| 334 | 3300025932 | Ga0207690_10186348 | Ga0207690_101863482 | 204 |
| 335 | 3300025933 | Ga0207706_10133769 | Ga0207706_101337692 | 204 |
| 336 | 3300025940 | Ga0207691_10163804 | Ga0207691_101638042 | 204 |
| 337 | 3300025944 | Ga0207661_10465314 | Ga0207661_104653141 | 204 |
| 338 | 3300025945 | Ga0207679_10244084 | Ga0207679_102440843 | 204 |
| 339 | 3300025949 | Ga0207667_10202131 | Ga0207667_102021311 | 204 |
| 340 | 3300025981 | Ga0207640_10238338 | Ga0207640_102383382 | 204 |
| 341 | 3300026023 | Ga0207677_10268969 | Ga0207677_102689692 | 204 |
| 342 | 3300026041 | Ga0207639_10192759 | Ga0207639_101927593 | 204 |
| 343 | 3300026041 | Ga0207639_10378085 | Ga0207639_103780852 | 204 |
| 344 | 3300026041 | Ga0207639_10570133 | Ga0207639_105701332 | 204 |
| 345 | 3300026067 | Ga0207678_10094504 | Ga0207678_100945042 | 204 |
| 346 | 3300026078 | Ga0207702_10119602 | Ga0207702_101196023 | 204 |
| 347 | 3300026089 | Ga0207648_10174981 | Ga0207648_101749812 | 204 |
| 348 | 3300026118 | Ga0207675_100104780 | Ga0207675_1001047803 | 204 |
| 349 | 3300026142 | Ga0207698_10426081 | Ga0207698_104260811 | 204 |
| 350 | 3300027876 | Ga0209974_10018046 | Ga0209974_100180462 | 204 |
| 351 | 3300028800 | Ga0265338_10018968 | Ga0265338_100189686 | 204 |
| 352 | 3300031235 | Ga0265330_10113796 | Ga0265330_101137962 | 204 |
| 353 | 3300031249 | Ga0265339_10005432 | Ga0265339_100054327 | 204 |
| 354 | 3300031595 | Ga0265313_10000044 | Ga0265313_1000004493 | 204 |
| 355 | 3300031730 | Ga0307516_10337816 | Ga0307516_103378162 | 204 |
| 356 | 3300031911 | Ga0307412_10355513 | Ga0307412_103555132 | 204 |
| 357 | 3300031995 | Ga0307409_100313677 | Ga0307409_1003136772 | 204 |
| 358 | 3300032004 | Ga0307414_10058182 | Ga0307414_100581823 | 204 |
| 359 | 3300032004 | Ga0307414_10148159 | Ga0307414_101481592 | 204 |
| 360 | 3300032004 | Ga0307414_10154126 | Ga0307414_101541263 | 204 |
| 361 | 3300032004 | Ga0307414_10578982 | Ga0307414_105789822 | 204 |
| 362 | 3300034816 | Ga0373930_0037291 | Ga0373930_0037291_22_642 | 204 |
| 363 | 3300035084 | Ga0373928_0043024 | Ga0373928_0043024_213_833 | 204 |
| 364 | 3300035090 | Ga0373949_0096340 | Ga0373949_0096340_168_788 | 204 |
| 365 | 3300035691 | Ga0373931_0081951 | Ga0373931_0081951_733_1353 | 204 |
| 366 | 3300041413 | Ga0439465_0020859 | Ga0439465_0020859_92_715 | 204 |
| 367 | 3300041413 | Ga0439465_0226623 | Ga0439465_0226623_56_673 | 204 |
| 368 | 3300041491 | Ga0451833_1389376 | Ga0451833_1389376_19_651 | 204 |
| 369 | 3300042006 | Ga0439432_042708 | Ga0439432_042708_696_1319 | 204 |
| 370 | 3300045051 | Ga0451576_0752684 | Ga0451576_0752684_20_640 | 204 |
| 371 | 3300046491 | Ga0495584_0185278 | Ga0495584_0185278_306_935 | 204 |
| 372 | 3300048918 | Ga0496115_0173322 | Ga0496115_0173322_639_1265 | 204 |
| 373 | 3300048923 | Ga0496120_0190083 | Ga0496120_0190083_359_991 | 204 |
| 374 | 3300048924 | Ga0496121_0091592 | Ga0496121_0091592_1086_1718 | 204 |
| 375 | 3300048927 | Ga0496124_0239028 | Ga0496124_0239028_232_852 | 204 |
| 376 | 3300049569 | Ga0501032_0177881 | Ga0501032_0177881_348_968 | 204 |
| 377 | 3300049579 | Ga0501043_0548204 | Ga0501043_0548204_155_775 | 204 |
| 378 | 3300050490 | nmdc:mga03n38_14159_c2 | nmdc:mga03n38_14159_c2_1737_2363 | 204 |
| 379 | 3300050493 | nmdc:mga0k408_11813_c1 | nmdc:mga0k408_11813_c1_2955_3581 | 204 |
| 380 | 3300050493 | nmdc:mga0k408_5302_c1 | nmdc:mga0k408_5302_c1_5392_6027 | 204 |
| 381 | 3300050494 | nmdc:mga06z11_161522_c1 | nmdc:mga06z11_161522_c1_169_795 | 204 |
| 382 | 3300053153 | Ga0500616_0032782 | Ga0500616_0032782_2092_2715 | 204 |
| 383 | iso_pu_bacteria | 2895880812 | 2895886228 | 204 |
| 384 | 3300001991 | JGI24743J22301_10019881 | JGI24743J22301_100198812 | 205 |
| 385 | 3300003215 | JGI25153J46596_10000066 | JGI25153J46596_10000066121 | 205 |
| 386 | 3300003323 | rootH1_10041760 | rootH1_100417607 | 205 |
| 387 | 3300003323 | rootH1_10087342 | rootH1_100873422 | 205 |
| 388 | 3300005290 | Ga0065712_10106759 | Ga0065712_101067592 | 205 |
| 389 | 3300005331 | Ga0070670_100044592 | Ga0070670_1000445924 | 205 |
| 390 | 3300005331 | Ga0070670_100061110 | Ga0070670_1000611103 | 205 |
| 391 | 3300005333 | Ga0070677_10001526 | Ga0070677_100015264 | 205 |
| 392 | 3300005335 | Ga0070666_10149784 | Ga0070666_101497842 | 205 |
| 393 | 3300005340 | Ga0070689_100021788 | Ga0070689_1000217883 | 205 |
| 394 | 3300005343 | Ga0070687_100133269 | Ga0070687_1001332693 | 205 |
| 395 | 3300005353 | Ga0070669_100043124 | Ga0070669_1000431242 | 205 |
| 396 | 3300005354 | Ga0070675_100007200 | Ga0070675_10000720011 | 205 |
| 397 | 3300005355 | Ga0070671_100260281 | Ga0070671_1002602811 | 205 |
| 398 | 3300005456 | Ga0070678_100034450 | Ga0070678_1000344502 | 205 |
| 399 | 3300005457 | Ga0070662_100146150 | Ga0070662_1001461501 | 205 |
| 400 | 3300005457 | Ga0070662_100433034 | Ga0070662_1004330342 | 205 |
| 401 | 3300005459 | Ga0068867_100052549 | Ga0068867_1000525492 | 205 |
| 402 | 3300005466 | Ga0070685_10011297 | Ga0070685_100112972 | 205 |
| 403 | 3300005539 | Ga0068853_100201445 | Ga0068853_1002014452 | 205 |
| 404 | 3300005543 | Ga0070672_100145172 | Ga0070672_1001451722 | 205 |
| 405 | 3300005544 | Ga0070686_100021445 | Ga0070686_1000214455 | 205 |
| 406 | 3300005548 | Ga0070665_100064426 | Ga0070665_1000644263 | 205 |
| 407 | 3300005548 | Ga0070665_100795005 | Ga0070665_1007950052 | 205 |
| 408 | 3300005563 | Ga0068855_100011710 | Ga0068855_1000117108 | 205 |
| 409 | 3300005577 | Ga0068857_100029926 | Ga0068857_1000299262 | 205 |
| 410 | 3300005616 | Ga0068852_100008530 | Ga0068852_1000085305 | 205 |
| 411 | 3300005617 | Ga0068859_100144709 | Ga0068859_1001447093 | 205 |
| 412 | 3300005718 | Ga0068866_10079475 | Ga0068866_100794753 | 205 |
| 413 | 3300005719 | Ga0068861_100595517 | Ga0068861_1005955171 | 205 |
| 414 | 3300006881 | Ga0068865_100698612 | Ga0068865_1006986121 | 205 |
| 415 | 3300006931 | Ga0097620_100144727 | Ga0097620_1001447273 | 205 |
| 416 | 3300007076 | Ga0075435_100440179 | Ga0075435_1004401792 | 205 |
| 417 | 3300009098 | Ga0105245_10594066 | Ga0105245_105940662 | 205 |
| 418 | 3300009101 | Ga0105247_10035298 | Ga0105247_100352983 | 205 |
| 419 | 3300009101 | Ga0105247_10237445 | Ga0105247_102374452 | 205 |
| 420 | 3300009148 | Ga0105243_10172090 | Ga0105243_101720902 | 205 |
| 421 | 3300009174 | Ga0105241_10014840 | Ga0105241_100148405 | 205 |
| 422 | 3300009174 | Ga0105241_10404082 | Ga0105241_104040822 | 205 |
| 423 | 3300009177 | Ga0105248_10434349 | Ga0105248_104343492 | 205 |
| 424 | 3300009545 | Ga0105237_10222456 | Ga0105237_102224562 | 205 |
| 425 | 3300009553 | Ga0105249_10387775 | Ga0105249_103877751 | 205 |
| 426 | 3300009553 | Ga0105249_10620383 | Ga0105249_106203832 | 205 |
| 427 | 3300009553 | Ga0105249_10786199 | Ga0105249_107861992 | 205 |
| 428 | 3300011119 | Ga0105246_10093612 | Ga0105246_100936123 | 205 |
| 429 | 3300013102 | Ga0157371_10016668 | Ga0157371_100166686 | 205 |
| 430 | 3300013104 | Ga0157370_10013414 | Ga0157370_100134146 | 205 |
| 431 | 3300013297 | Ga0157378_10013498 | Ga0157378_1001349810 | 205 |
| 432 | 3300013306 | Ga0163162_10091938 | Ga0163162_100919383 | 205 |
| 433 | 3300013307 | Ga0157372_10024794 | Ga0157372_100247948 | 205 |
| 434 | 3300013308 | Ga0157375_10011914 | Ga0157375_100119149 | 205 |
| 435 | 3300013308 | Ga0157375_10685619 | Ga0157375_106856191 | 205 |
| 436 | 3300014325 | Ga0163163_10160285 | Ga0163163_101602852 | 205 |
| 437 | 3300014325 | Ga0163163_10227792 | Ga0163163_102277922 | 205 |
| 438 | 3300014325 | Ga0163163_10400319 | Ga0163163_104003192 | 205 |
| 439 | 3300014325 | Ga0163163_10516990 | Ga0163163_105169902 | 205 |
| 440 | 3300014969 | Ga0157376_10009435 | Ga0157376_100094353 | 205 |
| 441 | 3300014969 | Ga0157376_10381715 | Ga0157376_103817153 | 205 |
| 442 | 3300017792 | Ga0163161_10041795 | Ga0163161_100417952 | 205 |
| 443 | 3300025297 | Ga0209758_1000028 | Ga0209758_10000289 | 205 |
| 444 | 3300025893 | Ga0207682_10000200 | Ga0207682_1000020023 | 205 |
| 445 | 3300025899 | Ga0207642_10023803 | Ga0207642_100238033 | 205 |
| 446 | 3300025900 | Ga0207710_10055447 | Ga0207710_100554474 | 205 |
| 447 | 3300025901 | Ga0207688_10007988 | Ga0207688_100079886 | 205 |
| 448 | 3300025907 | Ga0207645_10005680 | Ga0207645_100056807 | 205 |
| 449 | 3300025918 | Ga0207662_10023087 | Ga0207662_100230872 | 205 |
| 450 | 3300025920 | Ga0207649_10258133 | Ga0207649_102581332 | 205 |
| 451 | 3300025923 | Ga0207681_10008085 | Ga0207681_100080855 | 205 |
| 452 | 3300025925 | Ga0207650_10025926 | Ga0207650_100259262 | 205 |
| 453 | 3300025925 | Ga0207650_10268444 | Ga0207650_102684442 | 205 |
| 454 | 3300025926 | Ga0207659_10135529 | Ga0207659_101355293 | 205 |
| 455 | 3300025926 | Ga0207659_10671534 | Ga0207659_106715341 | 205 |
| 456 | 3300025933 | Ga0207706_10271376 | Ga0207706_102713761 | 205 |
| 457 | 3300025935 | Ga0207709_10122222 | Ga0207709_101222223 | 205 |
| 458 | 3300025936 | Ga0207670_10412984 | Ga0207670_104129841 | 205 |
| 459 | 3300025938 | Ga0207704_10263159 | Ga0207704_102631592 | 205 |
| 460 | 3300025940 | Ga0207691_10002205 | Ga0207691_1000220515 | 205 |
| 461 | 3300025941 | Ga0207711_10428611 | Ga0207711_104286112 | 205 |
| 462 | 3300025942 | Ga0207689_10056790 | Ga0207689_100567902 | 205 |
| 463 | 3300025945 | Ga0207679_10304856 | Ga0207679_103048562 | 205 |
| 464 | 3300025945 | Ga0207679_10477804 | Ga0207679_104778042 | 205 |
| 465 | 3300025949 | Ga0207667_10387452 | Ga0207667_103874522 | 205 |
| 466 | 3300025960 | Ga0207651_10407723 | Ga0207651_104077232 | 205 |
| 467 | 3300025961 | Ga0207712_10254036 | Ga0207712_102540361 | 205 |
| 468 | 3300026067 | Ga0207678_10442451 | Ga0207678_104424511 | 205 |
| 469 | 3300026075 | Ga0207708_10004234 | Ga0207708_100042346 | 205 |
| 470 | 3300026075 | Ga0207708_10351510 | Ga0207708_103515102 | 205 |
| 471 | 3300026078 | Ga0207702_10061501 | Ga0207702_100615013 | 205 |
| 472 | 3300026089 | Ga0207648_10005468 | Ga0207648_100054684 | 205 |
| 473 | 3300026095 | Ga0207676_10209472 | Ga0207676_102094723 | 205 |
| 474 | 3300026095 | Ga0207676_10542282 | Ga0207676_105422822 | 205 |
| 475 | 3300026116 | Ga0207674_10032125 | Ga0207674_100321255 | 205 |
| 476 | 3300026118 | Ga0207675_100205047 | Ga0207675_1002050473 | 205 |
| 477 | 3300026121 | Ga0207683_10008639 | Ga0207683_100086398 | 205 |
| 478 | 3300026142 | Ga0207698_10068167 | Ga0207698_100681672 | 205 |
| 479 | 3300027682 | Ga0209971_1021207 | Ga0209971_10212071 | 205 |
| 480 | 3300028379 | Ga0268266_10094215 | Ga0268266_100942153 | 205 |
| 481 | 3300028577 | Ga0265318_10001593 | Ga0265318_100015932 | 205 |
| 482 | 3300028577 | Ga0265318_10035734 | Ga0265318_100357342 | 205 |
| 483 | 3300031235 | Ga0265330_10135036 | Ga0265330_101350362 | 205 |
| 484 | 3300031238 | Ga0265332_10053204 | Ga0265332_100532043 | 205 |
| 485 | 3300031242 | Ga0265329_10015828 | Ga0265329_100158283 | 205 |
| 486 | 3300031247 | Ga0265340_10040744 | Ga0265340_100407442 | 205 |
| 487 | 3300031247 | Ga0265340_10121949 | Ga0265340_101219492 | 205 |
| 488 | 3300031250 | Ga0265331_10031059 | Ga0265331_100310593 | 205 |
| 489 | 3300031250 | Ga0265331_10060020 | Ga0265331_100600203 | 205 |
| 490 | 3300031344 | Ga0265316_10049879 | Ga0265316_100498792 | 205 |
| 491 | 3300031344 | Ga0265316_10356950 | Ga0265316_103569502 | 205 |
| 492 | 3300031595 | Ga0265313_10022625 | Ga0265313_100226254 | 205 |
| 493 | 3300031711 | Ga0265314_10094791 | Ga0265314_100947912 | 205 |
| 494 | 3300031711 | Ga0265314_10101375 | Ga0265314_101013753 | 205 |
| 495 | 3300031711 | Ga0265314_10209167 | Ga0265314_102091672 | 205 |
| 496 | 3300031712 | Ga0265342_10283987 | Ga0265342_102839872 | 205 |
| 497 | 3300034819 | Ga0373958_0025252 | Ga0373958_0025252_466_1104 | 205 |
| 498 | 3300035114 | Ga0373939_0210915 | Ga0373939_0210915_25_669 | 205 |
| 499 | 3300035171 | Ga0373946_0011244 | Ga0373946_0011244_1822_2460 | 205 |
| 500 | 3300035692 | Ga0373935_0022191 | Ga0373935_0022191_960_1598 | 205 |
| 501 | 3300035695 | Ga0373927_0054968 | Ga0373927_0054968_1052_1690 | 205 |
| 502 | 3300035725 | Ga0373947_0006153 | Ga0373947_0006153_3335_3973 | 205 |
| 503 | 3300037068 | Ga0373925_0004747 | Ga0373925_0004747_5385_6023 | 205 |
| 504 | 3300037312 | Ga0395899_0259027 | Ga0395899_0259027_69_704 | 205 |
| 505 | 3300037466 | Ga0395898_0349692 | Ga0395898_0349692_671_1306 | 205 |
| 506 | 3300037466 | Ga0395898_0833597 | Ga0395898_0833597_112_831 | 205 |
| 507 | 3300038443 | Ga0395901_0159813 | Ga0395901_0159813_1002_1637 | 205 |
| 508 | 3300046459 | Ga0495629_0000401 | Ga0495629_0000401_18750_19388 | 205 |
| 509 | 3300046461 | Ga0495641_0029113 | Ga0495641_0029113_1229_1867 | 205 |
| 510 | 3300046462 | Ga0495651_0281516 | Ga0495651_0281516_35_673 | 205 |
| 511 | 3300046475 | Ga0495639_0064197 | Ga0495639_0064197_800_1438 | 205 |
| 512 | 3300046499 | Ga0495594_0026038 | Ga0495594_0026038_629_1267 | 205 |
| 513 | 3300046531 | Ga0495665_0092618 | Ga0495665_0092618_525_1163 | 205 |
| 514 | 3300046537 | Ga0495598_0058399 | Ga0495598_0058399_303_935 | 205 |
| 515 | 3300046615 | Ga0495656_0396620 | Ga0495656_0396620_17_649 | 205 |
| 516 | 3300046681 | Ga0495647_0008543 | Ga0495647_0008543_1439_2077 | 205 |
| 517 | 3300046683 | Ga0495658_0000265 | Ga0495658_0000265_11405_12043 | 205 |
| 518 | 3300046689 | Ga0495613_0021477 | Ga0495613_0021477_3006_3644 | 205 |
| 519 | 3300047321 | Ga0495676_0028968 | Ga0495676_0028968_2319_2957 | 205 |
| 520 | 3300047673 | Ga0495593_0003423 | Ga0495593_0003423_8539_9177 | 205 |
| 521 | 3300048904 | Ga0496101_0044812 | Ga0496101_0044812_1157_1801 | 205 |
| 522 | 3300048907 | Ga0496104_0136526 | Ga0496104_0136526_367_1011 | 205 |
| 523 | 3300048908 | Ga0496105_0038287 | Ga0496105_0038287_615_1259 | 205 |
| 524 | 3300048909 | Ga0496106_0227089 | Ga0496106_0227089_732_1376 | 205 |
| 525 | 3300048910 | Ga0496107_0013051 | Ga0496107_0013051_3069_3713 | 205 |
| 526 | 3300048911 | Ga0496108_0058071 | Ga0496108_0058071_2446_3084 | 205 |
| 527 | 3300048911 | Ga0496108_0139528 | Ga0496108_0139528_436_1080 | 205 |
| 528 | 3300048912 | Ga0496109_0008666 | Ga0496109_0008666_2711_3355 | 205 |
| 529 | 3300048912 | Ga0496109_0043699 | Ga0496109_0043699_1859_2503 | 205 |
| 530 | 3300048913 | Ga0496110_0247311 | Ga0496110_0247311_15_653 | 205 |
| 531 | 3300048914 | Ga0496111_0022126 | Ga0496111_0022126_53_691 | 205 |
| 532 | 3300048915 | Ga0496112_0166700 | Ga0496112_0166700_452_1096 | 205 |
| 533 | 3300048915 | Ga0496112_0456718 | Ga0496112_0456718_457_1095 | 205 |
| 534 | 3300048918 | Ga0496115_0058628 | Ga0496115_0058628_522_1166 | 205 |
| 535 | 3300049569 | Ga0501032_0280731 | Ga0501032_0280731_136_771 | 205 |
| 536 | 3300049571 | Ga0501034_0016923 | Ga0501034_0016923_848_1483 | 205 |
| 537 | 3300049571 | Ga0501034_0032939 | Ga0501034_0032939_821_1456 | 205 |
| 538 | 3300049571 | Ga0501034_0180502 | Ga0501034_0180502_1200_1835 | 205 |
| 539 | 3300049573 | Ga0501037_0120258 | Ga0501037_0120258_748_1383 | 205 |
| 540 | 3300049580 | Ga0501046_0035794 | Ga0501046_0035794_1320_1955 | 205 |
| 541 | 3300049582 | Ga0501048_0151176 | Ga0501048_0151176_645_1280 | 205 |
| 542 | 3300049583 | Ga0501067_0048871 | Ga0501067_0048871_1505_2140 | 205 |
| 543 | 3300049584 | Ga0501068_0032227 | Ga0501068_0032227_606_1241 | 205 |
| 544 | 3300049584 | Ga0501068_0511333 | Ga0501068_0511333_68_697 | 205 |
| 545 | 3300049586 | Ga0501070_0089148 | Ga0501070_0089148_981_1616 | 205 |
| 546 | 3300049588 | Ga0501072_0755433 | Ga0501072_0755433_67_696 | 205 |
| 547 | 3300049590 | Ga0501074_0196429 | Ga0501074_0196429_705_1340 | 205 |
| 548 | 3300049742 | Ga0501080_0133865 | Ga0501080_0133865_1438_2073 | 205 |
| 549 | 3300049744 | Ga0501083_0148457 | Ga0501083_0148457_367_984 | 205 |
| 550 | 3300049823 | Ga0501044_0007150 | Ga0501044_0007150_2325_2960 | 205 |
| 551 | 3300050512 | nmdc:mga0n895_45294_c1 | nmdc:mga0n895_45294_c1_1859_2503 | 205 |
| 552 | 3300053085 | Ga0495619_0000164 | Ga0495619_0000164_16739_17377 | 205 |
| 553 | 3300054114 | Ga0501084_0211154 | Ga0501084_0211154_504_1139 | 205 |
| 554 | 3300003659 | JGI25404J52841_10010937 | JGI25404J52841_100109373 | 206 |
| 555 | 3300005333 | Ga0070677_10266966 | Ga0070677_102669661 | 206 |
| 556 | 3300005339 | Ga0070660_100044880 | Ga0070660_1000448802 | 206 |
| 557 | 3300005457 | Ga0070662_100009002 | Ga0070662_1000090022 | 206 |
| 558 | 3300005458 | Ga0070681_10027494 | Ga0070681_100274942 | 206 |
| 559 | 3300005530 | Ga0070679_100129273 | Ga0070679_1001292732 | 206 |
| 560 | 3300005564 | Ga0070664_100061077 | Ga0070664_1000610773 | 206 |
| 561 | 3300005614 | Ga0068856_100390563 | Ga0068856_1003905632 | 206 |
| 562 | 3300005616 | Ga0068852_100932758 | Ga0068852_1009327582 | 206 |
| 563 | 3300005983 | Ga0081540_1000462 | Ga0081540_10004629 | 206 |
| 564 | 3300006177 | Ga0075362_10003309 | Ga0075362_100033095 | 206 |
| 565 | 3300006195 | Ga0075366_10006005 | Ga0075366_100060055 | 206 |
| 566 | 3300006358 | Ga0068871_100225212 | Ga0068871_1002252122 | 206 |
| 567 | 3300013307 | Ga0157372_10462668 | Ga0157372_104626681 | 206 |
| 568 | 3300025893 | Ga0207682_10345867 | Ga0207682_103458671 | 206 |
| 569 | 3300025911 | Ga0207654_10505547 | Ga0207654_105055471 | 206 |
| 570 | 3300025917 | Ga0207660_10500188 | Ga0207660_105001882 | 206 |
| 571 | 3300025919 | Ga0207657_10125508 | Ga0207657_101255081 | 206 |
| 572 | 3300025921 | Ga0207652_10109912 | Ga0207652_101099122 | 206 |
| 573 | 3300025933 | Ga0207706_10014123 | Ga0207706_100141235 | 206 |
| 574 | 3300025945 | Ga0207679_10038500 | Ga0207679_100385003 | 206 |
| 575 | 3300049569 | Ga0501032_0003009 | Ga0501032_0003009_5006_5677 | 206 |
| 576 | 3300049570 | Ga0501033_0013087 | Ga0501033_0013087_4765_5436 | 206 |
| 577 | 3300049571 | Ga0501034_0006092 | Ga0501034_0006092_5058_5729 | 206 |
| 578 | 3300049571 | Ga0501034_0023919 | Ga0501034_0023919_1848_2495 | 206 |
| 579 | 3300049572 | Ga0501036_0018194 | Ga0501036_0018194_3366_4037 | 206 |
| 580 | 3300049572 | Ga0501036_0400644 | Ga0501036_0400644_485_1117 | 206 |
| 581 | 3300049573 | Ga0501037_0005542 | Ga0501037_0005542_3226_3897 | 206 |
| 582 | 3300049574 | Ga0501038_0008694 | Ga0501038_0008694_4972_5643 | 206 |
| 583 | 3300049574 | Ga0501038_0101294 | Ga0501038_0101294_683_1330 | 206 |
| 584 | 3300049574 | Ga0501038_0341746 | Ga0501038_0341746_160_804 | 206 |
| 585 | 3300049575 | Ga0501039_0099656 | Ga0501039_0099656_1131_1802 | 206 |
| 586 | 3300049579 | Ga0501043_0004706 | Ga0501043_0004706_6879_7550 | 206 |
| 587 | 3300049579 | Ga0501043_0263384 | Ga0501043_0263384_304_951 | 206 |
| 588 | 3300049581 | Ga0501047_0003479 | Ga0501047_0003479_7404_8075 | 206 |
| 589 | 3300049581 | Ga0501047_0297701 | Ga0501047_0297701_58_705 | 206 |
| 590 | 3300049582 | Ga0501048_0059739 | Ga0501048_0059739_1733_2404 | 206 |
| 591 | 3300049584 | Ga0501068_0068477 | Ga0501068_0068477_1373_2044 | 206 |
| 592 | 3300049585 | Ga0501069_0006105 | Ga0501069_0006105_1744_2415 | 206 |
| 593 | 3300049586 | Ga0501070_0011792 | Ga0501070_0011792_821_1492 | 206 |
| 594 | 3300049589 | Ga0501073_0002727 | Ga0501073_0002727_5165_5836 | 206 |
| 595 | 3300049590 | Ga0501074_0002406 | Ga0501074_0002406_6448_7119 | 206 |
| 596 | 3300049592 | Ga0501076_0240920 | Ga0501076_0240920_295_939 | 206 |
| 597 | 3300049742 | Ga0501080_0002491 | Ga0501080_0002491_6762_7433 | 206 |
| 598 | 3300049742 | Ga0501080_0254339 | Ga0501080_0254339_789_1415 | 206 |
| 599 | 3300049822 | Ga0501035_0002087 | Ga0501035_0002087_6493_7164 | 206 |
| 600 | 3300049822 | Ga0501035_0150278 | Ga0501035_0150278_936_1583 | 206 |
| 601 | 3300049823 | Ga0501044_0008252 | Ga0501044_0008252_5274_5921 | 206 |
| 602 | 3300050489 | nmdc:mga03683_6724_c1 | nmdc:mga03683_6724_c1_2475_3119 | 206 |
| 603 | 3300050491 | nmdc:mga00v17_123433_c1 | nmdc:mga00v17_123433_c1_905_1549 | 206 |
| 604 | 3300050493 | nmdc:mga0k408_5967_c1 | nmdc:mga0k408_5967_c1_4587_5231 | 206 |
| 605 | 3300050496 | nmdc:mga07m45_93628_c1 | nmdc:mga07m45_93628_c1_369_1013 | 206 |
| 606 | 3300053077 | Ga0495601_0316942 | Ga0495601_0316942_119_757 | 206 |
| 607 | 3300053078 | Ga0495612_0021700 | Ga0495612_0021700_1928_2566 | 206 |
| 608 | 3300053085 | Ga0495619_0203405 | Ga0495619_0203405_518_1156 | 206 |
| 609 | 3300054114 | Ga0501084_0209256 | Ga0501084_0209256_894_1565 | 206 |
| 610 | 3300005530 | Ga0070679_100208362 | Ga0070679_1002083623 | 207 |
| 611 | 3300005843 | Ga0068860_100435755 | Ga0068860_1004357552 | 207 |
| 612 | 3300005937 | Ga0081455_10248818 | Ga0081455_102488182 | 207 |
| 613 | 3300005981 | Ga0081538_10061201 | Ga0081538_100612012 | 207 |
| 614 | 3300006038 | Ga0075365_10167953 | Ga0075365_101679533 | 207 |
| 615 | 3300006038 | Ga0075365_10228041 | Ga0075365_102280412 | 207 |
| 616 | 3300006042 | Ga0075368_10037214 | Ga0075368_100372144 | 207 |
| 617 | 3300006042 | Ga0075368_10107303 | Ga0075368_101073032 | 207 |
| 618 | 3300006048 | Ga0075363_100143012 | Ga0075363_1001430122 | 207 |
| 619 | 3300006051 | Ga0075364_10413132 | Ga0075364_104131322 | 207 |
| 620 | 3300006177 | Ga0075362_10094065 | Ga0075362_100940652 | 207 |
| 621 | 3300006178 | Ga0075367_10092400 | Ga0075367_100924002 | 207 |
| 622 | 3300006186 | Ga0075369_10008060 | Ga0075369_100080604 | 207 |
| 623 | 3300006195 | Ga0075366_10109524 | Ga0075366_101095242 | 207 |
| 624 | 3300006852 | Ga0075433_10067681 | Ga0075433_100676812 | 207 |
| 625 | 3300006871 | Ga0075434_100019269 | Ga0075434_1000192695 | 207 |
| 626 | 3300007076 | Ga0075435_100486817 | Ga0075435_1004868171 | 207 |
| 627 | 3300009094 | Ga0111539_10048837 | Ga0111539_100488375 | 207 |
| 628 | 3300011119 | Ga0105246_10185487 | Ga0105246_101854872 | 207 |
| 629 | 3300013297 | Ga0157378_10133492 | Ga0157378_101334922 | 207 |
| 630 | 3300013297 | Ga0157378_10279934 | Ga0157378_102799343 | 207 |
| 631 | 3300014968 | Ga0157379_10258154 | Ga0157379_102581542 | 207 |
| 632 | 3300014969 | Ga0157376_10189844 | Ga0157376_101898443 | 207 |
| 633 | 3300025921 | Ga0207652_10391066 | Ga0207652_103910662 | 207 |
| 634 | 3300027866 | Ga0209813_10044478 | Ga0209813_100444781 | 207 |
| 635 | 3300027907 | Ga0207428_10148445 | Ga0207428_101484452 | 207 |
| 636 | 3300035242 | Ga0373962_0125778 | Ga0373962_0125778_20_661 | 207 |
| 637 | 3300035691 | Ga0373931_0165434 | Ga0373931_0165434_172_813 | 207 |
| 638 | 3300044712 | Ga0453684_0569639 | Ga0453684_0569639_584_1222 | 207 |
| 639 | 3300045976 | Ga0466967_0109578 | Ga0466967_0109578_905_1555 | 207 |
| 640 | 3300046454 | Ga0495592_0076095 | Ga0495592_0076095_919_1563 | 207 |
| 641 | 3300046459 | Ga0495629_0207070 | Ga0495629_0207070_62_706 | 207 |
| 642 | 3300046511 | Ga0495608_0077938 | Ga0495608_0077938_1368_2012 | 207 |
| 643 | 3300046516 | Ga0495628_0575487 | Ga0495628_0575487_132_776 | 207 |
| 644 | 3300046529 | Ga0495652_0058677 | Ga0495652_0058677_1850_2494 | 207 |
| 645 | 3300046533 | Ga0495640_0040573 | Ga0495640_0040573_1873_2517 | 207 |
| 646 | 3300046642 | Ga0495634_0048969 | Ga0495634_0048969_1613_2257 | 207 |
| 647 | 3300046663 | Ga0495635_0008556 | Ga0495635_0008556_1571_2215 | 207 |
| 648 | 3300046809 | Ga0495600_0145298 | Ga0495600_0145298_185_829 | 207 |
| 649 | 3300047317 | Ga0495604_0128590 | Ga0495604_0128590_112_756 | 207 |
| 650 | 3300047319 | Ga0495674_0029493 | Ga0495674_0029493_3207_3851 | 207 |
| 651 | 3300047322 | Ga0495680_0006959 | Ga0495680_0006959_3599_4243 | 207 |
| 652 | 3300048088 | Ga0495602_0451316 | Ga0495602_0451316_118_753 | 207 |
| 653 | 3300048907 | Ga0496104_0121789 | Ga0496104_0121789_616_1257 | 207 |
| 654 | 3300048909 | Ga0496106_0046732 | Ga0496106_0046732_1993_2634 | 207 |
| 655 | 3300048913 | Ga0496110_0320106 | Ga0496110_0320106_150_791 | 207 |
| 656 | 3300049568 | Ga0501031_0019928 | Ga0501031_0019928_1171_1812 | 207 |
| 657 | 3300049569 | Ga0501032_0035806 | Ga0501032_0035806_1424_2065 | 207 |
| 658 | 3300049570 | Ga0501033_0012065 | Ga0501033_0012065_636_1277 | 207 |
| 659 | 3300049572 | Ga0501036_0081797 | Ga0501036_0081797_1367_2008 | 207 |
| 660 | 3300049573 | Ga0501037_0047366 | Ga0501037_0047366_2236_2877 | 207 |
| 661 | 3300049574 | Ga0501038_0050643 | Ga0501038_0050643_293_934 | 207 |
| 662 | 3300049575 | Ga0501039_0039751 | Ga0501039_0039751_976_1617 | 207 |
| 663 | 3300049575 | Ga0501039_0206374 | Ga0501039_0206374_885_1520 | 207 |
| 664 | 3300049578 | Ga0501042_0469204 | Ga0501042_0469204_197_859 | 207 |
| 665 | 3300049580 | Ga0501046_0199710 | Ga0501046_0199710_444_1085 | 207 |
| 666 | 3300049582 | Ga0501048_0119077 | Ga0501048_0119077_453_1094 | 207 |
| 667 | 3300049586 | Ga0501070_0055774 | Ga0501070_0055774_201_842 | 207 |
| 668 | 3300049588 | Ga0501072_0011656 | Ga0501072_0011656_5916_6638 | 207 |
| 669 | 3300049593 | Ga0501077_0038193 | Ga0501077_0038193_2049_2684 | 207 |
| 670 | 3300049741 | Ga0501079_0026067 | Ga0501079_0026067_3694_4329 | 207 |
| 671 | 3300049743 | Ga0501081_0154907 | Ga0501081_0154907_673_1308 | 207 |
| 672 | 3300049823 | Ga0501044_0136143 | Ga0501044_0136143_676_1317 | 207 |
| 673 | 3300050490 | nmdc:mga03n38_99775_c1 | nmdc:mga03n38_99775_c1_122_766 | 207 |
| 674 | 3300050491 | nmdc:mga00v17_202229_c1 | nmdc:mga00v17_202229_c1_21_665 | 207 |
| 675 | 3300050492 | nmdc:mga0yw44_116719_c1 | nmdc:mga0yw44_116719_c1_659_1303 | 207 |
| 676 | 3300050493 | nmdc:mga0k408_23023_c1 | nmdc:mga0k408_23023_c1_2357_3001 | 207 |
| 677 | 3300050493 | nmdc:mga0k408_31378_c1 | nmdc:mga0k408_31378_c1_677_1321 | 207 |
| 678 | 3300050494 | nmdc:mga06z11_457316_c1 | nmdc:mga06z11_457316_c1_40_684 | 207 |
| 679 | 3300050494 | nmdc:mga06z11_69648_c1 | nmdc:mga06z11_69648_c1_666_1310 | 207 |
| 680 | 3300050496 | nmdc:mga07m45_12111_c1 | nmdc:mga07m45_12111_c1_2912_3556 | 207 |
| 681 | 3300050496 | nmdc:mga07m45_231716_c1 | nmdc:mga07m45_231716_c1_105_749 | 207 |
| 682 | 3300050496 | nmdc:mga07m45_63242_c1 | nmdc:mga07m45_63242_c1_185_829 | 207 |
| 683 | 3300050511 | nmdc:mga08y16_141077_c1 | nmdc:mga08y16_141077_c1_1203_1844 | 207 |
| 684 | 3300050512 | nmdc:mga0n895_202634_c1 | nmdc:mga0n895_202634_c1_708_1349 | 207 |
| 685 | 3300050515 | nmdc:mga0a205_19489_c1 | nmdc:mga0a205_19489_c1_4524_5165 | 207 |
| 686 | 3300050516 | nmdc:mga0sz30_116538_c1 | nmdc:mga0sz30_116538_c1_400_1044 | 207 |
| 687 | 3300053077 | Ga0495601_0038174 | Ga0495601_0038174_1569_2213 | 207 |
| 688 | 3300053078 | Ga0495612_0068978 | Ga0495612_0068978_416_1060 | 207 |
| 689 | 3300053084 | Ga0495595_0012363 | Ga0495595_0012363_2199_2843 | 207 |
| 690 | 3300053085 | Ga0495619_0000016 | Ga0495619_0000016_16994_17638 | 207 |
| 691 | 3300053096 | Ga0500641_0010930 | Ga0500641_0010930_858_1502 | 207 |
| 692 | 2162886007 | SwRhRL2b_contig_1582902 | SwRhRL2b_0037.00006380 | 208 |
| 693 | 2209111006 | 2214939635 | 2214002959 | 208 |
| 694 | 3300000042 | ARSoilYngRDRAFT_c00360 | ARSoilYngRDRAFT_003603 | 208 |
| 695 | 3300000043 | ARcpr5yngRDRAFT_c000225 | ARcpr5yngRDRAFT_0002258 | 208 |
| 696 | 3300000044 | ARSoilOldRDRAFT_c000119 | ARSoilOldRDRAFT_00011911 | 208 |
| 697 | 3300000652 | ARCol0yngRDRAFT_1000365 | ARCol0yngRDRAFT_10003653 | 208 |
| 698 | 3300002459 | JGI24751J29686_10025198 | JGI24751J29686_100251982 | 208 |
| 699 | 3300003911 | JGI25405J52794_10017989 | JGI25405J52794_100179892 | 208 |
| 700 | 3300005276 | Ga0065717_1002139 | Ga0065717_10021392 | 208 |
| 701 | 3300005277 | Ga0065716_1001608 | Ga0065716_10016088 | 208 |
| 702 | 3300005289 | Ga0065704_10105710 | Ga0065704_101057102 | 208 |
| 703 | 3300005293 | Ga0065715_10144144 | Ga0065715_101441442 | 208 |
| 704 | 3300005293 | Ga0065715_10282375 | Ga0065715_102823751 | 208 |
| 705 | 3300005295 | Ga0065707_10090693 | Ga0065707_100906933 | 208 |
| 706 | 3300005328 | Ga0070676_10061003 | Ga0070676_100610032 | 208 |
| 707 | 3300005330 | Ga0070690_100033018 | Ga0070690_1000330182 | 208 |
| 708 | 3300005331 | Ga0070670_100011983 | Ga0070670_1000119837 | 208 |
| 709 | 3300005331 | Ga0070670_100290620 | Ga0070670_1002906203 | 208 |
| 710 | 3300005334 | Ga0068869_100252571 | Ga0068869_1002525712 | 208 |
| 711 | 3300005335 | Ga0070666_10178099 | Ga0070666_101780992 | 208 |
| 712 | 3300005337 | Ga0070682_100137007 | Ga0070682_1001370072 | 208 |
| 713 | 3300005339 | Ga0070660_100192648 | Ga0070660_1001926482 | 208 |
| 714 | 3300005339 | Ga0070660_100418205 | Ga0070660_1004182051 | 208 |
| 715 | 3300005340 | Ga0070689_100228563 | Ga0070689_1002285632 | 208 |
| 716 | 3300005341 | Ga0070691_10003914 | Ga0070691_100039145 | 208 |
| 717 | 3300005343 | Ga0070687_100109504 | Ga0070687_1001095042 | 208 |
| 718 | 3300005343 | Ga0070687_100200186 | Ga0070687_1002001862 | 208 |
| 719 | 3300005345 | Ga0070692_10060793 | Ga0070692_100607932 | 208 |
| 720 | 3300005345 | Ga0070692_10367334 | Ga0070692_103673342 | 208 |
| 721 | 3300005347 | Ga0070668_100114077 | Ga0070668_1001140772 | 208 |
| 722 | 3300005347 | Ga0070668_100437240 | Ga0070668_1004372402 | 208 |
| 723 | 3300005353 | Ga0070669_100219278 | Ga0070669_1002192782 | 208 |
| 724 | 3300005353 | Ga0070669_100535922 | Ga0070669_1005359221 | 208 |
| 725 | 3300005354 | Ga0070675_100087493 | Ga0070675_1000874933 | 208 |
| 726 | 3300005355 | Ga0070671_100066953 | Ga0070671_1000669533 | 208 |
| 727 | 3300005356 | Ga0070674_100121467 | Ga0070674_1001214672 | 208 |
| 728 | 3300005364 | Ga0070673_100286459 | Ga0070673_1002864591 | 208 |
| 729 | 3300005365 | Ga0070688_100025018 | Ga0070688_1000250183 | 208 |
| 730 | 3300005365 | Ga0070688_100043897 | Ga0070688_1000438974 | 208 |
| 731 | 3300005366 | Ga0070659_100127450 | Ga0070659_1001274502 | 208 |
| 732 | 3300005366 | Ga0070659_100378869 | Ga0070659_1003788692 | 208 |
| 733 | 3300005367 | Ga0070667_100352910 | Ga0070667_1003529102 | 208 |
| 734 | 3300005367 | Ga0070667_100454556 | Ga0070667_1004545562 | 208 |
| 735 | 3300005406 | Ga0070703_10069324 | Ga0070703_100693242 | 208 |
| 736 | 3300005436 | Ga0070713_100850202 | Ga0070713_1008502021 | 208 |
| 737 | 3300005437 | Ga0070710_10340530 | Ga0070710_103405302 | 208 |
| 738 | 3300005438 | Ga0070701_10041651 | Ga0070701_100416512 | 208 |
| 739 | 3300005438 | Ga0070701_10063229 | Ga0070701_100632292 | 208 |
| 740 | 3300005440 | Ga0070705_100438681 | Ga0070705_1004386812 | 208 |
| 741 | 3300005441 | Ga0070700_100165045 | Ga0070700_1001650451 | 208 |
| 742 | 3300005441 | Ga0070700_100561300 | Ga0070700_1005613001 | 208 |
| 743 | 3300005445 | Ga0070708_100625087 | Ga0070708_1006250872 | 208 |
| 744 | 3300005455 | Ga0070663_100093127 | Ga0070663_1000931272 | 208 |
| 745 | 3300005456 | Ga0070678_100041947 | Ga0070678_1000419471 | 208 |
| 746 | 3300005459 | Ga0068867_100045681 | Ga0068867_1000456811 | 208 |
| 747 | 3300005459 | Ga0068867_100445852 | Ga0068867_1004458522 | 208 |
| 748 | 3300005466 | Ga0070685_10206135 | Ga0070685_102061352 | 208 |
| 749 | 3300005535 | Ga0070684_100098312 | Ga0070684_1000983122 | 208 |
| 750 | 3300005535 | Ga0070684_100236131 | Ga0070684_1002361313 | 208 |
| 751 | 3300005543 | Ga0070672_100205077 | Ga0070672_1002050772 | 208 |
| 752 | 3300005543 | Ga0070672_100297961 | Ga0070672_1002979612 | 208 |
| 753 | 3300005544 | Ga0070686_100255154 | Ga0070686_1002551542 | 208 |
| 754 | 3300005544 | Ga0070686_100480662 | Ga0070686_1004806621 | 208 |
| 755 | 3300005545 | Ga0070695_100013226 | Ga0070695_1000132262 | 208 |
| 756 | 3300005547 | Ga0070693_100427682 | Ga0070693_1004276821 | 208 |
| 757 | 3300005548 | Ga0070665_100600274 | Ga0070665_1006002742 | 208 |
| 758 | 3300005563 | Ga0068855_100287977 | Ga0068855_1002879773 | 208 |
| 759 | 3300005564 | Ga0070664_100104300 | Ga0070664_1001043001 | 208 |
| 760 | 3300005564 | Ga0070664_100178405 | Ga0070664_1001784052 | 208 |
| 761 | 3300005578 | Ga0068854_100067161 | Ga0068854_1000671614 | 208 |
| 762 | 3300005614 | Ga0068856_100501928 | Ga0068856_1005019281 | 208 |
| 763 | 3300005615 | Ga0070702_100056799 | Ga0070702_1000567992 | 208 |
| 764 | 3300005617 | Ga0068859_100275925 | Ga0068859_1002759252 | 208 |
| 765 | 3300005618 | Ga0068864_100100636 | Ga0068864_1001006364 | 208 |
| 766 | 3300005618 | Ga0068864_100446564 | Ga0068864_1004465643 | 208 |
| 767 | 3300005718 | Ga0068866_10124912 | Ga0068866_101249122 | 208 |
| 768 | 3300005719 | Ga0068861_100091363 | Ga0068861_1000913632 | 208 |
| 769 | 3300005719 | Ga0068861_100653010 | Ga0068861_1006530101 | 208 |
| 770 | 3300005840 | Ga0068870_10281964 | Ga0068870_102819642 | 208 |
| 771 | 3300005841 | Ga0068863_100301030 | Ga0068863_1003010301 | 208 |
| 772 | 3300005842 | Ga0068858_100060995 | Ga0068858_1000609952 | 208 |
| 773 | 3300005842 | Ga0068858_100242083 | Ga0068858_1002420832 | 208 |
| 774 | 3300005842 | Ga0068858_100357213 | Ga0068858_1003572133 | 208 |
| 775 | 3300005843 | Ga0068860_100246815 | Ga0068860_1002468152 | 208 |
| 776 | 3300005844 | Ga0068862_100057501 | Ga0068862_1000575012 | 208 |
| 777 | 3300005844 | Ga0068862_100657071 | Ga0068862_1006570712 | 208 |
| 778 | 3300005844 | Ga0068862_100883331 | Ga0068862_1008833312 | 208 |
| 779 | 3300005937 | Ga0081455_10004090 | Ga0081455_1000409023 | 208 |
| 780 | 3300005937 | Ga0081455_10014407 | Ga0081455_100144077 | 208 |
| 781 | 3300006038 | Ga0075365_10091217 | Ga0075365_100912174 | 208 |
| 782 | 3300006038 | Ga0075365_10342195 | Ga0075365_103421952 | 208 |
| 783 | 3300006058 | Ga0075432_10006405 | Ga0075432_100064055 | 208 |
| 784 | 3300006163 | Ga0070715_10146164 | Ga0070715_101461642 | 208 |
| 785 | 3300006163 | Ga0070715_10328261 | Ga0070715_103282612 | 208 |
| 786 | 3300006175 | Ga0070712_100830729 | Ga0070712_1008307291 | 208 |
| 787 | 3300006194 | Ga0075427_10000106 | Ga0075427_100001067 | 208 |
| 788 | 3300006237 | Ga0097621_101075032 | Ga0097621_1010750321 | 208 |
| 789 | 3300006358 | Ga0068871_100238983 | Ga0068871_1002389832 | 208 |
| 790 | 3300006844 | Ga0075428_100167486 | Ga0075428_1001674862 | 208 |
| 791 | 3300006846 | Ga0075430_100001330 | Ga0075430_10000133013 | 208 |
| 792 | 3300006852 | Ga0075433_10085555 | Ga0075433_100855552 | 208 |
| 793 | 3300006852 | Ga0075433_10171968 | Ga0075433_101719682 | 208 |
| 794 | 3300006871 | Ga0075434_100000576 | Ga0075434_1000005766 | 208 |
| 795 | 3300006871 | Ga0075434_100103936 | Ga0075434_1001039364 | 208 |
| 796 | 3300006871 | Ga0075434_100242820 | Ga0075434_1002428201 | 208 |
| 797 | 3300006871 | Ga0075434_100770009 | Ga0075434_1007700091 | 208 |
| 798 | 3300006880 | Ga0075429_100007164 | Ga0075429_10000716410 | 208 |
| 799 | 3300006881 | Ga0068865_100467606 | Ga0068865_1004676062 | 208 |
| 800 | 3300006931 | Ga0097620_100275924 | Ga0097620_1002759242 | 208 |
| 801 | 3300007076 | Ga0075435_100120409 | Ga0075435_1001204093 | 208 |
| 802 | 3300007076 | Ga0075435_100154816 | Ga0075435_1001548162 | 208 |
| 803 | 3300009036 | Ga0105244_10093715 | Ga0105244_100937152 | 208 |
| 804 | 3300009094 | Ga0111539_10000503 | Ga0111539_1000050345 | 208 |
| 805 | 3300009094 | Ga0111539_10012946 | Ga0111539_100129464 | 208 |
| 806 | 3300009094 | Ga0111539_10032473 | Ga0111539_100324732 | 208 |
| 807 | 3300009094 | Ga0111539_10367883 | Ga0111539_103678832 | 208 |
| 808 | 3300009101 | Ga0105247_10061991 | Ga0105247_100619914 | 208 |
| 809 | 3300009101 | Ga0105247_10364322 | Ga0105247_103643221 | 208 |
| 810 | 3300009147 | Ga0114129_10000621 | Ga0114129_1000062115 | 208 |
| 811 | 3300009147 | Ga0114129_10028547 | Ga0114129_1002854712 | 208 |
| 812 | 3300009148 | Ga0105243_10083172 | Ga0105243_100831723 | 208 |
| 813 | 3300009148 | Ga0105243_10900518 | Ga0105243_109005181 | 208 |
| 814 | 3300009174 | Ga0105241_10580444 | Ga0105241_105804441 | 208 |
| 815 | 3300009176 | Ga0105242_10652459 | Ga0105242_106524592 | 208 |
| 816 | 3300009177 | Ga0105248_10603722 | Ga0105248_106037222 | 208 |
| 817 | 3300009177 | Ga0105248_10766508 | Ga0105248_107665082 | 208 |
| 818 | 3300009545 | Ga0105237_10836595 | Ga0105237_108365952 | 208 |
| 819 | 3300009553 | Ga0105249_10177884 | Ga0105249_101778842 | 208 |
| 820 | 3300010375 | Ga0105239_10031440 | Ga0105239_100314404 | 208 |
| 821 | 3300010375 | Ga0105239_10592715 | Ga0105239_105927152 | 208 |
| 822 | 3300010375 | Ga0105239_10979124 | Ga0105239_109791242 | 208 |
| 823 | 3300011119 | Ga0105246_10087145 | Ga0105246_100871452 | 208 |
| 824 | 3300012491 | Ga0157329_1000769 | Ga0157329_10007692 | 208 |
| 825 | 3300012494 | Ga0157341_1000699 | Ga0157341_10006992 | 208 |
| 826 | 3300012505 | Ga0157339_1002176 | Ga0157339_10021762 | 208 |
| 827 | 3300013296 | Ga0157374_10454642 | Ga0157374_104546422 | 208 |
| 828 | 3300013296 | Ga0157374_10600383 | Ga0157374_106003832 | 208 |
| 829 | 3300013297 | Ga0157378_10244302 | Ga0157378_102443022 | 208 |
| 830 | 3300013306 | Ga0163162_10655107 | Ga0163162_106551072 | 208 |
| 831 | 3300013307 | Ga0157372_10400010 | Ga0157372_104000102 | 208 |
| 832 | 3300013308 | Ga0157375_10147638 | Ga0157375_101476383 | 208 |
| 833 | 3300013308 | Ga0157375_10630389 | Ga0157375_106303892 | 208 |
| 834 | 3300014325 | Ga0163163_10003968 | Ga0163163_1000396814 | 208 |
| 835 | 3300014326 | Ga0157380_10036059 | Ga0157380_100360592 | 208 |
| 836 | 3300014745 | Ga0157377_10149221 | Ga0157377_101492212 | 208 |
| 837 | 3300014968 | Ga0157379_10337997 | Ga0157379_103379972 | 208 |
| 838 | 3300025271 | Ga0207666_1000236 | Ga0207666_10002364 | 208 |
| 839 | 3300025315 | Ga0207697_10003202 | Ga0207697_100032024 | 208 |
| 840 | 3300025315 | Ga0207697_10158588 | Ga0207697_101585881 | 208 |
| 841 | 3300025885 | Ga0207653_10009654 | Ga0207653_100096543 | 208 |
| 842 | 3300025898 | Ga0207692_10106713 | Ga0207692_101067131 | 208 |
| 843 | 3300025900 | Ga0207710_10093045 | Ga0207710_100930453 | 208 |
| 844 | 3300025901 | Ga0207688_10181349 | Ga0207688_101813492 | 208 |
| 845 | 3300025903 | Ga0207680_10123522 | Ga0207680_101235222 | 208 |
| 846 | 3300025903 | Ga0207680_10183061 | Ga0207680_101830612 | 208 |
| 847 | 3300025904 | Ga0207647_10023709 | Ga0207647_100237092 | 208 |
| 848 | 3300025904 | Ga0207647_10026302 | Ga0207647_100263022 | 208 |
| 849 | 3300025907 | Ga0207645_10037887 | Ga0207645_100378872 | 208 |
| 850 | 3300025907 | Ga0207645_10148439 | Ga0207645_101484392 | 208 |
| 851 | 3300025911 | Ga0207654_10504301 | Ga0207654_105043011 | 208 |
| 852 | 3300025912 | Ga0207707_10016195 | Ga0207707_100161957 | 208 |
| 853 | 3300025917 | Ga0207660_10066532 | Ga0207660_100665322 | 208 |
| 854 | 3300025918 | Ga0207662_10000420 | Ga0207662_100004205 | 208 |
| 855 | 3300025918 | Ga0207662_10038527 | Ga0207662_100385274 | 208 |
| 856 | 3300025919 | Ga0207657_10022635 | Ga0207657_100226353 | 208 |
| 857 | 3300025919 | Ga0207657_10180131 | Ga0207657_101801312 | 208 |
| 858 | 3300025921 | Ga0207652_10113575 | Ga0207652_101135752 | 208 |
| 859 | 3300025923 | Ga0207681_10035662 | Ga0207681_100356623 | 208 |
| 860 | 3300025925 | Ga0207650_10007537 | Ga0207650_100075372 | 208 |
| 861 | 3300025928 | Ga0207700_10126700 | Ga0207700_101267002 | 208 |
| 862 | 3300025928 | Ga0207700_10645159 | Ga0207700_106451592 | 208 |
| 863 | 3300025932 | Ga0207690_10182489 | Ga0207690_101824892 | 208 |
| 864 | 3300025933 | Ga0207706_10007686 | Ga0207706_100076866 | 208 |
| 865 | 3300025933 | Ga0207706_10028739 | Ga0207706_100287392 | 208 |
| 866 | 3300025933 | Ga0207706_10262103 | Ga0207706_102621033 | 208 |
| 867 | 3300025935 | Ga0207709_10028625 | Ga0207709_100286252 | 208 |
| 868 | 3300025935 | Ga0207709_10148893 | Ga0207709_101488932 | 208 |
| 869 | 3300025936 | Ga0207670_10042397 | Ga0207670_100423972 | 208 |
| 870 | 3300025937 | Ga0207669_10115992 | Ga0207669_101159922 | 208 |
| 871 | 3300025937 | Ga0207669_10353634 | Ga0207669_103536341 | 208 |
| 872 | 3300025938 | Ga0207704_10635147 | Ga0207704_106351471 | 208 |
| 873 | 3300025940 | Ga0207691_10089428 | Ga0207691_100894284 | 208 |
| 874 | 3300025941 | Ga0207711_10433359 | Ga0207711_104333592 | 208 |
| 875 | 3300025945 | Ga0207679_10052918 | Ga0207679_100529183 | 208 |
| 876 | 3300025945 | Ga0207679_10144987 | Ga0207679_101449874 | 208 |
| 877 | 3300025949 | Ga0207667_10159938 | Ga0207667_101599382 | 208 |
| 878 | 3300025961 | Ga0207712_10019384 | Ga0207712_100193842 | 208 |
| 879 | 3300025961 | Ga0207712_10345750 | Ga0207712_103457502 | 208 |
| 880 | 3300025972 | Ga0207668_10095091 | Ga0207668_100950912 | 208 |
| 881 | 3300025972 | Ga0207668_10271288 | Ga0207668_102712882 | 208 |
| 882 | 3300025981 | Ga0207640_10077899 | Ga0207640_100778992 | 208 |
| 883 | 3300026035 | Ga0207703_10192184 | Ga0207703_101921841 | 208 |
| 884 | 3300026035 | Ga0207703_10656418 | Ga0207703_106564182 | 208 |
| 885 | 3300026067 | Ga0207678_10017130 | Ga0207678_100171302 | 208 |
| 886 | 3300026067 | Ga0207678_10084461 | Ga0207678_100844612 | 208 |
| 887 | 3300026075 | Ga0207708_10011842 | Ga0207708_100118422 | 208 |
| 888 | 3300026078 | Ga0207702_10697731 | Ga0207702_106977312 | 208 |
| 889 | 3300026088 | Ga0207641_10409386 | Ga0207641_104093862 | 208 |
| 890 | 3300026089 | Ga0207648_10023947 | Ga0207648_100239475 | 208 |
| 891 | 3300026089 | Ga0207648_10031830 | Ga0207648_100318303 | 208 |
| 892 | 3300026116 | Ga0207674_10131097 | Ga0207674_101310973 | 208 |
| 893 | 3300026118 | Ga0207675_100017878 | Ga0207675_1000178785 | 208 |
| 894 | 3300026118 | Ga0207675_100018667 | Ga0207675_1000186678 | 208 |
| 895 | 3300026121 | Ga0207683_10240326 | Ga0207683_102403262 | 208 |
| 896 | 3300026121 | Ga0207683_10330990 | Ga0207683_103309902 | 208 |
| 897 | 3300027717 | Ga0209998_10011871 | Ga0209998_100118712 | 208 |
| 898 | 3300027907 | Ga0207428_10000114 | Ga0207428_1000011457 | 208 |
| 899 | 3300027907 | Ga0207428_10000780 | Ga0207428_1000078044 | 208 |
| 900 | 3300027907 | Ga0207428_10063883 | Ga0207428_100638834 | 208 |
| 901 | 3300028380 | Ga0268265_10379727 | Ga0268265_103797271 | 208 |
| 902 | 3300028381 | Ga0268264_10181628 | Ga0268264_101816282 | 208 |
| 903 | 3300028381 | Ga0268264_10381276 | Ga0268264_103812761 | 208 |
| 904 | 3300034816 | Ga0373930_0001543 | Ga0373930_0001543_282_908 | 208 |
| 905 | 3300034817 | Ga0373948_0026647 | Ga0373948_0026647_456_1082 | 208 |
| 906 | 3300034818 | Ga0373950_0001403 | Ga0373950_0001403_1614_2240 | 208 |
| 907 | 3300034819 | Ga0373958_0000619 | Ga0373958_0000619_2880_3506 | 208 |
| 908 | 3300034820 | Ga0373959_0001495 | Ga0373959_0001495_563_1189 | 208 |
| 909 | 3300034957 | Ga0373938_0005414 | Ga0373938_0005414_757_1383 | 208 |
| 910 | 3300035084 | Ga0373928_0001492 | Ga0373928_0001492_1907_2533 | 208 |
| 911 | 3300035085 | Ga0373929_0003088 | Ga0373929_0003088_896_1522 | 208 |
| 912 | 3300035088 | Ga0373940_0015579 | Ga0373940_0015579_620_1246 | 208 |
| 913 | 3300035090 | Ga0373949_0004253 | Ga0373949_0004253_363_989 | 208 |
| 914 | 3300035092 | Ga0373952_0003160 | Ga0373952_0003160_1015_1641 | 208 |
| 915 | 3300035111 | Ga0373923_0120013 | Ga0373923_0120013_297_941 | 208 |
| 916 | 3300035112 | Ga0373932_0008968 | Ga0373932_0008968_440_1066 | 208 |
| 917 | 3300035113 | Ga0373936_0069945 | Ga0373936_0069945_192_836 | 208 |
| 918 | 3300035114 | Ga0373939_0000722 | Ga0373939_0000722_3439_4065 | 208 |
| 919 | 3300035115 | Ga0373941_0002372 | Ga0373941_0002372_1166_1792 | 208 |
| 920 | 3300035116 | Ga0373945_0003731 | Ga0373945_0003731_4055_4699 | 208 |
| 921 | 3300035121 | Ga0373960_0010670 | Ga0373960_0010670_1598_2224 | 208 |
| 922 | 3300035170 | Ga0373943_0052522 | Ga0373943_0052522_413_1057 | 208 |
| 923 | 3300035170 | Ga0373943_0160975 | Ga0373943_0160975_358_996 | 208 |
| 924 | 3300035171 | Ga0373946_0193624 | Ga0373946_0193624_135_773 | 208 |
| 925 | 3300035172 | Ga0373955_0109805 | Ga0373955_0109805_45_695 | 208 |
| 926 | 3300035207 | Ga0373942_0001603 | Ga0373942_0001603_4665_5291 | 208 |
| 927 | 3300035241 | Ga0373961_0008986 | Ga0373961_0008986_920_1546 | 208 |
| 928 | 3300035242 | Ga0373962_0001346 | Ga0373962_0001346_3031_3657 | 208 |
| 929 | 3300035691 | Ga0373931_0010237 | Ga0373931_0010237_3422_4048 | 208 |
| 930 | 3300035691 | Ga0373931_0017812 | Ga0373931_0017812_1183_1809 | 208 |
| 931 | 3300035695 | Ga0373927_0158928 | Ga0373927_0158928_785_1429 | 208 |
| 932 | 3300035725 | Ga0373947_0023121 | Ga0373947_0023121_2938_3582 | 208 |
| 933 | 3300035725 | Ga0373947_0073637 | Ga0373947_0073637_648_1292 | 208 |
| 934 | 3300037068 | Ga0373925_0098904 | Ga0373925_0098904_818_1456 | 208 |
| 935 | 3300037068 | Ga0373925_0110753 | Ga0373925_0110753_880_1524 | 208 |
| 936 | 3300039450 | Ga0436363_1605866 | Ga0436363_1605866_1750_2400 | 208 |
| 937 | 3300041512 | Ga0451853_1492139 | Ga0451853_1492139_190_843 | 208 |
| 938 | 3300044712 | Ga0453684_0218063 | Ga0453684_0218063_61_687 | 208 |
| 939 | 3300046453 | Ga0495627_062755 | Ga0495627_062755_252_896 | 208 |
| 940 | 3300046457 | Ga0495590_0043265 | Ga0495590_0043265_882_1520 | 208 |
| 941 | 3300046459 | Ga0495629_0090408 | Ga0495629_0090408_772_1410 | 208 |
| 942 | 3300046460 | Ga0495638_0096360 | Ga0495638_0096360_333_971 | 208 |
| 943 | 3300046461 | Ga0495641_0004844 | Ga0495641_0004844_7087_7731 | 208 |
| 944 | 3300046473 | Ga0495582_0361348 | Ga0495582_0361348_121_765 | 208 |
| 945 | 3300046475 | Ga0495639_0056203 | Ga0495639_0056203_956_1600 | 208 |
| 946 | 3300046491 | Ga0495584_0333579 | Ga0495584_0333579_41_694 | 208 |
| 947 | 3300046492 | Ga0495585_0082050 | Ga0495585_0082050_243_887 | 208 |
| 948 | 3300046514 | Ga0495618_0071945 | Ga0495618_0071945_13_651 | 208 |
| 949 | 3300046526 | Ga0495666_0010453 | Ga0495666_0010453_2623_3267 | 208 |
| 950 | 3300046531 | Ga0495665_0043243 | Ga0495665_0043243_404_1048 | 208 |
| 951 | 3300046531 | Ga0495665_0113151 | Ga0495665_0113151_674_1318 | 208 |
| 952 | 3300046536 | Ga0495587_0226065 | Ga0495587_0226065_335_979 | 208 |
| 953 | 3300046537 | Ga0495598_0009195 | Ga0495598_0009195_1106_1759 | 208 |
| 954 | 3300046683 | Ga0495658_0022039 | Ga0495658_0022039_2561_3205 | 208 |
| 955 | 3300046689 | Ga0495613_0058664 | Ga0495613_0058664_1527_2171 | 208 |
| 956 | 3300046690 | Ga0495624_0235925 | Ga0495624_0235925_230_874 | 208 |
| 957 | 3300046810 | Ga0495660_0129760 | Ga0495660_0129760_555_1199 | 208 |
| 958 | 3300047315 | Ga0495581_0082802 | Ga0495581_0082802_349_993 | 208 |
| 959 | 3300047315 | Ga0495581_0281187 | Ga0495581_0281187_261_899 | 208 |
| 960 | 3300047317 | Ga0495604_0240520 | Ga0495604_0240520_382_1026 | 208 |
| 961 | 3300047321 | Ga0495676_0134654 | Ga0495676_0134654_384_1022 | 208 |
| 962 | 3300047673 | Ga0495593_0130270 | Ga0495593_0130270_522_1160 | 208 |
| 963 | 3300048091 | Ga0495626_0156478 | Ga0495626_0156478_58_711 | 208 |
| 964 | 3300048903 | Ga0496100_0037305 | Ga0496100_0037305_1860_2507 | 208 |
| 965 | 3300048903 | Ga0496100_0349203 | Ga0496100_0349203_123_770 | 208 |
| 966 | 3300048904 | Ga0496101_0038579 | Ga0496101_0038579_1866_2504 | 208 |
| 967 | 3300048905 | Ga0496102_0017500 | Ga0496102_0017500_2304_2942 | 208 |
| 968 | 3300048905 | Ga0496102_0201396 | Ga0496102_0201396_1155_1781 | 208 |
| 969 | 3300048905 | Ga0496102_0635764 | Ga0496102_0635764_192_839 | 208 |
| 970 | 3300048906 | Ga0496103_0004512 | Ga0496103_0004512_4454_5092 | 208 |
| 971 | 3300048907 | Ga0496104_0011639 | Ga0496104_0011639_370_1008 | 208 |
| 972 | 3300048907 | Ga0496104_0090470 | Ga0496104_0090470_1161_1814 | 208 |
| 973 | 3300048907 | Ga0496104_0701418 | Ga0496104_0701418_245_871 | 208 |
| 974 | 3300048908 | Ga0496105_0004355 | Ga0496105_0004355_5811_6449 | 208 |
| 975 | 3300048908 | Ga0496105_0154880 | Ga0496105_0154880_119_772 | 208 |
| 976 | 3300048909 | Ga0496106_0044848 | Ga0496106_0044848_1944_2582 | 208 |
| 977 | 3300048910 | Ga0496107_0040423 | Ga0496107_0040423_1379_2017 | 208 |
| 978 | 3300048910 | Ga0496107_0440364 | Ga0496107_0440364_168_815 | 208 |
| 979 | 3300048911 | Ga0496108_0000500 | Ga0496108_0000500_11861_12499 | 208 |
| 980 | 3300048912 | Ga0496109_0000423 | Ga0496109_0000423_17868_18506 | 208 |
| 981 | 3300048912 | Ga0496109_0878775 | Ga0496109_0878775_49_702 | 208 |
| 982 | 3300048913 | Ga0496110_0179448 | Ga0496110_0179448_134_772 | 208 |
| 983 | 3300048914 | Ga0496111_0013636 | Ga0496111_0013636_2157_2795 | 208 |
| 984 | 3300048915 | Ga0496112_0161341 | Ga0496112_0161341_1201_1839 | 208 |
| 985 | 3300048915 | Ga0496112_0365926 | Ga0496112_0365926_119_772 | 208 |
| 986 | 3300048916 | Ga0496113_0002838 | Ga0496113_0002838_5244_5882 | 208 |
| 987 | 3300048917 | Ga0496114_0201432 | Ga0496114_0201432_959_1612 | 208 |
| 988 | 3300048918 | Ga0496115_0074139 | Ga0496115_0074139_119_757 | 208 |
| 989 | 3300048918 | Ga0496115_0152663 | Ga0496115_0152663_1173_1811 | 208 |
| 990 | 3300049574 | Ga0501038_0141895 | Ga0501038_0141895_568_1212 | 208 |
| 991 | 3300049575 | Ga0501039_0234843 | Ga0501039_0234843_70_714 | 208 |
| 992 | 3300049580 | Ga0501046_0265638 | Ga0501046_0265638_359_1003 | 208 |
| 993 | 3300049587 | Ga0501071_0682165 | Ga0501071_0682165_18_662 | 208 |
| 994 | 3300049591 | Ga0501075_0103669 | Ga0501075_0103669_456_1100 | 208 |
| 995 | 3300049741 | Ga0501079_0395447 | Ga0501079_0395447_29_670 | 208 |
| 996 | 3300049822 | Ga0501035_0787545 | Ga0501035_0787545_51_698 | 208 |
| 997 | 3300049823 | Ga0501044_0076517 | Ga0501044_0076517_15_662 | 208 |
| 998 | 3300049824 | Ga0501045_0267857 | Ga0501045_0267857_467_1111 | 208 |
| 999 | 3300049824 | Ga0501045_0355179 | Ga0501045_0355179_295_939 | 208 |
| 1000 | 3300050492 | nmdc:mga0yw44_5076_c1 | nmdc:mga0yw44_5076_c1_3491_4135 | 208 |
| 1001 | 3300050492 | nmdc:mga0yw44_89212_c1 | nmdc:mga0yw44_89212_c1_975_1619 | 208 |
| 1002 | 3300050507 | nmdc:mga05p37_19716_c1 | nmdc:mga05p37_19716_c1_1812_2444 | 208 |
| 1003 | 3300050507 | nmdc:mga05p37_2557_c2 | nmdc:mga05p37_2557_c2_6035_6673 | 208 |
| 1004 | 3300050507 | nmdc:mga05p37_56_c3 | nmdc:mga05p37_56_c3_24685_25317 | 208 |
| 1005 | 3300050508 | nmdc:mga09592_976_c1 | nmdc:mga09592_976_c1_18059_18691 | 208 |
| 1006 | 3300050509 | nmdc:mga0qj67_52793_c1 | nmdc:mga0qj67_52793_c1_402_1034 | 208 |
| 1007 | 3300050510 | nmdc:mga06r32_806_c1 | nmdc:mga06r32_806_c1_17980_18612 | 208 |
| 1008 | 3300050511 | nmdc:mga08y16_206_c1 | nmdc:mga08y16_206_c1_20723_21355 | 208 |
| 1009 | 3300050511 | nmdc:mga08y16_22406_c1 | nmdc:mga08y16_22406_c1_415_1041 | 208 |
| 1010 | 3300050511 | nmdc:mga08y16_31639_c1 | nmdc:mga08y16_31639_c1_1335_1973 | 208 |
| 1011 | 3300050512 | nmdc:mga0n895_12772_c1 | nmdc:mga0n895_12772_c1_4124_4756 | 208 |
| 1012 | 3300050512 | nmdc:mga0n895_57984_c1 | nmdc:mga0n895_57984_c1_2184_2816 | 208 |
| 1013 | 3300050513 | nmdc:mga0rr50_316396_c1 | nmdc:mga0rr50_316396_c1_657_1289 | 208 |
| 1014 | 3300050515 | nmdc:mga0a205_80_c1 | nmdc:mga0a205_80_c1_31653_32285 | 208 |
| 1015 | 3300050515 | nmdc:mga0a205_82248_c1 | nmdc:mga0a205_82248_c1_971_1603 | 208 |
| 1016 | 3300050515 | nmdc:mga0a205_89699_c2 | nmdc:mga0a205_89699_c2_869_1495 | 208 |
| 1017 | 3300053077 | Ga0495601_0041938 | Ga0495601_0041938_1413_2057 | 208 |
| 1018 | 3300053085 | Ga0495619_0017754 | Ga0495619_0017754_810_1448 | 208 |
| 1019 | 3300061734 | Ga0530510_0055057 | Ga0530510_0055057_557_1201 | 208 |
| 1020 | 3300061734 | Ga0530510_0073046 | Ga0530510_0073046_872_1516 | 208 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dck-assembly1.cif.gz_A | structure of unphosphorylated fixj-n complexed with mn2+ | 0.9662 | 7 | 122 |
| 1d5w-assembly1.cif.gz_A | phosphorylated fixj receiver domain | 0.9643 | 6 | 122 |
| 1xhf-assembly1.cif.gz_A | crystal structure of the bef3-activated receiver domain of redox response regulator arca | 0.9537 | 5 | 123 |
| 6rh1-assembly1.cif.gz_C | revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 | 0.9533 | 5 | 121 |
| 6kju-assembly1.cif.gz_A | huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors | 0.9525 | 143 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1yioA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9775 | 143 | 199 | 1.10.10.10 |
| 1zn2A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9765 | 143 | 199 | 1.10.10.10 |
| 1dckB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9648 | 5 | 123 | 3.40.50.2300 |
| af_P0DMC9_101_196_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9592 | 143 | 200 | 1.10.10.10 |
| af_P0AFU4_2_125_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9552 | 6 | 122 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H8JF02-F1-model_v4 | Two component transcriptional regulator, LuxR family | 0.9674 | 5 | 201 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A317FC10-F1-model_v4 | DNA-binding response regulator | 0.9651 | 1 | 202 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A6N6ZPD7-F1-model_v4 | deleted | 0.9574 | 1 | 204 |
|
| AF-A0A258HL32-F1-model_v4 | DNA-binding response regulator | 0.9535 | 1 | 202 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A1H8JF02-F1-model_v4 | Two component transcriptional regulator, LuxR family | 0.9532 | 5 | 201 |
GO:0000160
GO:0003677 GO:0006355 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar