F488393
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1021 | 381 | 2042 | 540 |
Family's Representative Sequence
| Representative Sequence | 3300036712|Ga0316584_0017465|Ga0316584_0017465_1453_3045 |
| Length | 530 |
| Sequence | LTAPLSHPLDRHGITTAATIHANLGTAQLVEHAVSNGEGRLAAHGPLVVETGEFTGRSAKDKYIVRDGVTEHTVWWGDVNQPMSSEHFDALKADFLSALGAKEKLYVADLFGGSQKDHRVNVRVINELAWHNLFAHTMLVRPDAKDLDEFVPEYTVIDLPSFVADPERHGCRSETVIAVSFSEKLILIGGTGYAGEMKKSVFGILNFLLPPKGVMPMHCSANIGPDGKTAVFFGLSGTGKTTLSADPGRTLIGDDEHGWSDTAVFNFEGGCYAKMIRLSAEAEPEIYATTRMFGTVLENVVMDEASRELDLDDPSLAENSRGAYPIDFIPNTSEENLGPTPSNVIMLTADAFGVLPPIARLTPDQAMYHFLSGYTAKVAGTEIGVTEPEATFSTCFGAPFMPRHPSVYGNLLKERIAKGGVSCWLVNTGWTGGKYGVGKRMPIKETRALLNAALDGSLNNVEFRKDPNFGFDVPVAVPGVDSSILDPRSTWADTDDYDRTAQKLVQLFVNNFEQFADHVDESVRQAAPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 18 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 217 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 218 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 219 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 220 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 221 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 222 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 223 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 224 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 274 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 275 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 276 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 277 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 278 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 279 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 280 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 281 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 282 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 286 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 287 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 288 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 296 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 297 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 298 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 304 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 305 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 306 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 307 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 309 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 310 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 311 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 314 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 317 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 321 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 324 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 325 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 327 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 328 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 329 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 330 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 332 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 333 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 335 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 336 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 337 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 338 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 340 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 341 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 343 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 344 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 345 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 347 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 348 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 349 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 350 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 351 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 352 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 353 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 354 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 355 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 356 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 357 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 358 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 359 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 360 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 361 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 362 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 363 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 364 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 365 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 366 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 367 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 368 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 369 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 370 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 371 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 372 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 373 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 374 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 375 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 376 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 377 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 378 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 379 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 380 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 381 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.18 |
| Metatranscriptomes | 0.39 |
| Isolates | 3.43 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.99 |
| Nodule | 0 |
| Rhizoplane | 5.29 |
| Rhizosphere | 78.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316584_0017465 | 3300036712 | Bacteria | 5159 |
| 2 | SwRhRL2b_contig_2381042 | 2162886007 | Bacteria | 7708 |
| 3 | SwRhRL2b_contig_878851 | 2162886007 | Bacteria | 43540 |
| 4 | ARcpr5yngRDRAFT_c001944 | 3300000043 | Bacteria | 2208 |
| 5 | JGI24736J21556_1000415 | 3300001904 | Bacteria | 8028 |
| 6 | JGI24736J21556_1002014 | 3300001904 | Bacteria | 3612 |
| 7 | JGI24741J21665_1000020 | 3300001915 | Bacteria | 37657 |
| 8 | JGI24741J21665_1002181 | 3300001915 | Bacteria | 5196 |
| 9 | JGI24752J21851_1000014 | 3300001976 | Bacteria | 19299 |
| 10 | JGI24740J21852_10001751 | 3300001979 | Bacteria | 9977 |
| 11 | JGI24740J21852_10003682 | 3300001979 | Bacteria | 6675 |
| 12 | JGI24740J21852_10005611 | 3300001979 | Bacteria | 5286 |
| 13 | JGI24739J22299_10001047 | 3300001989 | Bacteria | 10271 |
| 14 | JGI24739J22299_10006253 | 3300001989 | Bacteria | 4495 |
| 15 | JGI24737J22298_10000015 | 3300001990 | Bacteria | 49821 |
| 16 | JGI24737J22298_10001361 | 3300001990 | Bacteria | 8661 |
| 17 | JGI24735J21928_10000711 | 3300002067 | Bacteria | 11788 |
| 18 | JGI24735J21928_10001925 | 3300002067 | Bacteria | 7285 |
| 19 | JGI24735J21928_10003716 | 3300002067 | Bacteria | 5177 |
| 20 | JGI24750J21931_1000311 | 3300002070 | Bacteria | 8392 |
| 21 | JGI24748J21848_1000058 | 3300002074 | Bacteria | 46055 |
| 22 | JGI24738J21930_10000387 | 3300002075 | Bacteria | 12278 |
| 23 | JGI24738J21930_10001330 | 3300002075 | Bacteria | 6900 |
| 24 | JGI24749J21850_1000021 | 3300002076 | Bacteria | 30737 |
| 25 | JGI24034J26672_10000050 | 3300002239 | Bacteria | 53117 |
| 26 | JGI24751J29686_10000080 | 3300002459 | Bacteria | 54264 |
| 27 | JGI24751J29686_10000192 | 3300002459 | Bacteria | 26926 |
| 28 | JGI25152J39213_1005835 | 3300002773 | Bacteria | 3490 |
| 29 | JGI25150J39212_1000319 | 3300002774 | Bacteria | 23638 |
| 30 | JGI25153J46596_10000999 | 3300003215 | Bacteria | 17177 |
| 31 | JGI25153J46596_10012183 | 3300003215 | Bacteria | 3736 |
| 32 | Ga0055526_1000760 | 3300003771 | Bacteria | 24068 |
| 33 | Ga0055537_1000317 | 3300003773 | Bacteria | 32918 |
| 34 | Ga0055537_1001489 | 3300003773 | Bacteria | 9020 |
| 35 | Ga0055537_1002474 | 3300003773 | Bacteria | 6179 |
| 36 | Ga0055524_1000149 | 3300003775 | Bacteria | 82511 |
| 37 | Ga0055536_1001571 | 3300003781 | Bacteria | 13660 |
| 38 | Ga0055534_1005555 | 3300003784 | Bacteria | 3344 |
| 39 | Ga0055530_10000005 | 3300003791 | Bacteria | 206625 |
| 40 | Ga0055530_10000060 | 3300003791 | Bacteria | 95767 |
| 41 | Ga0055540_1004881 | 3300003792 | Bacteria | 5866 |
| 42 | Ga0055531_10000049 | 3300003794 | Bacteria | 130662 |
| 43 | Ga0055531_10004473 | 3300003794 | Bacteria | 8502 |
| 44 | Ga0055531_10007837 | 3300003794 | Bacteria | 5746 |
| 45 | Ga0055531_10009294 | 3300003794 | Bacteria | 5045 |
| 46 | Ga0065165_1001158 | 3300005262 | Bacteria | 30746 |
| 47 | Ga0065165_1002598 | 3300005262 | Bacteria | 14805 |
| 48 | Ga0065704_10000191 | 3300005289 | Bacteria | 318191 |
| 49 | Ga0065704_10001918 | 3300005289 | Bacteria | 15286 |
| 50 | Ga0065704_10002532 | 3300005289 | Bacteria | 5058 |
| 51 | Ga0065704_10070424 | 3300005289 | Bacteria | 25504 |
| 52 | Ga0065712_10068171 | 3300005290 | Bacteria | 13481 |
| 53 | Ga0065715_10121438 | 3300005293 | Bacteria | 2230 |
| 54 | Ga0065707_10005245 | 3300005295 | Bacteria | 4046 |
| 55 | Ga0065707_10081716 | 3300005295 | Bacteria | 73074 |
| 56 | Ga0065707_10084323 | 3300005295 | Bacteria | 7346 |
| 57 | Ga0065707_10096989 | 3300005295 | Bacteria | 3214 |
| 58 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 59 | Ga0070658_10000346 | 3300005327 | Bacteria | 40223 |
| 60 | Ga0070658_10003793 | 3300005327 | Bacteria | 12379 |
| 61 | Ga0070658_10018251 | 3300005327 | Bacteria | 5615 |
| 62 | Ga0070658_10048053 | 3300005327 | Bacteria | 3454 |
| 63 | Ga0070658_10049173 | 3300005327 | Bacteria | 3415 |
| 64 | Ga0070658_10069849 | 3300005327 | Bacteria | 2874 |
| 65 | Ga0070658_10088700 | 3300005327 | Bacteria | 2547 |
| 66 | Ga0070683_100022268 | 3300005329 | Bacteria | 5661 |
| 67 | Ga0070683_100071276 | 3300005329 | Bacteria | 3242 |
| 68 | Ga0070683_100073958 | 3300005329 | Bacteria | 3182 |
| 69 | Ga0070690_100000159 | 3300005330 | Bacteria | 34513 |
| 70 | Ga0070690_100034329 | 3300005330 | Bacteria | 3178 |
| 71 | Ga0070670_100000031 | 3300005331 | Bacteria | 159070 |
| 72 | Ga0070670_100001267 | 3300005331 | Bacteria | 20126 |
| 73 | Ga0070670_100001683 | 3300005331 | Bacteria | 17959 |
| 74 | Ga0070670_100004563 | 3300005331 | Bacteria | 11617 |
| 75 | Ga0070670_100008579 | 3300005331 | Bacteria | 8717 |
| 76 | Ga0070670_100008763 | 3300005331 | Bacteria | 8637 |
| 77 | Ga0070670_100013186 | 3300005331 | Bacteria | 7080 |
| 78 | Ga0070670_100017279 | 3300005331 | Bacteria | 6188 |
| 79 | Ga0070670_100108759 | 3300005331 | Bacteria | 2389 |
| 80 | Ga0070670_100147018 | 3300005331 | Bacteria | 2039 |
| 81 | Ga0070677_10000121 | 3300005333 | Bacteria | 26015 |
| 82 | Ga0068869_100002541 | 3300005334 | Bacteria | 11013 |
| 83 | Ga0070666_10000002 | 3300005335 | Bacteria | 478684 |
| 84 | Ga0070666_10000589 | 3300005335 | Bacteria | 21952 |
| 85 | Ga0070666_10009729 | 3300005335 | Bacteria | 6006 |
| 86 | Ga0070666_10023181 | 3300005335 | Bacteria | 4038 |
| 87 | Ga0070666_10070361 | 3300005335 | Bacteria | 2380 |
| 88 | Ga0068868_100007180 | 3300005338 | Bacteria | 7915 |
| 89 | Ga0068868_100102849 | 3300005338 | Bacteria | 2313 |
| 90 | Ga0070660_100000048 | 3300005339 | Bacteria | 69472 |
| 91 | Ga0070660_100000061 | 3300005339 | Bacteria | 63766 |
| 92 | Ga0070660_100001167 | 3300005339 | Bacteria | 17757 |
| 93 | Ga0070660_100005280 | 3300005339 | Bacteria | 8932 |
| 94 | Ga0070660_100019123 | 3300005339 | Bacteria | 5014 |
| 95 | Ga0070689_100064407 | 3300005340 | Bacteria | 2853 |
| 96 | Ga0070661_100010200 | 3300005344 | Bacteria | 6526 |
| 97 | Ga0070661_100024164 | 3300005344 | Bacteria | 4358 |
| 98 | Ga0070661_100053552 | 3300005344 | Bacteria | 2954 |
| 99 | Ga0070692_10013757 | 3300005345 | Bacteria | 3781 |
| 100 | Ga0070668_100000006 | 3300005347 | Bacteria | 176486 |
| 101 | Ga0070668_100000012 | 3300005347 | Bacteria | 117937 |
| 102 | Ga0070668_100003316 | 3300005347 | Bacteria | 11877 |
| 103 | Ga0070668_100013778 | 3300005347 | Bacteria | 6039 |
| 104 | Ga0070668_100014071 | 3300005347 | Bacteria | 5981 |
| 105 | Ga0070669_100000015 | 3300005353 | Bacteria | 197597 |
| 106 | Ga0070669_100000042 | 3300005353 | Bacteria | 123396 |
| 107 | Ga0070669_100000055 | 3300005353 | Bacteria | 111488 |
| 108 | Ga0070669_100001258 | 3300005353 | Bacteria | 18395 |
| 109 | Ga0070669_100002274 | 3300005353 | Bacteria | 13933 |
| 110 | Ga0070669_100002309 | 3300005353 | Bacteria | 13799 |
| 111 | Ga0070669_100002547 | 3300005353 | Bacteria | 13172 |
| 112 | Ga0070669_100008852 | 3300005353 | Bacteria | 7182 |
| 113 | Ga0070669_100061893 | 3300005353 | Bacteria | 2751 |
| 114 | Ga0070675_100000487 | 3300005354 | Bacteria | 27135 |
| 115 | Ga0070675_100008232 | 3300005354 | Bacteria | 8089 |
| 116 | Ga0070675_100009413 | 3300005354 | Bacteria | 7601 |
| 117 | Ga0070671_100000010 | 3300005355 | Bacteria | 202799 |
| 118 | Ga0070671_100000066 | 3300005355 | Bacteria | 70998 |
| 119 | Ga0070671_100002199 | 3300005355 | Bacteria | 15059 |
| 120 | Ga0070671_100004238 | 3300005355 | Bacteria | 11351 |
| 121 | Ga0070671_100004664 | 3300005355 | Bacteria | 10873 |
| 122 | Ga0070671_100016348 | 3300005355 | Bacteria | 6000 |
| 123 | Ga0070671_100020459 | 3300005355 | Bacteria | 5397 |
| 124 | Ga0070671_100034019 | 3300005355 | Bacteria | 4218 |
| 125 | Ga0070671_100049709 | 3300005355 | Bacteria | 3488 |
| 126 | Ga0070671_100157713 | 3300005355 | Bacteria | 1917 |
| 127 | Ga0070674_100007181 | 3300005356 | Bacteria | 6557 |
| 128 | Ga0070674_100116314 | 3300005356 | Bacteria | 1973 |
| 129 | Ga0070673_100000046 | 3300005364 | Bacteria | 50435 |
| 130 | Ga0070673_100000926 | 3300005364 | Bacteria | 16587 |
| 131 | Ga0070673_100021743 | 3300005364 | Bacteria | 4658 |
| 132 | Ga0070673_100122880 | 3300005364 | Bacteria | 2168 |
| 133 | Ga0070688_100000701 | 3300005365 | Bacteria | 16516 |
| 134 | Ga0070659_100000001 | 3300005366 | Bacteria | 576390 |
| 135 | Ga0070659_100000833 | 3300005366 | Bacteria | 22486 |
| 136 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 137 | Ga0070667_100000016 | 3300005367 | Bacteria | 237028 |
| 138 | Ga0070667_100000038 | 3300005367 | Bacteria | 171914 |
| 139 | Ga0070667_100000396 | 3300005367 | Bacteria | 47159 |
| 140 | Ga0070667_100002247 | 3300005367 | Bacteria | 17006 |
| 141 | Ga0070667_100006418 | 3300005367 | Bacteria | 9774 |
| 142 | Ga0070667_100057015 | 3300005367 | Bacteria | 3300 |
| 143 | Ga0070667_100112523 | 3300005367 | Bacteria | 2361 |
| 144 | Ga0070714_100015883 | 3300005435 | Bacteria | 6068 |
| 145 | Ga0070663_100005530 | 3300005455 | Bacteria | 7519 |
| 146 | Ga0070663_100032815 | 3300005455 | Bacteria | 3583 |
| 147 | Ga0070678_100008901 | 3300005456 | Bacteria | 6043 |
| 148 | Ga0070678_100039163 | 3300005456 | Bacteria | 3341 |
| 149 | Ga0070662_100000391 | 3300005457 | Bacteria | 26178 |
| 150 | Ga0070662_100002528 | 3300005457 | Bacteria | 11273 |
| 151 | Ga0070662_100004908 | 3300005457 | Bacteria | 8495 |
| 152 | Ga0070662_100005390 | 3300005457 | Bacteria | 8167 |
| 153 | Ga0070662_100006946 | 3300005457 | Bacteria | 7325 |
| 154 | Ga0070662_100010219 | 3300005457 | Bacteria | 6153 |
| 155 | Ga0070662_100013093 | 3300005457 | Bacteria | 5513 |
| 156 | Ga0070681_10021524 | 3300005458 | Bacteria | 6462 |
| 157 | Ga0068867_100002495 | 3300005459 | Bacteria | 12930 |
| 158 | Ga0068867_100012914 | 3300005459 | Bacteria | 5910 |
| 159 | Ga0068867_100013381 | 3300005459 | Bacteria | 5812 |
| 160 | Ga0068867_100018201 | 3300005459 | Bacteria | 4992 |
| 161 | Ga0070685_10000023 | 3300005466 | Bacteria | 102548 |
| 162 | Ga0070684_100015958 | 3300005535 | Bacteria | 6133 |
| 163 | Ga0070684_100032382 | 3300005535 | Bacteria | 4455 |
| 164 | Ga0068853_100000764 | 3300005539 | Bacteria | 22317 |
| 165 | Ga0068853_100002364 | 3300005539 | Bacteria | 14106 |
| 166 | Ga0068853_100011737 | 3300005539 | Bacteria | 7120 |
| 167 | Ga0068853_100019489 | 3300005539 | Bacteria | 5625 |
| 168 | Ga0068853_100038510 | 3300005539 | Bacteria | 4073 |
| 169 | Ga0068853_100048866 | 3300005539 | Bacteria | 3634 |
| 170 | Ga0068853_100071790 | 3300005539 | Bacteria | 3015 |
| 171 | Ga0070672_100002251 | 3300005543 | Bacteria | 12167 |
| 172 | Ga0070672_100005075 | 3300005543 | Bacteria | 8685 |
| 173 | Ga0070686_100000003 | 3300005544 | Bacteria | 308397 |
| 174 | Ga0070665_100000036 | 3300005548 | Bacteria | 314603 |
| 175 | Ga0070665_100000075 | 3300005548 | Bacteria | 189496 |
| 176 | Ga0070665_100000107 | 3300005548 | Bacteria | 156048 |
| 177 | Ga0070665_100000705 | 3300005548 | Bacteria | 44568 |
| 178 | Ga0070665_100017020 | 3300005548 | Bacteria | 7289 |
| 179 | Ga0070665_100020206 | 3300005548 | Bacteria | 6687 |
| 180 | Ga0070665_100020609 | 3300005548 | Bacteria | 6624 |
| 181 | Ga0070665_100027294 | 3300005548 | Bacteria | 5750 |
| 182 | Ga0070665_100041899 | 3300005548 | Bacteria | 4603 |
| 183 | Ga0068855_100000318 | 3300005563 | Bacteria | 60020 |
| 184 | Ga0068855_100007587 | 3300005563 | Bacteria | 13122 |
| 185 | Ga0068855_100011156 | 3300005563 | Bacteria | 10850 |
| 186 | Ga0068855_100092728 | 3300005563 | Bacteria | 3483 |
| 187 | Ga0070664_100001286 | 3300005564 | Bacteria | 20075 |
| 188 | Ga0070664_100002719 | 3300005564 | Bacteria | 14275 |
| 189 | Ga0070664_100007861 | 3300005564 | Bacteria | 8614 |
| 190 | Ga0070664_100027928 | 3300005564 | Bacteria | 4693 |
| 191 | Ga0070664_100028012 | 3300005564 | Bacteria | 4685 |
| 192 | Ga0070664_100038260 | 3300005564 | Bacteria | 4037 |
| 193 | Ga0068857_100008844 | 3300005577 | Bacteria | 8723 |
| 194 | Ga0068857_100061759 | 3300005577 | Bacteria | 3329 |
| 195 | Ga0068854_100000494 | 3300005578 | Bacteria | 24007 |
| 196 | Ga0068854_100001685 | 3300005578 | Bacteria | 13460 |
| 197 | Ga0068854_100025551 | 3300005578 | Bacteria | 4054 |
| 198 | Ga0068854_100042423 | 3300005578 | Bacteria | 3220 |
| 199 | Ga0068856_100007003 | 3300005614 | Bacteria | 11013 |
| 200 | Ga0068856_100023109 | 3300005614 | Bacteria | 6047 |
| 201 | Ga0068856_100061441 | 3300005614 | Bacteria | 3711 |
| 202 | Ga0068856_100102017 | 3300005614 | Bacteria | 2862 |
| 203 | Ga0068852_100001901 | 3300005616 | Bacteria | 14205 |
| 204 | Ga0068852_100019408 | 3300005616 | Bacteria | 5380 |
| 205 | Ga0068852_100022300 | 3300005616 | Bacteria | 5076 |
| 206 | Ga0068859_100000068 | 3300005617 | Bacteria | 96701 |
| 207 | Ga0068859_100003549 | 3300005617 | Bacteria | 15886 |
| 208 | Ga0068859_100008593 | 3300005617 | Bacteria | 10325 |
| 209 | Ga0068859_100032839 | 3300005617 | Bacteria | 5214 |
| 210 | Ga0068859_100051689 | 3300005617 | Bacteria | 4131 |
| 211 | Ga0068859_100090863 | 3300005617 | Bacteria | 3104 |
| 212 | Ga0068859_100102860 | 3300005617 | Bacteria | 2914 |
| 213 | Ga0068864_100000188 | 3300005618 | Bacteria | 56337 |
| 214 | Ga0068864_100000248 | 3300005618 | Bacteria | 48142 |
| 215 | Ga0068864_100000339 | 3300005618 | Bacteria | 41252 |
| 216 | Ga0068864_100003036 | 3300005618 | Bacteria | 13866 |
| 217 | Ga0068864_100006681 | 3300005618 | Bacteria | 9445 |
| 218 | Ga0068864_100011537 | 3300005618 | Bacteria | 7300 |
| 219 | Ga0068864_100011656 | 3300005618 | Bacteria | 7260 |
| 220 | Ga0068864_100011788 | 3300005618 | Bacteria | 7221 |
| 221 | Ga0068864_100016371 | 3300005618 | Bacteria | 6173 |
| 222 | Ga0068861_100000968 | 3300005719 | Bacteria | 17516 |
| 223 | Ga0068861_100004123 | 3300005719 | Bacteria | 9749 |
| 224 | Ga0068861_100014384 | 3300005719 | Bacteria | 5554 |
| 225 | Ga0068861_100026908 | 3300005719 | Bacteria | 4185 |
| 226 | Ga0068861_100171550 | 3300005719 | Bacteria | 1798 |
| 227 | Ga0068863_100000034 | 3300005841 | Bacteria | 168359 |
| 228 | Ga0068863_100000318 | 3300005841 | Bacteria | 48923 |
| 229 | Ga0068863_100000535 | 3300005841 | Bacteria | 38753 |
| 230 | Ga0068863_100001229 | 3300005841 | Bacteria | 25559 |
| 231 | Ga0068863_100001802 | 3300005841 | Bacteria | 21263 |
| 232 | Ga0068863_100002834 | 3300005841 | Bacteria | 17170 |
| 233 | Ga0068863_100005094 | 3300005841 | Bacteria | 12962 |
| 234 | Ga0068863_100006405 | 3300005841 | Bacteria | 11540 |
| 235 | Ga0068863_100008251 | 3300005841 | Bacteria | 10177 |
| 236 | Ga0068863_100014352 | 3300005841 | Bacteria | 7629 |
| 237 | Ga0068863_100033388 | 3300005841 | Bacteria | 4902 |
| 238 | Ga0068863_100064667 | 3300005841 | Bacteria | 3459 |
| 239 | Ga0068863_100088446 | 3300005841 | Bacteria | 2935 |
| 240 | Ga0068858_100000688 | 3300005842 | Bacteria | 35297 |
| 241 | Ga0068858_100000911 | 3300005842 | Bacteria | 30658 |
| 242 | Ga0068858_100001148 | 3300005842 | Bacteria | 27405 |
| 243 | Ga0068858_100001791 | 3300005842 | Bacteria | 21917 |
| 244 | Ga0068858_100001843 | 3300005842 | Bacteria | 21605 |
| 245 | Ga0068858_100013165 | 3300005842 | Bacteria | 7797 |
| 246 | Ga0068858_100015659 | 3300005842 | Bacteria | 7132 |
| 247 | Ga0068858_100017819 | 3300005842 | Bacteria | 6650 |
| 248 | Ga0068858_100056971 | 3300005842 | Bacteria | 3612 |
| 249 | Ga0068860_100000001 | 3300005843 | Bacteria | 703043 |
| 250 | Ga0068860_100000008 | 3300005843 | Bacteria | 427367 |
| 251 | Ga0068860_100000068 | 3300005843 | Bacteria | 179208 |
| 252 | Ga0068860_100000256 | 3300005843 | Bacteria | 78477 |
| 253 | Ga0068860_100002412 | 3300005843 | Bacteria | 19607 |
| 254 | Ga0068860_100002747 | 3300005843 | Bacteria | 18315 |
| 255 | Ga0068860_100012538 | 3300005843 | Bacteria | 8346 |
| 256 | Ga0068860_100018987 | 3300005843 | Bacteria | 6676 |
| 257 | Ga0068860_100028188 | 3300005843 | Bacteria | 5406 |
| 258 | Ga0068860_100039618 | 3300005843 | Bacteria | 4507 |
| 259 | Ga0068862_100000006 | 3300005844 | Bacteria | 346828 |
| 260 | Ga0068862_100000088 | 3300005844 | Bacteria | 109244 |
| 261 | Ga0068862_100000092 | 3300005844 | Bacteria | 106896 |
| 262 | Ga0068862_100000620 | 3300005844 | Bacteria | 36954 |
| 263 | Ga0068862_100003636 | 3300005844 | Bacteria | 13191 |
| 264 | Ga0068862_100010829 | 3300005844 | Bacteria | 7533 |
| 265 | Ga0068862_100017674 | 3300005844 | Bacteria | 5936 |
| 266 | Ga0068862_100018008 | 3300005844 | Bacteria | 5885 |
| 267 | Ga0068862_100022595 | 3300005844 | Bacteria | 5263 |
| 268 | Ga0068862_100069418 | 3300005844 | Bacteria | 3042 |
| 269 | Ga0081539_10044092 | 3300005985 | Bacteria | 2577 |
| 270 | Ga0075365_10010228 | 3300006038 | Bacteria | 5452 |
| 271 | Ga0075368_10000074 | 3300006042 | Bacteria | 23851 |
| 272 | Ga0075363_100009825 | 3300006048 | Bacteria | 4511 |
| 273 | Ga0075364_10017883 | 3300006051 | Bacteria | 4433 |
| 274 | Ga0075364_10026599 | 3300006051 | Bacteria | 3691 |
| 275 | Ga0075432_10008434 | 3300006058 | Bacteria | 3516 |
| 276 | Ga0075362_10009768 | 3300006177 | Bacteria | 3722 |
| 277 | Ga0075367_10001673 | 3300006178 | Bacteria | 9680 |
| 278 | Ga0075367_10005332 | 3300006178 | Bacteria | 6368 |
| 279 | Ga0075369_10006044 | 3300006186 | Bacteria | 4562 |
| 280 | Ga0075370_10038986 | 3300006353 | Bacteria | 2676 |
| 281 | Ga0068871_100006907 | 3300006358 | Bacteria | 8084 |
| 282 | Ga0068871_100007948 | 3300006358 | Bacteria | 7605 |
| 283 | Ga0068871_100009459 | 3300006358 | Bacteria | 7064 |
| 284 | Ga0075430_100138273 | 3300006846 | Bacteria | 2029 |
| 285 | Ga0075431_100040222 | 3300006847 | Bacteria | 4818 |
| 286 | Ga0097620_100000068 | 3300006931 | Bacteria | 96701 |
| 287 | Ga0097620_100003549 | 3300006931 | Bacteria | 15886 |
| 288 | Ga0097620_100008593 | 3300006931 | Bacteria | 10325 |
| 289 | Ga0097620_100015011 | 3300006931 | Bacteria | 7775 |
| 290 | Ga0097620_100032839 | 3300006931 | Bacteria | 5214 |
| 291 | Ga0097620_100051689 | 3300006931 | Bacteria | 4131 |
| 292 | Ga0097620_100090853 | 3300006931 | Bacteria | 3104 |
| 293 | Ga0097620_100102867 | 3300006931 | Bacteria | 2914 |
| 294 | Ga0105250_10001326 | 3300009092 | Bacteria | 13524 |
| 295 | Ga0105240_10068043 | 3300009093 | Bacteria | 4412 |
| 296 | Ga0105245_10004863 | 3300009098 | Bacteria | 11828 |
| 297 | Ga0105245_10012964 | 3300009098 | Bacteria | 7267 |
| 298 | Ga0105245_10038453 | 3300009098 | Bacteria | 4257 |
| 299 | Ga0105247_10006552 | 3300009101 | Bacteria | 7201 |
| 300 | Ga0105247_10010078 | 3300009101 | Bacteria | 5726 |
| 301 | Ga0105247_10011458 | 3300009101 | Bacteria | 5345 |
| 302 | Ga0114129_10033552 | 3300009147 | Bacteria | 7254 |
| 303 | Ga0105243_10151945 | 3300009148 | Bacteria | 1987 |
| 304 | Ga0105241_10000478 | 3300009174 | Bacteria | 30203 |
| 305 | Ga0105242_10077215 | 3300009176 | Bacteria | 2778 |
| 306 | Ga0105248_10000066 | 3300009177 | Bacteria | 121254 |
| 307 | Ga0105248_10000071 | 3300009177 | Bacteria | 118281 |
| 308 | Ga0105248_10000135 | 3300009177 | Bacteria | 85668 |
| 309 | Ga0105248_10001282 | 3300009177 | Bacteria | 28057 |
| 310 | Ga0105248_10003049 | 3300009177 | Bacteria | 18581 |
| 311 | Ga0105248_10004287 | 3300009177 | Bacteria | 15777 |
| 312 | Ga0105248_10013575 | 3300009177 | Bacteria | 8969 |
| 313 | Ga0105248_10018690 | 3300009177 | Bacteria | 7663 |
| 314 | Ga0105248_10053518 | 3300009177 | Bacteria | 4529 |
| 315 | Ga0105248_10072624 | 3300009177 | Bacteria | 3867 |
| 316 | Ga0105237_10031128 | 3300009545 | Bacteria | 5411 |
| 317 | Ga0105238_10063284 | 3300009551 | Bacteria | 3699 |
| 318 | Ga0105238_10170636 | 3300009551 | Bacteria | 2151 |
| 319 | Ga0105249_10000026 | 3300009553 | Bacteria | 232053 |
| 320 | Ga0105249_10000100 | 3300009553 | Bacteria | 119358 |
| 321 | Ga0105249_10106527 | 3300009553 | Bacteria | 2645 |
| 322 | Ga0105148_100261 | 3300009978 | Bacteria | 7162 |
| 323 | Ga0105239_10132192 | 3300010375 | Bacteria | 2777 |
| 324 | Ga0105246_10000273 | 3300011119 | Bacteria | 26935 |
| 325 | Ga0157371_10000458 | 3300013102 | Bacteria | 50035 |
| 326 | Ga0157371_10007513 | 3300013102 | Bacteria | 8819 |
| 327 | Ga0157370_10125127 | 3300013104 | Bacteria | 2400 |
| 328 | Ga0157378_10001242 | 3300013297 | Bacteria | 23038 |
| 329 | Ga0157378_10200460 | 3300013297 | Bacteria | 1887 |
| 330 | Ga0163162_10004777 | 3300013306 | Bacteria | 13080 |
| 331 | Ga0163162_10013372 | 3300013306 | Bacteria | 8015 |
| 332 | Ga0163162_10015345 | 3300013306 | Bacteria | 7484 |
| 333 | Ga0163162_10022616 | 3300013306 | Bacteria | 6197 |
| 334 | Ga0163162_10023002 | 3300013306 | Bacteria | 6147 |
| 335 | Ga0163162_10027151 | 3300013306 | Bacteria | 5660 |
| 336 | Ga0157372_10004194 | 3300013307 | Bacteria | 15426 |
| 337 | Ga0157372_10045540 | 3300013307 | Bacteria | 4867 |
| 338 | Ga0157375_10055574 | 3300013308 | Bacteria | 3904 |
| 339 | Ga0157375_10087888 | 3300013308 | Bacteria | 3161 |
| 340 | Ga0157375_10096542 | 3300013308 | Bacteria | 3028 |
| 341 | Ga0163163_10000995 | 3300014325 | Bacteria | 23981 |
| 342 | Ga0163163_10002903 | 3300014325 | Bacteria | 14499 |
| 343 | Ga0163163_10034083 | 3300014325 | Bacteria | 4929 |
| 344 | Ga0157380_10001048 | 3300014326 | Bacteria | 17689 |
| 345 | Ga0157380_10002655 | 3300014326 | Bacteria | 12118 |
| 346 | Ga0157380_10003323 | 3300014326 | Bacteria | 11035 |
| 347 | Ga0157380_10006460 | 3300014326 | Bacteria | 8258 |
| 348 | Ga0157380_10008128 | 3300014326 | Bacteria | 7475 |
| 349 | Ga0157379_10004123 | 3300014968 | Bacteria | 12399 |
| 350 | Ga0157379_10005617 | 3300014968 | Bacteria | 10779 |
| 351 | Ga0157379_10027613 | 3300014968 | Bacteria | 5054 |
| 352 | Ga0183363_1001 | 3300015690 | Bacteria | 611534 |
| 353 | Ga0163161_10000008 | 3300017792 | Bacteria | 294642 |
| 354 | Ga0163161_10003797 | 3300017792 | Bacteria | 10589 |
| 355 | Ga0163161_10046782 | 3300017792 | Bacteria | 3122 |
| 356 | Ga0206353_12066863 | 3300020082 | Bacteria | 22106 |
| 357 | Ga0213873_10000015 | 3300021358 | Bacteria | 131343 |
| 358 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 359 | Ga0213876_10001213 | 3300021384 | Bacteria | 16270 |
| 360 | Ga0213875_10000401 | 3300021388 | Bacteria | 38122 |
| 361 | Ga0207672_1000500 | 3300025223 | Bacteria | 4889 |
| 362 | Ga0209147_101541 | 3300025229 | Bacteria | 7956 |
| 363 | Ga0207425_1000022 | 3300025245 | Bacteria | 355305 |
| 364 | Ga0209129_1000573 | 3300025258 | Bacteria | 25384 |
| 365 | Ga0209565_1000010 | 3300025263 | Bacteria | 687724 |
| 366 | Ga0209565_1000099 | 3300025263 | Bacteria | 131080 |
| 367 | Ga0209673_1001990 | 3300025273 | Bacteria | 15816 |
| 368 | Ga0209673_1007473 | 3300025273 | Bacteria | 5028 |
| 369 | Ga0209675_1000245 | 3300025291 | Bacteria | 53738 |
| 370 | Ga0209676_1000557 | 3300025292 | Bacteria | 56440 |
| 371 | Ga0209676_1000881 | 3300025292 | Bacteria | 38438 |
| 372 | Ga0209676_1001901 | 3300025292 | Bacteria | 17006 |
| 373 | Ga0209676_1014918 | 3300025292 | Bacteria | 2889 |
| 374 | Ga0209025_1001210 | 3300025294 | Bacteria | 36189 |
| 375 | Ga0209025_1034240 | 3300025294 | Bacteria | 2325 |
| 376 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 377 | Ga0209758_1016223 | 3300025297 | Bacteria | 3797 |
| 378 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 379 | Ga0209050_1000010 | 3300025298 | Bacteria | 980454 |
| 380 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 381 | Ga0209256_1000034 | 3300025299 | Bacteria | 388475 |
| 382 | Ga0209051_1000450 | 3300025303 | Bacteria | 54435 |
| 383 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 384 | Ga0209257_1000113 | 3300025304 | Bacteria | 233523 |
| 385 | Ga0209257_1000872 | 3300025304 | Bacteria | 42806 |
| 386 | Ga0209257_1000921 | 3300025304 | Bacteria | 40974 |
| 387 | Ga0209257_1001176 | 3300025304 | Bacteria | 33109 |
| 388 | Ga0209257_1002733 | 3300025304 | Bacteria | 16751 |
| 389 | Ga0209257_1006958 | 3300025304 | Bacteria | 7051 |
| 390 | Ga0207697_10000004 | 3300025315 | Bacteria | 90016 |
| 391 | Ga0207697_10000250 | 3300025315 | Bacteria | 29574 |
| 392 | Ga0207697_10001021 | 3300025315 | Bacteria | 15675 |
| 393 | Ga0207696_1011753 | 3300025711 | Bacteria | 3134 |
| 394 | Ga0207713_1001941 | 3300025735 | Bacteria | 15635 |
| 395 | Ga0207713_1010814 | 3300025735 | Bacteria | 5017 |
| 396 | Ga0207682_10002256 | 3300025893 | Bacteria | 8689 |
| 397 | Ga0207682_10050615 | 3300025893 | Bacteria | 1718 |
| 398 | Ga0207710_10007666 | 3300025900 | Bacteria | 4566 |
| 399 | Ga0207710_10017260 | 3300025900 | Bacteria | 3061 |
| 400 | Ga0207710_10023328 | 3300025900 | Bacteria | 2658 |
| 401 | Ga0207688_10000994 | 3300025901 | Bacteria | 14453 |
| 402 | Ga0207680_10000004 | 3300025903 | Bacteria | 827324 |
| 403 | Ga0207680_10016625 | 3300025903 | Bacteria | 3868 |
| 404 | Ga0207647_10000153 | 3300025904 | Bacteria | 54496 |
| 405 | Ga0207647_10022203 | 3300025904 | Bacteria | 4221 |
| 406 | Ga0207647_10022445 | 3300025904 | Bacteria | 4191 |
| 407 | Ga0207647_10051972 | 3300025904 | Bacteria | 2530 |
| 408 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 409 | Ga0207705_10000131 | 3300025909 | Bacteria | 81639 |
| 410 | Ga0207705_10000537 | 3300025909 | Bacteria | 31974 |
| 411 | Ga0207705_10001553 | 3300025909 | Bacteria | 18222 |
| 412 | Ga0207705_10003226 | 3300025909 | Bacteria | 12416 |
| 413 | Ga0207705_10005122 | 3300025909 | Bacteria | 9827 |
| 414 | Ga0207705_10009316 | 3300025909 | Bacteria | 7140 |
| 415 | Ga0207705_10013718 | 3300025909 | Bacteria | 5847 |
| 416 | Ga0207705_10019589 | 3300025909 | Bacteria | 4837 |
| 417 | Ga0207705_10052094 | 3300025909 | Bacteria | 2945 |
| 418 | Ga0207705_10054965 | 3300025909 | Bacteria | 2870 |
| 419 | Ga0207705_10070795 | 3300025909 | Bacteria | 2528 |
| 420 | Ga0207707_10015128 | 3300025912 | Bacteria | 6717 |
| 421 | Ga0207707_10045508 | 3300025912 | Bacteria | 3824 |
| 422 | Ga0207695_10021776 | 3300025913 | Bacteria | 7302 |
| 423 | Ga0207671_10025636 | 3300025914 | Bacteria | 4427 |
| 424 | Ga0207660_10004720 | 3300025917 | Bacteria | 8874 |
| 425 | Ga0207657_10000181 | 3300025919 | Bacteria | 65099 |
| 426 | Ga0207657_10000391 | 3300025919 | Bacteria | 46247 |
| 427 | Ga0207657_10000811 | 3300025919 | Bacteria | 33015 |
| 428 | Ga0207657_10006930 | 3300025919 | Bacteria | 11679 |
| 429 | Ga0207657_10009507 | 3300025919 | Bacteria | 9762 |
| 430 | Ga0207657_10015686 | 3300025919 | Bacteria | 7328 |
| 431 | Ga0207657_10016312 | 3300025919 | Bacteria | 7167 |
| 432 | Ga0207657_10077244 | 3300025919 | Bacteria | 2807 |
| 433 | Ga0207649_10001955 | 3300025920 | Bacteria | 11752 |
| 434 | Ga0207649_10006461 | 3300025920 | Bacteria | 6367 |
| 435 | Ga0207649_10009943 | 3300025920 | Bacteria | 5214 |
| 436 | Ga0207649_10039189 | 3300025920 | Bacteria | 2871 |
| 437 | Ga0207652_10012124 | 3300025921 | Bacteria | 6963 |
| 438 | Ga0207652_10014430 | 3300025921 | Bacteria | 6399 |
| 439 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 440 | Ga0207681_10000002 | 3300025923 | Bacteria | 985597 |
| 441 | Ga0207681_10000069 | 3300025923 | Bacteria | 92959 |
| 442 | Ga0207681_10009746 | 3300025923 | Bacteria | 5878 |
| 443 | Ga0207681_10025053 | 3300025923 | Bacteria | 3833 |
| 444 | Ga0207681_10038744 | 3300025923 | Bacteria | 3160 |
| 445 | Ga0207681_10054292 | 3300025923 | Bacteria | 2723 |
| 446 | Ga0207681_10064571 | 3300025923 | Bacteria | 2528 |
| 447 | Ga0207681_10064810 | 3300025923 | Bacteria | 2524 |
| 448 | Ga0207694_10029607 | 3300025924 | Bacteria | 4178 |
| 449 | Ga0207650_10000055 | 3300025925 | Bacteria | 158325 |
| 450 | Ga0207650_10000969 | 3300025925 | Bacteria | 21577 |
| 451 | Ga0207650_10001212 | 3300025925 | Bacteria | 18926 |
| 452 | Ga0207650_10002248 | 3300025925 | Bacteria | 13488 |
| 453 | Ga0207650_10003061 | 3300025925 | Bacteria | 11523 |
| 454 | Ga0207650_10003163 | 3300025925 | Bacteria | 11341 |
| 455 | Ga0207650_10004868 | 3300025925 | Bacteria | 9173 |
| 456 | Ga0207650_10016491 | 3300025925 | Bacteria | 5165 |
| 457 | Ga0207650_10021723 | 3300025925 | Bacteria | 4538 |
| 458 | Ga0207650_10024587 | 3300025925 | Bacteria | 4283 |
| 459 | Ga0207650_10057305 | 3300025925 | Bacteria | 2897 |
| 460 | Ga0207659_10001482 | 3300025926 | Bacteria | 13991 |
| 461 | Ga0207659_10004037 | 3300025926 | Bacteria | 8857 |
| 462 | Ga0207659_10008772 | 3300025926 | Bacteria | 6297 |
| 463 | Ga0207659_10035773 | 3300025926 | Bacteria | 3435 |
| 464 | Ga0207700_10036947 | 3300025928 | Bacteria | 3533 |
| 465 | Ga0207644_10000002 | 3300025931 | Bacteria | 942221 |
| 466 | Ga0207644_10000087 | 3300025931 | Bacteria | 67315 |
| 467 | Ga0207644_10000340 | 3300025931 | Bacteria | 30290 |
| 468 | Ga0207644_10000389 | 3300025931 | Bacteria | 28599 |
| 469 | Ga0207644_10002973 | 3300025931 | Bacteria | 10914 |
| 470 | Ga0207644_10003017 | 3300025931 | Bacteria | 10833 |
| 471 | Ga0207644_10004808 | 3300025931 | Bacteria | 8798 |
| 472 | Ga0207644_10005364 | 3300025931 | Bacteria | 8364 |
| 473 | Ga0207644_10007241 | 3300025931 | Bacteria | 7221 |
| 474 | Ga0207644_10009606 | 3300025931 | Bacteria | 6352 |
| 475 | Ga0207644_10025852 | 3300025931 | Bacteria | 4039 |
| 476 | Ga0207690_10000001 | 3300025932 | Bacteria | 807539 |
| 477 | Ga0207690_10000002 | 3300025932 | Bacteria | 807473 |
| 478 | Ga0207690_10000003 | 3300025932 | Bacteria | 783011 |
| 479 | Ga0207690_10000004 | 3300025932 | Bacteria | 746138 |
| 480 | Ga0207690_10004241 | 3300025932 | Bacteria | 8468 |
| 481 | Ga0207690_10060455 | 3300025932 | Bacteria | 2571 |
| 482 | Ga0207706_10000194 | 3300025933 | Bacteria | 67452 |
| 483 | Ga0207706_10001611 | 3300025933 | Bacteria | 22395 |
| 484 | Ga0207706_10001775 | 3300025933 | Bacteria | 21183 |
| 485 | Ga0207706_10004919 | 3300025933 | Bacteria | 12496 |
| 486 | Ga0207706_10013591 | 3300025933 | Bacteria | 7396 |
| 487 | Ga0207706_10014236 | 3300025933 | Bacteria | 7211 |
| 488 | Ga0207706_10014348 | 3300025933 | Bacteria | 7181 |
| 489 | Ga0207706_10016990 | 3300025933 | Bacteria | 6565 |
| 490 | Ga0207706_10029595 | 3300025933 | Bacteria | 4888 |
| 491 | Ga0207706_10053746 | 3300025933 | Bacteria | 3555 |
| 492 | Ga0207670_10043642 | 3300025936 | Bacteria | 2963 |
| 493 | Ga0207669_10003957 | 3300025937 | Bacteria | 6466 |
| 494 | Ga0207669_10059755 | 3300025937 | Bacteria | 2333 |
| 495 | Ga0207691_10003366 | 3300025940 | Bacteria | 15559 |
| 496 | Ga0207691_10005114 | 3300025940 | Bacteria | 12658 |
| 497 | Ga0207691_10020930 | 3300025940 | Bacteria | 6182 |
| 498 | Ga0207691_10087767 | 3300025940 | Bacteria | 2790 |
| 499 | Ga0207691_10137706 | 3300025940 | Bacteria | 2152 |
| 500 | Ga0207711_10000046 | 3300025941 | Bacteria | 153238 |
| 501 | Ga0207711_10002576 | 3300025941 | Bacteria | 16129 |
| 502 | Ga0207711_10003882 | 3300025941 | Bacteria | 12863 |
| 503 | Ga0207711_10012213 | 3300025941 | Bacteria | 7142 |
| 504 | Ga0207711_10015275 | 3300025941 | Bacteria | 6374 |
| 505 | Ga0207711_10016234 | 3300025941 | Bacteria | 6184 |
| 506 | Ga0207711_10017997 | 3300025941 | Bacteria | 5872 |
| 507 | Ga0207711_10029685 | 3300025941 | Bacteria | 4613 |
| 508 | Ga0207711_10038361 | 3300025941 | Bacteria | 4073 |
| 509 | Ga0207689_10000094 | 3300025942 | Bacteria | 71733 |
| 510 | Ga0207661_10017379 | 3300025944 | Bacteria | 5321 |
| 511 | Ga0207661_10022719 | 3300025944 | Bacteria | 4730 |
| 512 | Ga0207679_10002042 | 3300025945 | Bacteria | 12522 |
| 513 | Ga0207679_10003444 | 3300025945 | Bacteria | 9762 |
| 514 | Ga0207679_10004747 | 3300025945 | Bacteria | 8462 |
| 515 | Ga0207679_10019755 | 3300025945 | Bacteria | 4534 |
| 516 | Ga0207679_10022413 | 3300025945 | Bacteria | 4300 |
| 517 | Ga0207667_10000282 | 3300025949 | Bacteria | 69790 |
| 518 | Ga0207667_10027494 | 3300025949 | Bacteria | 6190 |
| 519 | Ga0207667_10027860 | 3300025949 | Bacteria | 6142 |
| 520 | Ga0207667_10031460 | 3300025949 | Bacteria | 5729 |
| 521 | Ga0207667_10106545 | 3300025949 | Bacteria | 2891 |
| 522 | Ga0207651_10001348 | 3300025960 | Bacteria | 11100 |
| 523 | Ga0207651_10006159 | 3300025960 | Bacteria | 6241 |
| 524 | Ga0207651_10006765 | 3300025960 | Bacteria | 6042 |
| 525 | Ga0207651_10017217 | 3300025960 | Bacteria | 4262 |
| 526 | Ga0207651_10039726 | 3300025960 | Bacteria | 3106 |
| 527 | Ga0207712_10000001 | 3300025961 | Bacteria | 750309 |
| 528 | Ga0207712_10000008 | 3300025961 | Bacteria | 527957 |
| 529 | Ga0207712_10005663 | 3300025961 | Bacteria | 7881 |
| 530 | Ga0207712_10042891 | 3300025961 | Bacteria | 3118 |
| 531 | Ga0207668_10000060 | 3300025972 | Bacteria | 89732 |
| 532 | Ga0207668_10000110 | 3300025972 | Bacteria | 58891 |
| 533 | Ga0207668_10000769 | 3300025972 | Bacteria | 19619 |
| 534 | Ga0207668_10012881 | 3300025972 | Bacteria | 5132 |
| 535 | Ga0207668_10018603 | 3300025972 | Bacteria | 4376 |
| 536 | Ga0207668_10019497 | 3300025972 | Bacteria | 4290 |
| 537 | Ga0207640_10001024 | 3300025981 | Bacteria | 15466 |
| 538 | Ga0207640_10008015 | 3300025981 | Bacteria | 5837 |
| 539 | Ga0207640_10009891 | 3300025981 | Bacteria | 5353 |
| 540 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 541 | Ga0207658_10000029 | 3300025986 | Bacteria | 171928 |
| 542 | Ga0207658_10000213 | 3300025986 | Bacteria | 60739 |
| 543 | Ga0207658_10001284 | 3300025986 | Bacteria | 19875 |
| 544 | Ga0207658_10001650 | 3300025986 | Bacteria | 17032 |
| 545 | Ga0207658_10005201 | 3300025986 | Bacteria | 8956 |
| 546 | Ga0207658_10009836 | 3300025986 | Bacteria | 6493 |
| 547 | Ga0207658_10009999 | 3300025986 | Bacteria | 6448 |
| 548 | Ga0207658_10025001 | 3300025986 | Bacteria | 4179 |
| 549 | Ga0207658_10065107 | 3300025986 | Bacteria | 2736 |
| 550 | Ga0207658_10080325 | 3300025986 | Bacteria | 2497 |
| 551 | Ga0207658_10172413 | 3300025986 | Bacteria | 1783 |
| 552 | Ga0207677_10000110 | 3300026023 | Bacteria | 66525 |
| 553 | Ga0207677_10015525 | 3300026023 | Bacteria | 4483 |
| 554 | Ga0207677_10042819 | 3300026023 | Bacteria | 3005 |
| 555 | Ga0207703_10000717 | 3300026035 | Bacteria | 32692 |
| 556 | Ga0207703_10001432 | 3300026035 | Bacteria | 21786 |
| 557 | Ga0207703_10004575 | 3300026035 | Bacteria | 11339 |
| 558 | Ga0207703_10005684 | 3300026035 | Bacteria | 10009 |
| 559 | Ga0207703_10007899 | 3300026035 | Bacteria | 8412 |
| 560 | Ga0207703_10008344 | 3300026035 | Bacteria | 8188 |
| 561 | Ga0207703_10008355 | 3300026035 | Bacteria | 8184 |
| 562 | Ga0207703_10009335 | 3300026035 | Bacteria | 7710 |
| 563 | Ga0207703_10016697 | 3300026035 | Bacteria | 5726 |
| 564 | Ga0207703_10025377 | 3300026035 | Bacteria | 4661 |
| 565 | Ga0207703_10087942 | 3300026035 | Bacteria | 2606 |
| 566 | Ga0207639_10000649 | 3300026041 | Bacteria | 23939 |
| 567 | Ga0207639_10001311 | 3300026041 | Bacteria | 16818 |
| 568 | Ga0207639_10001653 | 3300026041 | Bacteria | 15010 |
| 569 | Ga0207639_10007752 | 3300026041 | Bacteria | 7336 |
| 570 | Ga0207639_10029754 | 3300026041 | Bacteria | 4001 |
| 571 | Ga0207639_10095058 | 3300026041 | Bacteria | 2394 |
| 572 | Ga0207678_10000271 | 3300026067 | Bacteria | 47011 |
| 573 | Ga0207678_10000587 | 3300026067 | Bacteria | 33282 |
| 574 | Ga0207678_10004806 | 3300026067 | Bacteria | 12134 |
| 575 | Ga0207678_10007492 | 3300026067 | Bacteria | 9646 |
| 576 | Ga0207678_10011154 | 3300026067 | Bacteria | 7893 |
| 577 | Ga0207678_10017387 | 3300026067 | Bacteria | 6313 |
| 578 | Ga0207702_10000811 | 3300026078 | Bacteria | 33140 |
| 579 | Ga0207702_10010616 | 3300026078 | Bacteria | 7697 |
| 580 | Ga0207702_10041239 | 3300026078 | Bacteria | 3870 |
| 581 | Ga0207702_10180157 | 3300026078 | Bacteria | 1945 |
| 582 | Ga0207641_10000057 | 3300026088 | Bacteria | 168603 |
| 583 | Ga0207641_10000091 | 3300026088 | Bacteria | 127567 |
| 584 | Ga0207641_10000102 | 3300026088 | Bacteria | 122366 |
| 585 | Ga0207641_10000342 | 3300026088 | Bacteria | 56068 |
| 586 | Ga0207641_10002687 | 3300026088 | Bacteria | 16222 |
| 587 | Ga0207641_10002980 | 3300026088 | Bacteria | 15314 |
| 588 | Ga0207641_10003152 | 3300026088 | Bacteria | 14783 |
| 589 | Ga0207641_10007862 | 3300026088 | Bacteria | 8849 |
| 590 | Ga0207641_10029253 | 3300026088 | Bacteria | 4554 |
| 591 | Ga0207641_10060259 | 3300026088 | Bacteria | 3235 |
| 592 | Ga0207648_10000104 | 3300026089 | Bacteria | 81717 |
| 593 | Ga0207648_10002737 | 3300026089 | Bacteria | 18733 |
| 594 | Ga0207648_10003545 | 3300026089 | Bacteria | 16326 |
| 595 | Ga0207648_10018393 | 3300026089 | Bacteria | 6330 |
| 596 | Ga0207648_10043276 | 3300026089 | Bacteria | 3953 |
| 597 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 598 | Ga0207676_10000184 | 3300026095 | Bacteria | 55154 |
| 599 | Ga0207676_10000604 | 3300026095 | Bacteria | 29483 |
| 600 | Ga0207676_10002954 | 3300026095 | Bacteria | 12127 |
| 601 | Ga0207676_10003007 | 3300026095 | Bacteria | 12023 |
| 602 | Ga0207676_10003310 | 3300026095 | Bacteria | 11436 |
| 603 | Ga0207676_10003565 | 3300026095 | Bacteria | 10997 |
| 604 | Ga0207676_10035653 | 3300026095 | Bacteria | 3778 |
| 605 | Ga0207674_10001996 | 3300026116 | Bacteria | 25880 |
| 606 | Ga0207674_10007306 | 3300026116 | Bacteria | 12871 |
| 607 | Ga0207674_10008119 | 3300026116 | Bacteria | 12167 |
| 608 | Ga0207674_10008156 | 3300026116 | Bacteria | 12145 |
| 609 | Ga0207674_10010461 | 3300026116 | Bacteria | 10507 |
| 610 | Ga0207674_10013773 | 3300026116 | Bacteria | 8949 |
| 611 | Ga0207675_100000016 | 3300026118 | Bacteria | 126353 |
| 612 | Ga0207675_100000435 | 3300026118 | Bacteria | 40580 |
| 613 | Ga0207675_100000818 | 3300026118 | Bacteria | 30959 |
| 614 | Ga0207675_100001590 | 3300026118 | Bacteria | 22733 |
| 615 | Ga0207675_100003186 | 3300026118 | Bacteria | 16096 |
| 616 | Ga0207675_100019269 | 3300026118 | Bacteria | 6364 |
| 617 | Ga0207675_100022444 | 3300026118 | Bacteria | 5878 |
| 618 | Ga0207675_100042911 | 3300026118 | Bacteria | 4223 |
| 619 | Ga0207683_10042498 | 3300026121 | Bacteria | 3970 |
| 620 | Ga0207698_10014014 | 3300026142 | Bacteria | 5312 |
| 621 | Ga0207698_10019539 | 3300026142 | Bacteria | 4641 |
| 622 | Ga0207698_10022477 | 3300026142 | Bacteria | 4384 |
| 623 | Ga0209813_10000093 | 3300027866 | Bacteria | 33306 |
| 624 | Ga0209974_10006494 | 3300027876 | Bacteria | 4080 |
| 625 | Ga0207428_10046362 | 3300027907 | Bacteria | 3496 |
| 626 | Ga0268266_10000042 | 3300028379 | Bacteria | 316826 |
| 627 | Ga0268266_10000133 | 3300028379 | Bacteria | 143210 |
| 628 | Ga0268266_10000354 | 3300028379 | Bacteria | 70983 |
| 629 | Ga0268266_10000468 | 3300028379 | Bacteria | 58386 |
| 630 | Ga0268266_10004851 | 3300028379 | Bacteria | 12769 |
| 631 | Ga0268266_10008187 | 3300028379 | Bacteria | 9328 |
| 632 | Ga0268266_10010333 | 3300028379 | Bacteria | 8167 |
| 633 | Ga0268266_10018696 | 3300028379 | Bacteria | 5904 |
| 634 | Ga0268266_10046227 | 3300028379 | Bacteria | 3727 |
| 635 | Ga0268266_10137207 | 3300028379 | Bacteria | 2192 |
| 636 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 637 | Ga0268265_10000091 | 3300028380 | Bacteria | 115237 |
| 638 | Ga0268265_10000145 | 3300028380 | Bacteria | 89267 |
| 639 | Ga0268265_10000260 | 3300028380 | Bacteria | 60001 |
| 640 | Ga0268265_10001372 | 3300028380 | Bacteria | 20680 |
| 641 | Ga0268265_10003169 | 3300028380 | Bacteria | 11962 |
| 642 | Ga0268265_10004650 | 3300028380 | Bacteria | 9476 |
| 643 | Ga0268265_10009026 | 3300028380 | Bacteria | 6744 |
| 644 | Ga0268265_10011653 | 3300028380 | Bacteria | 5946 |
| 645 | Ga0268265_10012998 | 3300028380 | Bacteria | 5653 |
| 646 | Ga0268265_10014104 | 3300028380 | Bacteria | 5447 |
| 647 | Ga0268265_10022561 | 3300028380 | Bacteria | 4425 |
| 648 | Ga0268264_10000006 | 3300028381 | Bacteria | 827324 |
| 649 | Ga0268264_10000010 | 3300028381 | Bacteria | 596543 |
| 650 | Ga0268264_10000018 | 3300028381 | Bacteria | 495324 |
| 651 | Ga0268264_10000087 | 3300028381 | Bacteria | 236696 |
| 652 | Ga0268264_10000103 | 3300028381 | Bacteria | 222439 |
| 653 | Ga0268264_10000425 | 3300028381 | Bacteria | 58711 |
| 654 | Ga0268264_10001804 | 3300028381 | Bacteria | 19568 |
| 655 | Ga0268264_10002419 | 3300028381 | Bacteria | 16426 |
| 656 | Ga0268264_10010046 | 3300028381 | Bacteria | 7834 |
| 657 | Ga0268264_10028009 | 3300028381 | Bacteria | 4608 |
| 658 | Ga0268264_10046251 | 3300028381 | Bacteria | 3614 |
| 659 | Ga0268264_10088785 | 3300028381 | Bacteria | 2661 |
| 660 | Ga0307408_100040705 | 3300031548 | Bacteria | 3291 |
| 661 | Ga0307408_100052891 | 3300031548 | Bacteria | 2931 |
| 662 | Ga0307408_100097525 | 3300031548 | Bacteria | 2233 |
| 663 | Ga0307508_10005528 | 3300031616 | Bacteria | 12006 |
| 664 | Ga0307508_10080130 | 3300031616 | Bacteria | 2847 |
| 665 | Ga0307405_10010703 | 3300031731 | Bacteria | 4769 |
| 666 | Ga0307405_10022524 | 3300031731 | Bacteria | 3563 |
| 667 | Ga0307405_10069610 | 3300031731 | Bacteria | 2256 |
| 668 | Ga0307413_10001042 | 3300031824 | Bacteria | 10040 |
| 669 | Ga0307413_10012378 | 3300031824 | Bacteria | 4244 |
| 670 | Ga0307413_10013512 | 3300031824 | Bacteria | 4108 |
| 671 | Ga0307413_10035331 | 3300031824 | Bacteria | 2865 |
| 672 | Ga0307413_10071058 | 3300031824 | Bacteria | 2191 |
| 673 | Ga0307413_10123956 | 3300031824 | Bacteria | 1755 |
| 674 | Ga0307410_10004118 | 3300031852 | Bacteria | 7450 |
| 675 | Ga0307410_10016554 | 3300031852 | Bacteria | 4400 |
| 676 | Ga0307410_10022347 | 3300031852 | Bacteria | 3907 |
| 677 | Ga0307410_10049287 | 3300031852 | Bacteria | 2826 |
| 678 | Ga0307410_10052350 | 3300031852 | Bacteria | 2757 |
| 679 | Ga0307410_10055748 | 3300031852 | Bacteria | 2684 |
| 680 | Ga0307410_10055785 | 3300031852 | Bacteria | 2683 |
| 681 | Ga0307406_10010899 | 3300031901 | Bacteria | 5140 |
| 682 | Ga0307406_10055147 | 3300031901 | Bacteria | 2539 |
| 683 | Ga0307407_10062180 | 3300031903 | Bacteria | 2185 |
| 684 | Ga0307407_10074787 | 3300031903 | Bacteria | 2028 |
| 685 | Ga0307407_10077002 | 3300031903 | Bacteria | 2004 |
| 686 | Ga0307412_10001412 | 3300031911 | Bacteria | 13375 |
| 687 | Ga0307412_10003919 | 3300031911 | Bacteria | 8289 |
| 688 | Ga0307412_10040833 | 3300031911 | Bacteria | 3003 |
| 689 | Ga0307412_10056319 | 3300031911 | Bacteria | 2619 |
| 690 | Ga0307412_10058445 | 3300031911 | Bacteria | 2579 |
| 691 | Ga0307409_100010865 | 3300031995 | Bacteria | 5697 |
| 692 | Ga0307409_100025354 | 3300031995 | Bacteria | 4157 |
| 693 | Ga0307409_100057154 | 3300031995 | Bacteria | 3021 |
| 694 | Ga0307409_100077486 | 3300031995 | Bacteria | 2670 |
| 695 | Ga0307416_100005969 | 3300032002 | Bacteria | 7568 |
| 696 | Ga0307416_100021093 | 3300032002 | Bacteria | 4669 |
| 697 | Ga0307416_100039417 | 3300032002 | Bacteria | 3657 |
| 698 | Ga0307416_100130056 | 3300032002 | Bacteria | 2264 |
| 699 | Ga0307416_100144250 | 3300032002 | Bacteria | 2170 |
| 700 | Ga0307414_10000230 | 3300032004 | Bacteria | 36506 |
| 701 | Ga0307414_10002011 | 3300032004 | Bacteria | 10559 |
| 702 | Ga0307414_10005482 | 3300032004 | Bacteria | 6991 |
| 703 | Ga0307414_10007276 | 3300032004 | Bacteria | 6217 |
| 704 | Ga0307414_10015338 | 3300032004 | Bacteria | 4626 |
| 705 | Ga0307414_10032371 | 3300032004 | Bacteria | 3441 |
| 706 | Ga0307414_10065819 | 3300032004 | Bacteria | 2587 |
| 707 | Ga0307414_10069197 | 3300032004 | Bacteria | 2536 |
| 708 | Ga0307411_10015806 | 3300032005 | Bacteria | 4252 |
| 709 | Ga0307411_10017646 | 3300032005 | Bacteria | 4074 |
| 710 | Ga0307411_10017807 | 3300032005 | Bacteria | 4060 |
| 711 | Ga0307411_10049763 | 3300032005 | Bacteria | 2725 |
| 712 | Ga0307411_10059882 | 3300032005 | Bacteria | 2526 |
| 713 | Ga0307411_10061655 | 3300032005 | Bacteria | 2497 |
| 714 | Ga0307411_10062989 | 3300032005 | Bacteria | 2476 |
| 715 | Ga0307411_10105305 | 3300032005 | Bacteria | 2005 |
| 716 | Ga0307415_100001168 | 3300032126 | Bacteria | 12279 |
| 717 | Ga0307415_100021846 | 3300032126 | Bacteria | 3941 |
| 718 | Ga0307415_100029330 | 3300032126 | Bacteria | 3514 |
| 719 | Ga0307415_100031961 | 3300032126 | Bacteria | 3398 |
| 720 | Ga0307510_10003707 | 3300033180 | Bacteria | 17860 |
| 721 | Ga0373943_0003208 | 3300035170 | Bacteria | 7421 |
| 722 | Ga0373935_0027403 | 3300035692 | Bacteria | 3521 |
| 723 | Ga0373935_0096905 | 3300035692 | Bacteria | 1939 |
| 724 | Ga0373947_0047947 | 3300035725 | Bacteria | 2562 |
| 725 | Ga0395899_0002090 | 3300037312 | Bacteria | 16385 |
| 726 | Ga0395899_0011079 | 3300037312 | Bacteria | 6906 |
| 727 | Ga0395899_0013169 | 3300037312 | Bacteria | 6325 |
| 728 | Ga0395899_0114950 | 3300037312 | Bacteria | 1932 |
| 729 | Ga0395900_0004149 | 3300037418 | Bacteria | 15419 |
| 730 | Ga0395900_0031168 | 3300037418 | Bacteria | 5476 |
| 731 | Ga0395900_0032675 | 3300037418 | Bacteria | 5351 |
| 732 | Ga0395900_0060471 | 3300037418 | Bacteria | 3898 |
| 733 | Ga0395900_0073994 | 3300037418 | Bacteria | 3503 |
| 734 | Ga0395898_0012526 | 3300037466 | Bacteria | 8771 |
| 735 | Ga0395898_0017336 | 3300037466 | Bacteria | 7357 |
| 736 | Ga0395898_0052866 | 3300037466 | Bacteria | 3968 |
| 737 | Ga0395898_0076029 | 3300037466 | Bacteria | 3243 |
| 738 | Ga0395898_0086371 | 3300037466 | Bacteria | 3023 |
| 739 | Ga0395898_0157699 | 3300037466 | Bacteria | 2171 |
| 740 | Ga0395905_0000193 | 3300037471 | Bacteria | 96667 |
| 741 | Ga0395905_0003054 | 3300037471 | Bacteria | 18136 |
| 742 | Ga0395905_0004969 | 3300037471 | Bacteria | 13697 |
| 743 | Ga0395905_0029464 | 3300037471 | Bacteria | 5171 |
| 744 | Ga0395905_0089060 | 3300037471 | Bacteria | 2892 |
| 745 | Ga0395905_0109362 | 3300037471 | Bacteria | 2595 |
| 746 | Ga0395905_0181388 | 3300037471 | Bacteria | 1976 |
| 747 | Ga0436364_0484549 | 3300037853 | Bacteria | 37401 |
| 748 | Ga0395901_0001182 | 3300038443 | Bacteria | 27756 |
| 749 | Ga0395901_0004785 | 3300038443 | Bacteria | 13663 |
| 750 | Ga0395901_0025716 | 3300038443 | Bacteria | 6043 |
| 751 | Ga0395901_0062262 | 3300038443 | Bacteria | 3883 |
| 752 | Ga0395901_0085298 | 3300038443 | Bacteria | 3301 |
| 753 | Ga0395901_0179426 | 3300038443 | Bacteria | 2221 |
| 754 | Ga0395901_0182776 | 3300038443 | Bacteria | 2199 |
| 755 | Ga0436365_0668445 | 3300039437 | Bacteria | 24471 |
| 756 | Ga0436365_0853458 | 3300039437 | Bacteria | 6825 |
| 757 | Ga0436362_0284509 | 3300039453 | Bacteria | 45469 |
| 758 | Ga0439461_0000364 | 3300041410 | Bacteria | 6457 |
| 759 | Ga0439465_0000704 | 3300041413 | Bacteria | 10276 |
| 760 | Ga0439465_0012388 | 3300041413 | Bacteria | 2667 |
| 761 | Ga0439432_001242 | 3300042006 | Bacteria | 9640 |
| 762 | Ga0439457_004158 | 3300042014 | Bacteria | 3817 |
| 763 | Ga0439462_0008277 | 3300042015 | Bacteria | 2617 |
| 764 | Ga0450912_000714 | 3300042116 | Bacteria | 1776 |
| 765 | Ga0439434_0005349 | 3300042435 | Bacteria | 3757 |
| 766 | Ga0466961_0009058 | 3300044693 | Bacteria | 6348 |
| 767 | Ga0466963_0012590 | 3300044694 | Bacteria | 5182 |
| 768 | Ga0466971_0002752 | 3300044719 | Bacteria | 7431 |
| 769 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 770 | Ga0466958_0001341 | 3300045836 | Bacteria | 11619 |
| 771 | Ga0466967_0128101 | 3300045976 | Bacteria | 2353 |
| 772 | Ga0495627_000167 | 3300046453 | Bacteria | 74800 |
| 773 | Ga0495627_000217 | 3300046453 | Bacteria | 62536 |
| 774 | Ga0495650_0000559 | 3300046471 | Bacteria | 52755 |
| 775 | Ga0495650_0008074 | 3300046471 | Bacteria | 6211 |
| 776 | Ga0495596_0000233 | 3300046500 | Bacteria | 37690 |
| 777 | Ga0495607_0015908 | 3300046501 | Bacteria | 4864 |
| 778 | Ga0495583_0000260 | 3300046506 | Bacteria | 86495 |
| 779 | Ga0495606_0000235 | 3300046507 | Bacteria | 98069 |
| 780 | Ga0495606_0035039 | 3300046507 | Bacteria | 3437 |
| 781 | Ga0495610_0000030 | 3300046512 | Bacteria | 265950 |
| 782 | Ga0495610_0000127 | 3300046512 | Bacteria | 84143 |
| 783 | Ga0495616_0000022 | 3300046513 | Bacteria | 149720 |
| 784 | Ga0495632_0000076 | 3300046519 | Bacteria | 101121 |
| 785 | Ga0495632_0021408 | 3300046519 | Bacteria | 3484 |
| 786 | Ga0495637_0002289 | 3300046520 | Bacteria | 10607 |
| 787 | Ga0495643_0000009 | 3300046522 | Bacteria | 344767 |
| 788 | Ga0495643_0000746 | 3300046522 | Bacteria | 36916 |
| 789 | Ga0495643_0006640 | 3300046522 | Bacteria | 7592 |
| 790 | Ga0495648_0000026 | 3300046524 | Bacteria | 232162 |
| 791 | Ga0495648_0005225 | 3300046524 | Bacteria | 10856 |
| 792 | Ga0495663_0000023 | 3300046525 | Bacteria | 105104 |
| 793 | Ga0495663_0000975 | 3300046525 | Bacteria | 9481 |
| 794 | Ga0495654_0000194 | 3300046530 | Bacteria | 59637 |
| 795 | Ga0495598_0000610 | 3300046537 | Bacteria | 6760 |
| 796 | Ga0495609_0030341 | 3300046538 | Bacteria | 2461 |
| 797 | Ga0495621_0000010 | 3300046539 | Bacteria | 39172 |
| 798 | Ga0495621_0007030 | 3300046539 | Bacteria | 3315 |
| 799 | Ga0495633_0000136 | 3300046558 | Bacteria | 97314 |
| 800 | Ga0495633_0001163 | 3300046558 | Bacteria | 21130 |
| 801 | Ga0495633_0005728 | 3300046558 | Bacteria | 7510 |
| 802 | Ga0495668_0000004 | 3300046616 | Bacteria | 574236 |
| 803 | Ga0495668_0005823 | 3300046616 | Bacteria | 8238 |
| 804 | Ga0495668_0007759 | 3300046616 | Bacteria | 6808 |
| 805 | Ga0495625_0000729 | 3300046660 | Bacteria | 46117 |
| 806 | Ga0495625_0010834 | 3300046660 | Bacteria | 7500 |
| 807 | Ga0495625_0034320 | 3300046660 | Bacteria | 3745 |
| 808 | Ga0495669_0005836 | 3300046684 | Bacteria | 5135 |
| 809 | Ga0495669_0038592 | 3300046684 | Bacteria | 2115 |
| 810 | Ga0495670_0000004 | 3300046691 | Bacteria | 310086 |
| 811 | Ga0495671_0000013 | 3300046692 | Bacteria | 344767 |
| 812 | Ga0495671_0000139 | 3300046692 | Bacteria | 63631 |
| 813 | Ga0495673_0000066 | 3300047469 | Bacteria | 221478 |
| 814 | Ga0495681_0000011 | 3300047470 | Bacteria | 201843 |
| 815 | Ga0495681_0000042 | 3300047470 | Bacteria | 116324 |
| 816 | Ga0495681_0002227 | 3300047470 | Bacteria | 13958 |
| 817 | Ga0495686_0025230 | 3300047472 | Bacteria | 3899 |
| 818 | Ga0495615_0000025 | 3300048090 | Bacteria | 49753 |
| 819 | Ga0495626_0012404 | 3300048091 | Bacteria | 4468 |
| 820 | Ga0496100_0019893 | 3300048903 | Bacteria | 4015 |
| 821 | Ga0496100_0045726 | 3300048903 | Bacteria | 2811 |
| 822 | Ga0496102_0000043 | 3300048905 | Bacteria | 189201 |
| 823 | Ga0496102_0000998 | 3300048905 | Bacteria | 26613 |
| 824 | Ga0496102_0004522 | 3300048905 | Bacteria | 11750 |
| 825 | Ga0496102_0038873 | 3300048905 | Bacteria | 4297 |
| 826 | Ga0496103_0000133 | 3300048906 | Bacteria | 78740 |
| 827 | Ga0496103_0000201 | 3300048906 | Bacteria | 59837 |
| 828 | Ga0496103_0009525 | 3300048906 | Bacteria | 5751 |
| 829 | Ga0496103_0013050 | 3300048906 | Bacteria | 4925 |
| 830 | Ga0496104_0000078 | 3300048907 | Bacteria | 100203 |
| 831 | Ga0496104_0017309 | 3300048907 | Bacteria | 6560 |
| 832 | Ga0496105_0000241 | 3300048908 | Bacteria | 36833 |
| 833 | Ga0496105_0005919 | 3300048908 | Bacteria | 9331 |
| 834 | Ga0496105_0099749 | 3300048908 | Bacteria | 2398 |
| 835 | Ga0496106_0002700 | 3300048909 | Bacteria | 13158 |
| 836 | Ga0496106_0003227 | 3300048909 | Bacteria | 12209 |
| 837 | Ga0496106_0042593 | 3300048909 | Bacteria | 3405 |
| 838 | Ga0496107_0007192 | 3300048910 | Bacteria | 7667 |
| 839 | Ga0496107_0011807 | 3300048910 | Bacteria | 6098 |
| 840 | Ga0496107_0012495 | 3300048910 | Bacteria | 5926 |
| 841 | Ga0496107_0071001 | 3300048910 | Bacteria | 2530 |
| 842 | Ga0496108_0002029 | 3300048911 | Bacteria | 16208 |
| 843 | Ga0496108_0004360 | 3300048911 | Bacteria | 11380 |
| 844 | Ga0496108_0006530 | 3300048911 | Bacteria | 9457 |
| 845 | Ga0496108_0008130 | 3300048911 | Bacteria | 8506 |
| 846 | Ga0496108_0044071 | 3300048911 | Bacteria | 3725 |
| 847 | Ga0496109_0004600 | 3300048912 | Bacteria | 11514 |
| 848 | Ga0496109_0008938 | 3300048912 | Bacteria | 8536 |
| 849 | Ga0496109_0014993 | 3300048912 | Bacteria | 6746 |
| 850 | Ga0496109_0024508 | 3300048912 | Bacteria | 5364 |
| 851 | Ga0496109_0084654 | 3300048912 | Bacteria | 2926 |
| 852 | Ga0496110_0003943 | 3300048913 | Bacteria | 11413 |
| 853 | Ga0496110_0006209 | 3300048913 | Bacteria | 9432 |
| 854 | Ga0496110_0006236 | 3300048913 | Bacteria | 9401 |
| 855 | Ga0496110_0011114 | 3300048913 | Bacteria | 7354 |
| 856 | Ga0496110_0087861 | 3300048913 | Bacteria | 2776 |
| 857 | Ga0496111_0013500 | 3300048914 | Bacteria | 5562 |
| 858 | Ga0496111_0014957 | 3300048914 | Bacteria | 5315 |
| 859 | Ga0496111_0023348 | 3300048914 | Bacteria | 4340 |
| 860 | Ga0496111_0114788 | 3300048914 | Bacteria | 1985 |
| 861 | Ga0496112_0014138 | 3300048915 | Bacteria | 7393 |
| 862 | Ga0496112_0021605 | 3300048915 | Bacteria | 6122 |
| 863 | Ga0496112_0062776 | 3300048915 | Bacteria | 3665 |
| 864 | Ga0496112_0076839 | 3300048915 | Bacteria | 3302 |
| 865 | Ga0496112_0116575 | 3300048915 | Bacteria | 2641 |
| 866 | Ga0496113_0003327 | 3300048916 | Bacteria | 9598 |
| 867 | Ga0496113_0040762 | 3300048916 | Bacteria | 3423 |
| 868 | Ga0496113_0071744 | 3300048916 | Bacteria | 2634 |
| 869 | Ga0496114_0020555 | 3300048917 | Bacteria | 5358 |
| 870 | Ga0496114_0048461 | 3300048917 | Bacteria | 3534 |
| 871 | Ga0496114_0051260 | 3300048917 | Bacteria | 3436 |
| 872 | Ga0496115_0000504 | 3300048918 | Bacteria | 30605 |
| 873 | Ga0496116_0000028 | 3300048919 | Bacteria | 424086 |
| 874 | Ga0496116_0000682 | 3300048919 | Bacteria | 44118 |
| 875 | Ga0496117_0000104 | 3300048920 | Bacteria | 189201 |
| 876 | Ga0496117_0003203 | 3300048920 | Bacteria | 19356 |
| 877 | Ga0496117_0021921 | 3300048920 | Bacteria | 5144 |
| 878 | Ga0496118_0000080 | 3300048921 | Bacteria | 189201 |
| 879 | Ga0496118_0018225 | 3300048921 | Bacteria | 6343 |
| 880 | Ga0496118_0025704 | 3300048921 | Bacteria | 5039 |
| 881 | Ga0496119_0000114 | 3300048922 | Bacteria | 114495 |
| 882 | Ga0496120_0000266 | 3300048923 | Bacteria | 87412 |
| 883 | Ga0496121_0000021 | 3300048924 | Bacteria | 478544 |
| 884 | Ga0496121_0000520 | 3300048924 | Bacteria | 73411 |
| 885 | Ga0496121_0000731 | 3300048924 | Bacteria | 60609 |
| 886 | Ga0496121_0001018 | 3300048924 | Bacteria | 50054 |
| 887 | Ga0496121_0016625 | 3300048924 | Bacteria | 7581 |
| 888 | Ga0496122_0005756 | 3300048925 | Bacteria | 14594 |
| 889 | Ga0496122_0005810 | 3300048925 | Bacteria | 14503 |
| 890 | Ga0496122_0019036 | 3300048925 | Bacteria | 6298 |
| 891 | Ga0496123_0001678 | 3300048926 | Bacteria | 29639 |
| 892 | Ga0496123_0009221 | 3300048926 | Bacteria | 8921 |
| 893 | Ga0496123_0017201 | 3300048926 | Bacteria | 5832 |
| 894 | Ga0496124_0000093 | 3300048927 | Bacteria | 189201 |
| 895 | Ga0496124_0003121 | 3300048927 | Bacteria | 20560 |
| 896 | Ga0496124_0003580 | 3300048927 | Bacteria | 18883 |
| 897 | Ga0496124_0004225 | 3300048927 | Bacteria | 16906 |
| 898 | Ga0496124_0008108 | 3300048927 | Bacteria | 11033 |
| 899 | Ga0496124_0128771 | 3300048927 | Bacteria | 2013 |
| 900 | Ga0496125_0006013 | 3300048928 | Bacteria | 13276 |
| 901 | Ga0496125_0021035 | 3300048928 | Bacteria | 6098 |
| 902 | Ga0496125_0024152 | 3300048928 | Bacteria | 5594 |
| 903 | Ga0496125_0035203 | 3300048928 | Bacteria | 4399 |
| 904 | Ga0496126_0000079 | 3300048929 | Bacteria | 222463 |
| 905 | Ga0496126_0000173 | 3300048929 | Bacteria | 146490 |
| 906 | Ga0496126_0005189 | 3300048929 | Bacteria | 15051 |
| 907 | Ga0501307_002712 | 3300049162 | Bacteria | 1677 |
| 908 | Ga0501290_000042 | 3300049513 | Bacteria | 16627 |
| 909 | Ga0501292_000005 | 3300049515 | Bacteria | 147536 |
| 910 | Ga0501294_000049 | 3300049517 | Bacteria | 12363 |
| 911 | Ga0501317_002272 | 3300049533 | Bacteria | 1794 |
| 912 | Ga0501032_0024236 | 3300049569 | Bacteria | 4191 |
| 913 | Ga0501034_0002130 | 3300049571 | Bacteria | 24593 |
| 914 | Ga0501034_0053982 | 3300049571 | Bacteria | 4046 |
| 915 | Ga0501036_0010046 | 3300049572 | Bacteria | 7798 |
| 916 | Ga0501037_0014284 | 3300049573 | Bacteria | 5852 |
| 917 | Ga0501069_0050106 | 3300049585 | Bacteria | 2322 |
| 918 | Ga0501070_0018814 | 3300049586 | Bacteria | 5794 |
| 919 | Ga0501206_000476 | 3300049653 | Bacteria | 4839 |
| 920 | Ga0501207_001528 | 3300049654 | Bacteria | 2903 |
| 921 | Ga0501222_000183 | 3300049662 | Bacteria | 11236 |
| 922 | Ga0501223_000205 | 3300049663 | Bacteria | 15152 |
| 923 | Ga0501223_001035 | 3300049663 | Bacteria | 6564 |
| 924 | Ga0501224_000028 | 3300049664 | Bacteria | 53596 |
| 925 | Ga0501227_002874 | 3300049665 | Bacteria | 3779 |
| 926 | Ga0501233_003691 | 3300049668 | Bacteria | 2764 |
| 927 | Ga0501235_001607 | 3300049669 | Bacteria | 4843 |
| 928 | Ga0501249_000294 | 3300049679 | Bacteria | 14101 |
| 929 | Ga0501249_006567 | 3300049679 | Bacteria | 2391 |
| 930 | Ga0501257_000016 | 3300049686 | Bacteria | 49821 |
| 931 | Ga0501258_001149 | 3300049687 | Bacteria | 2087 |
| 932 | Ga0501221_000663 | 3300049704 | Bacteria | 5515 |
| 933 | Ga0501225_0001120 | 3300049705 | Bacteria | 8398 |
| 934 | Ga0501225_0001850 | 3300049705 | Bacteria | 6639 |
| 935 | Ga0501234_002566 | 3300049707 | Bacteria | 2859 |
| 936 | Ga0501279_000020 | 3300049775 | Bacteria | 58285 |
| 937 | Ga0501280_000025 | 3300049776 | Bacteria | 49396 |
| 938 | Ga0501282_000036 | 3300049778 | Bacteria | 17537 |
| 939 | Ga0501044_0013271 | 3300049823 | Bacteria | 8919 |
| 940 | Ga0501226_000146 | 3300049853 | Bacteria | 13414 |
| 941 | nmdc:mga03683_448_c1 | 3300050489 | Bacteria | 11870 |
| 942 | nmdc:mga03n38_15852_c1 | 3300050490 | Bacteria | 2919 |
| 943 | nmdc:mga00v17_12785_c1 | 3300050491 | Bacteria | 4638 |
| 944 | nmdc:mga00v17_7556_c1 | 3300050491 | Bacteria | 5805 |
| 945 | nmdc:mga0yw44_9045_c1 | 3300050492 | Bacteria | 5008 |
| 946 | nmdc:mga0k408_8774_c1 | 3300050493 | Bacteria | 5441 |
| 947 | nmdc:mga06z11_168_c1 | 3300050494 | Bacteria | 25790 |
| 948 | nmdc:mga06z11_482_c1 | 3300050494 | Bacteria | 14695 |
| 949 | nmdc:mga04h51_189_c1 | 3300050495 | Bacteria | 16836 |
| 950 | nmdc:mga07m45_55_c1 | 3300050496 | Bacteria | 47453 |
| 951 | nmdc:mga0qj67_3093_c1 | 3300050509 | Bacteria | 11964 |
| 952 | nmdc:mga0sz30_15843_c1 | 3300050516 | Bacteria | 2984 |
| 953 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 954 | Ga0500643_000167 | 3300053087 | Bacteria | 64874 |
| 955 | Ga0500643_000523 | 3300053087 | Bacteria | 27013 |
| 956 | Ga0500643_007597 | 3300053087 | Bacteria | 4347 |
| 957 | Ga0500566_0001889 | 3300053094 | Bacteria | 12327 |
| 958 | Ga0500556_0000040 | 3300053104 | Bacteria | 137489 |
| 959 | Ga0500592_000074 | 3300053116 | Bacteria | 25290 |
| 960 | Ga0500607_000354 | 3300053121 | Bacteria | 43487 |
| 961 | Ga0500607_001619 | 3300053121 | Bacteria | 19861 |
| 962 | Ga0500608_008713 | 3300053122 | Bacteria | 4276 |
| 963 | Ga0500618_001172 | 3300053125 | Bacteria | 12656 |
| 964 | Ga0500642_0000003 | 3300053130 | Bacteria | 544899 |
| 965 | Ga0500655_001426 | 3300053133 | Bacteria | 4538 |
| 966 | Ga0500658_0000887 | 3300053134 | Bacteria | 12284 |
| 967 | Ga0500559_0001553 | 3300053136 | Bacteria | 12848 |
| 968 | Ga0500568_0000708 | 3300053139 | Bacteria | 23914 |
| 969 | Ga0500568_0012994 | 3300053139 | Bacteria | 3810 |
| 970 | Ga0500573_0000019 | 3300053140 | Bacteria | 173601 |
| 971 | Ga0500604_0000004 | 3300053151 | Bacteria | 146374 |
| 972 | Ga0500616_0000195 | 3300053153 | Bacteria | 99188 |
| 973 | Ga0500616_0000893 | 3300053153 | Bacteria | 32769 |
| 974 | Ga0500616_0003996 | 3300053153 | Bacteria | 10763 |
| 975 | Ga0500622_0000145 | 3300053156 | Bacteria | 75417 |
| 976 | Ga0500624_000012 | 3300053157 | Bacteria | 165895 |
| 977 | Ga0500624_000092 | 3300053157 | Bacteria | 43880 |
| 978 | Ga0500627_0000126 | 3300053158 | Bacteria | 23656 |
| 979 | Ga0500627_0000254 | 3300053158 | Bacteria | 15182 |
| 980 | Ga0500627_0000423 | 3300053158 | Bacteria | 11458 |
| 981 | Ga0500567_000039 | 3300053723 | Bacteria | 27122 |
| 982 | Ga0500625_000021 | 3300053729 | Bacteria | 83503 |
| 983 | Ga0500645_002312 | 3300053730 | Bacteria | 8598 |
| 984 | Ga0500645_002526 | 3300053730 | Bacteria | 8075 |
| 985 | Ga0587077_005217 | 3300059493 | Bacteria | 1765 |
| 986 | Ga0466962_0002983 | 3300061719 | Bacteria | 8076 |
| 987 | 2511125726 | 2510917021 | Bacteria | 5705459 |
| 988 | 2512645659 | 2512564014 | Bacteria | 4639632 |
| 989 | 2600200357 | 2599185354 | Bacteria | 4398675 |
| 990 | 2643820503 | 2643221560 | Bacteria | 4801179 |
| 991 | 2643836319 | 2643221563 | Bacteria | 4726935 |
| 992 | 2643951819 | 2643221588 | Bacteria | 3692460 |
| 993 | 2644043449 | 2643221606 | Bacteria | 5588032 |
| 994 | 2644052795 | 2643221608 | Bacteria | 4724829 |
| 995 | 2644126664 | 2643221622 | Bacteria | 4212502 |
| 996 | 2644393608 | 2643221671 | Bacteria | 5496681 |
| 997 | 2738711566 | 2738541275 | Bacteria | 4830863 |
| 998 | 2738849991 | 2738541301 | Bacteria | 4834102 |
| 999 | 2738865720 | 2738541304 | Bacteria | 4833665 |
| 1000 | 2739298238 | 2738543022 | Bacteria | 4835059 |
| 1001 | 2739359916 | 2738543033 | Bacteria | 4833336 |
| 1002 | 2739649106 | 2739367664 | Bacteria | 4114334 |
| 1003 | 2740027579 | 2739367865 | Bacteria | 4114482 |
| 1004 | 2753763831 | 2751185897 | Bacteria | 5322941 |
| 1005 | 2778123442 | 2775507255 | Bacteria | 3945731 |
| 1006 | 2809062552 | 2808606401 | Bacteria | 4586670 |
| 1007 | 2809078764 | 2808606404 | Bacteria | 4652788 |
| 1008 | 2809082941 | 2808606405 | Bacteria | 4586632 |
| 1009 | 2819553072 | 2818991438 | Bacteria | 5793701 |
| 1010 | 2848298468 | 2848297114 | Bacteria | 3608511 |
| 1011 | 2852653930 | 2852653556 | Bacteria | 4050083 |
| 1012 | 2852682674 | 2852680915 | Bacteria | 4100189 |
| 1013 | 2880521643 | 2880518877 | Bacteria | 5012590 |
| 1014 | 2895884265 | 2895880812 | Bacteria | 11255272 |
| 1015 | 2896184364 | 2896184354 | Bacteria | 3258548 |
| 1016 | 2896254919 | 2896253425 | Bacteria | 3418029 |
| 1017 | 2919709856 | 2919709256 | Bacteria | 4318106 |
| 1018 | 2928104184 | 2928100450 | Bacteria | 4837635 |
| 1019 | 2928961649 | 2928959182 | Bacteria | 4725774 |
| 1020 | 8054305891 | 8054302542 | Bacteria | 5698134 |
| 1021 | 8057103277 | 8057101203 | Bacteria | 5034064 |
| 1022 | Ga0316584_0017465 | |||
| 1023 | SwRhRL2b_contig_2381042 | |||
| 1024 | SwRhRL2b_contig_878851 | |||
| 1025 | ARcpr5yngRDRAFT_c001944 | |||
| 1026 | JGI24736J21556_1000415 | |||
| 1027 | JGI24736J21556_1002014 | |||
| 1028 | JGI24741J21665_1000020 | |||
| 1029 | JGI24741J21665_1002181 | |||
| 1030 | JGI24752J21851_1000014 | |||
| 1031 | JGI24740J21852_10001751 | |||
| 1032 | JGI24740J21852_10003682 | |||
| 1033 | JGI24740J21852_10005611 | |||
| 1034 | JGI24739J22299_10001047 | |||
| 1035 | JGI24739J22299_10006253 | |||
| 1036 | JGI24737J22298_10000015 | |||
| 1037 | JGI24737J22298_10001361 | |||
| 1038 | JGI24735J21928_10000711 | |||
| 1039 | JGI24735J21928_10001925 | |||
| 1040 | JGI24735J21928_10003716 | |||
| 1041 | JGI24750J21931_1000311 | |||
| 1042 | JGI24748J21848_1000058 | |||
| 1043 | JGI24738J21930_10000387 | |||
| 1044 | JGI24738J21930_10001330 | |||
| 1045 | JGI24749J21850_1000021 | |||
| 1046 | JGI24034J26672_10000050 | |||
| 1047 | JGI24751J29686_10000080 | |||
| 1048 | JGI24751J29686_10000192 | |||
| 1049 | JGI25152J39213_1005835 | |||
| 1050 | JGI25150J39212_1000319 | |||
| 1051 | JGI25153J46596_10000999 | |||
| 1052 | JGI25153J46596_10012183 | |||
| 1053 | Ga0055526_1000760 | |||
| 1054 | Ga0055537_1000317 | |||
| 1055 | Ga0055537_1001489 | |||
| 1056 | Ga0055537_1002474 | |||
| 1057 | Ga0055524_1000149 | |||
| 1058 | Ga0055536_1001571 | |||
| 1059 | Ga0055534_1005555 | |||
| 1060 | Ga0055530_10000005 | |||
| 1061 | Ga0055530_10000060 | |||
| 1062 | Ga0055540_1004881 | |||
| 1063 | Ga0055531_10000049 | |||
| 1064 | Ga0055531_10004473 | |||
| 1065 | Ga0055531_10007837 | |||
| 1066 | Ga0055531_10009294 | |||
| 1067 | Ga0065165_1001158 | |||
| 1068 | Ga0065165_1002598 | |||
| 1069 | Ga0065704_10000191 | |||
| 1070 | Ga0065704_10001918 | |||
| 1071 | Ga0065704_10002532 | |||
| 1072 | Ga0065704_10070424 | |||
| 1073 | Ga0065712_10068171 | |||
| 1074 | Ga0065715_10121438 | |||
| 1075 | Ga0065707_10005245 | |||
| 1076 | Ga0065707_10081716 | |||
| 1077 | Ga0065707_10084323 | |||
| 1078 | Ga0065707_10096989 | |||
| 1079 | Ga0070658_10000001 | |||
| 1080 | Ga0070658_10000346 | |||
| 1081 | Ga0070658_10003793 | |||
| 1082 | Ga0070658_10018251 | |||
| 1083 | Ga0070658_10048053 | |||
| 1084 | Ga0070658_10049173 | |||
| 1085 | Ga0070658_10069849 | |||
| 1086 | Ga0070658_10088700 | |||
| 1087 | Ga0070683_100022268 | |||
| 1088 | Ga0070683_100071276 | |||
| 1089 | Ga0070683_100073958 | |||
| 1090 | Ga0070690_100000159 | |||
| 1091 | Ga0070690_100034329 | |||
| 1092 | Ga0070670_100000031 | |||
| 1093 | Ga0070670_100001267 | |||
| 1094 | Ga0070670_100001683 | |||
| 1095 | Ga0070670_100004563 | |||
| 1096 | Ga0070670_100008579 | |||
| 1097 | Ga0070670_100008763 | |||
| 1098 | Ga0070670_100013186 | |||
| 1099 | Ga0070670_100017279 | |||
| 1100 | Ga0070670_100108759 | |||
| 1101 | Ga0070670_100147018 | |||
| 1102 | Ga0070677_10000121 | |||
| 1103 | Ga0068869_100002541 | |||
| 1104 | Ga0070666_10000002 | |||
| 1105 | Ga0070666_10000589 | |||
| 1106 | Ga0070666_10009729 | |||
| 1107 | Ga0070666_10023181 | |||
| 1108 | Ga0070666_10070361 | |||
| 1109 | Ga0068868_100007180 | |||
| 1110 | Ga0068868_100102849 | |||
| 1111 | Ga0070660_100000048 | |||
| 1112 | Ga0070660_100000061 | |||
| 1113 | Ga0070660_100001167 | |||
| 1114 | Ga0070660_100005280 | |||
| 1115 | Ga0070660_100019123 | |||
| 1116 | Ga0070689_100064407 | |||
| 1117 | Ga0070661_100010200 | |||
| 1118 | Ga0070661_100024164 | |||
| 1119 | Ga0070661_100053552 | |||
| 1120 | Ga0070692_10013757 | |||
| 1121 | Ga0070668_100000006 | |||
| 1122 | Ga0070668_100000012 | |||
| 1123 | Ga0070668_100003316 | |||
| 1124 | Ga0070668_100013778 | |||
| 1125 | Ga0070668_100014071 | |||
| 1126 | Ga0070669_100000015 | |||
| 1127 | Ga0070669_100000042 | |||
| 1128 | Ga0070669_100000055 | |||
| 1129 | Ga0070669_100001258 | |||
| 1130 | Ga0070669_100002274 | |||
| 1131 | Ga0070669_100002309 | |||
| 1132 | Ga0070669_100002547 | |||
| 1133 | Ga0070669_100008852 | |||
| 1134 | Ga0070669_100061893 | |||
| 1135 | Ga0070675_100000487 | |||
| 1136 | Ga0070675_100008232 | |||
| 1137 | Ga0070675_100009413 | |||
| 1138 | Ga0070671_100000010 | |||
| 1139 | Ga0070671_100000066 | |||
| 1140 | Ga0070671_100002199 | |||
| 1141 | Ga0070671_100004238 | |||
| 1142 | Ga0070671_100004664 | |||
| 1143 | Ga0070671_100016348 | |||
| 1144 | Ga0070671_100020459 | |||
| 1145 | Ga0070671_100034019 | |||
| 1146 | Ga0070671_100049709 | |||
| 1147 | Ga0070671_100157713 | |||
| 1148 | Ga0070674_100007181 | |||
| 1149 | Ga0070674_100116314 | |||
| 1150 | Ga0070673_100000046 | |||
| 1151 | Ga0070673_100000926 | |||
| 1152 | Ga0070673_100021743 | |||
| 1153 | Ga0070673_100122880 | |||
| 1154 | Ga0070688_100000701 | |||
| 1155 | Ga0070659_100000001 | |||
| 1156 | Ga0070659_100000833 | |||
| 1157 | Ga0070667_100000003 | |||
| 1158 | Ga0070667_100000016 | |||
| 1159 | Ga0070667_100000038 | |||
| 1160 | Ga0070667_100000396 | |||
| 1161 | Ga0070667_100002247 | |||
| 1162 | Ga0070667_100006418 | |||
| 1163 | Ga0070667_100057015 | |||
| 1164 | Ga0070667_100112523 | |||
| 1165 | Ga0070714_100015883 | |||
| 1166 | Ga0070663_100005530 | |||
| 1167 | Ga0070663_100032815 | |||
| 1168 | Ga0070678_100008901 | |||
| 1169 | Ga0070678_100039163 | |||
| 1170 | Ga0070662_100000391 | |||
| 1171 | Ga0070662_100002528 | |||
| 1172 | Ga0070662_100004908 | |||
| 1173 | Ga0070662_100005390 | |||
| 1174 | Ga0070662_100006946 | |||
| 1175 | Ga0070662_100010219 | |||
| 1176 | Ga0070662_100013093 | |||
| 1177 | Ga0070681_10021524 | |||
| 1178 | Ga0068867_100002495 | |||
| 1179 | Ga0068867_100012914 | |||
| 1180 | Ga0068867_100013381 | |||
| 1181 | Ga0068867_100018201 | |||
| 1182 | Ga0070685_10000023 | |||
| 1183 | Ga0070684_100015958 | |||
| 1184 | Ga0070684_100032382 | |||
| 1185 | Ga0068853_100000764 | |||
| 1186 | Ga0068853_100002364 | |||
| 1187 | Ga0068853_100011737 | |||
| 1188 | Ga0068853_100019489 | |||
| 1189 | Ga0068853_100038510 | |||
| 1190 | Ga0068853_100048866 | |||
| 1191 | Ga0068853_100071790 | |||
| 1192 | Ga0070672_100002251 | |||
| 1193 | Ga0070672_100005075 | |||
| 1194 | Ga0070686_100000003 | |||
| 1195 | Ga0070665_100000036 | |||
| 1196 | Ga0070665_100000075 | |||
| 1197 | Ga0070665_100000107 | |||
| 1198 | Ga0070665_100000705 | |||
| 1199 | Ga0070665_100017020 | |||
| 1200 | Ga0070665_100020206 | |||
| 1201 | Ga0070665_100020609 | |||
| 1202 | Ga0070665_100027294 | |||
| 1203 | Ga0070665_100041899 | |||
| 1204 | Ga0068855_100000318 | |||
| 1205 | Ga0068855_100007587 | |||
| 1206 | Ga0068855_100011156 | |||
| 1207 | Ga0068855_100092728 | |||
| 1208 | Ga0070664_100001286 | |||
| 1209 | Ga0070664_100002719 | |||
| 1210 | Ga0070664_100007861 | |||
| 1211 | Ga0070664_100027928 | |||
| 1212 | Ga0070664_100028012 | |||
| 1213 | Ga0070664_100038260 | |||
| 1214 | Ga0068857_100008844 | |||
| 1215 | Ga0068857_100061759 | |||
| 1216 | Ga0068854_100000494 | |||
| 1217 | Ga0068854_100001685 | |||
| 1218 | Ga0068854_100025551 | |||
| 1219 | Ga0068854_100042423 | |||
| 1220 | Ga0068856_100007003 | |||
| 1221 | Ga0068856_100023109 | |||
| 1222 | Ga0068856_100061441 | |||
| 1223 | Ga0068856_100102017 | |||
| 1224 | Ga0068852_100001901 | |||
| 1225 | Ga0068852_100019408 | |||
| 1226 | Ga0068852_100022300 | |||
| 1227 | Ga0068859_100000068 | |||
| 1228 | Ga0068859_100003549 | |||
| 1229 | Ga0068859_100008593 | |||
| 1230 | Ga0068859_100032839 | |||
| 1231 | Ga0068859_100051689 | |||
| 1232 | Ga0068859_100090863 | |||
| 1233 | Ga0068859_100102860 | |||
| 1234 | Ga0068864_100000188 | |||
| 1235 | Ga0068864_100000248 | |||
| 1236 | Ga0068864_100000339 | |||
| 1237 | Ga0068864_100003036 | |||
| 1238 | Ga0068864_100006681 | |||
| 1239 | Ga0068864_100011537 | |||
| 1240 | Ga0068864_100011656 | |||
| 1241 | Ga0068864_100011788 | |||
| 1242 | Ga0068864_100016371 | |||
| 1243 | Ga0068861_100000968 | |||
| 1244 | Ga0068861_100004123 | |||
| 1245 | Ga0068861_100014384 | |||
| 1246 | Ga0068861_100026908 | |||
| 1247 | Ga0068861_100171550 | |||
| 1248 | Ga0068863_100000034 | |||
| 1249 | Ga0068863_100000318 | |||
| 1250 | Ga0068863_100000535 | |||
| 1251 | Ga0068863_100001229 | |||
| 1252 | Ga0068863_100001802 | |||
| 1253 | Ga0068863_100002834 | |||
| 1254 | Ga0068863_100005094 | |||
| 1255 | Ga0068863_100006405 | |||
| 1256 | Ga0068863_100008251 | |||
| 1257 | Ga0068863_100014352 | |||
| 1258 | Ga0068863_100033388 | |||
| 1259 | Ga0068863_100064667 | |||
| 1260 | Ga0068863_100088446 | |||
| 1261 | Ga0068858_100000688 | |||
| 1262 | Ga0068858_100000911 | |||
| 1263 | Ga0068858_100001148 | |||
| 1264 | Ga0068858_100001791 | |||
| 1265 | Ga0068858_100001843 | |||
| 1266 | Ga0068858_100013165 | |||
| 1267 | Ga0068858_100015659 | |||
| 1268 | Ga0068858_100017819 | |||
| 1269 | Ga0068858_100056971 | |||
| 1270 | Ga0068860_100000001 | |||
| 1271 | Ga0068860_100000008 | |||
| 1272 | Ga0068860_100000068 | |||
| 1273 | Ga0068860_100000256 | |||
| 1274 | Ga0068860_100002412 | |||
| 1275 | Ga0068860_100002747 | |||
| 1276 | Ga0068860_100012538 | |||
| 1277 | Ga0068860_100018987 | |||
| 1278 | Ga0068860_100028188 | |||
| 1279 | Ga0068860_100039618 | |||
| 1280 | Ga0068862_100000006 | |||
| 1281 | Ga0068862_100000088 | |||
| 1282 | Ga0068862_100000092 | |||
| 1283 | Ga0068862_100000620 | |||
| 1284 | Ga0068862_100003636 | |||
| 1285 | Ga0068862_100010829 | |||
| 1286 | Ga0068862_100017674 | |||
| 1287 | Ga0068862_100018008 | |||
| 1288 | Ga0068862_100022595 | |||
| 1289 | Ga0068862_100069418 | |||
| 1290 | Ga0081539_10044092 | |||
| 1291 | Ga0075365_10010228 | |||
| 1292 | Ga0075368_10000074 | |||
| 1293 | Ga0075363_100009825 | |||
| 1294 | Ga0075364_10017883 | |||
| 1295 | Ga0075364_10026599 | |||
| 1296 | Ga0075432_10008434 | |||
| 1297 | Ga0075362_10009768 | |||
| 1298 | Ga0075367_10001673 | |||
| 1299 | Ga0075367_10005332 | |||
| 1300 | Ga0075369_10006044 | |||
| 1301 | Ga0075370_10038986 | |||
| 1302 | Ga0068871_100006907 | |||
| 1303 | Ga0068871_100007948 | |||
| 1304 | Ga0068871_100009459 | |||
| 1305 | Ga0075430_100138273 | |||
| 1306 | Ga0075431_100040222 | |||
| 1307 | Ga0097620_100000068 | |||
| 1308 | Ga0097620_100003549 | |||
| 1309 | Ga0097620_100008593 | |||
| 1310 | Ga0097620_100015011 | |||
| 1311 | Ga0097620_100032839 | |||
| 1312 | Ga0097620_100051689 | |||
| 1313 | Ga0097620_100090853 | |||
| 1314 | Ga0097620_100102867 | |||
| 1315 | Ga0105250_10001326 | |||
| 1316 | Ga0105240_10068043 | |||
| 1317 | Ga0105245_10004863 | |||
| 1318 | Ga0105245_10012964 | |||
| 1319 | Ga0105245_10038453 | |||
| 1320 | Ga0105247_10006552 | |||
| 1321 | Ga0105247_10010078 | |||
| 1322 | Ga0105247_10011458 | |||
| 1323 | Ga0114129_10033552 | |||
| 1324 | Ga0105243_10151945 | |||
| 1325 | Ga0105241_10000478 | |||
| 1326 | Ga0105242_10077215 | |||
| 1327 | Ga0105248_10000066 | |||
| 1328 | Ga0105248_10000071 | |||
| 1329 | Ga0105248_10000135 | |||
| 1330 | Ga0105248_10001282 | |||
| 1331 | Ga0105248_10003049 | |||
| 1332 | Ga0105248_10004287 | |||
| 1333 | Ga0105248_10013575 | |||
| 1334 | Ga0105248_10018690 | |||
| 1335 | Ga0105248_10053518 | |||
| 1336 | Ga0105248_10072624 | |||
| 1337 | Ga0105237_10031128 | |||
| 1338 | Ga0105238_10063284 | |||
| 1339 | Ga0105238_10170636 | |||
| 1340 | Ga0105249_10000026 | |||
| 1341 | Ga0105249_10000100 | |||
| 1342 | Ga0105249_10106527 | |||
| 1343 | Ga0105148_100261 | |||
| 1344 | Ga0105239_10132192 | |||
| 1345 | Ga0105246_10000273 | |||
| 1346 | Ga0157371_10000458 | |||
| 1347 | Ga0157371_10007513 | |||
| 1348 | Ga0157370_10125127 | |||
| 1349 | Ga0157378_10001242 | |||
| 1350 | Ga0157378_10200460 | |||
| 1351 | Ga0163162_10004777 | |||
| 1352 | Ga0163162_10013372 | |||
| 1353 | Ga0163162_10015345 | |||
| 1354 | Ga0163162_10022616 | |||
| 1355 | Ga0163162_10023002 | |||
| 1356 | Ga0163162_10027151 | |||
| 1357 | Ga0157372_10004194 | |||
| 1358 | Ga0157372_10045540 | |||
| 1359 | Ga0157375_10055574 | |||
| 1360 | Ga0157375_10087888 | |||
| 1361 | Ga0157375_10096542 | |||
| 1362 | Ga0163163_10000995 | |||
| 1363 | Ga0163163_10002903 | |||
| 1364 | Ga0163163_10034083 | |||
| 1365 | Ga0157380_10001048 | |||
| 1366 | Ga0157380_10002655 | |||
| 1367 | Ga0157380_10003323 | |||
| 1368 | Ga0157380_10006460 | |||
| 1369 | Ga0157380_10008128 | |||
| 1370 | Ga0157379_10004123 | |||
| 1371 | Ga0157379_10005617 | |||
| 1372 | Ga0157379_10027613 | |||
| 1373 | Ga0183363_1001 | |||
| 1374 | Ga0163161_10000008 | |||
| 1375 | Ga0163161_10003797 | |||
| 1376 | Ga0163161_10046782 | |||
| 1377 | Ga0206353_12066863 | |||
| 1378 | Ga0213873_10000015 | |||
| 1379 | Ga0213876_10000005 | |||
| 1380 | Ga0213876_10001213 | |||
| 1381 | Ga0213875_10000401 | |||
| 1382 | Ga0207672_1000500 | |||
| 1383 | Ga0209147_101541 | |||
| 1384 | Ga0207425_1000022 | |||
| 1385 | Ga0209129_1000573 | |||
| 1386 | Ga0209565_1000010 | |||
| 1387 | Ga0209565_1000099 | |||
| 1388 | Ga0209673_1001990 | |||
| 1389 | Ga0209673_1007473 | |||
| 1390 | Ga0209675_1000245 | |||
| 1391 | Ga0209676_1000557 | |||
| 1392 | Ga0209676_1000881 | |||
| 1393 | Ga0209676_1001901 | |||
| 1394 | Ga0209676_1014918 | |||
| 1395 | Ga0209025_1001210 | |||
| 1396 | Ga0209025_1034240 | |||
| 1397 | Ga0209758_1000004 | |||
| 1398 | Ga0209758_1016223 | |||
| 1399 | Ga0209050_1000001 | |||
| 1400 | Ga0209050_1000010 | |||
| 1401 | Ga0209050_1000017 | |||
| 1402 | Ga0209256_1000034 | |||
| 1403 | Ga0209051_1000450 | |||
| 1404 | Ga0209257_1000009 | |||
| 1405 | Ga0209257_1000113 | |||
| 1406 | Ga0209257_1000872 | |||
| 1407 | Ga0209257_1000921 | |||
| 1408 | Ga0209257_1001176 | |||
| 1409 | Ga0209257_1002733 | |||
| 1410 | Ga0209257_1006958 | |||
| 1411 | Ga0207697_10000004 | |||
| 1412 | Ga0207697_10000250 | |||
| 1413 | Ga0207697_10001021 | |||
| 1414 | Ga0207696_1011753 | |||
| 1415 | Ga0207713_1001941 | |||
| 1416 | Ga0207713_1010814 | |||
| 1417 | Ga0207682_10002256 | |||
| 1418 | Ga0207682_10050615 | |||
| 1419 | Ga0207710_10007666 | |||
| 1420 | Ga0207710_10017260 | |||
| 1421 | Ga0207710_10023328 | |||
| 1422 | Ga0207688_10000994 | |||
| 1423 | Ga0207680_10000004 | |||
| 1424 | Ga0207680_10016625 | |||
| 1425 | Ga0207647_10000153 | |||
| 1426 | Ga0207647_10022203 | |||
| 1427 | Ga0207647_10022445 | |||
| 1428 | Ga0207647_10051972 | |||
| 1429 | Ga0207705_10000002 | |||
| 1430 | Ga0207705_10000131 | |||
| 1431 | Ga0207705_10000537 | |||
| 1432 | Ga0207705_10001553 | |||
| 1433 | Ga0207705_10003226 | |||
| 1434 | Ga0207705_10005122 | |||
| 1435 | Ga0207705_10009316 | |||
| 1436 | Ga0207705_10013718 | |||
| 1437 | Ga0207705_10019589 | |||
| 1438 | Ga0207705_10052094 | |||
| 1439 | Ga0207705_10054965 | |||
| 1440 | Ga0207705_10070795 | |||
| 1441 | Ga0207707_10015128 | |||
| 1442 | Ga0207707_10045508 | |||
| 1443 | Ga0207695_10021776 | |||
| 1444 | Ga0207671_10025636 | |||
| 1445 | Ga0207660_10004720 | |||
| 1446 | Ga0207657_10000181 | |||
| 1447 | Ga0207657_10000391 | |||
| 1448 | Ga0207657_10000811 | |||
| 1449 | Ga0207657_10006930 | |||
| 1450 | Ga0207657_10009507 | |||
| 1451 | Ga0207657_10015686 | |||
| 1452 | Ga0207657_10016312 | |||
| 1453 | Ga0207657_10077244 | |||
| 1454 | Ga0207649_10001955 | |||
| 1455 | Ga0207649_10006461 | |||
| 1456 | Ga0207649_10009943 | |||
| 1457 | Ga0207649_10039189 | |||
| 1458 | Ga0207652_10012124 | |||
| 1459 | Ga0207652_10014430 | |||
| 1460 | Ga0207681_10000001 | |||
| 1461 | Ga0207681_10000002 | |||
| 1462 | Ga0207681_10000069 | |||
| 1463 | Ga0207681_10009746 | |||
| 1464 | Ga0207681_10025053 | |||
| 1465 | Ga0207681_10038744 | |||
| 1466 | Ga0207681_10054292 | |||
| 1467 | Ga0207681_10064571 | |||
| 1468 | Ga0207681_10064810 | |||
| 1469 | Ga0207694_10029607 | |||
| 1470 | Ga0207650_10000055 | |||
| 1471 | Ga0207650_10000969 | |||
| 1472 | Ga0207650_10001212 | |||
| 1473 | Ga0207650_10002248 | |||
| 1474 | Ga0207650_10003061 | |||
| 1475 | Ga0207650_10003163 | |||
| 1476 | Ga0207650_10004868 | |||
| 1477 | Ga0207650_10016491 | |||
| 1478 | Ga0207650_10021723 | |||
| 1479 | Ga0207650_10024587 | |||
| 1480 | Ga0207650_10057305 | |||
| 1481 | Ga0207659_10001482 | |||
| 1482 | Ga0207659_10004037 | |||
| 1483 | Ga0207659_10008772 | |||
| 1484 | Ga0207659_10035773 | |||
| 1485 | Ga0207700_10036947 | |||
| 1486 | Ga0207644_10000002 | |||
| 1487 | Ga0207644_10000087 | |||
| 1488 | Ga0207644_10000340 | |||
| 1489 | Ga0207644_10000389 | |||
| 1490 | Ga0207644_10002973 | |||
| 1491 | Ga0207644_10003017 | |||
| 1492 | Ga0207644_10004808 | |||
| 1493 | Ga0207644_10005364 | |||
| 1494 | Ga0207644_10007241 | |||
| 1495 | Ga0207644_10009606 | |||
| 1496 | Ga0207644_10025852 | |||
| 1497 | Ga0207690_10000001 | |||
| 1498 | Ga0207690_10000002 | |||
| 1499 | Ga0207690_10000003 | |||
| 1500 | Ga0207690_10000004 | |||
| 1501 | Ga0207690_10004241 | |||
| 1502 | Ga0207690_10060455 | |||
| 1503 | Ga0207706_10000194 | |||
| 1504 | Ga0207706_10001611 | |||
| 1505 | Ga0207706_10001775 | |||
| 1506 | Ga0207706_10004919 | |||
| 1507 | Ga0207706_10013591 | |||
| 1508 | Ga0207706_10014236 | |||
| 1509 | Ga0207706_10014348 | |||
| 1510 | Ga0207706_10016990 | |||
| 1511 | Ga0207706_10029595 | |||
| 1512 | Ga0207706_10053746 | |||
| 1513 | Ga0207670_10043642 | |||
| 1514 | Ga0207669_10003957 | |||
| 1515 | Ga0207669_10059755 | |||
| 1516 | Ga0207691_10003366 | |||
| 1517 | Ga0207691_10005114 | |||
| 1518 | Ga0207691_10020930 | |||
| 1519 | Ga0207691_10087767 | |||
| 1520 | Ga0207691_10137706 | |||
| 1521 | Ga0207711_10000046 | |||
| 1522 | Ga0207711_10002576 | |||
| 1523 | Ga0207711_10003882 | |||
| 1524 | Ga0207711_10012213 | |||
| 1525 | Ga0207711_10015275 | |||
| 1526 | Ga0207711_10016234 | |||
| 1527 | Ga0207711_10017997 | |||
| 1528 | Ga0207711_10029685 | |||
| 1529 | Ga0207711_10038361 | |||
| 1530 | Ga0207689_10000094 | |||
| 1531 | Ga0207661_10017379 | |||
| 1532 | Ga0207661_10022719 | |||
| 1533 | Ga0207679_10002042 | |||
| 1534 | Ga0207679_10003444 | |||
| 1535 | Ga0207679_10004747 | |||
| 1536 | Ga0207679_10019755 | |||
| 1537 | Ga0207679_10022413 | |||
| 1538 | Ga0207667_10000282 | |||
| 1539 | Ga0207667_10027494 | |||
| 1540 | Ga0207667_10027860 | |||
| 1541 | Ga0207667_10031460 | |||
| 1542 | Ga0207667_10106545 | |||
| 1543 | Ga0207651_10001348 | |||
| 1544 | Ga0207651_10006159 | |||
| 1545 | Ga0207651_10006765 | |||
| 1546 | Ga0207651_10017217 | |||
| 1547 | Ga0207651_10039726 | |||
| 1548 | Ga0207712_10000001 | |||
| 1549 | Ga0207712_10000008 | |||
| 1550 | Ga0207712_10005663 | |||
| 1551 | Ga0207712_10042891 | |||
| 1552 | Ga0207668_10000060 | |||
| 1553 | Ga0207668_10000110 | |||
| 1554 | Ga0207668_10000769 | |||
| 1555 | Ga0207668_10012881 | |||
| 1556 | Ga0207668_10018603 | |||
| 1557 | Ga0207668_10019497 | |||
| 1558 | Ga0207640_10001024 | |||
| 1559 | Ga0207640_10008015 | |||
| 1560 | Ga0207640_10009891 | |||
| 1561 | Ga0207658_10000002 | |||
| 1562 | Ga0207658_10000029 | |||
| 1563 | Ga0207658_10000213 | |||
| 1564 | Ga0207658_10001284 | |||
| 1565 | Ga0207658_10001650 | |||
| 1566 | Ga0207658_10005201 | |||
| 1567 | Ga0207658_10009836 | |||
| 1568 | Ga0207658_10009999 | |||
| 1569 | Ga0207658_10025001 | |||
| 1570 | Ga0207658_10065107 | |||
| 1571 | Ga0207658_10080325 | |||
| 1572 | Ga0207658_10172413 | |||
| 1573 | Ga0207677_10000110 | |||
| 1574 | Ga0207677_10015525 | |||
| 1575 | Ga0207677_10042819 | |||
| 1576 | Ga0207703_10000717 | |||
| 1577 | Ga0207703_10001432 | |||
| 1578 | Ga0207703_10004575 | |||
| 1579 | Ga0207703_10005684 | |||
| 1580 | Ga0207703_10007899 | |||
| 1581 | Ga0207703_10008344 | |||
| 1582 | Ga0207703_10008355 | |||
| 1583 | Ga0207703_10009335 | |||
| 1584 | Ga0207703_10016697 | |||
| 1585 | Ga0207703_10025377 | |||
| 1586 | Ga0207703_10087942 | |||
| 1587 | Ga0207639_10000649 | |||
| 1588 | Ga0207639_10001311 | |||
| 1589 | Ga0207639_10001653 | |||
| 1590 | Ga0207639_10007752 | |||
| 1591 | Ga0207639_10029754 | |||
| 1592 | Ga0207639_10095058 | |||
| 1593 | Ga0207678_10000271 | |||
| 1594 | Ga0207678_10000587 | |||
| 1595 | Ga0207678_10004806 | |||
| 1596 | Ga0207678_10007492 | |||
| 1597 | Ga0207678_10011154 | |||
| 1598 | Ga0207678_10017387 | |||
| 1599 | Ga0207702_10000811 | |||
| 1600 | Ga0207702_10010616 | |||
| 1601 | Ga0207702_10041239 | |||
| 1602 | Ga0207702_10180157 | |||
| 1603 | Ga0207641_10000057 | |||
| 1604 | Ga0207641_10000091 | |||
| 1605 | Ga0207641_10000102 | |||
| 1606 | Ga0207641_10000342 | |||
| 1607 | Ga0207641_10002687 | |||
| 1608 | Ga0207641_10002980 | |||
| 1609 | Ga0207641_10003152 | |||
| 1610 | Ga0207641_10007862 | |||
| 1611 | Ga0207641_10029253 | |||
| 1612 | Ga0207641_10060259 | |||
| 1613 | Ga0207648_10000104 | |||
| 1614 | Ga0207648_10002737 | |||
| 1615 | Ga0207648_10003545 | |||
| 1616 | Ga0207648_10018393 | |||
| 1617 | Ga0207648_10043276 | |||
| 1618 | Ga0207676_10000004 | |||
| 1619 | Ga0207676_10000184 | |||
| 1620 | Ga0207676_10000604 | |||
| 1621 | Ga0207676_10002954 | |||
| 1622 | Ga0207676_10003007 | |||
| 1623 | Ga0207676_10003310 | |||
| 1624 | Ga0207676_10003565 | |||
| 1625 | Ga0207676_10035653 | |||
| 1626 | Ga0207674_10001996 | |||
| 1627 | Ga0207674_10007306 | |||
| 1628 | Ga0207674_10008119 | |||
| 1629 | Ga0207674_10008156 | |||
| 1630 | Ga0207674_10010461 | |||
| 1631 | Ga0207674_10013773 | |||
| 1632 | Ga0207675_100000016 | |||
| 1633 | Ga0207675_100000435 | |||
| 1634 | Ga0207675_100000818 | |||
| 1635 | Ga0207675_100001590 | |||
| 1636 | Ga0207675_100003186 | |||
| 1637 | Ga0207675_100019269 | |||
| 1638 | Ga0207675_100022444 | |||
| 1639 | Ga0207675_100042911 | |||
| 1640 | Ga0207683_10042498 | |||
| 1641 | Ga0207698_10014014 | |||
| 1642 | Ga0207698_10019539 | |||
| 1643 | Ga0207698_10022477 | |||
| 1644 | Ga0209813_10000093 | |||
| 1645 | Ga0209974_10006494 | |||
| 1646 | Ga0207428_10046362 | |||
| 1647 | Ga0268266_10000042 | |||
| 1648 | Ga0268266_10000133 | |||
| 1649 | Ga0268266_10000354 | |||
| 1650 | Ga0268266_10000468 | |||
| 1651 | Ga0268266_10004851 | |||
| 1652 | Ga0268266_10008187 | |||
| 1653 | Ga0268266_10010333 | |||
| 1654 | Ga0268266_10018696 | |||
| 1655 | Ga0268266_10046227 | |||
| 1656 | Ga0268266_10137207 | |||
| 1657 | Ga0268265_10000002 | |||
| 1658 | Ga0268265_10000091 | |||
| 1659 | Ga0268265_10000145 | |||
| 1660 | Ga0268265_10000260 | |||
| 1661 | Ga0268265_10001372 | |||
| 1662 | Ga0268265_10003169 | |||
| 1663 | Ga0268265_10004650 | |||
| 1664 | Ga0268265_10009026 | |||
| 1665 | Ga0268265_10011653 | |||
| 1666 | Ga0268265_10012998 | |||
| 1667 | Ga0268265_10014104 | |||
| 1668 | Ga0268265_10022561 | |||
| 1669 | Ga0268264_10000006 | |||
| 1670 | Ga0268264_10000010 | |||
| 1671 | Ga0268264_10000018 | |||
| 1672 | Ga0268264_10000087 | |||
| 1673 | Ga0268264_10000103 | |||
| 1674 | Ga0268264_10000425 | |||
| 1675 | Ga0268264_10001804 | |||
| 1676 | Ga0268264_10002419 | |||
| 1677 | Ga0268264_10010046 | |||
| 1678 | Ga0268264_10028009 | |||
| 1679 | Ga0268264_10046251 | |||
| 1680 | Ga0268264_10088785 | |||
| 1681 | Ga0307408_100040705 | |||
| 1682 | Ga0307408_100052891 | |||
| 1683 | Ga0307408_100097525 | |||
| 1684 | Ga0307508_10005528 | |||
| 1685 | Ga0307508_10080130 | |||
| 1686 | Ga0307405_10010703 | |||
| 1687 | Ga0307405_10022524 | |||
| 1688 | Ga0307405_10069610 | |||
| 1689 | Ga0307413_10001042 | |||
| 1690 | Ga0307413_10012378 | |||
| 1691 | Ga0307413_10013512 | |||
| 1692 | Ga0307413_10035331 | |||
| 1693 | Ga0307413_10071058 | |||
| 1694 | Ga0307413_10123956 | |||
| 1695 | Ga0307410_10004118 | |||
| 1696 | Ga0307410_10016554 | |||
| 1697 | Ga0307410_10022347 | |||
| 1698 | Ga0307410_10049287 | |||
| 1699 | Ga0307410_10052350 | |||
| 1700 | Ga0307410_10055748 | |||
| 1701 | Ga0307410_10055785 | |||
| 1702 | Ga0307406_10010899 | |||
| 1703 | Ga0307406_10055147 | |||
| 1704 | Ga0307407_10062180 | |||
| 1705 | Ga0307407_10074787 | |||
| 1706 | Ga0307407_10077002 | |||
| 1707 | Ga0307412_10001412 | |||
| 1708 | Ga0307412_10003919 | |||
| 1709 | Ga0307412_10040833 | |||
| 1710 | Ga0307412_10056319 | |||
| 1711 | Ga0307412_10058445 | |||
| 1712 | Ga0307409_100010865 | |||
| 1713 | Ga0307409_100025354 | |||
| 1714 | Ga0307409_100057154 | |||
| 1715 | Ga0307409_100077486 | |||
| 1716 | Ga0307416_100005969 | |||
| 1717 | Ga0307416_100021093 | |||
| 1718 | Ga0307416_100039417 | |||
| 1719 | Ga0307416_100130056 | |||
| 1720 | Ga0307416_100144250 | |||
| 1721 | Ga0307414_10000230 | |||
| 1722 | Ga0307414_10002011 | |||
| 1723 | Ga0307414_10005482 | |||
| 1724 | Ga0307414_10007276 | |||
| 1725 | Ga0307414_10015338 | |||
| 1726 | Ga0307414_10032371 | |||
| 1727 | Ga0307414_10065819 | |||
| 1728 | Ga0307414_10069197 | |||
| 1729 | Ga0307411_10015806 | |||
| 1730 | Ga0307411_10017646 | |||
| 1731 | Ga0307411_10017807 | |||
| 1732 | Ga0307411_10049763 | |||
| 1733 | Ga0307411_10059882 | |||
| 1734 | Ga0307411_10061655 | |||
| 1735 | Ga0307411_10062989 | |||
| 1736 | Ga0307411_10105305 | |||
| 1737 | Ga0307415_100001168 | |||
| 1738 | Ga0307415_100021846 | |||
| 1739 | Ga0307415_100029330 | |||
| 1740 | Ga0307415_100031961 | |||
| 1741 | Ga0307510_10003707 | |||
| 1742 | Ga0373943_0003208 | |||
| 1743 | Ga0373935_0027403 | |||
| 1744 | Ga0373935_0096905 | |||
| 1745 | Ga0373947_0047947 | |||
| 1746 | Ga0395899_0002090 | |||
| 1747 | Ga0395899_0011079 | |||
| 1748 | Ga0395899_0013169 | |||
| 1749 | Ga0395899_0114950 | |||
| 1750 | Ga0395900_0004149 | |||
| 1751 | Ga0395900_0031168 | |||
| 1752 | Ga0395900_0032675 | |||
| 1753 | Ga0395900_0060471 | |||
| 1754 | Ga0395900_0073994 | |||
| 1755 | Ga0395898_0012526 | |||
| 1756 | Ga0395898_0017336 | |||
| 1757 | Ga0395898_0052866 | |||
| 1758 | Ga0395898_0076029 | |||
| 1759 | Ga0395898_0086371 | |||
| 1760 | Ga0395898_0157699 | |||
| 1761 | Ga0395905_0000193 | |||
| 1762 | Ga0395905_0003054 | |||
| 1763 | Ga0395905_0004969 | |||
| 1764 | Ga0395905_0029464 | |||
| 1765 | Ga0395905_0089060 | |||
| 1766 | Ga0395905_0109362 | |||
| 1767 | Ga0395905_0181388 | |||
| 1768 | Ga0436364_0484549 | |||
| 1769 | Ga0395901_0001182 | |||
| 1770 | Ga0395901_0004785 | |||
| 1771 | Ga0395901_0025716 | |||
| 1772 | Ga0395901_0062262 | |||
| 1773 | Ga0395901_0085298 | |||
| 1774 | Ga0395901_0179426 | |||
| 1775 | Ga0395901_0182776 | |||
| 1776 | Ga0436365_0668445 | |||
| 1777 | Ga0436365_0853458 | |||
| 1778 | Ga0436362_0284509 | |||
| 1779 | Ga0439461_0000364 | |||
| 1780 | Ga0439465_0000704 | |||
| 1781 | Ga0439465_0012388 | |||
| 1782 | Ga0439432_001242 | |||
| 1783 | Ga0439457_004158 | |||
| 1784 | Ga0439462_0008277 | |||
| 1785 | Ga0450912_000714 | |||
| 1786 | Ga0439434_0005349 | |||
| 1787 | Ga0466961_0009058 | |||
| 1788 | Ga0466963_0012590 | |||
| 1789 | Ga0466971_0002752 | |||
| 1790 | Ga0451576_0000007 | |||
| 1791 | Ga0466958_0001341 | |||
| 1792 | Ga0466967_0128101 | |||
| 1793 | Ga0495627_000167 | |||
| 1794 | Ga0495627_000217 | |||
| 1795 | Ga0495650_0000559 | |||
| 1796 | Ga0495650_0008074 | |||
| 1797 | Ga0495596_0000233 | |||
| 1798 | Ga0495607_0015908 | |||
| 1799 | Ga0495583_0000260 | |||
| 1800 | Ga0495606_0000235 | |||
| 1801 | Ga0495606_0035039 | |||
| 1802 | Ga0495610_0000030 | |||
| 1803 | Ga0495610_0000127 | |||
| 1804 | Ga0495616_0000022 | |||
| 1805 | Ga0495632_0000076 | |||
| 1806 | Ga0495632_0021408 | |||
| 1807 | Ga0495637_0002289 | |||
| 1808 | Ga0495643_0000009 | |||
| 1809 | Ga0495643_0000746 | |||
| 1810 | Ga0495643_0006640 | |||
| 1811 | Ga0495648_0000026 | |||
| 1812 | Ga0495648_0005225 | |||
| 1813 | Ga0495663_0000023 | |||
| 1814 | Ga0495663_0000975 | |||
| 1815 | Ga0495654_0000194 | |||
| 1816 | Ga0495598_0000610 | |||
| 1817 | Ga0495609_0030341 | |||
| 1818 | Ga0495621_0000010 | |||
| 1819 | Ga0495621_0007030 | |||
| 1820 | Ga0495633_0000136 | |||
| 1821 | Ga0495633_0001163 | |||
| 1822 | Ga0495633_0005728 | |||
| 1823 | Ga0495668_0000004 | |||
| 1824 | Ga0495668_0005823 | |||
| 1825 | Ga0495668_0007759 | |||
| 1826 | Ga0495625_0000729 | |||
| 1827 | Ga0495625_0010834 | |||
| 1828 | Ga0495625_0034320 | |||
| 1829 | Ga0495669_0005836 | |||
| 1830 | Ga0495669_0038592 | |||
| 1831 | Ga0495670_0000004 | |||
| 1832 | Ga0495671_0000013 | |||
| 1833 | Ga0495671_0000139 | |||
| 1834 | Ga0495673_0000066 | |||
| 1835 | Ga0495681_0000011 | |||
| 1836 | Ga0495681_0000042 | |||
| 1837 | Ga0495681_0002227 | |||
| 1838 | Ga0495686_0025230 | |||
| 1839 | Ga0495615_0000025 | |||
| 1840 | Ga0495626_0012404 | |||
| 1841 | Ga0496100_0019893 | |||
| 1842 | Ga0496100_0045726 | |||
| 1843 | Ga0496102_0000043 | |||
| 1844 | Ga0496102_0000998 | |||
| 1845 | Ga0496102_0004522 | |||
| 1846 | Ga0496102_0038873 | |||
| 1847 | Ga0496103_0000133 | |||
| 1848 | Ga0496103_0000201 | |||
| 1849 | Ga0496103_0009525 | |||
| 1850 | Ga0496103_0013050 | |||
| 1851 | Ga0496104_0000078 | |||
| 1852 | Ga0496104_0017309 | |||
| 1853 | Ga0496105_0000241 | |||
| 1854 | Ga0496105_0005919 | |||
| 1855 | Ga0496105_0099749 | |||
| 1856 | Ga0496106_0002700 | |||
| 1857 | Ga0496106_0003227 | |||
| 1858 | Ga0496106_0042593 | |||
| 1859 | Ga0496107_0007192 | |||
| 1860 | Ga0496107_0011807 | |||
| 1861 | Ga0496107_0012495 | |||
| 1862 | Ga0496107_0071001 | |||
| 1863 | Ga0496108_0002029 | |||
| 1864 | Ga0496108_0004360 | |||
| 1865 | Ga0496108_0006530 | |||
| 1866 | Ga0496108_0008130 | |||
| 1867 | Ga0496108_0044071 | |||
| 1868 | Ga0496109_0004600 | |||
| 1869 | Ga0496109_0008938 | |||
| 1870 | Ga0496109_0014993 | |||
| 1871 | Ga0496109_0024508 | |||
| 1872 | Ga0496109_0084654 | |||
| 1873 | Ga0496110_0003943 | |||
| 1874 | Ga0496110_0006209 | |||
| 1875 | Ga0496110_0006236 | |||
| 1876 | Ga0496110_0011114 | |||
| 1877 | Ga0496110_0087861 | |||
| 1878 | Ga0496111_0013500 | |||
| 1879 | Ga0496111_0014957 | |||
| 1880 | Ga0496111_0023348 | |||
| 1881 | Ga0496111_0114788 | |||
| 1882 | Ga0496112_0014138 | |||
| 1883 | Ga0496112_0021605 | |||
| 1884 | Ga0496112_0062776 | |||
| 1885 | Ga0496112_0076839 | |||
| 1886 | Ga0496112_0116575 | |||
| 1887 | Ga0496113_0003327 | |||
| 1888 | Ga0496113_0040762 | |||
| 1889 | Ga0496113_0071744 | |||
| 1890 | Ga0496114_0020555 | |||
| 1891 | Ga0496114_0048461 | |||
| 1892 | Ga0496114_0051260 | |||
| 1893 | Ga0496115_0000504 | |||
| 1894 | Ga0496116_0000028 | |||
| 1895 | Ga0496116_0000682 | |||
| 1896 | Ga0496117_0000104 | |||
| 1897 | Ga0496117_0003203 | |||
| 1898 | Ga0496117_0021921 | |||
| 1899 | Ga0496118_0000080 | |||
| 1900 | Ga0496118_0018225 | |||
| 1901 | Ga0496118_0025704 | |||
| 1902 | Ga0496119_0000114 | |||
| 1903 | Ga0496120_0000266 | |||
| 1904 | Ga0496121_0000021 | |||
| 1905 | Ga0496121_0000520 | |||
| 1906 | Ga0496121_0000731 | |||
| 1907 | Ga0496121_0001018 | |||
| 1908 | Ga0496121_0016625 | |||
| 1909 | Ga0496122_0005756 | |||
| 1910 | Ga0496122_0005810 | |||
| 1911 | Ga0496122_0019036 | |||
| 1912 | Ga0496123_0001678 | |||
| 1913 | Ga0496123_0009221 | |||
| 1914 | Ga0496123_0017201 | |||
| 1915 | Ga0496124_0000093 | |||
| 1916 | Ga0496124_0003121 | |||
| 1917 | Ga0496124_0003580 | |||
| 1918 | Ga0496124_0004225 | |||
| 1919 | Ga0496124_0008108 | |||
| 1920 | Ga0496124_0128771 | |||
| 1921 | Ga0496125_0006013 | |||
| 1922 | Ga0496125_0021035 | |||
| 1923 | Ga0496125_0024152 | |||
| 1924 | Ga0496125_0035203 | |||
| 1925 | Ga0496126_0000079 | |||
| 1926 | Ga0496126_0000173 | |||
| 1927 | Ga0496126_0005189 | |||
| 1928 | Ga0501307_002712 | |||
| 1929 | Ga0501290_000042 | |||
| 1930 | Ga0501292_000005 | |||
| 1931 | Ga0501294_000049 | |||
| 1932 | Ga0501317_002272 | |||
| 1933 | Ga0501032_0024236 | |||
| 1934 | Ga0501034_0002130 | |||
| 1935 | Ga0501034_0053982 | |||
| 1936 | Ga0501036_0010046 | |||
| 1937 | Ga0501037_0014284 | |||
| 1938 | Ga0501069_0050106 | |||
| 1939 | Ga0501070_0018814 | |||
| 1940 | Ga0501206_000476 | |||
| 1941 | Ga0501207_001528 | |||
| 1942 | Ga0501222_000183 | |||
| 1943 | Ga0501223_000205 | |||
| 1944 | Ga0501223_001035 | |||
| 1945 | Ga0501224_000028 | |||
| 1946 | Ga0501227_002874 | |||
| 1947 | Ga0501233_003691 | |||
| 1948 | Ga0501235_001607 | |||
| 1949 | Ga0501249_000294 | |||
| 1950 | Ga0501249_006567 | |||
| 1951 | Ga0501257_000016 | |||
| 1952 | Ga0501258_001149 | |||
| 1953 | Ga0501221_000663 | |||
| 1954 | Ga0501225_0001120 | |||
| 1955 | Ga0501225_0001850 | |||
| 1956 | Ga0501234_002566 | |||
| 1957 | Ga0501279_000020 | |||
| 1958 | Ga0501280_000025 | |||
| 1959 | Ga0501282_000036 | |||
| 1960 | Ga0501044_0013271 | |||
| 1961 | Ga0501226_000146 | |||
| 1962 | nmdc:mga03683_448_c1 | |||
| 1963 | nmdc:mga03n38_15852_c1 | |||
| 1964 | nmdc:mga00v17_12785_c1 | |||
| 1965 | nmdc:mga00v17_7556_c1 | |||
| 1966 | nmdc:mga0yw44_9045_c1 | |||
| 1967 | nmdc:mga0k408_8774_c1 | |||
| 1968 | nmdc:mga06z11_168_c1 | |||
| 1969 | nmdc:mga06z11_482_c1 | |||
| 1970 | nmdc:mga04h51_189_c1 | |||
| 1971 | nmdc:mga07m45_55_c1 | |||
| 1972 | nmdc:mga0qj67_3093_c1 | |||
| 1973 | nmdc:mga0sz30_15843_c1 | |||
| 1974 | Ga0500643_000001 | |||
| 1975 | Ga0500643_000167 | |||
| 1976 | Ga0500643_000523 | |||
| 1977 | Ga0500643_007597 | |||
| 1978 | Ga0500566_0001889 | |||
| 1979 | Ga0500556_0000040 | |||
| 1980 | Ga0500592_000074 | |||
| 1981 | Ga0500607_000354 | |||
| 1982 | Ga0500607_001619 | |||
| 1983 | Ga0500608_008713 | |||
| 1984 | Ga0500618_001172 | |||
| 1985 | Ga0500642_0000003 | |||
| 1986 | Ga0500655_001426 | |||
| 1987 | Ga0500658_0000887 | |||
| 1988 | Ga0500559_0001553 | |||
| 1989 | Ga0500568_0000708 | |||
| 1990 | Ga0500568_0012994 | |||
| 1991 | Ga0500573_0000019 | |||
| 1992 | Ga0500604_0000004 | |||
| 1993 | Ga0500616_0000195 | |||
| 1994 | Ga0500616_0000893 | |||
| 1995 | Ga0500616_0003996 | |||
| 1996 | Ga0500622_0000145 | |||
| 1997 | Ga0500624_000012 | |||
| 1998 | Ga0500624_000092 | |||
| 1999 | Ga0500627_0000126 | |||
| 2000 | Ga0500627_0000254 | |||
| 2001 | Ga0500627_0000423 | |||
| 2002 | Ga0500567_000039 | |||
| 2003 | Ga0500625_000021 | |||
| 2004 | Ga0500645_002312 | |||
| 2005 | Ga0500645_002526 | |||
| 2006 | Ga0587077_005217 | |||
| 2007 | Ga0466962_0002983 | |||
| 2008 | 2511125726 | |||
| 2009 | 2512645659 | |||
| 2010 | 2600200357 | |||
| 2011 | 2643820503 | |||
| 2012 | 2643836319 | |||
| 2013 | 2643951819 | |||
| 2014 | 2644043449 | |||
| 2015 | 2644052795 | |||
| 2016 | 2644126664 | |||
| 2017 | 2644393608 | |||
| 2018 | 2738711566 | |||
| 2019 | 2738849991 | |||
| 2020 | 2738865720 | |||
| 2021 | 2739298238 | |||
| 2022 | 2739359916 | |||
| 2023 | 2739649106 | |||
| 2024 | 2740027579 | |||
| 2025 | 2753763831 | |||
| 2026 | 2778123442 | |||
| 2027 | 2809062552 | |||
| 2028 | 2809078764 | |||
| 2029 | 2809082941 | |||
| 2030 | 2819553072 | |||
| 2031 | 2848298468 | |||
| 2032 | 2852653930 | |||
| 2033 | 2852682674 | |||
| 2034 | 2880521643 | |||
| 2035 | 2895884265 | |||
| 2036 | 2896184364 | |||
| 2037 | 2896254919 | |||
| 2038 | 2919709856 | |||
| 2039 | 2928104184 | |||
| 2040 | 2928961649 | |||
| 2041 | 8054305891 | |||
| 2042 | 8057103277 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pc9-assembly2.cif.gz_B | crystal structure of atp-dependent phosphoenolpyruvate carboxykinase from thermus thermophilus hb8 | 0.9649 | 8 | 531 |
| 2pc9-assembly2.cif.gz_B | crystal structure of atp-dependent phosphoenolpyruvate carboxykinase from thermus thermophilus hb8 | 0.9594 | 8 | 531 |
| 1ii2-assembly1.cif.gz_B | crystal structure of phosphoenolpyruvate carboxykinase (pepck) from trypanosoma cruzi | 0.9554 | 17 | 534 |
| 1xkv-assembly1.cif.gz_A | crystal structure of atp-dependent phosphoenolpyruvate carboxykinase from thermus thermophilus hb8 | 0.9544 | 8 | 534 |
| 1xkv-assembly1.cif.gz_A | crystal structure of atp-dependent phosphoenolpyruvate carboxykinase from thermus thermophilus hb8 | 0.9526 | 8 | 534 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I2Y7_62_174_3.40.449.10 | Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 | 0.9689 | 77 | 187 | 3.40.449.10 |
| af_A0A1D6JWH6_180_340_3.40.449.10 | Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 | 0.9594 | 62 | 205 | 3.40.449.10 |
| af_Q2G1W2_22_214_3.40.449.10 | Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 | 0.9588 | 23 | 213 | 3.40.449.10 |
| 1ii2A01 | Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 | 0.9581 | 17 | 206 | 3.40.449.10 |
| af_A0A1D6FBU2_97_203_3.40.449.10 | Alpha Beta;3-Layer(aba) Sandwich;Phosphoenolpyruvate Carboxykinase; domain 1;Phosphoenolpyruvate Carboxykinase, domain 1 | 0.9547 | 81 | 178 | 3.40.449.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1KMX3-F1-model_v4 | Phosphoenolpyruvate carboxykinase (ATP) | 0.9871 | 442 | 532 |
GO:0004612
GO:0005524 GO:0005829 GO:0006094 GO:0016301 |
| AF-A0A3D2LFL4-F1-model_v4 | deleted | 0.9786 | 5 | 214 |
|
| AF-A0A352HA49-F1-model_v4 | deleted | 0.9767 | 400 | 533 |
|
| AF-A0A3N5MZM6-F1-model_v4 | Phosphoenolpyruvate carboxykinase (ATP) | 0.9765 | 20 | 209 |
GO:0004612
GO:0005524 GO:0005829 GO:0006094 GO:0016301 |
| AF-A0A7V9EIM8-F1-model_v4 | Phosphoenolpyruvate carboxykinase (ATP) | 0.9754 | 442 | 534 |
GO:0004612
GO:0005524 GO:0005829 GO:0006094 GO:0016301 |