F488394
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1021 | 487 | 2042 | 263 |
Family's Representative Sequence
| Representative Sequence | 3300036712|Ga0316584_0029841|Ga0316584_0029841_2942_3844 |
| Length | 300 |
| Sequence | VCAVSSTGGSALPVLTGAAGDRPVMSMPMPLKRLKLHGFNNLTKSLSFNIYDVCYTDSAEQRAAYIAYIDEAYNAERLTAILNDVANIIGATVLNVARQDYEPQGASVTLLIAEEPPAAETISNSATPGPLPEAVVGHLDKSHITVHTYPESHPHNGISTFRADIDVSTCGLISPLKALNYLIHAVESDIVTMDYRVRGFTRDVRGRKHFVDHNISSIQNYLSRDTKNRYQMLDVNVYQENLFHTKMVVSDFRLDDYLFCVDSSQLSDKEQGRIRRLVRREMMEIFYGRNLGRDLGVGES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 37 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 57 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 58 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 59 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 93 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 101 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 102 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 103 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 104 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 105 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 106 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 108 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 111 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 112 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 114 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 115 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 117 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 120 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 121 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 122 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 129 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 130 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 131 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 132 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 133 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 134 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 135 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 136 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 137 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 138 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 139 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 140 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 141 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 142 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 143 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 144 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 145 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 146 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 147 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 148 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 149 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 150 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 151 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 152 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 153 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 154 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 155 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 156 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 157 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 158 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 159 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 160 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 161 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 162 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 163 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 164 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 212 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 215 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 216 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 217 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 218 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 219 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 220 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 221 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 222 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 223 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 224 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 225 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 226 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 246 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 247 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 248 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 249 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 250 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 251 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 252 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 253 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 254 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 255 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 256 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 257 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 258 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 259 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 260 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 261 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 262 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 263 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 264 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 265 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 266 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 267 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 268 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 269 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 270 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 271 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 272 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 273 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 274 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 275 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 276 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 277 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 278 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 279 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 280 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 281 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 282 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 283 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 284 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 285 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 286 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 287 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 288 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 289 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 290 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 291 | 2671180330 | Peribacillus simplex SH-B26 | Isolate | Unclassified |
| 292 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 293 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 294 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 295 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 296 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 297 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 298 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 299 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 300 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 301 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 302 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 303 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 304 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 305 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 306 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 307 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 308 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 309 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 310 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 311 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 312 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 313 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 314 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 315 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 316 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 317 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 318 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 319 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 320 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 321 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 322 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 323 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 324 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 325 | 2808606364 | Bacillus sp. SLBN-3 | Isolate | Unclassified |
| 326 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 327 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 328 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 329 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 330 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 331 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 332 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 333 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 334 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 335 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 336 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 337 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 338 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 339 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 340 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 341 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 342 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 343 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 344 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 345 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 346 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 347 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 348 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 349 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 350 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 351 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 352 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 353 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 354 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 355 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 356 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 357 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 358 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 359 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 360 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 361 | 2857465823 | Brevibacillus sp. R-74266 | Isolate | Unclassified |
| 362 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 363 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 364 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 365 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 366 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 367 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 368 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 369 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 370 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 371 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 372 | 2871272651 | Pectobacterium carotovorum SS96 | Isolate | Stem Tuber |
| 373 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 374 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 375 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 376 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 377 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 378 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 379 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 380 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 381 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 382 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 383 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 384 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 385 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 386 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 387 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 388 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 389 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 390 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 391 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 392 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 393 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 394 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 395 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 396 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 397 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 398 | 2916178963 | Pseudoalteromonas rhizosphaerae RA15 | Isolate | Rhizosphere |
| 399 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 400 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 401 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 402 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 403 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 404 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 405 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 406 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 407 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 408 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 409 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 410 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 411 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 412 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 413 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 414 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 415 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 416 | 2929297113 | Heliophilum fasciatum MTM | Isolate | Rhizosphere |
| 417 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 418 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 419 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 420 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 421 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 422 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 423 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 424 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 425 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 426 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 427 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 428 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 429 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 430 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 431 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 432 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 433 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 434 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 435 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 436 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 437 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 438 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 439 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 440 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 441 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 442 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 443 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 444 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 445 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 446 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 447 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 448 | 2989392574 | Methylomonas rhizoryzae GJ1 | Isolate | Unclassified |
| 449 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 450 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 451 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 452 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 453 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 454 | 3001272096 | Lederbergia citrisecunda FJAT-49732 | Isolate | Rhizosphere |
| 455 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 456 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 457 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 458 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 459 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 460 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 461 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 462 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 463 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 464 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 465 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 466 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 467 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 468 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 469 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 470 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 471 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 472 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 473 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 474 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 475 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 476 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 477 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 478 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 479 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 480 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 481 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 482 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 483 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 484 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 485 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 486 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 487 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.46 |
| Metatranscriptomes | 2.64 |
| Isolates | 23.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.59 |
| Bulb | 0.1 |
| Endosphere | 6.46 |
| Nodule | 2.64 |
| Rhizoplane | 2.84 |
| Rhizosphere | 64.25 |
| Stem | 0 |
| Stem Tuber | 0.39 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316584_0029841 | 3300036712 | Bacteria | 4026 |
| 2 | SwRhRL2b_contig_179258 | 2162886007 | Bacteria | 1077 |
| 3 | SwRhRL2b_contig_1896067 | 2162886007 | Bacteria | 1832 |
| 4 | SwRhRL2b_contig_2697100 | 2162886007 | Bacteria | 1070 |
| 5 | SwRhRL2b_contig_3444256 | 2162886007 | Bacteria | 1185 |
| 6 | SwRhRL2b_contig_419289 | 2162886007 | Bacteria | 3003 |
| 7 | JGI24739J22299_10000061 | 3300001989 | Bacteria | 30056 |
| 8 | JGI25162J39368_1000006 | 3300002737 | Bacteria | 405267 |
| 9 | JGI25162J39368_1000659 | 3300002737 | Bacteria | 24396 |
| 10 | JGI25163J39215_1000001 | 3300002771 | Bacteria | 314282 |
| 11 | JGI25163J39215_1000382 | 3300002771 | Bacteria | 14268 |
| 12 | JGI25164J39214_1000001 | 3300002772 | Bacteria | 477015 |
| 13 | JGI25164J39214_1000410 | 3300002772 | Bacteria | 24396 |
| 14 | JGI25152J39213_1000194 | 3300002773 | Bacteria | 41017 |
| 15 | JGI25159J45721_1022814 | 3300002987 | Bacteria | 1148 |
| 16 | JGI25151J46595_10005255 | 3300003187 | Bacteria | 6715 |
| 17 | JGI25151J46595_10007869 | 3300003187 | Bacteria | 5178 |
| 18 | JGI25151J46595_10025601 | 3300003187 | Bacteria | 2397 |
| 19 | JGI25151J46595_10029530 | 3300003187 | Bacteria | 2169 |
| 20 | JGI25165J46597_1000774 | 3300003214 | Bacteria | 24396 |
| 21 | Ga0055538_1000004 | 3300003751 | Bacteria | 615646 |
| 22 | Ga0055538_1000672 | 3300003751 | Bacteria | 10604 |
| 23 | Ga0055539_1000004 | 3300003752 | Bacteria | 615646 |
| 24 | Ga0055533_1000007 | 3300003756 | Bacteria | 615646 |
| 25 | Ga0055532_1000088 | 3300003758 | Bacteria | 106291 |
| 26 | Ga0055525_1000007 | 3300003759 | Bacteria | 615646 |
| 27 | Ga0055536_1020486 | 3300003781 | Bacteria | 2040 |
| 28 | Ga0055530_10000832 | 3300003791 | Bacteria | 25491 |
| 29 | Ga0055540_1000533 | 3300003792 | Bacteria | 28667 |
| 30 | Ga0055531_10000286 | 3300003794 | Bacteria | 51010 |
| 31 | Ga0055531_10001251 | 3300003794 | Bacteria | 19278 |
| 32 | Ga0055541_1000004 | 3300003841 | Bacteria | 615646 |
| 33 | Ga0058692_1000183 | 3300003856 | Bacteria | 38266 |
| 34 | Ga0058692_1000306 | 3300003856 | Bacteria | 24787 |
| 35 | Ga0058692_1000311 | 3300003856 | Bacteria | 24338 |
| 36 | Ga0058692_1003055 | 3300003856 | Bacteria | 5338 |
| 37 | Ga0058692_1003813 | 3300003856 | Bacteria | 4582 |
| 38 | Ga0058692_1005138 | 3300003856 | Bacteria | 3767 |
| 39 | Ga0058692_1008820 | 3300003856 | Bacteria | 2585 |
| 40 | Ga0058692_1008822 | 3300003856 | Bacteria | 2585 |
| 41 | Ga0058692_1020408 | 3300003856 | Bacteria | 1394 |
| 42 | Ga0065714_10000513 | 3300005288 | Bacteria | 4119 |
| 43 | Ga0065704_10001139 | 3300005289 | Bacteria | 16584 |
| 44 | Ga0065704_10001780 | 3300005289 | Bacteria | 9988 |
| 45 | Ga0065704_10009771 | 3300005289 | Bacteria | 2536 |
| 46 | Ga0065704_10073626 | 3300005289 | Bacteria | 6944 |
| 47 | Ga0065704_10090987 | 3300005289 | Bacteria | 2749 |
| 48 | Ga0065712_10001345 | 3300005290 | Bacteria | 12716 |
| 49 | Ga0065712_10068271 | 3300005290 | Bacteria | 12282 |
| 50 | Ga0070676_10115339 | 3300005328 | Bacteria | 1678 |
| 51 | Ga0070668_100085212 | 3300005347 | Bacteria | 2483 |
| 52 | Ga0070669_100003634 | 3300005353 | Bacteria | 11125 |
| 53 | Ga0070659_100376372 | 3300005366 | Bacteria | 1195 |
| 54 | Ga0070662_100032682 | 3300005457 | Bacteria | 3657 |
| 55 | Ga0070665_100009321 | 3300005548 | Bacteria | 9935 |
| 56 | Ga0070665_100141643 | 3300005548 | Bacteria | 2408 |
| 57 | Ga0070665_100460010 | 3300005548 | Bacteria | 1282 |
| 58 | Ga0068857_100000004 | 3300005577 | Bacteria | 171895 |
| 59 | Ga0068851_10043982 | 3300005834 | Bacteria | 2253 |
| 60 | Ga0081455_10099386 | 3300005937 | Bacteria | 2340 |
| 61 | Ga0081455_10257171 | 3300005937 | Bacteria | 1273 |
| 62 | Ga0075365_10227209 | 3300006038 | Bacteria | 1310 |
| 63 | Ga0075364_10002478 | 3300006051 | Bacteria | 10335 |
| 64 | Ga0075364_10002674 | 3300006051 | Bacteria | 10002 |
| 65 | Ga0079104_1000406 | 3300006946 | Bacteria | 49721 |
| 66 | Ga0079104_1001044 | 3300006946 | Bacteria | 21144 |
| 67 | Ga0079104_1005238 | 3300006946 | Bacteria | 5236 |
| 68 | Ga0079104_1006147 | 3300006946 | Bacteria | 4621 |
| 69 | Ga0079104_1012465 | 3300006946 | Bacteria | 2668 |
| 70 | Ga0105251_10000595 | 3300009011 | Bacteria | 33132 |
| 71 | Ga0105251_10001239 | 3300009011 | Bacteria | 22107 |
| 72 | Ga0105251_10002260 | 3300009011 | Bacteria | 15297 |
| 73 | Ga0105251_10008398 | 3300009011 | Bacteria | 6217 |
| 74 | Ga0105251_10009331 | 3300009011 | Bacteria | 5802 |
| 75 | Ga0105251_10015024 | 3300009011 | Bacteria | 4248 |
| 76 | Ga0105251_10016560 | 3300009011 | Bacteria | 3979 |
| 77 | Ga0105251_10018026 | 3300009011 | Bacteria | 3766 |
| 78 | Ga0105251_10033934 | 3300009011 | Bacteria | 2529 |
| 79 | Ga0105251_10035432 | 3300009011 | Bacteria | 2462 |
| 80 | Ga0105251_10063505 | 3300009011 | Bacteria | 1732 |
| 81 | Ga0105244_10000023 | 3300009036 | Bacteria | 233110 |
| 82 | Ga0105244_10000713 | 3300009036 | Bacteria | 28708 |
| 83 | Ga0105244_10001414 | 3300009036 | Bacteria | 19428 |
| 84 | Ga0105244_10001617 | 3300009036 | Bacteria | 17859 |
| 85 | Ga0105244_10004325 | 3300009036 | Bacteria | 9821 |
| 86 | Ga0105244_10010532 | 3300009036 | Bacteria | 5602 |
| 87 | Ga0105244_10013293 | 3300009036 | Bacteria | 4818 |
| 88 | Ga0105244_10025204 | 3300009036 | Bacteria | 3236 |
| 89 | Ga0105244_10047701 | 3300009036 | Bacteria | 2195 |
| 90 | Ga0105244_10050091 | 3300009036 | Bacteria | 2131 |
| 91 | Ga0105244_10074544 | 3300009036 | Bacteria | 1688 |
| 92 | Ga0105250_10000042 | 3300009092 | Bacteria | 130495 |
| 93 | Ga0105250_10000378 | 3300009092 | Bacteria | 33263 |
| 94 | Ga0105250_10001245 | 3300009092 | Bacteria | 14110 |
| 95 | Ga0105250_10003232 | 3300009092 | Bacteria | 7768 |
| 96 | Ga0105250_10030333 | 3300009092 | Bacteria | 2174 |
| 97 | Ga0105250_10074922 | 3300009092 | Bacteria | 1369 |
| 98 | Ga0105240_10252210 | 3300009093 | Bacteria | 2040 |
| 99 | Ga0105247_10000223 | 3300009101 | Bacteria | 54349 |
| 100 | Ga0105243_10002183 | 3300009148 | Bacteria | 16513 |
| 101 | Ga0105243_10055572 | 3300009148 | Bacteria | 3146 |
| 102 | Ga0105243_10197003 | 3300009148 | Bacteria | 1764 |
| 103 | Ga0105243_10297212 | 3300009148 | Bacteria | 1462 |
| 104 | Ga0105241_10000006 | 3300009174 | Bacteria | 373608 |
| 105 | Ga0105241_10434644 | 3300009174 | Bacteria | 1158 |
| 106 | Ga0105239_10268243 | 3300010375 | Bacteria | 1919 |
| 107 | Ga0105246_10005186 | 3300011119 | Bacteria | 7919 |
| 108 | Ga0105246_10010294 | 3300011119 | Bacteria | 5779 |
| 109 | Ga0105246_10013672 | 3300011119 | Bacteria | 5093 |
| 110 | Ga0105246_10020546 | 3300011119 | Bacteria | 4237 |
| 111 | Ga0105246_10027407 | 3300011119 | Bacteria | 3732 |
| 112 | Ga0105246_10105547 | 3300011119 | Bacteria | 2059 |
| 113 | Ga0157345_1000681 | 3300012498 | Bacteria | 2780 |
| 114 | Ga0157373_10003696 | 3300013100 | Bacteria | 11578 |
| 115 | Ga0157373_10013207 | 3300013100 | Bacteria | 6062 |
| 116 | Ga0157373_10062449 | 3300013100 | Bacteria | 2639 |
| 117 | Ga0157371_10000020 | 3300013102 | Bacteria | 304987 |
| 118 | Ga0157371_10000800 | 3300013102 | Bacteria | 36092 |
| 119 | Ga0157371_10002582 | 3300013102 | Bacteria | 17186 |
| 120 | Ga0157371_10005708 | 3300013102 | Bacteria | 10433 |
| 121 | Ga0157371_10026573 | 3300013102 | Bacteria | 4206 |
| 122 | Ga0157371_10115385 | 3300013102 | Bacteria | 1907 |
| 123 | Ga0157371_10219407 | 3300013102 | Bacteria | 1365 |
| 124 | Ga0157371_10260022 | 3300013102 | Bacteria | 1251 |
| 125 | Ga0157370_10000142 | 3300013104 | Bacteria | 87393 |
| 126 | Ga0157370_10001229 | 3300013104 | Bacteria | 32093 |
| 127 | Ga0157370_10002701 | 3300013104 | Bacteria | 21260 |
| 128 | Ga0157370_10126670 | 3300013104 | Bacteria | 2383 |
| 129 | Ga0157369_10008578 | 3300013105 | Bacteria | 11721 |
| 130 | Ga0157369_10010151 | 3300013105 | Bacteria | 10747 |
| 131 | Ga0157369_10012225 | 3300013105 | Bacteria | 9747 |
| 132 | Ga0163162_10018952 | 3300013306 | Bacteria | 6749 |
| 133 | Ga0163162_10025666 | 3300013306 | Bacteria | 5825 |
| 134 | Ga0163162_10440660 | 3300013306 | Bacteria | 1435 |
| 135 | Ga0157372_10002392 | 3300013307 | Bacteria | 20313 |
| 136 | Ga0157372_10012060 | 3300013307 | Bacteria | 9205 |
| 137 | Ga0157372_10335072 | 3300013307 | Bacteria | 1762 |
| 138 | Ga0182008_10055446 | 3300014497 | Bacteria | 1960 |
| 139 | Ga0182008_10147394 | 3300014497 | Bacteria | 1179 |
| 140 | Ga0182006_1004458 | 3300015261 | Bacteria | 6900 |
| 141 | Ga0182006_1005580 | 3300015261 | Bacteria | 5970 |
| 142 | Ga0182006_1006250 | 3300015261 | Bacteria | 5551 |
| 143 | Ga0182005_1004563 | 3300015265 | Bacteria | 4452 |
| 144 | Ga0182005_1013120 | 3300015265 | Bacteria | 2333 |
| 145 | Ga0183366_1003 | 3300015679 | Bacteria | 453474 |
| 146 | Ga0183370_1003 | 3300015680 | Bacteria | 454044 |
| 147 | Ga0183369_1005 | 3300015685 | Bacteria | 453680 |
| 148 | Ga0183368_1006 | 3300015687 | Bacteria | 551576 |
| 149 | Ga0163161_10000050 | 3300017792 | Bacteria | 125396 |
| 150 | Ga0163161_10035907 | 3300017792 | Bacteria | 3548 |
| 151 | Ga0163161_10067649 | 3300017792 | Bacteria | 2609 |
| 152 | Ga0163161_10106308 | 3300017792 | Bacteria | 2094 |
| 153 | Ga0209760_100044 | 3300025207 | Bacteria | 111537 |
| 154 | Ga0209760_100155 | 3300025207 | Bacteria | 41538 |
| 155 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 156 | Ga0209784_100325 | 3300025224 | Bacteria | 24276 |
| 157 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 158 | Ga0209566_100108 | 3300025225 | Bacteria | 119382 |
| 159 | Ga0209566_100155 | 3300025225 | Bacteria | 77547 |
| 160 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 161 | Ga0209147_100058 | 3300025229 | Bacteria | 252750 |
| 162 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 163 | Ga0209563_100863 | 3300025230 | Bacteria | 9009 |
| 164 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 165 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 166 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 167 | Ga0209437_100046 | 3300025233 | Bacteria | 405293 |
| 168 | Ga0209437_100063 | 3300025233 | Bacteria | 335477 |
| 169 | Ga0209437_101051 | 3300025233 | Bacteria | 9178 |
| 170 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 171 | Ga0209759_1010700 | 3300025256 | Bacteria | 2669 |
| 172 | Ga0209129_1000008 | 3300025258 | Bacteria | 640959 |
| 173 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 174 | Ga0209233_1001000 | 3300025261 | Bacteria | 12086 |
| 175 | Ga0209130_1002272 | 3300025284 | Bacteria | 9910 |
| 176 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 177 | Ga0209676_1000574 | 3300025292 | Bacteria | 55392 |
| 178 | Ga0209676_1001175 | 3300025292 | Bacteria | 28332 |
| 179 | Ga0209676_1055365 | 3300025292 | Bacteria | 1017 |
| 180 | Ga0209025_1000801 | 3300025294 | Bacteria | 51045 |
| 181 | Ga0209025_1001470 | 3300025294 | Bacteria | 30704 |
| 182 | Ga0209025_1002760 | 3300025294 | Bacteria | 17742 |
| 183 | Ga0209025_1005308 | 3300025294 | Bacteria | 10582 |
| 184 | Ga0209050_1001031 | 3300025298 | Bacteria | 34644 |
| 185 | Ga0209050_1005862 | 3300025298 | Bacteria | 7521 |
| 186 | Ga0209051_1000041 | 3300025303 | Bacteria | 311155 |
| 187 | Ga0209257_1000069 | 3300025304 | Bacteria | 339826 |
| 188 | Ga0207656_10045750 | 3300025321 | Bacteria | 1874 |
| 189 | Ga0207696_1000014 | 3300025711 | Bacteria | 517939 |
| 190 | Ga0207696_1000027 | 3300025711 | Bacteria | 412783 |
| 191 | Ga0207696_1000066 | 3300025711 | Bacteria | 231203 |
| 192 | Ga0207696_1000319 | 3300025711 | Bacteria | 51975 |
| 193 | Ga0207696_1000598 | 3300025711 | Bacteria | 27197 |
| 194 | Ga0207696_1000663 | 3300025711 | Bacteria | 24393 |
| 195 | Ga0207696_1001272 | 3300025711 | Bacteria | 14110 |
| 196 | Ga0207696_1003590 | 3300025711 | Bacteria | 7005 |
| 197 | Ga0207696_1005762 | 3300025711 | Bacteria | 5091 |
| 198 | Ga0207696_1010946 | 3300025711 | Bacteria | 3299 |
| 199 | Ga0207696_1020689 | 3300025711 | Bacteria | 2117 |
| 200 | Ga0207655_1000017 | 3300025728 | Bacteria | 544403 |
| 201 | Ga0207655_1000028 | 3300025728 | Bacteria | 437324 |
| 202 | Ga0207655_1000056 | 3300025728 | Bacteria | 279166 |
| 203 | Ga0207655_1000223 | 3300025728 | Bacteria | 96651 |
| 204 | Ga0207655_1001041 | 3300025728 | Bacteria | 27873 |
| 205 | Ga0207655_1001219 | 3300025728 | Bacteria | 24788 |
| 206 | Ga0207655_1001446 | 3300025728 | Bacteria | 21992 |
| 207 | Ga0207655_1001643 | 3300025728 | Bacteria | 19816 |
| 208 | Ga0207655_1003013 | 3300025728 | Bacteria | 12894 |
| 209 | Ga0207655_1005240 | 3300025728 | Bacteria | 8899 |
| 210 | Ga0207655_1006410 | 3300025728 | Bacteria | 7801 |
| 211 | Ga0207655_1007055 | 3300025728 | Bacteria | 7354 |
| 212 | Ga0207655_1008271 | 3300025728 | Bacteria | 6624 |
| 213 | Ga0207655_1008821 | 3300025728 | Bacteria | 6343 |
| 214 | Ga0207655_1027648 | 3300025728 | Bacteria | 2697 |
| 215 | Ga0207655_1030437 | 3300025728 | Bacteria | 2509 |
| 216 | Ga0207655_1032019 | 3300025728 | Bacteria | 2411 |
| 217 | Ga0207655_1033857 | 3300025728 | Bacteria | 2308 |
| 218 | Ga0207655_1046600 | 3300025728 | Bacteria | 1798 |
| 219 | Ga0207713_1000007 | 3300025735 | Bacteria | 564979 |
| 220 | Ga0207713_1000048 | 3300025735 | Bacteria | 228272 |
| 221 | Ga0207713_1000057 | 3300025735 | Bacteria | 217090 |
| 222 | Ga0207713_1000164 | 3300025735 | Bacteria | 98195 |
| 223 | Ga0207713_1000362 | 3300025735 | Bacteria | 49304 |
| 224 | Ga0207713_1000420 | 3300025735 | Bacteria | 45109 |
| 225 | Ga0207713_1001415 | 3300025735 | Bacteria | 19260 |
| 226 | Ga0207713_1002240 | 3300025735 | Bacteria | 14314 |
| 227 | Ga0207713_1005632 | 3300025735 | Bacteria | 7789 |
| 228 | Ga0207713_1009623 | 3300025735 | Bacteria | 5426 |
| 229 | Ga0207713_1012812 | 3300025735 | Bacteria | 4458 |
| 230 | Ga0207713_1024793 | 3300025735 | Bacteria | 2785 |
| 231 | Ga0207713_1038584 | 3300025735 | Bacteria | 2025 |
| 232 | Ga0207713_1049913 | 3300025735 | Bacteria | 1674 |
| 233 | Ga0207713_1054608 | 3300025735 | Bacteria | 1565 |
| 234 | Ga0207713_1129300 | 3300025735 | Bacteria | 838 |
| 235 | Ga0207710_10000007 | 3300025900 | Bacteria | 488292 |
| 236 | Ga0207645_10191014 | 3300025907 | Bacteria | 1346 |
| 237 | Ga0207654_10000008 | 3300025911 | Bacteria | 375871 |
| 238 | Ga0207695_10186172 | 3300025913 | Bacteria | 1995 |
| 239 | Ga0207681_10009669 | 3300025923 | Bacteria | 5898 |
| 240 | Ga0207706_10006427 | 3300025933 | Bacteria | 10915 |
| 241 | Ga0207706_10012888 | 3300025933 | Bacteria | 7610 |
| 242 | Ga0207709_10000506 | 3300025935 | Bacteria | 34436 |
| 243 | Ga0207709_10001680 | 3300025935 | Bacteria | 14910 |
| 244 | Ga0207709_10019891 | 3300025935 | Bacteria | 3781 |
| 245 | Ga0207678_10092768 | 3300026067 | Bacteria | 2580 |
| 246 | Ga0207674_10000009 | 3300026116 | Bacteria | 202730 |
| 247 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 248 | Ga0209281_1000058 | 3300027111 | Bacteria | 300244 |
| 249 | Ga0209281_1000060 | 3300027111 | Bacteria | 295683 |
| 250 | Ga0209281_1000146 | 3300027111 | Bacteria | 169237 |
| 251 | Ga0209281_1000260 | 3300027111 | Bacteria | 101875 |
| 252 | Ga0209281_1000298 | 3300027111 | Bacteria | 90323 |
| 253 | Ga0209281_1000891 | 3300027111 | Bacteria | 25418 |
| 254 | Ga0209281_1003504 | 3300027111 | Bacteria | 5156 |
| 255 | Ga0209281_1010011 | 3300027111 | Bacteria | 2194 |
| 256 | Ga0209371_1000014 | 3300027312 | Bacteria | 661118 |
| 257 | Ga0209371_1000030 | 3300027312 | Bacteria | 423605 |
| 258 | Ga0209371_1000053 | 3300027312 | Bacteria | 264616 |
| 259 | Ga0209371_1000096 | 3300027312 | Bacteria | 160552 |
| 260 | Ga0209371_1000276 | 3300027312 | Bacteria | 59687 |
| 261 | Ga0209371_1000300 | 3300027312 | Bacteria | 55324 |
| 262 | Ga0209371_1000435 | 3300027312 | Bacteria | 42480 |
| 263 | Ga0209371_1001319 | 3300027312 | Bacteria | 17337 |
| 264 | Ga0209371_1001390 | 3300027312 | Bacteria | 16613 |
| 265 | Ga0209371_1001468 | 3300027312 | Bacteria | 15875 |
| 266 | Ga0209371_1002980 | 3300027312 | Bacteria | 8794 |
| 267 | Ga0209371_1003617 | 3300027312 | Bacteria | 7375 |
| 268 | Ga0209371_1004348 | 3300027312 | Bacteria | 6226 |
| 269 | Ga0209371_1018900 | 3300027312 | Bacteria | 1736 |
| 270 | Ga0209969_1012631 | 3300027360 | Bacteria | 1219 |
| 271 | Ga0209995_1000634 | 3300027471 | Bacteria | 5417 |
| 272 | Ga0209983_1000782 | 3300027665 | Bacteria | 6913 |
| 273 | Ga0209971_1000459 | 3300027682 | Bacteria | 10808 |
| 274 | Ga0209974_10001088 | 3300027876 | Bacteria | 9626 |
| 275 | Ga0268266_10000307 | 3300028379 | Bacteria | 77625 |
| 276 | Ga0268266_10002381 | 3300028379 | Bacteria | 20323 |
| 277 | Ga0268266_10108839 | 3300028379 | Bacteria | 2453 |
| 278 | Ga0268266_10483741 | 3300028379 | Bacteria | 1180 |
| 279 | Ga0268256_1000012 | 3300030500 | Bacteria | 794553 |
| 280 | Ga0268256_1000021 | 3300030500 | Bacteria | 542735 |
| 281 | Ga0268256_1000025 | 3300030500 | Bacteria | 484317 |
| 282 | Ga0268256_1000053 | 3300030500 | Bacteria | 264616 |
| 283 | Ga0268256_1000086 | 3300030500 | Bacteria | 160533 |
| 284 | Ga0268256_1000230 | 3300030500 | Bacteria | 59687 |
| 285 | Ga0268256_1001193 | 3300030500 | Bacteria | 16613 |
| 286 | Ga0268256_1001251 | 3300030500 | Bacteria | 15875 |
| 287 | Ga0268256_1001533 | 3300030500 | Bacteria | 13631 |
| 288 | Ga0268256_1002281 | 3300030500 | Bacteria | 9957 |
| 289 | Ga0268256_1003295 | 3300030500 | Bacteria | 7410 |
| 290 | Ga0268256_1004026 | 3300030500 | Bacteria | 6315 |
| 291 | Ga0268256_1021167 | 3300030500 | Bacteria | 1736 |
| 292 | Ga0316177_1153363 | 3300030731 | Bacteria | 3754 |
| 293 | Ga0314311_1171705 | 3300030733 | Bacteria | 3858 |
| 294 | Ga0316178_1009978 | 3300030735 | Bacteria | 23983 |
| 295 | Ga0316183_1089672 | 3300030742 | Bacteria | 1835 |
| 296 | Ga0316181_1195268 | 3300030744 | Bacteria | 1666 |
| 297 | Ga0265331_10022548 | 3300031250 | Bacteria | 3212 |
| 298 | Ga0265327_10000393 | 3300031251 | Bacteria | 82261 |
| 299 | Ga0265327_10003818 | 3300031251 | Bacteria | 13925 |
| 300 | Ga0265327_10009488 | 3300031251 | Bacteria | 7016 |
| 301 | Ga0265327_10085252 | 3300031251 | Bacteria | 1551 |
| 302 | Ga0265316_10001475 | 3300031344 | Bacteria | 25202 |
| 303 | Ga0265316_10010827 | 3300031344 | Bacteria | 8286 |
| 304 | Ga0307408_100004188 | 3300031548 | Bacteria | 9830 |
| 305 | Ga0316575_10031837 | 3300031665 | Bacteria | 2065 |
| 306 | Ga0316575_10034455 | 3300031665 | Bacteria | 1989 |
| 307 | Ga0316579_10000764 | 3300031691 | Bacteria | 11024 |
| 308 | Ga0316579_10000832 | 3300031691 | Bacteria | 10658 |
| 309 | Ga0316579_10000866 | 3300031691 | Bacteria | 10471 |
| 310 | Ga0316579_10005086 | 3300031691 | Bacteria | 5275 |
| 311 | Ga0316579_10006802 | 3300031691 | Bacteria | 4683 |
| 312 | Ga0316579_10011962 | 3300031691 | Bacteria | 3702 |
| 313 | Ga0316579_10029923 | 3300031691 | Bacteria | 2486 |
| 314 | Ga0316579_10079247 | 3300031691 | Bacteria | 1563 |
| 315 | Ga0316579_10097985 | 3300031691 | Bacteria | 1403 |
| 316 | Ga0316579_10205903 | 3300031691 | Bacteria | 951 |
| 317 | Ga0265314_10201888 | 3300031711 | Bacteria | 1174 |
| 318 | Ga0316576_10005252 | 3300031727 | Bacteria | 7883 |
| 319 | Ga0316576_10018090 | 3300031727 | Bacteria | 4803 |
| 320 | Ga0316576_10025690 | 3300031727 | Bacteria | 4125 |
| 321 | Ga0316576_10036563 | 3300031727 | Bacteria | 3511 |
| 322 | Ga0316576_10039565 | 3300031727 | Bacteria | 3385 |
| 323 | Ga0316576_10056298 | 3300031727 | Bacteria | 2871 |
| 324 | Ga0316576_10056991 | 3300031727 | Bacteria | 2855 |
| 325 | Ga0316576_10067834 | 3300031727 | Bacteria | 2627 |
| 326 | Ga0316576_10080683 | 3300031727 | Bacteria | 2413 |
| 327 | Ga0316576_10109534 | 3300031727 | Bacteria | 2070 |
| 328 | Ga0316576_10412245 | 3300031727 | Bacteria | 1000 |
| 329 | Ga0316578_10000708 | 3300031728 | Bacteria | 12056 |
| 330 | Ga0316578_10004427 | 3300031728 | Bacteria | 6634 |
| 331 | Ga0316578_10006348 | 3300031728 | Bacteria | 5826 |
| 332 | Ga0316578_10015990 | 3300031728 | Bacteria | 4050 |
| 333 | Ga0316578_10018852 | 3300031728 | Bacteria | 3789 |
| 334 | Ga0316578_10022900 | 3300031728 | Bacteria | 3490 |
| 335 | Ga0316578_10030290 | 3300031728 | Bacteria | 3075 |
| 336 | Ga0316578_10038051 | 3300031728 | Bacteria | 2773 |
| 337 | Ga0316578_10059355 | 3300031728 | Bacteria | 2250 |
| 338 | Ga0316578_10084927 | 3300031728 | Bacteria | 1886 |
| 339 | Ga0316578_10123758 | 3300031728 | Bacteria | 1555 |
| 340 | Ga0316578_10281481 | 3300031728 | Bacteria | 996 |
| 341 | Ga0307405_10000248 | 3300031731 | Bacteria | 19649 |
| 342 | Ga0316577_10001781 | 3300031733 | Bacteria | 10385 |
| 343 | Ga0316577_10002393 | 3300031733 | Bacteria | 9283 |
| 344 | Ga0316577_10008258 | 3300031733 | Bacteria | 5577 |
| 345 | Ga0316577_10020992 | 3300031733 | Bacteria | 3621 |
| 346 | Ga0316577_10024227 | 3300031733 | Bacteria | 3373 |
| 347 | Ga0316577_10052266 | 3300031733 | Bacteria | 2279 |
| 348 | Ga0316577_10085105 | 3300031733 | Bacteria | 1769 |
| 349 | Ga0316577_10105491 | 3300031733 | Bacteria | 1581 |
| 350 | Ga0316577_10135604 | 3300031733 | Bacteria | 1386 |
| 351 | Ga0307406_10004204 | 3300031901 | Bacteria | 7840 |
| 352 | Ga0307414_10032415 | 3300032004 | Bacteria | 3439 |
| 353 | Ga0316583_10000732 | 3300032133 | Bacteria | 10221 |
| 354 | Ga0316583_10002841 | 3300032133 | Bacteria | 6070 |
| 355 | Ga0316583_10014978 | 3300032133 | Bacteria | 2791 |
| 356 | Ga0316583_10015499 | 3300032133 | Bacteria | 2743 |
| 357 | Ga0316583_10056945 | 3300032133 | Bacteria | 1373 |
| 358 | Ga0316585_10000930 | 3300032137 | Bacteria | 7500 |
| 359 | Ga0316585_10021392 | 3300032137 | Bacteria | 1986 |
| 360 | Ga0316585_10022775 | 3300032137 | Bacteria | 1928 |
| 361 | Ga0316585_10093532 | 3300032137 | Bacteria | 983 |
| 362 | Ga0316580_10000571 | 3300032139 | Bacteria | 8632 |
| 363 | Ga0316580_10001354 | 3300032139 | Bacteria | 6363 |
| 364 | Ga0316580_10007878 | 3300032139 | Bacteria | 3181 |
| 365 | Ga0316593_10000385 | 3300032168 | Bacteria | 7877 |
| 366 | Ga0316593_10001920 | 3300032168 | Bacteria | 4768 |
| 367 | Ga0316593_10003764 | 3300032168 | Bacteria | 3811 |
| 368 | Ga0316593_10005777 | 3300032168 | Bacteria | 3295 |
| 369 | Ga0316593_10016016 | 3300032168 | Bacteria | 2266 |
| 370 | Ga0316593_10032512 | 3300032168 | Bacteria | 1704 |
| 371 | Ga0316593_10044636 | 3300032168 | Bacteria | 1484 |
| 372 | Ga0316593_10047692 | 3300032168 | Bacteria | 1441 |
| 373 | Ga0316592_1008270 | 3300033524 | Bacteria | 2049 |
| 374 | Ga0316586_1001708 | 3300033527 | Bacteria | 2598 |
| 375 | Ga0316586_1011739 | 3300033527 | Bacteria | 1347 |
| 376 | Ga0316588_1002169 | 3300033528 | Bacteria | 3383 |
| 377 | Ga0316588_1015885 | 3300033528 | Bacteria | 1662 |
| 378 | Ga0316587_1003873 | 3300033529 | Bacteria | 2130 |
| 379 | Ga0316587_1011921 | 3300033529 | Bacteria | 1409 |
| 380 | Ga0316587_1024496 | 3300033529 | Bacteria | 1044 |
| 381 | Ga0316596_1002356 | 3300033541 | Bacteria | 4021 |
| 382 | Ga0316596_1009573 | 3300033541 | Bacteria | 2326 |
| 383 | Ga0316596_1015987 | 3300033541 | Bacteria | 1877 |
| 384 | Ga0316596_1020019 | 3300033541 | Bacteria | 1700 |
| 385 | Ga0316596_1033058 | 3300033541 | Bacteria | 1347 |
| 386 | Ga0316596_1044267 | 3300033541 | Bacteria | 1172 |
| 387 | Ga0316574_0000526 | 3300035398 | Bacteria | 15691 |
| 388 | Ga0316574_0001797 | 3300035398 | Bacteria | 10438 |
| 389 | Ga0316574_0003658 | 3300035398 | Bacteria | 7961 |
| 390 | Ga0316574_0006602 | 3300035398 | Bacteria | 6284 |
| 391 | Ga0316574_0008008 | 3300035398 | Bacteria | 5837 |
| 392 | Ga0316574_0024772 | 3300035398 | Bacteria | 3595 |
| 393 | Ga0316574_0024907 | 3300035398 | Bacteria | 3586 |
| 394 | Ga0316574_0040121 | 3300035398 | Bacteria | 2881 |
| 395 | Ga0316574_0040353 | 3300035398 | Bacteria | 2874 |
| 396 | Ga0316574_0045189 | 3300035398 | Bacteria | 2727 |
| 397 | Ga0316574_0050031 | 3300035398 | Bacteria | 2600 |
| 398 | Ga0316574_0057258 | 3300035398 | Bacteria | 2440 |
| 399 | Ga0316574_0061282 | 3300035398 | Bacteria | 2362 |
| 400 | Ga0316574_0078434 | 3300035398 | Bacteria | 2094 |
| 401 | Ga0316574_0138951 | 3300035398 | Bacteria | 1565 |
| 402 | Ga0316574_0202070 | 3300035398 | Bacteria | 1276 |
| 403 | Ga0316574_0256224 | 3300035398 | Bacteria | 1118 |
| 404 | Ga0316574_0277532 | 3300035398 | Bacteria | 1068 |
| 405 | Ga0316582_0001017 | 3300036647 | Bacteria | 11725 |
| 406 | Ga0316582_0001397 | 3300036647 | Bacteria | 10537 |
| 407 | Ga0316582_0002764 | 3300036647 | Bacteria | 8351 |
| 408 | Ga0316582_0003814 | 3300036647 | Bacteria | 7490 |
| 409 | Ga0316582_0005774 | 3300036647 | Bacteria | 6421 |
| 410 | Ga0316582_0006041 | 3300036647 | Bacteria | 6313 |
| 411 | Ga0316582_0008555 | 3300036647 | Bacteria | 5509 |
| 412 | Ga0316582_0011379 | 3300036647 | Bacteria | 4914 |
| 413 | Ga0316582_0011568 | 3300036647 | Bacteria | 4886 |
| 414 | Ga0316582_0019086 | 3300036647 | Bacteria | 4006 |
| 415 | Ga0316582_0025706 | 3300036647 | Bacteria | 3538 |
| 416 | Ga0316582_0035735 | 3300036647 | Bacteria | 3071 |
| 417 | Ga0316582_0043915 | 3300036647 | Bacteria | 2807 |
| 418 | Ga0316582_0049146 | 3300036647 | Bacteria | 2668 |
| 419 | Ga0316582_0050615 | 3300036647 | Bacteria | 2632 |
| 420 | Ga0316582_0053755 | 3300036647 | Bacteria | 2562 |
| 421 | Ga0316582_0169537 | 3300036647 | Bacteria | 1481 |
| 422 | Ga0316582_0211346 | 3300036647 | Bacteria | 1325 |
| 423 | Ga0316582_0343680 | 3300036647 | Bacteria | 1026 |
| 424 | Ga0316582_0471825 | 3300036647 | Bacteria | 865 |
| 425 | Ga0316584_0001979 | 3300036712 | Bacteria | 12787 |
| 426 | Ga0316584_0008900 | 3300036712 | Bacteria | 6941 |
| 427 | Ga0316584_0009487 | 3300036712 | Bacteria | 6759 |
| 428 | Ga0316584_0012711 | 3300036712 | Bacteria | 5941 |
| 429 | Ga0316584_0015347 | 3300036712 | Bacteria | 5477 |
| 430 | Ga0316584_0015982 | 3300036712 | Bacteria | 5376 |
| 431 | Ga0316584_0020856 | 3300036712 | Bacteria | 4758 |
| 432 | Ga0316584_0022059 | 3300036712 | Bacteria | 4640 |
| 433 | Ga0316584_0024898 | 3300036712 | Bacteria | 4384 |
| 434 | Ga0316584_0028328 | 3300036712 | Bacteria | 4129 |
| 435 | Ga0316584_0057146 | 3300036712 | Bacteria | 2921 |
| 436 | Ga0316584_0070421 | 3300036712 | Bacteria | 2621 |
| 437 | Ga0316584_0108352 | 3300036712 | Bacteria | 2078 |
| 438 | Ga0316584_0137624 | 3300036712 | Bacteria | 1822 |
| 439 | Ga0316584_0156393 | 3300036712 | Bacteria | 1695 |
| 440 | Ga0316584_0163229 | 3300036712 | Bacteria | 1654 |
| 441 | Ga0316584_0169456 | 3300036712 | Bacteria | 1620 |
| 442 | Ga0316584_0355740 | 3300036712 | Bacteria | 1050 |
| 443 | Ga0316581_0000605 | 3300037588 | Bacteria | 7106 |
| 444 | Ga0316581_0001282 | 3300037588 | Bacteria | 5581 |
| 445 | Ga0316581_0013993 | 3300037588 | Bacteria | 2281 |
| 446 | Ga0316581_0019495 | 3300037588 | Bacteria | 1979 |
| 447 | Ga0316581_0037767 | 3300037588 | Bacteria | 1468 |
| 448 | Ga0237819_00998 | 3300038705 | Bacteria | 8547 |
| 449 | Ga0400484_23537 | 3300038725 | Bacteria | 13279 |
| 450 | Ga0400490_46332 | 3300038726 | Bacteria | 6117 |
| 451 | Ga0400490_50955 | 3300038726 | Bacteria | 4469 |
| 452 | Ga0400485_04817 | 3300038735 | Bacteria | 2133 |
| 453 | Ga0400488_18063 | 3300038741 | Bacteria | 3628 |
| 454 | Ga0400488_23404 | 3300038741 | Bacteria | 1690 |
| 455 | Ga0400486_10873 | 3300038742 | Bacteria | 1348 |
| 456 | Ga0400486_27166 | 3300038742 | Bacteria | 3998 |
| 457 | Ga0400483_017640 | 3300039062 | Bacteria | 9395 |
| 458 | Ga0400483_039315 | 3300039062 | Bacteria | 4266 |
| 459 | Ga0400483_070366 | 3300039062 | Bacteria | 2281 |
| 460 | Ga0400483_193205 | 3300039062 | Bacteria | 4917 |
| 461 | Ga0400483_284851 | 3300039062 | Bacteria | 2473 |
| 462 | Ga0400489_94800 | 3300039093 | Bacteria | 4454 |
| 463 | Ga0400487_62529 | 3300039110 | Bacteria | 2574 |
| 464 | Ga0439436_0009790 | 3300041404 | Bacteria | 2934 |
| 465 | Ga0439438_000003 | 3300041405 | Bacteria | 464587 |
| 466 | Ga0439438_003055 | 3300041405 | Bacteria | 6881 |
| 467 | Ga0439438_007793 | 3300041405 | Bacteria | 3618 |
| 468 | Ga0439439_0005991 | 3300041406 | Bacteria | 2798 |
| 469 | Ga0439447_000387 | 3300041407 | Bacteria | 16130 |
| 470 | Ga0439447_001753 | 3300041407 | Bacteria | 7962 |
| 471 | Ga0439447_006699 | 3300041407 | Bacteria | 3712 |
| 472 | Ga0439447_016244 | 3300041407 | Bacteria | 2047 |
| 473 | Ga0439466_0000107 | 3300041411 | Bacteria | 31816 |
| 474 | Ga0439466_0002320 | 3300041411 | Bacteria | 7471 |
| 475 | Ga0439466_0003915 | 3300041411 | Bacteria | 5742 |
| 476 | Ga0439466_0013218 | 3300041411 | Bacteria | 3024 |
| 477 | Ga0451853_3494193 | 3300041512 | Bacteria | 2357 |
| 478 | Ga0439431_0000429 | 3300041997 | Bacteria | 8934 |
| 479 | Ga0439431_0005059 | 3300041997 | Bacteria | 2907 |
| 480 | Ga0439431_0011438 | 3300041997 | Bacteria | 2028 |
| 481 | Ga0439433_0000804 | 3300041999 | Bacteria | 6199 |
| 482 | Ga0439437_000864 | 3300042000 | Bacteria | 3151 |
| 483 | Ga0439432_000568 | 3300042006 | Bacteria | 13848 |
| 484 | Ga0439432_000616 | 3300042006 | Bacteria | 13400 |
| 485 | Ga0439432_018713 | 3300042006 | Bacteria | 2312 |
| 486 | Ga0439449_0000086 | 3300042007 | Bacteria | 30358 |
| 487 | Ga0439452_000004 | 3300042010 | Bacteria | 764268 |
| 488 | Ga0439452_000005 | 3300042010 | Bacteria | 646919 |
| 489 | Ga0439452_000074 | 3300042010 | Bacteria | 88357 |
| 490 | Ga0439452_001682 | 3300042010 | Bacteria | 8686 |
| 491 | Ga0439452_003675 | 3300042010 | Bacteria | 5314 |
| 492 | Ga0439452_004175 | 3300042010 | Bacteria | 4897 |
| 493 | Ga0439452_010592 | 3300042010 | Bacteria | 2674 |
| 494 | Ga0439462_0004980 | 3300042015 | Bacteria | 3260 |
| 495 | Ga0439463_000657 | 3300042016 | Bacteria | 9599 |
| 496 | Ga0439463_005527 | 3300042016 | Bacteria | 3141 |
| 497 | Ga0450911_000330 | 3300042115 | Bacteria | 16996 |
| 498 | Ga0450923_035777 | 3300042125 | Bacteria | 1028 |
| 499 | Ga0450904_000169 | 3300042139 | Bacteria | 14258 |
| 500 | Ga0450907_000034 | 3300042146 | Bacteria | 61803 |
| 501 | Ga0450907_001447 | 3300042146 | Bacteria | 5129 |
| 502 | Ga0439446_0003777 | 3300042156 | Bacteria | 3787 |
| 503 | Ga0439446_0010581 | 3300042156 | Bacteria | 2487 |
| 504 | Ga0439464_0009420 | 3300042439 | Bacteria | 2571 |
| 505 | Ga0450893_0003734 | 3300042532 | Bacteria | 2409 |
| 506 | Ga0451577_0000096 | 3300042876 | Bacteria | 195129 |
| 507 | Ga0453684_0001083 | 3300044712 | Bacteria | 86721 |
| 508 | Ga0453684_0003868 | 3300044712 | Bacteria | 32963 |
| 509 | Ga0453684_0004281 | 3300044712 | Bacteria | 30458 |
| 510 | Ga0453684_0016029 | 3300044712 | Bacteria | 11766 |
| 511 | Ga0453684_0039530 | 3300044712 | Bacteria | 6426 |
| 512 | Ga0453684_0073400 | 3300044712 | Bacteria | 4313 |
| 513 | Ga0453684_0189408 | 3300044712 | Bacteria | 2408 |
| 514 | Ga0453684_0300539 | 3300044712 | Bacteria | 1824 |
| 515 | Ga0453684_0328156 | 3300044712 | Bacteria | 1731 |
| 516 | Ga0451576_0274447 | 3300045051 | Bacteria | 1763 |
| 517 | Ga0495627_000266 | 3300046453 | Bacteria | 53407 |
| 518 | Ga0495627_002309 | 3300046453 | Bacteria | 9398 |
| 519 | Ga0495591_000047 | 3300046458 | Bacteria | 140371 |
| 520 | Ga0495591_000781 | 3300046458 | Bacteria | 22669 |
| 521 | Ga0495591_004492 | 3300046458 | Bacteria | 6812 |
| 522 | Ga0495591_007463 | 3300046458 | Bacteria | 4644 |
| 523 | Ga0495591_029949 | 3300046458 | Bacteria | 1648 |
| 524 | Ga0495638_0005629 | 3300046460 | Bacteria | 9236 |
| 525 | Ga0495638_0076348 | 3300046460 | Bacteria | 2041 |
| 526 | Ga0495650_0000004 | 3300046471 | Bacteria | 779487 |
| 527 | Ga0495650_0000028 | 3300046471 | Bacteria | 473012 |
| 528 | Ga0495650_0006996 | 3300046471 | Bacteria | 6888 |
| 529 | Ga0495650_0010358 | 3300046471 | Bacteria | 5210 |
| 530 | Ga0495650_0035387 | 3300046471 | Bacteria | 2199 |
| 531 | Ga0495605_0000278 | 3300046474 | Bacteria | 57625 |
| 532 | Ga0495605_0000930 | 3300046474 | Bacteria | 20030 |
| 533 | Ga0495605_0006053 | 3300046474 | Bacteria | 6988 |
| 534 | Ga0495605_0017501 | 3300046474 | Bacteria | 3855 |
| 535 | Ga0495605_0032038 | 3300046474 | Bacteria | 2680 |
| 536 | Ga0495585_0085228 | 3300046492 | Bacteria | 1707 |
| 537 | Ga0495594_0000635 | 3300046499 | Bacteria | 18070 |
| 538 | Ga0495607_0001037 | 3300046501 | Bacteria | 25477 |
| 539 | Ga0495607_0001805 | 3300046501 | Bacteria | 18284 |
| 540 | Ga0495607_0083259 | 3300046501 | Bacteria | 1752 |
| 541 | Ga0495583_0000504 | 3300046506 | Bacteria | 56210 |
| 542 | Ga0495583_0003618 | 3300046506 | Bacteria | 11573 |
| 543 | Ga0495583_0122853 | 3300046506 | Bacteria | 1091 |
| 544 | Ga0495606_0000631 | 3300046507 | Bacteria | 55444 |
| 545 | Ga0495606_0000785 | 3300046507 | Bacteria | 48544 |
| 546 | Ga0495606_0000954 | 3300046507 | Bacteria | 42555 |
| 547 | Ga0495610_0007403 | 3300046512 | Bacteria | 7313 |
| 548 | Ga0495616_0017184 | 3300046513 | Bacteria | 3991 |
| 549 | Ga0495620_0000153 | 3300046515 | Bacteria | 56187 |
| 550 | Ga0495620_0001468 | 3300046515 | Bacteria | 14106 |
| 551 | Ga0495620_0022124 | 3300046515 | Bacteria | 3070 |
| 552 | Ga0495631_0000885 | 3300046518 | Bacteria | 18745 |
| 553 | Ga0495631_0008078 | 3300046518 | Bacteria | 5317 |
| 554 | Ga0495637_0003816 | 3300046520 | Bacteria | 7920 |
| 555 | Ga0495637_0092316 | 3300046520 | Bacteria | 1192 |
| 556 | Ga0495643_0001069 | 3300046522 | Bacteria | 27292 |
| 557 | Ga0495643_0024885 | 3300046522 | Bacteria | 3392 |
| 558 | Ga0495644_0007545 | 3300046523 | Bacteria | 4193 |
| 559 | Ga0495648_0003159 | 3300046524 | Bacteria | 14659 |
| 560 | Ga0495648_0006054 | 3300046524 | Bacteria | 9924 |
| 561 | Ga0495648_0009421 | 3300046524 | Bacteria | 7574 |
| 562 | Ga0495648_0010621 | 3300046524 | Bacteria | 6997 |
| 563 | Ga0495642_0000848 | 3300046528 | Bacteria | 14563 |
| 564 | Ga0495642_0001368 | 3300046528 | Bacteria | 10903 |
| 565 | Ga0495654_0000546 | 3300046530 | Bacteria | 30342 |
| 566 | Ga0495654_0001218 | 3300046530 | Bacteria | 18240 |
| 567 | Ga0495654_0001456 | 3300046530 | Bacteria | 16218 |
| 568 | Ga0495654_0145543 | 3300046530 | Bacteria | 1052 |
| 569 | Ga0495587_0010198 | 3300046536 | Bacteria | 5991 |
| 570 | Ga0495609_0000166 | 3300046538 | Bacteria | 69064 |
| 571 | Ga0495609_0045207 | 3300046538 | Bacteria | 1973 |
| 572 | Ga0495597_0003210 | 3300046542 | Bacteria | 9734 |
| 573 | Ga0495633_0000291 | 3300046558 | Bacteria | 57655 |
| 574 | Ga0495656_0005423 | 3300046615 | Bacteria | 4402 |
| 575 | Ga0495611_0008254 | 3300046648 | Bacteria | 4417 |
| 576 | Ga0495661_0000294 | 3300046665 | Bacteria | 56661 |
| 577 | Ga0495661_0079341 | 3300046665 | Bacteria | 1897 |
| 578 | Ga0495623_0045526 | 3300046679 | Bacteria | 2787 |
| 579 | Ga0495646_0104365 | 3300046680 | Bacteria | 1620 |
| 580 | Ga0495669_0002337 | 3300046684 | Bacteria | 7770 |
| 581 | Ga0495670_0014298 | 3300046691 | Bacteria | 3903 |
| 582 | Ga0495671_0002990 | 3300046692 | Bacteria | 10507 |
| 583 | Ga0495671_0112674 | 3300046692 | Bacteria | 1328 |
| 584 | Ga0495649_0012306 | 3300046694 | Bacteria | 4985 |
| 585 | Ga0495649_0031182 | 3300046694 | Bacteria | 2940 |
| 586 | Ga0495649_0261235 | 3300046694 | Bacteria | 887 |
| 587 | Ga0495589_0000028 | 3300046794 | Bacteria | 179523 |
| 588 | Ga0495589_0000676 | 3300046794 | Bacteria | 22317 |
| 589 | Ga0495660_0000013 | 3300046810 | Bacteria | 350283 |
| 590 | Ga0495660_0000516 | 3300046810 | Bacteria | 31688 |
| 591 | Ga0495660_0008552 | 3300046810 | Bacteria | 5992 |
| 592 | Ga0495636_0048751 | 3300047318 | Bacteria | 1770 |
| 593 | Ga0495672_0000029 | 3300047320 | Bacteria | 305231 |
| 594 | Ga0495672_0000054 | 3300047320 | Bacteria | 230777 |
| 595 | Ga0495672_0008309 | 3300047320 | Bacteria | 7686 |
| 596 | Ga0495672_0084814 | 3300047320 | Bacteria | 1756 |
| 597 | Ga0495683_0000196 | 3300047323 | Bacteria | 57478 |
| 598 | Ga0495683_0001353 | 3300047323 | Bacteria | 16343 |
| 599 | Ga0495683_0001587 | 3300047323 | Bacteria | 14649 |
| 600 | Ga0495687_008219 | 3300047443 | Bacteria | 6008 |
| 601 | Ga0495675_0045645 | 3300047444 | Bacteria | 2790 |
| 602 | Ga0495679_000987 | 3300047446 | Bacteria | 17554 |
| 603 | Ga0495679_026456 | 3300047446 | Bacteria | 1926 |
| 604 | Ga0495673_0000047 | 3300047469 | Bacteria | 266522 |
| 605 | Ga0495673_0000092 | 3300047469 | Bacteria | 187963 |
| 606 | Ga0495673_0006592 | 3300047469 | Bacteria | 6808 |
| 607 | Ga0495673_0007180 | 3300047469 | Bacteria | 6446 |
| 608 | Ga0495673_0015070 | 3300047469 | Bacteria | 3996 |
| 609 | Ga0495673_0046250 | 3300047469 | Bacteria | 1929 |
| 610 | Ga0495681_0010573 | 3300047470 | Bacteria | 5580 |
| 611 | Ga0495681_0011600 | 3300047470 | Bacteria | 5235 |
| 612 | Ga0495681_0031723 | 3300047470 | Bacteria | 2670 |
| 613 | Ga0495686_0067279 | 3300047472 | Bacteria | 2212 |
| 614 | Ga0495626_0077596 | 3300048091 | Bacteria | 1480 |
| 615 | Ga0496100_0112202 | 3300048903 | Bacteria | 1896 |
| 616 | Ga0496101_0105686 | 3300048904 | Bacteria | 2113 |
| 617 | Ga0496102_0003362 | 3300048905 | Bacteria | 13560 |
| 618 | Ga0496102_0145276 | 3300048905 | Bacteria | 2226 |
| 619 | Ga0496102_0352048 | 3300048905 | Bacteria | 1387 |
| 620 | Ga0496102_0372192 | 3300048905 | Bacteria | 1344 |
| 621 | Ga0496103_0108925 | 3300048906 | Bacteria | 1758 |
| 622 | Ga0496104_0001075 | 3300048907 | Bacteria | 23321 |
| 623 | Ga0496104_0011029 | 3300048907 | Bacteria | 8084 |
| 624 | Ga0496104_0155030 | 3300048907 | Bacteria | 2199 |
| 625 | Ga0496104_0300655 | 3300048907 | Bacteria | 1517 |
| 626 | Ga0496105_0002003 | 3300048908 | Bacteria | 14699 |
| 627 | Ga0496105_0067341 | 3300048908 | Bacteria | 2956 |
| 628 | Ga0496105_0195630 | 3300048908 | Bacteria | 1652 |
| 629 | Ga0496105_0346463 | 3300048908 | Bacteria | 1187 |
| 630 | Ga0496116_0000009 | 3300048919 | Bacteria | 716119 |
| 631 | Ga0496116_0000016 | 3300048919 | Bacteria | 555146 |
| 632 | Ga0496116_0000214 | 3300048919 | Bacteria | 109085 |
| 633 | Ga0496116_0000368 | 3300048919 | Bacteria | 69066 |
| 634 | Ga0496116_0007736 | 3300048919 | Bacteria | 9455 |
| 635 | Ga0496116_0009298 | 3300048919 | Bacteria | 8396 |
| 636 | Ga0496116_0020768 | 3300048919 | Bacteria | 4974 |
| 637 | Ga0496116_0026248 | 3300048919 | Bacteria | 4264 |
| 638 | Ga0496116_0030775 | 3300048919 | Bacteria | 3851 |
| 639 | Ga0496116_0030916 | 3300048919 | Bacteria | 3841 |
| 640 | Ga0496116_0054852 | 3300048919 | Bacteria | 2622 |
| 641 | Ga0496116_0252597 | 3300048919 | Bacteria | 876 |
| 642 | Ga0496117_0000350 | 3300048920 | Bacteria | 81439 |
| 643 | Ga0496117_0000753 | 3300048920 | Bacteria | 51060 |
| 644 | Ga0496117_0000772 | 3300048920 | Bacteria | 50588 |
| 645 | Ga0496117_0003500 | 3300048920 | Bacteria | 18205 |
| 646 | Ga0496117_0004686 | 3300048920 | Bacteria | 14856 |
| 647 | Ga0496117_0021006 | 3300048920 | Bacteria | 5304 |
| 648 | Ga0496117_0022249 | 3300048920 | Bacteria | 5090 |
| 649 | Ga0496117_0056339 | 3300048920 | Bacteria | 2738 |
| 650 | Ga0496117_0083835 | 3300048920 | Bacteria | 2082 |
| 651 | Ga0496118_0000821 | 3300048921 | Bacteria | 49444 |
| 652 | Ga0496118_0001525 | 3300048921 | Bacteria | 34487 |
| 653 | Ga0496118_0001665 | 3300048921 | Bacteria | 32618 |
| 654 | Ga0496118_0002391 | 3300048921 | Bacteria | 25363 |
| 655 | Ga0496118_0003425 | 3300048921 | Bacteria | 20012 |
| 656 | Ga0496118_0022263 | 3300048921 | Bacteria | 5548 |
| 657 | Ga0496118_0030448 | 3300048921 | Bacteria | 4503 |
| 658 | Ga0496118_0076287 | 3300048921 | Bacteria | 2384 |
| 659 | Ga0496118_0082275 | 3300048921 | Bacteria | 2256 |
| 660 | Ga0496119_0000134 | 3300048922 | Bacteria | 104139 |
| 661 | Ga0496119_0000171 | 3300048922 | Bacteria | 91583 |
| 662 | Ga0496119_0000226 | 3300048922 | Bacteria | 78974 |
| 663 | Ga0496119_0000516 | 3300048922 | Bacteria | 52621 |
| 664 | Ga0496119_0002114 | 3300048922 | Bacteria | 22380 |
| 665 | Ga0496119_0004720 | 3300048922 | Bacteria | 13398 |
| 666 | Ga0496119_0005631 | 3300048922 | Bacteria | 11907 |
| 667 | Ga0496119_0007240 | 3300048922 | Bacteria | 10041 |
| 668 | Ga0496119_0008294 | 3300048922 | Bacteria | 9161 |
| 669 | Ga0496119_0010529 | 3300048922 | Bacteria | 7766 |
| 670 | Ga0496119_0012717 | 3300048922 | Bacteria | 6802 |
| 671 | Ga0496119_0081167 | 3300048922 | Bacteria | 1868 |
| 672 | Ga0496120_0000017 | 3300048923 | Bacteria | 269222 |
| 673 | Ga0496120_0000032 | 3300048923 | Bacteria | 220255 |
| 674 | Ga0496120_0000330 | 3300048923 | Bacteria | 78975 |
| 675 | Ga0496120_0002452 | 3300048923 | Bacteria | 18740 |
| 676 | Ga0496120_0002661 | 3300048923 | Bacteria | 17615 |
| 677 | Ga0496120_0002723 | 3300048923 | Bacteria | 17271 |
| 678 | Ga0496120_0003940 | 3300048923 | Bacteria | 12942 |
| 679 | Ga0496120_0006300 | 3300048923 | Bacteria | 9143 |
| 680 | Ga0496120_0010236 | 3300048923 | Bacteria | 6565 |
| 681 | Ga0496120_0010281 | 3300048923 | Bacteria | 6546 |
| 682 | Ga0496120_0010797 | 3300048923 | Bacteria | 6327 |
| 683 | Ga0496120_0044727 | 3300048923 | Bacteria | 2570 |
| 684 | Ga0496120_0073633 | 3300048923 | Bacteria | 1868 |
| 685 | Ga0496121_0000336 | 3300048924 | Bacteria | 97792 |
| 686 | Ga0496121_0003876 | 3300048924 | Bacteria | 20792 |
| 687 | Ga0496121_0018475 | 3300048924 | Bacteria | 7028 |
| 688 | Ga0496121_0023839 | 3300048924 | Bacteria | 5873 |
| 689 | Ga0496121_0030318 | 3300048924 | Bacteria | 4968 |
| 690 | Ga0496121_0067776 | 3300048924 | Bacteria | 2890 |
| 691 | Ga0496121_0093404 | 3300048924 | Bacteria | 2342 |
| 692 | Ga0496121_0106388 | 3300048924 | Bacteria | 2150 |
| 693 | Ga0496121_0299097 | 3300048924 | Bacteria | 1093 |
| 694 | Ga0496122_0000419 | 3300048925 | Bacteria | 89990 |
| 695 | Ga0496122_0000481 | 3300048925 | Bacteria | 82890 |
| 696 | Ga0496122_0004379 | 3300048925 | Bacteria | 17595 |
| 697 | Ga0496122_0005594 | 3300048925 | Bacteria | 14872 |
| 698 | Ga0496122_0006694 | 3300048925 | Bacteria | 13120 |
| 699 | Ga0496122_0054239 | 3300048925 | Bacteria | 3013 |
| 700 | Ga0496122_0088207 | 3300048925 | Bacteria | 2127 |
| 701 | Ga0496122_0145243 | 3300048925 | Bacteria | 1475 |
| 702 | Ga0496122_0183502 | 3300048925 | Bacteria | 1244 |
| 703 | Ga0496123_0000385 | 3300048926 | Bacteria | 82890 |
| 704 | Ga0496123_0000746 | 3300048926 | Bacteria | 52614 |
| 705 | Ga0496123_0001433 | 3300048926 | Bacteria | 33269 |
| 706 | Ga0496123_0001855 | 3300048926 | Bacteria | 27728 |
| 707 | Ga0496123_0010008 | 3300048926 | Bacteria | 8449 |
| 708 | Ga0496123_0015833 | 3300048926 | Bacteria | 6159 |
| 709 | Ga0496123_0035253 | 3300048926 | Bacteria | 3568 |
| 710 | Ga0496123_0096672 | 3300048926 | Bacteria | 1733 |
| 711 | Ga0496123_0107489 | 3300048926 | Bacteria | 1604 |
| 712 | Ga0496123_0122985 | 3300048926 | Bacteria | 1455 |
| 713 | Ga0496124_0000096 | 3300048927 | Bacteria | 183847 |
| 714 | Ga0496124_0000142 | 3300048927 | Bacteria | 147311 |
| 715 | Ga0496124_0000305 | 3300048927 | Bacteria | 90763 |
| 716 | Ga0496124_0000730 | 3300048927 | Bacteria | 53903 |
| 717 | Ga0496124_0003010 | 3300048927 | Bacteria | 21078 |
| 718 | Ga0496124_0009520 | 3300048927 | Bacteria | 9993 |
| 719 | Ga0496124_0019237 | 3300048927 | Bacteria | 6364 |
| 720 | Ga0496124_0022697 | 3300048927 | Bacteria | 5746 |
| 721 | Ga0496124_0035850 | 3300048927 | Bacteria | 4334 |
| 722 | Ga0496124_0052610 | 3300048927 | Bacteria | 3458 |
| 723 | Ga0496124_0102495 | 3300048927 | Bacteria | 2316 |
| 724 | Ga0496124_0120429 | 3300048927 | Bacteria | 2098 |
| 725 | Ga0496124_0133459 | 3300048927 | Bacteria | 1969 |
| 726 | Ga0496124_0161997 | 3300048927 | Bacteria | 1742 |
| 727 | Ga0496124_0339903 | 3300048927 | Bacteria | 1066 |
| 728 | Ga0496125_0000588 | 3300048928 | Bacteria | 61975 |
| 729 | Ga0496125_0000943 | 3300048928 | Bacteria | 45676 |
| 730 | Ga0496125_0002656 | 3300048928 | Bacteria | 22857 |
| 731 | Ga0496125_0007084 | 3300048928 | Bacteria | 11972 |
| 732 | Ga0496125_0009650 | 3300048928 | Bacteria | 9868 |
| 733 | Ga0496125_0010612 | 3300048928 | Bacteria | 9306 |
| 734 | Ga0496125_0018353 | 3300048928 | Bacteria | 6647 |
| 735 | Ga0496125_0020228 | 3300048928 | Bacteria | 6251 |
| 736 | Ga0496125_0027825 | 3300048928 | Bacteria | 5115 |
| 737 | Ga0496125_0037210 | 3300048928 | Bacteria | 4233 |
| 738 | Ga0496125_0076937 | 3300048928 | Bacteria | 2575 |
| 739 | Ga0496126_0002156 | 3300048929 | Bacteria | 27382 |
| 740 | Ga0496126_0002622 | 3300048929 | Bacteria | 23930 |
| 741 | Ga0496126_0005699 | 3300048929 | Bacteria | 14110 |
| 742 | Ga0496126_0008258 | 3300048929 | Bacteria | 11243 |
| 743 | Ga0496126_0092164 | 3300048929 | Bacteria | 2663 |
| 744 | Ga0496126_0117545 | 3300048929 | Bacteria | 2309 |
| 745 | Ga0496126_0137644 | 3300048929 | Bacteria | 2104 |
| 746 | Ga0496126_0174914 | 3300048929 | Bacteria | 1827 |
| 747 | Ga0496126_0284585 | 3300048929 | Bacteria | 1368 |
| 748 | Ga0495678_000268 | 3300049459 | Bacteria | 57604 |
| 749 | Ga0495682_0000003 | 3300049460 | Bacteria | 515787 |
| 750 | Ga0495682_0000198 | 3300049460 | Bacteria | 48570 |
| 751 | Ga0495682_0000911 | 3300049460 | Bacteria | 18044 |
| 752 | Ga0495682_0009119 | 3300049460 | Bacteria | 3886 |
| 753 | Ga0501312_014756 | 3300049528 | Bacteria | 1101 |
| 754 | Ga0501314_004384 | 3300049530 | Bacteria | 1169 |
| 755 | Ga0501315_005738 | 3300049531 | Bacteria | 1357 |
| 756 | Ga0501323_000644 | 3300049539 | Bacteria | 2688 |
| 757 | Ga0501326_00333 | 3300049542 | Bacteria | 1814 |
| 758 | Ga0501032_0137468 | 3300049569 | Bacteria | 1610 |
| 759 | Ga0501034_0146959 | 3300049571 | Bacteria | 2334 |
| 760 | Ga0501036_0571259 | 3300049572 | Bacteria | 939 |
| 761 | Ga0501037_0002384 | 3300049573 | Bacteria | 13565 |
| 762 | Ga0501037_0028134 | 3300049573 | Bacteria | 4152 |
| 763 | Ga0501038_0001493 | 3300049574 | Bacteria | 21546 |
| 764 | Ga0501038_0001625 | 3300049574 | Bacteria | 20909 |
| 765 | Ga0501040_0000006 | 3300049576 | Bacteria | 97170 |
| 766 | Ga0501069_0019876 | 3300049585 | Bacteria | 3634 |
| 767 | Ga0501070_0015435 | 3300049586 | Bacteria | 6425 |
| 768 | Ga0501070_0025309 | 3300049586 | Bacteria | 4977 |
| 769 | Ga0501070_0112963 | 3300049586 | Bacteria | 2245 |
| 770 | Ga0501074_0004461 | 3300049590 | Bacteria | 10015 |
| 771 | Ga0501080_0001094 | 3300049742 | Bacteria | 22336 |
| 772 | Ga0501080_0007575 | 3300049742 | Bacteria | 9815 |
| 773 | Ga0501044_0034592 | 3300049823 | Bacteria | 5297 |
| 774 | Ga0501226_000033 | 3300049853 | Bacteria | 72088 |
| 775 | nmdc:mga00v17_51771_c1 | 3300050491 | Bacteria | 2497 |
| 776 | nmdc:mga00v17_59361_c1 | 3300050491 | Bacteria | 2347 |
| 777 | Ga0500621_000006 | 3300053126 | Bacteria | 245480 |
| 778 | 2506585445 | 2506520008 | Bacteria | 5443009 |
| 779 | 2510283153 | 2510065053 | Bacteria | 5005518 |
| 780 | 2510293818 | 2510065055 | Bacteria | 5037935 |
| 781 | 2510310567 | 2510065058 | Bacteria | 5005894 |
| 782 | 2511274452 | 2511231007 | Bacteria | 6306603 |
| 783 | 2511290925 | 2511231010 | Bacteria | 6373152 |
| 784 | 2511296881 | 2511231011 | Bacteria | 6149768 |
| 785 | 2511304585 | 2511231012 | Bacteria | 6738011 |
| 786 | 2511313565 | 2511231014 | Bacteria | 6462302 |
| 787 | 2511318343 | 2511231015 | Bacteria | 6598026 |
| 788 | 2511331346 | 2511231017 | Bacteria | 6503007 |
| 789 | 2511337416 | 2511231018 | Bacteria | 6436256 |
| 790 | 2511341779 | 2511231019 | Bacteria | 6520662 |
| 791 | 2511351442 | 2511231020 | Bacteria | 6115223 |
| 792 | 2511372529 | 2511231023 | Bacteria | 6808468 |
| 793 | 2511415804 | 2511231031 | Bacteria | 6558529 |
| 794 | 2512734209 | 2512564039 | Bacteria | 8739048 |
| 795 | 2554813024 | 2554235132 | Bacteria | 6772433 |
| 796 | 2556065279 | 2554235469 | Bacteria | 3590176 |
| 797 | 2563928459 | 2563366752 | Bacteria | 4961801 |
| 798 | 2585827874 | 2585427591 | Bacteria | 5482980 |
| 799 | 2585830887 | 2585427592 | Bacteria | 5370892 |
| 800 | 2587743491 | 2585428059 | Bacteria | 8696589 |
| 801 | 2595090895 | 2593339131 | Bacteria | 5116855 |
| 802 | 2599330860 | 2599185155 | Bacteria | 5827168 |
| 803 | 2599502350 | 2599185188 | Bacteria | 6164180 |
| 804 | 2599928246 | 2599185299 | Bacteria | 4854625 |
| 805 | 2599933952 | 2599185300 | Bacteria | 6062622 |
| 806 | 2599975274 | 2599185307 | Bacteria | 6194719 |
| 807 | 2601628559 | 2600255283 | Bacteria | 6061572 |
| 808 | 2601801092 | 2600255318 | Bacteria | 6383414 |
| 809 | 2606073186 | 2603880185 | Bacteria | 6379190 |
| 810 | 2606125980 | 2603880199 | Bacteria | 6377649 |
| 811 | 2608383491 | 2606217733 | Bacteria | 6360972 |
| 812 | 2608670416 | 2608642108 | Bacteria | 4104624 |
| 813 | 2624483105 | 2623620443 | Bacteria | 6427864 |
| 814 | 2624494636 | 2623620446 | Bacteria | 6500345 |
| 815 | 2643739498 | 2643221543 | Bacteria | 6628015 |
| 816 | 2643955944 | 2643221589 | Bacteria | 6250934 |
| 817 | 2644020738 | 2643221602 | Bacteria | 6249926 |
| 818 | 2644186247 | 2643221633 | Bacteria | 6733554 |
| 819 | 2644423352 | 2643221676 | Bacteria | 8119172 |
| 820 | 2650900097 | 2648501693 | Bacteria | 5069560 |
| 821 | 2671106390 | 2667528173 | Bacteria | 5375747 |
| 822 | 2672336083 | 2671180330 | Bacteria | 5521719 |
| 823 | 2686354336 | 2684622997 | Bacteria | 4624240 |
| 824 | 2687579648 | 2687453129 | Bacteria | 4387428 |
| 825 | 2689446837 | 2687453601 | Bacteria | 5546041 |
| 826 | 2691331093 | 2690315857 | Bacteria | 4396207 |
| 827 | 2707100022 | 2706794495 | Bacteria | 4536932 |
| 828 | 2715750126 | 2713897148 | Bacteria | 5883533 |
| 829 | 2715756527 | 2713897149 | Bacteria | 6506249 |
| 830 | 2718636306 | 2718217725 | Bacteria | 5758958 |
| 831 | 2723602904 | 2721755693 | Bacteria | 6126117 |
| 832 | 2729145136 | 2728369097 | Bacteria | 4333476 |
| 833 | 2730138890 | 2728369359 | Bacteria | 5621728 |
| 834 | 2738690347 | 2738541271 | Bacteria | 5657310 |
| 835 | 2738839829 | 2738541299 | Bacteria | 4020721 |
| 836 | 2739198755 | 2738543004 | Bacteria | 6381073 |
| 837 | 2739230773 | 2738543010 | Bacteria | 5583595 |
| 838 | 2739261482 | 2738543015 | Bacteria | 6750701 |
| 839 | 2739266121 | 2738543016 | Bacteria | 5657564 |
| 840 | 2739271881 | 2738543017 | Bacteria | 4271950 |
| 841 | 2739289805 | 2738543020 | Bacteria | 5718238 |
| 842 | 2739295117 | 2738543021 | Bacteria | 5718241 |
| 843 | 2739312816 | 2738543025 | Bacteria | 6600348 |
| 844 | 2753809638 | 2751185905 | Bacteria | 6142767 |
| 845 | 2757568519 | 2757320391 | Bacteria | 4746095 |
| 846 | 2772440741 | 2772190666 | Bacteria | 5117644 |
| 847 | 2774131158 | 2773857672 | Bacteria | 4993178 |
| 848 | 2774135871 | 2773857673 | Bacteria | 6513460 |
| 849 | 2777763535 | 2775507177 | Bacteria | 4384303 |
| 850 | 2777835747 | 2775507192 | Bacteria | 4622234 |
| 851 | 2784262124 | 2784132063 | Bacteria | 6262788 |
| 852 | 2794598535 | 2791355520 | Bacteria | 5948615 |
| 853 | 2802436553 | 2802428803 | Bacteria | 5806948 |
| 854 | 2807178726 | 2806310673 | Bacteria | 4801221 |
| 855 | 2808858112 | 2808606361 | Bacteria | 6136259 |
| 856 | 2808868943 | 2808606364 | Bacteria | 4465927 |
| 857 | 2808906414 | 2808606373 | Bacteria | 4423627 |
| 858 | 2808925965 | 2808606376 | Bacteria | 6248667 |
| 859 | 2808932280 | 2808606377 | Bacteria | 6646337 |
| 860 | 2808938283 | 2808606378 | Bacteria | 6177535 |
| 861 | 2808941958 | 2808606379 | Bacteria | 5022697 |
| 862 | 2808948148 | 2808606380 | Bacteria | 6248705 |
| 863 | 2808954401 | 2808606381 | Bacteria | 6646461 |
| 864 | 2808960829 | 2808606382 | Bacteria | 6841132 |
| 865 | 2808966597 | 2808606383 | Bacteria | 6138645 |
| 866 | 2809001427 | 2808606389 | Bacteria | 6138126 |
| 867 | 2809124375 | 2808606414 | Bacteria | 4917181 |
| 868 | 2812369143 | 2811994881 | Bacteria | 6298475 |
| 869 | 2816864662 | 2816332186 | Bacteria | 5331395 |
| 870 | 2819568062 | 2818991441 | Bacteria | 5062707 |
| 871 | 2819654827 | 2818991456 | Bacteria | 6123676 |
| 872 | 2819669094 | 2818991459 | Bacteria | 8736032 |
| 873 | 2821116025 | 2821111986 | Bacteria | 6894338 |
| 874 | 2826582162 | 2826581358 | Bacteria | 5963467 |
| 875 | 2842683494 | 2842682962 | Bacteria | 5589973 |
| 876 | 2842808020 | 2842805378 | Bacteria | 5385175 |
| 877 | 2842821161 | 2842815866 | Bacteria | 5947510 |
| 878 | 2842833157 | 2842832357 | Bacteria | 5959113 |
| 879 | 2842845396 | 2842843487 | Bacteria | 6004777 |
| 880 | 2842852488 | 2842849001 | Bacteria | 5924277 |
| 881 | 2842855315 | 2842854478 | Bacteria | 6143501 |
| 882 | 2844532491 | 2844528606 | Bacteria | 4733806 |
| 883 | 2846541309 | 2846540461 | Bacteria | 5471451 |
| 884 | 2847088993 | 2847085930 | Bacteria | 5070450 |
| 885 | 2847801186 | 2847797336 | Bacteria | 5176640 |
| 886 | 2849144767 | 2849139964 | Bacteria | 5613304 |
| 887 | 2852662551 | 2852657418 | Bacteria | 6472974 |
| 888 | 2854603730 | 2854601825 | Bacteria | 4797592 |
| 889 | 2855196089 | 2855195626 | Bacteria | 4927512 |
| 890 | 2857453933 | 2857453340 | Bacteria | 8090534 |
| 891 | 2857461138 | 2857460504 | Bacteria | 5194327 |
| 892 | 2857468285 | 2857465823 | Bacteria | 6772595 |
| 893 | 2857581384 | 2857581216 | Bacteria | 5522813 |
| 894 | 2857589306 | 2857586860 | Bacteria | 4354574 |
| 895 | 2857607828 | 2857604169 | Bacteria | 5111450 |
| 896 | 2857612343 | 2857609550 | Bacteria | 3753890 |
| 897 | 2860341410 | 2860339153 | Bacteria | 6846989 |
| 898 | 2864739142 | 2864733723 | Bacteria | 6770668 |
| 899 | 2865001417 | 2864997549 | Bacteria | 5139696 |
| 900 | 2865008688 | 2865002811 | Bacteria | 6333767 |
| 901 | 2865018270 | 2865014394 | Bacteria | 4764573 |
| 902 | 2869556216 | 2869551831 | Bacteria | 5474685 |
| 903 | 2871276923 | 2871272651 | Bacteria | 5042015 |
| 904 | 2878035043 | 2878029506 | Bacteria | 6418441 |
| 905 | 2880235685 | 2880230671 | Bacteria | 6140320 |
| 906 | 2881613081 | 2881609920 | Bacteria | 4405319 |
| 907 | 2885530701 | 2885526491 | Bacteria | 7164189 |
| 908 | 2887633425 | 2887630918 | Bacteria | 3239855 |
| 909 | 2888370840 | 2888366609 | Bacteria | 5155009 |
| 910 | 2888376722 | 2888373701 | Bacteria | 5098052 |
| 911 | 2888582577 | 2888578766 | Bacteria | 6743310 |
| 912 | 2889044047 | 2889042446 | Bacteria | 7618936 |
| 913 | 2889055214 | 2889049205 | Bacteria | 7524325 |
| 914 | 2889278867 | 2889276214 | Bacteria | 5979355 |
| 915 | 2889298427 | 2889295896 | Bacteria | 4704906 |
| 916 | 2894515209 | 2894510363 | Bacteria | 5121143 |
| 917 | 2900053372 | 2900051742 | Bacteria | 4985156 |
| 918 | 2904166260 | 2904162308 | Bacteria | 7086713 |
| 919 | 2904474465 | 2904474040 | Bacteria | 5504324 |
| 920 | 2904490934 | 2904490793 | Bacteria | 7046938 |
| 921 | 2904506967 | 2904504865 | Bacteria | 5152820 |
| 922 | 2904519255 | 2904518522 | Bacteria | 6068986 |
| 923 | 2904555452 | 2904550169 | Bacteria | 6221258 |
| 924 | 2904598544 | 2904595352 | Bacteria | 6124848 |
| 925 | 2904762187 | 2904755435 | Bacteria | 7986759 |
| 926 | 2907207696 | 2907202186 | Bacteria | 6632024 |
| 927 | 2908673244 | 2908669403 | Bacteria | 5740494 |
| 928 | 2913042253 | 2913036834 | Bacteria | 6704877 |
| 929 | 2916179713 | 2916178963 | Bacteria | 5265078 |
| 930 | 2917836430 | 2917832318 | Bacteria | 5346010 |
| 931 | 2919065872 | 2919063839 | Bacteria | 6302690 |
| 932 | 2919126548 | 2919125081 | Bacteria | 5385106 |
| 933 | 2919150811 | 2919150387 | Bacteria | 5500879 |
| 934 | 2919165895 | 2919160200 | Bacteria | 6929020 |
| 935 | 2919389494 | 2919385768 | Bacteria | 5897293 |
| 936 | 2919429279 | 2919425241 | Bacteria | 8055701 |
| 937 | 2919457249 | 2919456309 | Bacteria | 6586567 |
| 938 | 2919486679 | 2919481497 | Bacteria | 6907839 |
| 939 | 2919488460 | 2919487758 | Bacteria | 5929766 |
| 940 | 2919534654 | 2919534386 | Bacteria | 4577686 |
| 941 | 2919689687 | 2919688452 | Bacteria | 4595932 |
| 942 | 2919700870 | 2919697872 | Bacteria | 6553725 |
| 943 | 2923523224 | 2923519811 | Bacteria | 6298479 |
| 944 | 2925327209 | 2925326138 | Bacteria | 9652120 |
| 945 | 2927145685 | 2927143783 | Bacteria | 5504251 |
| 946 | 2929211391 | 2929206907 | Bacteria | 5918291 |
| 947 | 2929298163 | 2929297113 | Bacteria | 3141306 |
| 948 | 2931387503 | 2931384279 | Bacteria | 7299545 |
| 949 | 2931397760 | 2931396565 | Bacteria | 7251677 |
| 950 | 2932406853 | 2932406140 | Bacteria | 5134491 |
| 951 | 2932407562 | 2932406140 | Bacteria | 5134491 |
| 952 | 2936342032 | 2936340661 | Bacteria | 5139038 |
| 953 | 2936362176 | 2936361878 | Bacteria | 5632809 |
| 954 | 2937969326 | 2937967321 | Bacteria | 5094075 |
| 955 | 2939579472 | 2939577877 | Bacteria | 5132791 |
| 956 | 2939579739 | 2939577877 | Bacteria | 5132791 |
| 957 | 2939605253 | 2939602548 | Bacteria | 4950493 |
| 958 | 2939642178 | 2939636861 | Bacteria | 6297853 |
| 959 | 2939683747 | 2939679117 | Bacteria | 6921672 |
| 960 | 2939704550 | 2939702853 | Bacteria | 5139229 |
| 961 | 2945954220 | 2945951305 | Bacteria | 4918162 |
| 962 | 2945993904 | 2945991243 | Bacteria | 7008369 |
| 963 | 2946056669 | 2946053406 | Bacteria | 6978655 |
| 964 | 2956900223 | 2956897341 | Bacteria | 5447711 |
| 965 | 2964379481 | 2964375228 | Bacteria | 4909004 |
| 966 | 2964380341 | 2964375228 | Bacteria | 4909004 |
| 967 | 2969309871 | 2969304461 | Bacteria | 6601805 |
| 968 | 2971416974 | 2971410472 | Bacteria | 8311090 |
| 969 | 2974294382 | 2974289157 | Bacteria | 6080362 |
| 970 | 2974302773 | 2974298342 | Bacteria | 4840922 |
| 971 | 2978976704 | 2978975091 | Bacteria | 4704313 |
| 972 | 2981289174 | 2981284811 | Bacteria | 4641497 |
| 973 | 2981293990 | 2981289755 | Bacteria | 4641509 |
| 974 | 2981984755 | 2981980479 | Bacteria | 4641628 |
| 975 | 2981989683 | 2981985349 | Bacteria | 4641497 |
| 976 | 2984498013 | 2984494565 | Bacteria | 5000175 |
| 977 | 2984499641 | 2984499530 | Bacteria | 5020881 |
| 978 | 2984506899 | 2984504281 | Bacteria | 5262371 |
| 979 | 2984528412 | 2984527788 | Bacteria | 5288478 |
| 980 | 2984534519 | 2984532647 | Bacteria | 5288506 |
| 981 | 2988731186 | 2988728565 | Bacteria | 6124362 |
| 982 | 2989392930 | 2989392574 | Bacteria | 4554005 |
| 983 | 2990197029 | 2990196909 | Bacteria | 4054280 |
| 984 | 2990264471 | 2990261002 | Bacteria | 4919493 |
| 985 | 2996707655 | 2996706504 | Bacteria | 5757485 |
| 986 | 2998145097 | 2998139840 | Bacteria | 6073514 |
| 987 | 3001271322 | 3001267043 | Bacteria | 4823521 |
| 988 | 3001272243 | 3001272096 | Bacteria | 4729684 |
| 989 | 3006831804 | 3006826541 | Bacteria | 4678913 |
| 990 | 3006977485 | 3006973921 | Bacteria | 4423788 |
| 991 | 3006979763 | 3006978542 | Bacteria | 5328100 |
| 992 | 3006992573 | 3006988479 | Bacteria | 4767936 |
| 993 | 3007516888 | 3007511990 | Bacteria | 6481491 |
| 994 | 3007720032 | 3007718800 | Bacteria | 5971527 |
| 995 | 3007858125 | 3007855910 | Bacteria | 5637581 |
| 996 | 3007866558 | 3007861166 | Bacteria | 6045338 |
| 997 | 3007867053 | 3007866637 | Bacteria | 5899198 |
| 998 | 640939562 | 640753048 | Bacteria | 5495657 |
| 999 | 648169233 | 648028048 | Bacteria | 5394884 |
| 1000 | 8001525688 | 8001522603 | Bacteria | 4726425 |
| 1001 | 8002322936 | 8002317523 | Bacteria | 8051857 |
| 1002 | 8004593641 | 8004592986 | Bacteria | 5122074 |
| 1003 | 8011353567 | 8011350971 | Bacteria | 6158957 |
| 1004 | 8015398737 | 8015394850 | Bacteria | 5064660 |
| 1005 | 8016731047 | 8016728285 | Bacteria | 5263933 |
| 1006 | 8019777978 | 8019775933 | Bacteria | 6858656 |
| 1007 | 8022795633 | 8022792930 | Bacteria | 5693794 |
| 1008 | 8029995799 | 8029995093 | Bacteria | 5990776 |
| 1009 | 8046994496 | 8046991243 | Bacteria | 8497463 |
| 1010 | 8054799854 | 8054795415 | Bacteria | 9785225 |
| 1011 | 8056131304 | 8056125926 | Bacteria | 6228218 |
| 1012 | 8056148462 | 8056143049 | Bacteria | 6307666 |
| 1013 | 8056160538 | 8056155041 | Bacteria | 6486948 |
| 1014 | 8056171471 | 8056166840 | Bacteria | 5820959 |
| 1015 | 8056177715 | 8056172158 | Bacteria | 6133900 |
| 1016 | 8056181699 | 8056177738 | Bacteria | 6748268 |
| 1017 | 8056536627 | 8056533031 | Bacteria | 8964429 |
| 1018 | 8056570166 | 8056569372 | Bacteria | 5997322 |
| 1019 | 8057161087 | 8057160832 | Bacteria | 3268302 |
| 1020 | 8057585187 | 8057582654 | Bacteria | 5218944 |
| 1021 | 8057733985 | 8057733483 | Bacteria | 6578323 |
| 1022 | Ga0316584_0029841 | |||
| 1023 | SwRhRL2b_contig_179258 | |||
| 1024 | SwRhRL2b_contig_1896067 | |||
| 1025 | SwRhRL2b_contig_2697100 | |||
| 1026 | SwRhRL2b_contig_3444256 | |||
| 1027 | SwRhRL2b_contig_419289 | |||
| 1028 | JGI24739J22299_10000061 | |||
| 1029 | JGI25162J39368_1000006 | |||
| 1030 | JGI25162J39368_1000659 | |||
| 1031 | JGI25163J39215_1000001 | |||
| 1032 | JGI25163J39215_1000382 | |||
| 1033 | JGI25164J39214_1000001 | |||
| 1034 | JGI25164J39214_1000410 | |||
| 1035 | JGI25152J39213_1000194 | |||
| 1036 | JGI25159J45721_1022814 | |||
| 1037 | JGI25151J46595_10005255 | |||
| 1038 | JGI25151J46595_10007869 | |||
| 1039 | JGI25151J46595_10025601 | |||
| 1040 | JGI25151J46595_10029530 | |||
| 1041 | JGI25165J46597_1000774 | |||
| 1042 | Ga0055538_1000004 | |||
| 1043 | Ga0055538_1000672 | |||
| 1044 | Ga0055539_1000004 | |||
| 1045 | Ga0055533_1000007 | |||
| 1046 | Ga0055532_1000088 | |||
| 1047 | Ga0055525_1000007 | |||
| 1048 | Ga0055536_1020486 | |||
| 1049 | Ga0055530_10000832 | |||
| 1050 | Ga0055540_1000533 | |||
| 1051 | Ga0055531_10000286 | |||
| 1052 | Ga0055531_10001251 | |||
| 1053 | Ga0055541_1000004 | |||
| 1054 | Ga0058692_1000183 | |||
| 1055 | Ga0058692_1000306 | |||
| 1056 | Ga0058692_1000311 | |||
| 1057 | Ga0058692_1003055 | |||
| 1058 | Ga0058692_1003813 | |||
| 1059 | Ga0058692_1005138 | |||
| 1060 | Ga0058692_1008820 | |||
| 1061 | Ga0058692_1008822 | |||
| 1062 | Ga0058692_1020408 | |||
| 1063 | Ga0065714_10000513 | |||
| 1064 | Ga0065704_10001139 | |||
| 1065 | Ga0065704_10001780 | |||
| 1066 | Ga0065704_10009771 | |||
| 1067 | Ga0065704_10073626 | |||
| 1068 | Ga0065704_10090987 | |||
| 1069 | Ga0065712_10001345 | |||
| 1070 | Ga0065712_10068271 | |||
| 1071 | Ga0070676_10115339 | |||
| 1072 | Ga0070668_100085212 | |||
| 1073 | Ga0070669_100003634 | |||
| 1074 | Ga0070659_100376372 | |||
| 1075 | Ga0070662_100032682 | |||
| 1076 | Ga0070665_100009321 | |||
| 1077 | Ga0070665_100141643 | |||
| 1078 | Ga0070665_100460010 | |||
| 1079 | Ga0068857_100000004 | |||
| 1080 | Ga0068851_10043982 | |||
| 1081 | Ga0081455_10099386 | |||
| 1082 | Ga0081455_10257171 | |||
| 1083 | Ga0075365_10227209 | |||
| 1084 | Ga0075364_10002478 | |||
| 1085 | Ga0075364_10002674 | |||
| 1086 | Ga0079104_1000406 | |||
| 1087 | Ga0079104_1001044 | |||
| 1088 | Ga0079104_1005238 | |||
| 1089 | Ga0079104_1006147 | |||
| 1090 | Ga0079104_1012465 | |||
| 1091 | Ga0105251_10000595 | |||
| 1092 | Ga0105251_10001239 | |||
| 1093 | Ga0105251_10002260 | |||
| 1094 | Ga0105251_10008398 | |||
| 1095 | Ga0105251_10009331 | |||
| 1096 | Ga0105251_10015024 | |||
| 1097 | Ga0105251_10016560 | |||
| 1098 | Ga0105251_10018026 | |||
| 1099 | Ga0105251_10033934 | |||
| 1100 | Ga0105251_10035432 | |||
| 1101 | Ga0105251_10063505 | |||
| 1102 | Ga0105244_10000023 | |||
| 1103 | Ga0105244_10000713 | |||
| 1104 | Ga0105244_10001414 | |||
| 1105 | Ga0105244_10001617 | |||
| 1106 | Ga0105244_10004325 | |||
| 1107 | Ga0105244_10010532 | |||
| 1108 | Ga0105244_10013293 | |||
| 1109 | Ga0105244_10025204 | |||
| 1110 | Ga0105244_10047701 | |||
| 1111 | Ga0105244_10050091 | |||
| 1112 | Ga0105244_10074544 | |||
| 1113 | Ga0105250_10000042 | |||
| 1114 | Ga0105250_10000378 | |||
| 1115 | Ga0105250_10001245 | |||
| 1116 | Ga0105250_10003232 | |||
| 1117 | Ga0105250_10030333 | |||
| 1118 | Ga0105250_10074922 | |||
| 1119 | Ga0105240_10252210 | |||
| 1120 | Ga0105247_10000223 | |||
| 1121 | Ga0105243_10002183 | |||
| 1122 | Ga0105243_10055572 | |||
| 1123 | Ga0105243_10197003 | |||
| 1124 | Ga0105243_10297212 | |||
| 1125 | Ga0105241_10000006 | |||
| 1126 | Ga0105241_10434644 | |||
| 1127 | Ga0105239_10268243 | |||
| 1128 | Ga0105246_10005186 | |||
| 1129 | Ga0105246_10010294 | |||
| 1130 | Ga0105246_10013672 | |||
| 1131 | Ga0105246_10020546 | |||
| 1132 | Ga0105246_10027407 | |||
| 1133 | Ga0105246_10105547 | |||
| 1134 | Ga0157345_1000681 | |||
| 1135 | Ga0157373_10003696 | |||
| 1136 | Ga0157373_10013207 | |||
| 1137 | Ga0157373_10062449 | |||
| 1138 | Ga0157371_10000020 | |||
| 1139 | Ga0157371_10000800 | |||
| 1140 | Ga0157371_10002582 | |||
| 1141 | Ga0157371_10005708 | |||
| 1142 | Ga0157371_10026573 | |||
| 1143 | Ga0157371_10115385 | |||
| 1144 | Ga0157371_10219407 | |||
| 1145 | Ga0157371_10260022 | |||
| 1146 | Ga0157370_10000142 | |||
| 1147 | Ga0157370_10001229 | |||
| 1148 | Ga0157370_10002701 | |||
| 1149 | Ga0157370_10126670 | |||
| 1150 | Ga0157369_10008578 | |||
| 1151 | Ga0157369_10010151 | |||
| 1152 | Ga0157369_10012225 | |||
| 1153 | Ga0163162_10018952 | |||
| 1154 | Ga0163162_10025666 | |||
| 1155 | Ga0163162_10440660 | |||
| 1156 | Ga0157372_10002392 | |||
| 1157 | Ga0157372_10012060 | |||
| 1158 | Ga0157372_10335072 | |||
| 1159 | Ga0182008_10055446 | |||
| 1160 | Ga0182008_10147394 | |||
| 1161 | Ga0182006_1004458 | |||
| 1162 | Ga0182006_1005580 | |||
| 1163 | Ga0182006_1006250 | |||
| 1164 | Ga0182005_1004563 | |||
| 1165 | Ga0182005_1013120 | |||
| 1166 | Ga0183366_1003 | |||
| 1167 | Ga0183370_1003 | |||
| 1168 | Ga0183369_1005 | |||
| 1169 | Ga0183368_1006 | |||
| 1170 | Ga0163161_10000050 | |||
| 1171 | Ga0163161_10035907 | |||
| 1172 | Ga0163161_10067649 | |||
| 1173 | Ga0163161_10106308 | |||
| 1174 | Ga0209760_100044 | |||
| 1175 | Ga0209760_100155 | |||
| 1176 | Ga0209784_100001 | |||
| 1177 | Ga0209784_100325 | |||
| 1178 | Ga0209566_100001 | |||
| 1179 | Ga0209566_100108 | |||
| 1180 | Ga0209566_100155 | |||
| 1181 | Ga0209674_100002 | |||
| 1182 | Ga0209147_100058 | |||
| 1183 | Ga0209563_100008 | |||
| 1184 | Ga0209563_100863 | |||
| 1185 | Ga0207427_100002 | |||
| 1186 | Ga0207427_100006 | |||
| 1187 | Ga0209437_100013 | |||
| 1188 | Ga0209437_100046 | |||
| 1189 | Ga0209437_100063 | |||
| 1190 | Ga0209437_101051 | |||
| 1191 | Ga0209677_100004 | |||
| 1192 | Ga0209759_1010700 | |||
| 1193 | Ga0209129_1000008 | |||
| 1194 | Ga0209233_1000022 | |||
| 1195 | Ga0209233_1001000 | |||
| 1196 | Ga0209130_1002272 | |||
| 1197 | Ga0209676_1000015 | |||
| 1198 | Ga0209676_1000574 | |||
| 1199 | Ga0209676_1001175 | |||
| 1200 | Ga0209676_1055365 | |||
| 1201 | Ga0209025_1000801 | |||
| 1202 | Ga0209025_1001470 | |||
| 1203 | Ga0209025_1002760 | |||
| 1204 | Ga0209025_1005308 | |||
| 1205 | Ga0209050_1001031 | |||
| 1206 | Ga0209050_1005862 | |||
| 1207 | Ga0209051_1000041 | |||
| 1208 | Ga0209257_1000069 | |||
| 1209 | Ga0207656_10045750 | |||
| 1210 | Ga0207696_1000014 | |||
| 1211 | Ga0207696_1000027 | |||
| 1212 | Ga0207696_1000066 | |||
| 1213 | Ga0207696_1000319 | |||
| 1214 | Ga0207696_1000598 | |||
| 1215 | Ga0207696_1000663 | |||
| 1216 | Ga0207696_1001272 | |||
| 1217 | Ga0207696_1003590 | |||
| 1218 | Ga0207696_1005762 | |||
| 1219 | Ga0207696_1010946 | |||
| 1220 | Ga0207696_1020689 | |||
| 1221 | Ga0207655_1000017 | |||
| 1222 | Ga0207655_1000028 | |||
| 1223 | Ga0207655_1000056 | |||
| 1224 | Ga0207655_1000223 | |||
| 1225 | Ga0207655_1001041 | |||
| 1226 | Ga0207655_1001219 | |||
| 1227 | Ga0207655_1001446 | |||
| 1228 | Ga0207655_1001643 | |||
| 1229 | Ga0207655_1003013 | |||
| 1230 | Ga0207655_1005240 | |||
| 1231 | Ga0207655_1006410 | |||
| 1232 | Ga0207655_1007055 | |||
| 1233 | Ga0207655_1008271 | |||
| 1234 | Ga0207655_1008821 | |||
| 1235 | Ga0207655_1027648 | |||
| 1236 | Ga0207655_1030437 | |||
| 1237 | Ga0207655_1032019 | |||
| 1238 | Ga0207655_1033857 | |||
| 1239 | Ga0207655_1046600 | |||
| 1240 | Ga0207713_1000007 | |||
| 1241 | Ga0207713_1000048 | |||
| 1242 | Ga0207713_1000057 | |||
| 1243 | Ga0207713_1000164 | |||
| 1244 | Ga0207713_1000362 | |||
| 1245 | Ga0207713_1000420 | |||
| 1246 | Ga0207713_1001415 | |||
| 1247 | Ga0207713_1002240 | |||
| 1248 | Ga0207713_1005632 | |||
| 1249 | Ga0207713_1009623 | |||
| 1250 | Ga0207713_1012812 | |||
| 1251 | Ga0207713_1024793 | |||
| 1252 | Ga0207713_1038584 | |||
| 1253 | Ga0207713_1049913 | |||
| 1254 | Ga0207713_1054608 | |||
| 1255 | Ga0207713_1129300 | |||
| 1256 | Ga0207710_10000007 | |||
| 1257 | Ga0207645_10191014 | |||
| 1258 | Ga0207654_10000008 | |||
| 1259 | Ga0207695_10186172 | |||
| 1260 | Ga0207681_10009669 | |||
| 1261 | Ga0207706_10006427 | |||
| 1262 | Ga0207706_10012888 | |||
| 1263 | Ga0207709_10000506 | |||
| 1264 | Ga0207709_10001680 | |||
| 1265 | Ga0207709_10019891 | |||
| 1266 | Ga0207678_10092768 | |||
| 1267 | Ga0207674_10000009 | |||
| 1268 | Ga0209281_1000016 | |||
| 1269 | Ga0209281_1000058 | |||
| 1270 | Ga0209281_1000060 | |||
| 1271 | Ga0209281_1000146 | |||
| 1272 | Ga0209281_1000260 | |||
| 1273 | Ga0209281_1000298 | |||
| 1274 | Ga0209281_1000891 | |||
| 1275 | Ga0209281_1003504 | |||
| 1276 | Ga0209281_1010011 | |||
| 1277 | Ga0209371_1000014 | |||
| 1278 | Ga0209371_1000030 | |||
| 1279 | Ga0209371_1000053 | |||
| 1280 | Ga0209371_1000096 | |||
| 1281 | Ga0209371_1000276 | |||
| 1282 | Ga0209371_1000300 | |||
| 1283 | Ga0209371_1000435 | |||
| 1284 | Ga0209371_1001319 | |||
| 1285 | Ga0209371_1001390 | |||
| 1286 | Ga0209371_1001468 | |||
| 1287 | Ga0209371_1002980 | |||
| 1288 | Ga0209371_1003617 | |||
| 1289 | Ga0209371_1004348 | |||
| 1290 | Ga0209371_1018900 | |||
| 1291 | Ga0209969_1012631 | |||
| 1292 | Ga0209995_1000634 | |||
| 1293 | Ga0209983_1000782 | |||
| 1294 | Ga0209971_1000459 | |||
| 1295 | Ga0209974_10001088 | |||
| 1296 | Ga0268266_10000307 | |||
| 1297 | Ga0268266_10002381 | |||
| 1298 | Ga0268266_10108839 | |||
| 1299 | Ga0268266_10483741 | |||
| 1300 | Ga0268256_1000012 | |||
| 1301 | Ga0268256_1000021 | |||
| 1302 | Ga0268256_1000025 | |||
| 1303 | Ga0268256_1000053 | |||
| 1304 | Ga0268256_1000086 | |||
| 1305 | Ga0268256_1000230 | |||
| 1306 | Ga0268256_1001193 | |||
| 1307 | Ga0268256_1001251 | |||
| 1308 | Ga0268256_1001533 | |||
| 1309 | Ga0268256_1002281 | |||
| 1310 | Ga0268256_1003295 | |||
| 1311 | Ga0268256_1004026 | |||
| 1312 | Ga0268256_1021167 | |||
| 1313 | Ga0316177_1153363 | |||
| 1314 | Ga0314311_1171705 | |||
| 1315 | Ga0316178_1009978 | |||
| 1316 | Ga0316183_1089672 | |||
| 1317 | Ga0316181_1195268 | |||
| 1318 | Ga0265331_10022548 | |||
| 1319 | Ga0265327_10000393 | |||
| 1320 | Ga0265327_10003818 | |||
| 1321 | Ga0265327_10009488 | |||
| 1322 | Ga0265327_10085252 | |||
| 1323 | Ga0265316_10001475 | |||
| 1324 | Ga0265316_10010827 | |||
| 1325 | Ga0307408_100004188 | |||
| 1326 | Ga0316575_10031837 | |||
| 1327 | Ga0316575_10034455 | |||
| 1328 | Ga0316579_10000764 | |||
| 1329 | Ga0316579_10000832 | |||
| 1330 | Ga0316579_10000866 | |||
| 1331 | Ga0316579_10005086 | |||
| 1332 | Ga0316579_10006802 | |||
| 1333 | Ga0316579_10011962 | |||
| 1334 | Ga0316579_10029923 | |||
| 1335 | Ga0316579_10079247 | |||
| 1336 | Ga0316579_10097985 | |||
| 1337 | Ga0316579_10205903 | |||
| 1338 | Ga0265314_10201888 | |||
| 1339 | Ga0316576_10005252 | |||
| 1340 | Ga0316576_10018090 | |||
| 1341 | Ga0316576_10025690 | |||
| 1342 | Ga0316576_10036563 | |||
| 1343 | Ga0316576_10039565 | |||
| 1344 | Ga0316576_10056298 | |||
| 1345 | Ga0316576_10056991 | |||
| 1346 | Ga0316576_10067834 | |||
| 1347 | Ga0316576_10080683 | |||
| 1348 | Ga0316576_10109534 | |||
| 1349 | Ga0316576_10412245 | |||
| 1350 | Ga0316578_10000708 | |||
| 1351 | Ga0316578_10004427 | |||
| 1352 | Ga0316578_10006348 | |||
| 1353 | Ga0316578_10015990 | |||
| 1354 | Ga0316578_10018852 | |||
| 1355 | Ga0316578_10022900 | |||
| 1356 | Ga0316578_10030290 | |||
| 1357 | Ga0316578_10038051 | |||
| 1358 | Ga0316578_10059355 | |||
| 1359 | Ga0316578_10084927 | |||
| 1360 | Ga0316578_10123758 | |||
| 1361 | Ga0316578_10281481 | |||
| 1362 | Ga0307405_10000248 | |||
| 1363 | Ga0316577_10001781 | |||
| 1364 | Ga0316577_10002393 | |||
| 1365 | Ga0316577_10008258 | |||
| 1366 | Ga0316577_10020992 | |||
| 1367 | Ga0316577_10024227 | |||
| 1368 | Ga0316577_10052266 | |||
| 1369 | Ga0316577_10085105 | |||
| 1370 | Ga0316577_10105491 | |||
| 1371 | Ga0316577_10135604 | |||
| 1372 | Ga0307406_10004204 | |||
| 1373 | Ga0307414_10032415 | |||
| 1374 | Ga0316583_10000732 | |||
| 1375 | Ga0316583_10002841 | |||
| 1376 | Ga0316583_10014978 | |||
| 1377 | Ga0316583_10015499 | |||
| 1378 | Ga0316583_10056945 | |||
| 1379 | Ga0316585_10000930 | |||
| 1380 | Ga0316585_10021392 | |||
| 1381 | Ga0316585_10022775 | |||
| 1382 | Ga0316585_10093532 | |||
| 1383 | Ga0316580_10000571 | |||
| 1384 | Ga0316580_10001354 | |||
| 1385 | Ga0316580_10007878 | |||
| 1386 | Ga0316593_10000385 | |||
| 1387 | Ga0316593_10001920 | |||
| 1388 | Ga0316593_10003764 | |||
| 1389 | Ga0316593_10005777 | |||
| 1390 | Ga0316593_10016016 | |||
| 1391 | Ga0316593_10032512 | |||
| 1392 | Ga0316593_10044636 | |||
| 1393 | Ga0316593_10047692 | |||
| 1394 | Ga0316592_1008270 | |||
| 1395 | Ga0316586_1001708 | |||
| 1396 | Ga0316586_1011739 | |||
| 1397 | Ga0316588_1002169 | |||
| 1398 | Ga0316588_1015885 | |||
| 1399 | Ga0316587_1003873 | |||
| 1400 | Ga0316587_1011921 | |||
| 1401 | Ga0316587_1024496 | |||
| 1402 | Ga0316596_1002356 | |||
| 1403 | Ga0316596_1009573 | |||
| 1404 | Ga0316596_1015987 | |||
| 1405 | Ga0316596_1020019 | |||
| 1406 | Ga0316596_1033058 | |||
| 1407 | Ga0316596_1044267 | |||
| 1408 | Ga0316574_0000526 | |||
| 1409 | Ga0316574_0001797 | |||
| 1410 | Ga0316574_0003658 | |||
| 1411 | Ga0316574_0006602 | |||
| 1412 | Ga0316574_0008008 | |||
| 1413 | Ga0316574_0024772 | |||
| 1414 | Ga0316574_0024907 | |||
| 1415 | Ga0316574_0040121 | |||
| 1416 | Ga0316574_0040353 | |||
| 1417 | Ga0316574_0045189 | |||
| 1418 | Ga0316574_0050031 | |||
| 1419 | Ga0316574_0057258 | |||
| 1420 | Ga0316574_0061282 | |||
| 1421 | Ga0316574_0078434 | |||
| 1422 | Ga0316574_0138951 | |||
| 1423 | Ga0316574_0202070 | |||
| 1424 | Ga0316574_0256224 | |||
| 1425 | Ga0316574_0277532 | |||
| 1426 | Ga0316582_0001017 | |||
| 1427 | Ga0316582_0001397 | |||
| 1428 | Ga0316582_0002764 | |||
| 1429 | Ga0316582_0003814 | |||
| 1430 | Ga0316582_0005774 | |||
| 1431 | Ga0316582_0006041 | |||
| 1432 | Ga0316582_0008555 | |||
| 1433 | Ga0316582_0011379 | |||
| 1434 | Ga0316582_0011568 | |||
| 1435 | Ga0316582_0019086 | |||
| 1436 | Ga0316582_0025706 | |||
| 1437 | Ga0316582_0035735 | |||
| 1438 | Ga0316582_0043915 | |||
| 1439 | Ga0316582_0049146 | |||
| 1440 | Ga0316582_0050615 | |||
| 1441 | Ga0316582_0053755 | |||
| 1442 | Ga0316582_0169537 | |||
| 1443 | Ga0316582_0211346 | |||
| 1444 | Ga0316582_0343680 | |||
| 1445 | Ga0316582_0471825 | |||
| 1446 | Ga0316584_0001979 | |||
| 1447 | Ga0316584_0008900 | |||
| 1448 | Ga0316584_0009487 | |||
| 1449 | Ga0316584_0012711 | |||
| 1450 | Ga0316584_0015347 | |||
| 1451 | Ga0316584_0015982 | |||
| 1452 | Ga0316584_0020856 | |||
| 1453 | Ga0316584_0022059 | |||
| 1454 | Ga0316584_0024898 | |||
| 1455 | Ga0316584_0028328 | |||
| 1456 | Ga0316584_0057146 | |||
| 1457 | Ga0316584_0070421 | |||
| 1458 | Ga0316584_0108352 | |||
| 1459 | Ga0316584_0137624 | |||
| 1460 | Ga0316584_0156393 | |||
| 1461 | Ga0316584_0163229 | |||
| 1462 | Ga0316584_0169456 | |||
| 1463 | Ga0316584_0355740 | |||
| 1464 | Ga0316581_0000605 | |||
| 1465 | Ga0316581_0001282 | |||
| 1466 | Ga0316581_0013993 | |||
| 1467 | Ga0316581_0019495 | |||
| 1468 | Ga0316581_0037767 | |||
| 1469 | Ga0237819_00998 | |||
| 1470 | Ga0400484_23537 | |||
| 1471 | Ga0400490_46332 | |||
| 1472 | Ga0400490_50955 | |||
| 1473 | Ga0400485_04817 | |||
| 1474 | Ga0400488_18063 | |||
| 1475 | Ga0400488_23404 | |||
| 1476 | Ga0400486_10873 | |||
| 1477 | Ga0400486_27166 | |||
| 1478 | Ga0400483_017640 | |||
| 1479 | Ga0400483_039315 | |||
| 1480 | Ga0400483_070366 | |||
| 1481 | Ga0400483_193205 | |||
| 1482 | Ga0400483_284851 | |||
| 1483 | Ga0400489_94800 | |||
| 1484 | Ga0400487_62529 | |||
| 1485 | Ga0439436_0009790 | |||
| 1486 | Ga0439438_000003 | |||
| 1487 | Ga0439438_003055 | |||
| 1488 | Ga0439438_007793 | |||
| 1489 | Ga0439439_0005991 | |||
| 1490 | Ga0439447_000387 | |||
| 1491 | Ga0439447_001753 | |||
| 1492 | Ga0439447_006699 | |||
| 1493 | Ga0439447_016244 | |||
| 1494 | Ga0439466_0000107 | |||
| 1495 | Ga0439466_0002320 | |||
| 1496 | Ga0439466_0003915 | |||
| 1497 | Ga0439466_0013218 | |||
| 1498 | Ga0451853_3494193 | |||
| 1499 | Ga0439431_0000429 | |||
| 1500 | Ga0439431_0005059 | |||
| 1501 | Ga0439431_0011438 | |||
| 1502 | Ga0439433_0000804 | |||
| 1503 | Ga0439437_000864 | |||
| 1504 | Ga0439432_000568 | |||
| 1505 | Ga0439432_000616 | |||
| 1506 | Ga0439432_018713 | |||
| 1507 | Ga0439449_0000086 | |||
| 1508 | Ga0439452_000004 | |||
| 1509 | Ga0439452_000005 | |||
| 1510 | Ga0439452_000074 | |||
| 1511 | Ga0439452_001682 | |||
| 1512 | Ga0439452_003675 | |||
| 1513 | Ga0439452_004175 | |||
| 1514 | Ga0439452_010592 | |||
| 1515 | Ga0439462_0004980 | |||
| 1516 | Ga0439463_000657 | |||
| 1517 | Ga0439463_005527 | |||
| 1518 | Ga0450911_000330 | |||
| 1519 | Ga0450923_035777 | |||
| 1520 | Ga0450904_000169 | |||
| 1521 | Ga0450907_000034 | |||
| 1522 | Ga0450907_001447 | |||
| 1523 | Ga0439446_0003777 | |||
| 1524 | Ga0439446_0010581 | |||
| 1525 | Ga0439464_0009420 | |||
| 1526 | Ga0450893_0003734 | |||
| 1527 | Ga0451577_0000096 | |||
| 1528 | Ga0453684_0001083 | |||
| 1529 | Ga0453684_0003868 | |||
| 1530 | Ga0453684_0004281 | |||
| 1531 | Ga0453684_0016029 | |||
| 1532 | Ga0453684_0039530 | |||
| 1533 | Ga0453684_0073400 | |||
| 1534 | Ga0453684_0189408 | |||
| 1535 | Ga0453684_0300539 | |||
| 1536 | Ga0453684_0328156 | |||
| 1537 | Ga0451576_0274447 | |||
| 1538 | Ga0495627_000266 | |||
| 1539 | Ga0495627_002309 | |||
| 1540 | Ga0495591_000047 | |||
| 1541 | Ga0495591_000781 | |||
| 1542 | Ga0495591_004492 | |||
| 1543 | Ga0495591_007463 | |||
| 1544 | Ga0495591_029949 | |||
| 1545 | Ga0495638_0005629 | |||
| 1546 | Ga0495638_0076348 | |||
| 1547 | Ga0495650_0000004 | |||
| 1548 | Ga0495650_0000028 | |||
| 1549 | Ga0495650_0006996 | |||
| 1550 | Ga0495650_0010358 | |||
| 1551 | Ga0495650_0035387 | |||
| 1552 | Ga0495605_0000278 | |||
| 1553 | Ga0495605_0000930 | |||
| 1554 | Ga0495605_0006053 | |||
| 1555 | Ga0495605_0017501 | |||
| 1556 | Ga0495605_0032038 | |||
| 1557 | Ga0495585_0085228 | |||
| 1558 | Ga0495594_0000635 | |||
| 1559 | Ga0495607_0001037 | |||
| 1560 | Ga0495607_0001805 | |||
| 1561 | Ga0495607_0083259 | |||
| 1562 | Ga0495583_0000504 | |||
| 1563 | Ga0495583_0003618 | |||
| 1564 | Ga0495583_0122853 | |||
| 1565 | Ga0495606_0000631 | |||
| 1566 | Ga0495606_0000785 | |||
| 1567 | Ga0495606_0000954 | |||
| 1568 | Ga0495610_0007403 | |||
| 1569 | Ga0495616_0017184 | |||
| 1570 | Ga0495620_0000153 | |||
| 1571 | Ga0495620_0001468 | |||
| 1572 | Ga0495620_0022124 | |||
| 1573 | Ga0495631_0000885 | |||
| 1574 | Ga0495631_0008078 | |||
| 1575 | Ga0495637_0003816 | |||
| 1576 | Ga0495637_0092316 | |||
| 1577 | Ga0495643_0001069 | |||
| 1578 | Ga0495643_0024885 | |||
| 1579 | Ga0495644_0007545 | |||
| 1580 | Ga0495648_0003159 | |||
| 1581 | Ga0495648_0006054 | |||
| 1582 | Ga0495648_0009421 | |||
| 1583 | Ga0495648_0010621 | |||
| 1584 | Ga0495642_0000848 | |||
| 1585 | Ga0495642_0001368 | |||
| 1586 | Ga0495654_0000546 | |||
| 1587 | Ga0495654_0001218 | |||
| 1588 | Ga0495654_0001456 | |||
| 1589 | Ga0495654_0145543 | |||
| 1590 | Ga0495587_0010198 | |||
| 1591 | Ga0495609_0000166 | |||
| 1592 | Ga0495609_0045207 | |||
| 1593 | Ga0495597_0003210 | |||
| 1594 | Ga0495633_0000291 | |||
| 1595 | Ga0495656_0005423 | |||
| 1596 | Ga0495611_0008254 | |||
| 1597 | Ga0495661_0000294 | |||
| 1598 | Ga0495661_0079341 | |||
| 1599 | Ga0495623_0045526 | |||
| 1600 | Ga0495646_0104365 | |||
| 1601 | Ga0495669_0002337 | |||
| 1602 | Ga0495670_0014298 | |||
| 1603 | Ga0495671_0002990 | |||
| 1604 | Ga0495671_0112674 | |||
| 1605 | Ga0495649_0012306 | |||
| 1606 | Ga0495649_0031182 | |||
| 1607 | Ga0495649_0261235 | |||
| 1608 | Ga0495589_0000028 | |||
| 1609 | Ga0495589_0000676 | |||
| 1610 | Ga0495660_0000013 | |||
| 1611 | Ga0495660_0000516 | |||
| 1612 | Ga0495660_0008552 | |||
| 1613 | Ga0495636_0048751 | |||
| 1614 | Ga0495672_0000029 | |||
| 1615 | Ga0495672_0000054 | |||
| 1616 | Ga0495672_0008309 | |||
| 1617 | Ga0495672_0084814 | |||
| 1618 | Ga0495683_0000196 | |||
| 1619 | Ga0495683_0001353 | |||
| 1620 | Ga0495683_0001587 | |||
| 1621 | Ga0495687_008219 | |||
| 1622 | Ga0495675_0045645 | |||
| 1623 | Ga0495679_000987 | |||
| 1624 | Ga0495679_026456 | |||
| 1625 | Ga0495673_0000047 | |||
| 1626 | Ga0495673_0000092 | |||
| 1627 | Ga0495673_0006592 | |||
| 1628 | Ga0495673_0007180 | |||
| 1629 | Ga0495673_0015070 | |||
| 1630 | Ga0495673_0046250 | |||
| 1631 | Ga0495681_0010573 | |||
| 1632 | Ga0495681_0011600 | |||
| 1633 | Ga0495681_0031723 | |||
| 1634 | Ga0495686_0067279 | |||
| 1635 | Ga0495626_0077596 | |||
| 1636 | Ga0496100_0112202 | |||
| 1637 | Ga0496101_0105686 | |||
| 1638 | Ga0496102_0003362 | |||
| 1639 | Ga0496102_0145276 | |||
| 1640 | Ga0496102_0352048 | |||
| 1641 | Ga0496102_0372192 | |||
| 1642 | Ga0496103_0108925 | |||
| 1643 | Ga0496104_0001075 | |||
| 1644 | Ga0496104_0011029 | |||
| 1645 | Ga0496104_0155030 | |||
| 1646 | Ga0496104_0300655 | |||
| 1647 | Ga0496105_0002003 | |||
| 1648 | Ga0496105_0067341 | |||
| 1649 | Ga0496105_0195630 | |||
| 1650 | Ga0496105_0346463 | |||
| 1651 | Ga0496116_0000009 | |||
| 1652 | Ga0496116_0000016 | |||
| 1653 | Ga0496116_0000214 | |||
| 1654 | Ga0496116_0000368 | |||
| 1655 | Ga0496116_0007736 | |||
| 1656 | Ga0496116_0009298 | |||
| 1657 | Ga0496116_0020768 | |||
| 1658 | Ga0496116_0026248 | |||
| 1659 | Ga0496116_0030775 | |||
| 1660 | Ga0496116_0030916 | |||
| 1661 | Ga0496116_0054852 | |||
| 1662 | Ga0496116_0252597 | |||
| 1663 | Ga0496117_0000350 | |||
| 1664 | Ga0496117_0000753 | |||
| 1665 | Ga0496117_0000772 | |||
| 1666 | Ga0496117_0003500 | |||
| 1667 | Ga0496117_0004686 | |||
| 1668 | Ga0496117_0021006 | |||
| 1669 | Ga0496117_0022249 | |||
| 1670 | Ga0496117_0056339 | |||
| 1671 | Ga0496117_0083835 | |||
| 1672 | Ga0496118_0000821 | |||
| 1673 | Ga0496118_0001525 | |||
| 1674 | Ga0496118_0001665 | |||
| 1675 | Ga0496118_0002391 | |||
| 1676 | Ga0496118_0003425 | |||
| 1677 | Ga0496118_0022263 | |||
| 1678 | Ga0496118_0030448 | |||
| 1679 | Ga0496118_0076287 | |||
| 1680 | Ga0496118_0082275 | |||
| 1681 | Ga0496119_0000134 | |||
| 1682 | Ga0496119_0000171 | |||
| 1683 | Ga0496119_0000226 | |||
| 1684 | Ga0496119_0000516 | |||
| 1685 | Ga0496119_0002114 | |||
| 1686 | Ga0496119_0004720 | |||
| 1687 | Ga0496119_0005631 | |||
| 1688 | Ga0496119_0007240 | |||
| 1689 | Ga0496119_0008294 | |||
| 1690 | Ga0496119_0010529 | |||
| 1691 | Ga0496119_0012717 | |||
| 1692 | Ga0496119_0081167 | |||
| 1693 | Ga0496120_0000017 | |||
| 1694 | Ga0496120_0000032 | |||
| 1695 | Ga0496120_0000330 | |||
| 1696 | Ga0496120_0002452 | |||
| 1697 | Ga0496120_0002661 | |||
| 1698 | Ga0496120_0002723 | |||
| 1699 | Ga0496120_0003940 | |||
| 1700 | Ga0496120_0006300 | |||
| 1701 | Ga0496120_0010236 | |||
| 1702 | Ga0496120_0010281 | |||
| 1703 | Ga0496120_0010797 | |||
| 1704 | Ga0496120_0044727 | |||
| 1705 | Ga0496120_0073633 | |||
| 1706 | Ga0496121_0000336 | |||
| 1707 | Ga0496121_0003876 | |||
| 1708 | Ga0496121_0018475 | |||
| 1709 | Ga0496121_0023839 | |||
| 1710 | Ga0496121_0030318 | |||
| 1711 | Ga0496121_0067776 | |||
| 1712 | Ga0496121_0093404 | |||
| 1713 | Ga0496121_0106388 | |||
| 1714 | Ga0496121_0299097 | |||
| 1715 | Ga0496122_0000419 | |||
| 1716 | Ga0496122_0000481 | |||
| 1717 | Ga0496122_0004379 | |||
| 1718 | Ga0496122_0005594 | |||
| 1719 | Ga0496122_0006694 | |||
| 1720 | Ga0496122_0054239 | |||
| 1721 | Ga0496122_0088207 | |||
| 1722 | Ga0496122_0145243 | |||
| 1723 | Ga0496122_0183502 | |||
| 1724 | Ga0496123_0000385 | |||
| 1725 | Ga0496123_0000746 | |||
| 1726 | Ga0496123_0001433 | |||
| 1727 | Ga0496123_0001855 | |||
| 1728 | Ga0496123_0010008 | |||
| 1729 | Ga0496123_0015833 | |||
| 1730 | Ga0496123_0035253 | |||
| 1731 | Ga0496123_0096672 | |||
| 1732 | Ga0496123_0107489 | |||
| 1733 | Ga0496123_0122985 | |||
| 1734 | Ga0496124_0000096 | |||
| 1735 | Ga0496124_0000142 | |||
| 1736 | Ga0496124_0000305 | |||
| 1737 | Ga0496124_0000730 | |||
| 1738 | Ga0496124_0003010 | |||
| 1739 | Ga0496124_0009520 | |||
| 1740 | Ga0496124_0019237 | |||
| 1741 | Ga0496124_0022697 | |||
| 1742 | Ga0496124_0035850 | |||
| 1743 | Ga0496124_0052610 | |||
| 1744 | Ga0496124_0102495 | |||
| 1745 | Ga0496124_0120429 | |||
| 1746 | Ga0496124_0133459 | |||
| 1747 | Ga0496124_0161997 | |||
| 1748 | Ga0496124_0339903 | |||
| 1749 | Ga0496125_0000588 | |||
| 1750 | Ga0496125_0000943 | |||
| 1751 | Ga0496125_0002656 | |||
| 1752 | Ga0496125_0007084 | |||
| 1753 | Ga0496125_0009650 | |||
| 1754 | Ga0496125_0010612 | |||
| 1755 | Ga0496125_0018353 | |||
| 1756 | Ga0496125_0020228 | |||
| 1757 | Ga0496125_0027825 | |||
| 1758 | Ga0496125_0037210 | |||
| 1759 | Ga0496125_0076937 | |||
| 1760 | Ga0496126_0002156 | |||
| 1761 | Ga0496126_0002622 | |||
| 1762 | Ga0496126_0005699 | |||
| 1763 | Ga0496126_0008258 | |||
| 1764 | Ga0496126_0092164 | |||
| 1765 | Ga0496126_0117545 | |||
| 1766 | Ga0496126_0137644 | |||
| 1767 | Ga0496126_0174914 | |||
| 1768 | Ga0496126_0284585 | |||
| 1769 | Ga0495678_000268 | |||
| 1770 | Ga0495682_0000003 | |||
| 1771 | Ga0495682_0000198 | |||
| 1772 | Ga0495682_0000911 | |||
| 1773 | Ga0495682_0009119 | |||
| 1774 | Ga0501312_014756 | |||
| 1775 | Ga0501314_004384 | |||
| 1776 | Ga0501315_005738 | |||
| 1777 | Ga0501323_000644 | |||
| 1778 | Ga0501326_00333 | |||
| 1779 | Ga0501032_0137468 | |||
| 1780 | Ga0501034_0146959 | |||
| 1781 | Ga0501036_0571259 | |||
| 1782 | Ga0501037_0002384 | |||
| 1783 | Ga0501037_0028134 | |||
| 1784 | Ga0501038_0001493 | |||
| 1785 | Ga0501038_0001625 | |||
| 1786 | Ga0501040_0000006 | |||
| 1787 | Ga0501069_0019876 | |||
| 1788 | Ga0501070_0015435 | |||
| 1789 | Ga0501070_0025309 | |||
| 1790 | Ga0501070_0112963 | |||
| 1791 | Ga0501074_0004461 | |||
| 1792 | Ga0501080_0001094 | |||
| 1793 | Ga0501080_0007575 | |||
| 1794 | Ga0501044_0034592 | |||
| 1795 | Ga0501226_000033 | |||
| 1796 | nmdc:mga00v17_51771_c1 | |||
| 1797 | nmdc:mga00v17_59361_c1 | |||
| 1798 | Ga0500621_000006 | |||
| 1799 | 2506585445 | |||
| 1800 | 2510283153 | |||
| 1801 | 2510293818 | |||
| 1802 | 2510310567 | |||
| 1803 | 2511274452 | |||
| 1804 | 2511290925 | |||
| 1805 | 2511296881 | |||
| 1806 | 2511304585 | |||
| 1807 | 2511313565 | |||
| 1808 | 2511318343 | |||
| 1809 | 2511331346 | |||
| 1810 | 2511337416 | |||
| 1811 | 2511341779 | |||
| 1812 | 2511351442 | |||
| 1813 | 2511372529 | |||
| 1814 | 2511415804 | |||
| 1815 | 2512734209 | |||
| 1816 | 2554813024 | |||
| 1817 | 2556065279 | |||
| 1818 | 2563928459 | |||
| 1819 | 2585827874 | |||
| 1820 | 2585830887 | |||
| 1821 | 2587743491 | |||
| 1822 | 2595090895 | |||
| 1823 | 2599330860 | |||
| 1824 | 2599502350 | |||
| 1825 | 2599928246 | |||
| 1826 | 2599933952 | |||
| 1827 | 2599975274 | |||
| 1828 | 2601628559 | |||
| 1829 | 2601801092 | |||
| 1830 | 2606073186 | |||
| 1831 | 2606125980 | |||
| 1832 | 2608383491 | |||
| 1833 | 2608670416 | |||
| 1834 | 2624483105 | |||
| 1835 | 2624494636 | |||
| 1836 | 2643739498 | |||
| 1837 | 2643955944 | |||
| 1838 | 2644020738 | |||
| 1839 | 2644186247 | |||
| 1840 | 2644423352 | |||
| 1841 | 2650900097 | |||
| 1842 | 2671106390 | |||
| 1843 | 2672336083 | |||
| 1844 | 2686354336 | |||
| 1845 | 2687579648 | |||
| 1846 | 2689446837 | |||
| 1847 | 2691331093 | |||
| 1848 | 2707100022 | |||
| 1849 | 2715750126 | |||
| 1850 | 2715756527 | |||
| 1851 | 2718636306 | |||
| 1852 | 2723602904 | |||
| 1853 | 2729145136 | |||
| 1854 | 2730138890 | |||
| 1855 | 2738690347 | |||
| 1856 | 2738839829 | |||
| 1857 | 2739198755 | |||
| 1858 | 2739230773 | |||
| 1859 | 2739261482 | |||
| 1860 | 2739266121 | |||
| 1861 | 2739271881 | |||
| 1862 | 2739289805 | |||
| 1863 | 2739295117 | |||
| 1864 | 2739312816 | |||
| 1865 | 2753809638 | |||
| 1866 | 2757568519 | |||
| 1867 | 2772440741 | |||
| 1868 | 2774131158 | |||
| 1869 | 2774135871 | |||
| 1870 | 2777763535 | |||
| 1871 | 2777835747 | |||
| 1872 | 2784262124 | |||
| 1873 | 2794598535 | |||
| 1874 | 2802436553 | |||
| 1875 | 2807178726 | |||
| 1876 | 2808858112 | |||
| 1877 | 2808868943 | |||
| 1878 | 2808906414 | |||
| 1879 | 2808925965 | |||
| 1880 | 2808932280 | |||
| 1881 | 2808938283 | |||
| 1882 | 2808941958 | |||
| 1883 | 2808948148 | |||
| 1884 | 2808954401 | |||
| 1885 | 2808960829 | |||
| 1886 | 2808966597 | |||
| 1887 | 2809001427 | |||
| 1888 | 2809124375 | |||
| 1889 | 2812369143 | |||
| 1890 | 2816864662 | |||
| 1891 | 2819568062 | |||
| 1892 | 2819654827 | |||
| 1893 | 2819669094 | |||
| 1894 | 2821116025 | |||
| 1895 | 2826582162 | |||
| 1896 | 2842683494 | |||
| 1897 | 2842808020 | |||
| 1898 | 2842821161 | |||
| 1899 | 2842833157 | |||
| 1900 | 2842845396 | |||
| 1901 | 2842852488 | |||
| 1902 | 2842855315 | |||
| 1903 | 2844532491 | |||
| 1904 | 2846541309 | |||
| 1905 | 2847088993 | |||
| 1906 | 2847801186 | |||
| 1907 | 2849144767 | |||
| 1908 | 2852662551 | |||
| 1909 | 2854603730 | |||
| 1910 | 2855196089 | |||
| 1911 | 2857453933 | |||
| 1912 | 2857461138 | |||
| 1913 | 2857468285 | |||
| 1914 | 2857581384 | |||
| 1915 | 2857589306 | |||
| 1916 | 2857607828 | |||
| 1917 | 2857612343 | |||
| 1918 | 2860341410 | |||
| 1919 | 2864739142 | |||
| 1920 | 2865001417 | |||
| 1921 | 2865008688 | |||
| 1922 | 2865018270 | |||
| 1923 | 2869556216 | |||
| 1924 | 2871276923 | |||
| 1925 | 2878035043 | |||
| 1926 | 2880235685 | |||
| 1927 | 2881613081 | |||
| 1928 | 2885530701 | |||
| 1929 | 2887633425 | |||
| 1930 | 2888370840 | |||
| 1931 | 2888376722 | |||
| 1932 | 2888582577 | |||
| 1933 | 2889044047 | |||
| 1934 | 2889055214 | |||
| 1935 | 2889278867 | |||
| 1936 | 2889298427 | |||
| 1937 | 2894515209 | |||
| 1938 | 2900053372 | |||
| 1939 | 2904166260 | |||
| 1940 | 2904474465 | |||
| 1941 | 2904490934 | |||
| 1942 | 2904506967 | |||
| 1943 | 2904519255 | |||
| 1944 | 2904555452 | |||
| 1945 | 2904598544 | |||
| 1946 | 2904762187 | |||
| 1947 | 2907207696 | |||
| 1948 | 2908673244 | |||
| 1949 | 2913042253 | |||
| 1950 | 2916179713 | |||
| 1951 | 2917836430 | |||
| 1952 | 2919065872 | |||
| 1953 | 2919126548 | |||
| 1954 | 2919150811 | |||
| 1955 | 2919165895 | |||
| 1956 | 2919389494 | |||
| 1957 | 2919429279 | |||
| 1958 | 2919457249 | |||
| 1959 | 2919486679 | |||
| 1960 | 2919488460 | |||
| 1961 | 2919534654 | |||
| 1962 | 2919689687 | |||
| 1963 | 2919700870 | |||
| 1964 | 2923523224 | |||
| 1965 | 2925327209 | |||
| 1966 | 2927145685 | |||
| 1967 | 2929211391 | |||
| 1968 | 2929298163 | |||
| 1969 | 2931387503 | |||
| 1970 | 2931397760 | |||
| 1971 | 2932406853 | |||
| 1972 | 2932407562 | |||
| 1973 | 2936342032 | |||
| 1974 | 2936362176 | |||
| 1975 | 2937969326 | |||
| 1976 | 2939579472 | |||
| 1977 | 2939579739 | |||
| 1978 | 2939605253 | |||
| 1979 | 2939642178 | |||
| 1980 | 2939683747 | |||
| 1981 | 2939704550 | |||
| 1982 | 2945954220 | |||
| 1983 | 2945993904 | |||
| 1984 | 2946056669 | |||
| 1985 | 2956900223 | |||
| 1986 | 2964379481 | |||
| 1987 | 2964380341 | |||
| 1988 | 2969309871 | |||
| 1989 | 2971416974 | |||
| 1990 | 2974294382 | |||
| 1991 | 2974302773 | |||
| 1992 | 2978976704 | |||
| 1993 | 2981289174 | |||
| 1994 | 2981293990 | |||
| 1995 | 2981984755 | |||
| 1996 | 2981989683 | |||
| 1997 | 2984498013 | |||
| 1998 | 2984499641 | |||
| 1999 | 2984506899 | |||
| 2000 | 2984528412 | |||
| 2001 | 2984534519 | |||
| 2002 | 2988731186 | |||
| 2003 | 2989392930 | |||
| 2004 | 2990197029 | |||
| 2005 | 2990264471 | |||
| 2006 | 2996707655 | |||
| 2007 | 2998145097 | |||
| 2008 | 3001271322 | |||
| 2009 | 3001272243 | |||
| 2010 | 3006831804 | |||
| 2011 | 3006977485 | |||
| 2012 | 3006979763 | |||
| 2013 | 3006992573 | |||
| 2014 | 3007516888 | |||
| 2015 | 3007720032 | |||
| 2016 | 3007858125 | |||
| 2017 | 3007866558 | |||
| 2018 | 3007867053 | |||
| 2019 | 640939562 | |||
| 2020 | 648169233 | |||
| 2021 | 8001525688 | |||
| 2022 | 8002322936 | |||
| 2023 | 8004593641 | |||
| 2024 | 8011353567 | |||
| 2025 | 8015398737 | |||
| 2026 | 8016731047 | |||
| 2027 | 8019777978 | |||
| 2028 | 8022795633 | |||
| 2029 | 8029995799 | |||
| 2030 | 8046994496 | |||
| 2031 | 8054799854 | |||
| 2032 | 8056131304 | |||
| 2033 | 8056148462 | |||
| 2034 | 8056160538 | |||
| 2035 | 8056171471 | |||
| 2036 | 8056177715 | |||
| 2037 | 8056181699 | |||
| 2038 | 8056536627 | |||
| 2039 | 8056570166 | |||
| 2040 | 8057161087 | |||
| 2041 | 8057585187 | |||
| 2042 | 8057733985 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iwc-assembly1.cif.gz_D | t. maritima adometdc complex with s-adenosylmethionine methyl ester | 0.9388 | 44 | 84 |
| 1tmi-assembly1.cif.gz_B | structure of thermotoga maritima s63a non-processing mutant s-adenosylmethionine decarboxylase | 0.8086 | 11 | 169 |
| 1tlu-assembly1.cif.gz_B | crystal structure of thermotoga maritima s-adenosylmethionine decarboxylase | 0.8075 | 11 | 169 |
| 1tlu-assembly1.cif.gz_B | crystal structure of thermotoga maritima s-adenosylmethionine decarboxylase | 0.7639 | 11 | 169 |
| 1tmi-assembly1.cif.gz_B | structure of thermotoga maritima s63a non-processing mutant s-adenosylmethionine decarboxylase | 0.7636 | 11 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A7F6_186_264_1.20.1270.220 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 1 | 186 | 264 | 1.20.1270.220 |
| af_P0A7F6_186_264_1.20.1270.220 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.9876 | 186 | 264 | 1.20.1270.220 |
| af_P0A7F6_32_185_3.60.90.10 | Alpha Beta;4-Layer Sandwich;S-adenosylmethionine decarboxylase;S-adenosylmethionine decarboxylase | 0.8819 | 33 | 185 | 3.60.90.10 |
| af_P0A7F6_32_185_3.60.90.10 | Alpha Beta;4-Layer Sandwich;S-adenosylmethionine decarboxylase;S-adenosylmethionine decarboxylase | 0.8713 | 33 | 185 | 3.60.90.10 |
| 1tluB00 | Alpha Beta;4-Layer Sandwich;S-adenosylmethionine decarboxylase;S-adenosylmethionine decarboxylase | 0.8075 | 11 | 169 | 3.60.90.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D5AXK9-F1-model_v4 | Adenosylmethionine decarboxylase (EC 4.1.1.50) | 0.9768 | 112 | 262 |
GO:0004014
GO:0005829 GO:0008295 |
| AF-A0A6L2ZNF3-F1-model_v4 | S-adenosylmethionine decarboxylase proenzyme (AdoMetDC) (SAMDC) (EC 4.1.1.50) [Cleaved into: S-adenosylmethionine decarboxylase beta chain; S-adenosylmethionine decarboxylase alpha chain] | 0.9745 | 1 | 264 |
GO:0004014
GO:0005829 GO:0008295 |
| AF-A0A6L2ZNF3-F1-model_v4 | S-adenosylmethionine decarboxylase proenzyme (AdoMetDC) (SAMDC) (EC 4.1.1.50) [Cleaved into: S-adenosylmethionine decarboxylase beta chain; S-adenosylmethionine decarboxylase alpha chain] | 0.9707 | 1 | 264 |
GO:0004014
GO:0005829 GO:0008295 |
| AF-A0A3D5AXK9-F1-model_v4 | Adenosylmethionine decarboxylase (EC 4.1.1.50) | 0.9705 | 112 | 262 |
GO:0004014
GO:0005829 GO:0008295 |
| AF-W1WS33-F1-model_v4 | Adenosylmethionine decarboxylase (EC 4.1.1.50) | 0.9682 | 32 | 264 |
GO:0004014
GO:0005829 GO:0008295 |