F488403
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1021 | 774 | 2042 | 379 |
Family's Representative Sequence
| Representative Sequence | 3300046530|Ga0495654_0000758|Ga0495654_0000758_16162_17409 |
| Length | 415 |
| Sequence | MGNADNPTGAGGQSSDPYGKAEVLPASVDLVIVGGGIMGLWAAVKAERRGIRTVLVDAGLLGQGTSGGLLGALMPHMPDKWNDKKQFQFDALLSLQDEVAAIEAATGLSCGYRRSGRLIPLPKPHLRAIALRYNQEAVTNWYPGPEGDRGSDGDQGGRRFRWDVLDQSPHAGWPDVSFIEAGLVHDTFAARVSPRKLTAALAAALRAGRHVTIAEGLEVQRIDAGAGRIEFSDGGKITFGTCIVAAGHRAFPLIEGVSAPLAHPLGQPVKGQAALLRAGIDPDLPLLYLNGLYLVPHDNGDVALGSTSEEEFDEPFSTDTKLDDLVEKARALVPALAAAPVIERWAGLRPKAIDRDPMVGPHPDHANVIALGGGFKVSFGIAHLLADAALEALAGKPMAVPASFSLVNHMAAASR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 27 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 35 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 36 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 37 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 38 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 39 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 40 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 41 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 42 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 43 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 44 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 50 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 56 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 59 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 60 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 61 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 62 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 63 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 64 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 65 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 95 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 99 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 100 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 101 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 102 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 104 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 105 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 106 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 107 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 108 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 109 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 110 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 111 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 112 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 113 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 114 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 115 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 116 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 117 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 118 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 119 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 120 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 155 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 156 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 157 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 158 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 160 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 161 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 162 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 163 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 164 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 165 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 166 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 167 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 168 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 169 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 170 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 171 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 172 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 173 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 174 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 187 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 188 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 189 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 190 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 191 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 192 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 193 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 194 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 195 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 196 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 197 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 198 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 199 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 200 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 201 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 202 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 203 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 204 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 205 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 206 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 207 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 208 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 209 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 210 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 211 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 212 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 213 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 215 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 216 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 217 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 218 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 219 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 220 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 221 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 222 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 223 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 224 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 225 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 226 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 227 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 228 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 229 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 230 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 231 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 232 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 233 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 234 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 235 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 236 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 237 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 238 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 239 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 240 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 241 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 242 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 243 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 244 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 245 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 246 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 247 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 248 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 249 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 250 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 251 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 252 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 253 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 254 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 255 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 256 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 257 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 258 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 259 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 260 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 261 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 262 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 263 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 264 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 265 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 266 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 267 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 268 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 269 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 270 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 271 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 272 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 273 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 274 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 275 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 276 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 277 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 278 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 279 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 280 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 281 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 282 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 283 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 284 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 285 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 286 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 287 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 288 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 289 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 290 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 291 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 292 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 293 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 294 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 295 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 296 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 297 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 298 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 299 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 300 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 301 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 302 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 303 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 304 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 305 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 306 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 307 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 308 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 309 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 310 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 311 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 312 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 313 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 314 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 315 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 316 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 317 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 318 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 319 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 320 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 321 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 322 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 323 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 324 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 325 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 326 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 327 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 328 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 329 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 330 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 331 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 332 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 333 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 334 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 335 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 336 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 337 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 338 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 339 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 340 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 341 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 342 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 343 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 344 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 345 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 346 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 347 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 348 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 349 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 350 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 351 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 352 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 353 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 354 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 355 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 356 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 357 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 358 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 359 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 360 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 361 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 362 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 363 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 364 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 365 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 366 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 367 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 368 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 369 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 370 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 371 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 372 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 373 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 374 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 375 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 376 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 377 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 378 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 379 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 380 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 381 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 382 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 383 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 384 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 385 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 386 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 387 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 388 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 389 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 390 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 391 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 392 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 393 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 394 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 395 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 396 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 397 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 398 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 399 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 400 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 401 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 402 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 403 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 404 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 405 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 406 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 407 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 408 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 409 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 410 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 411 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 412 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 413 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 414 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 415 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 416 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 417 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 418 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 419 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 420 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 421 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 422 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 423 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 424 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 425 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 426 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 427 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 428 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 429 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 430 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 431 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 432 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 433 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 434 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 435 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 436 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 437 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 438 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 439 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 440 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 441 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 442 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 443 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 444 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 445 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 446 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 447 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 448 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 449 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 450 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 451 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 452 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 453 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 454 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 455 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 456 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 457 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 458 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 459 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 460 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 461 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 462 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 463 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 464 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 465 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 466 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 467 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 468 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 469 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 470 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 471 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 472 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 473 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 474 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 475 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 476 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 477 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 478 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 479 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 480 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 481 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 482 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 483 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 484 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 485 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 486 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 487 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 488 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 489 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 490 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 491 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 492 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 493 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 494 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 495 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 496 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 497 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 498 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 499 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 500 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 501 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 502 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 503 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 504 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 505 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 506 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 507 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 508 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 509 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 510 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 511 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 512 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 513 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 514 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 515 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 516 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 517 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 518 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 519 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 520 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 521 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 522 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 523 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 524 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 525 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 526 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 527 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 528 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 529 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 530 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 531 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 532 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 533 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 534 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 535 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 536 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 537 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 538 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 539 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 540 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 541 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 542 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 543 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 544 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 545 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 546 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 547 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 548 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 549 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 550 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 551 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 552 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 553 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 554 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 555 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 556 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 557 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 558 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 559 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 560 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 561 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 562 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 563 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 564 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 565 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 566 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 567 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 568 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 569 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 570 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 571 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 572 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 573 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 574 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 575 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 576 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 577 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 578 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 579 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 580 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 581 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 582 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 583 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 584 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 585 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 586 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 587 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 588 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 589 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 590 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 591 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 592 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 593 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 594 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 595 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 596 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 597 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 598 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 599 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 600 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 601 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 602 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 603 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 604 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 605 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 606 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 607 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 608 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 609 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 610 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 611 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 612 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 613 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 614 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 615 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 616 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 617 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 618 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 619 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 620 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 621 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 622 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 623 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 624 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 625 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 626 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 627 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 628 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 629 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 630 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 631 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 632 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 633 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 634 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 635 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 636 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 637 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 638 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 639 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 640 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 641 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 642 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 643 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 644 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 645 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 646 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 647 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 648 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 649 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 650 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 651 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 652 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 653 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 654 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 655 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 656 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 657 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 658 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 659 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 660 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 661 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 662 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 663 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 664 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 665 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 666 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 667 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 668 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 669 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 670 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 671 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 672 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 673 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 674 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 675 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 676 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 677 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 678 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 679 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 680 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 681 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 682 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 683 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 684 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 685 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 686 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 687 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 688 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 689 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 690 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 691 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 692 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 693 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 694 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 695 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 696 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 697 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 698 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 699 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 700 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 701 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 702 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 703 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 704 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 705 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 706 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 707 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 708 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 709 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 710 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 711 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 712 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 713 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 714 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 715 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 716 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 717 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 718 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 719 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 720 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 721 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 722 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 723 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 724 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 725 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 726 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 727 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 728 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 729 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 730 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 731 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 732 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 733 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 734 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 735 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 736 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 737 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 738 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 739 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 740 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 741 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 742 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 743 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 744 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 745 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 746 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 747 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 748 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 749 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 750 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 751 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 752 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 753 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 754 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 755 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 756 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 757 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 758 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 759 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 760 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 761 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 762 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 763 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 764 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 765 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 766 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 767 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 768 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 769 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 770 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 771 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 772 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 773 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 774 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 45.15 |
| Metatranscriptomes | 0 |
| Isolates | 54.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.49 |
| Bulb | 0 |
| Endosphere | 17.73 |
| Nodule | 41.92 |
| Rhizoplane | 2.45 |
| Rhizosphere | 16.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495654_0000758 | 3300046530 | Bacteria | 24982 |
| 2 | JGI24740J21852_10007862 | 3300001979 | Bacteria | 4302 |
| 3 | JGI25155J39150_1000014 | 3300002704 | Bacteria | 196159 |
| 4 | JGI25156J39149_1000083 | 3300002705 | Bacteria | 70138 |
| 5 | JGI25162J39368_1000217 | 3300002737 | Bacteria | 59945 |
| 6 | JGI25162J39368_1000272 | 3300002737 | Bacteria | 49890 |
| 7 | JGI25162J39368_1000416 | 3300002737 | Bacteria | 34791 |
| 8 | JGI25154J39366_1000052 | 3300002738 | Bacteria | 120209 |
| 9 | JGI25158J39367_1000097 | 3300002739 | Bacteria | 20403 |
| 10 | JGI25157J39369_1000110 | 3300002741 | Bacteria | 69643 |
| 11 | JGI25152J39213_1002158 | 3300002773 | Bacteria | 7716 |
| 12 | JGI25152J39213_1005874 | 3300002773 | Bacteria | 3469 |
| 13 | JGI25152J39213_1019264 | 3300002773 | Bacteria | 1244 |
| 14 | JGI25152J39213_1019273 | 3300002773 | Bacteria | 1244 |
| 15 | JGI25150J39212_1000100 | 3300002774 | Bacteria | 49138 |
| 16 | JGI25150J39212_1002765 | 3300002774 | Bacteria | 4262 |
| 17 | JGI25159J45721_1000004 | 3300002987 | Bacteria | 215789 |
| 18 | JGI25159J45721_1002615 | 3300002987 | Bacteria | 6738 |
| 19 | JGI25151J46595_10000146 | 3300003187 | Bacteria | 93373 |
| 20 | JGI25151J46595_10003013 | 3300003187 | Bacteria | 9572 |
| 21 | JGI25151J46595_10012519 | 3300003187 | Bacteria | 3855 |
| 22 | JGI25151J46595_10017075 | 3300003187 | Bacteria | 3159 |
| 23 | JGI25151J46595_10020722 | 3300003187 | Bacteria | 2766 |
| 24 | JGI25165J46597_1000363 | 3300003214 | Bacteria | 50542 |
| 25 | JGI25165J46597_1000767 | 3300003214 | Bacteria | 24591 |
| 26 | JGI25153J46596_10000764 | 3300003215 | Bacteria | 19680 |
| 27 | JGI25153J46596_10002359 | 3300003215 | Bacteria | 10937 |
| 28 | JGI25153J46596_10004820 | 3300003215 | Bacteria | 7185 |
| 29 | JGI25153J46596_10048278 | 3300003215 | Bacteria | 1244 |
| 30 | JGI25153J46596_10048289 | 3300003215 | Bacteria | 1244 |
| 31 | rootH1_10055212 | 3300003316 | Bacteria | 2479 |
| 32 | rootH2_10026824 | 3300003320 | Bacteria | 1393 |
| 33 | rootH1_10042649 | 3300003323 | Bacteria | 1697 |
| 34 | JGI25160J50197_1000021 | 3300003354 | Bacteria | 215789 |
| 35 | JGI25160J50197_1000351 | 3300003354 | Bacteria | 30617 |
| 36 | JGI25160J50197_1006792 | 3300003354 | Bacteria | 4582 |
| 37 | JGI25160J50197_1008702 | 3300003354 | Bacteria | 3844 |
| 38 | JGI25161J50226_1000167 | 3300003374 | Bacteria | 45203 |
| 39 | JGI25161J50226_1000534 | 3300003374 | Bacteria | 16346 |
| 40 | Ga0055526_1000842 | 3300003771 | Bacteria | 22899 |
| 41 | Ga0055526_1003643 | 3300003771 | Bacteria | 9648 |
| 42 | Ga0055526_1004423 | 3300003771 | Bacteria | 8446 |
| 43 | Ga0055524_1000572 | 3300003775 | Bacteria | 27327 |
| 44 | Ga0055524_1002425 | 3300003775 | Bacteria | 9616 |
| 45 | Ga0055524_1003892 | 3300003775 | Bacteria | 7079 |
| 46 | Ga0055524_1017337 | 3300003775 | Bacteria | 2544 |
| 47 | Ga0055536_1001497 | 3300003781 | Bacteria | 14045 |
| 48 | Ga0055536_1010331 | 3300003781 | Bacteria | 3720 |
| 49 | Ga0055528_1000158 | 3300003790 | Bacteria | 56769 |
| 50 | Ga0055528_1000707 | 3300003790 | Bacteria | 23679 |
| 51 | Ga0055528_1000749 | 3300003790 | Bacteria | 22632 |
| 52 | Ga0055528_1003189 | 3300003790 | Bacteria | 8389 |
| 53 | Ga0055540_1000518 | 3300003792 | Bacteria | 29203 |
| 54 | Ga0055540_1006013 | 3300003792 | Bacteria | 4916 |
| 55 | Ga0055540_1018452 | 3300003792 | Bacteria | 1911 |
| 56 | Ga0055531_10001986 | 3300003794 | Bacteria | 14211 |
| 57 | Ga0058692_1004992 | 3300003856 | Bacteria | 3843 |
| 58 | Ga0055543_1000060 | 3300004625 | Bacteria | 98330 |
| 59 | Ga0055543_1000102 | 3300004625 | Bacteria | 73861 |
| 60 | Ga0055543_1000699 | 3300004625 | Bacteria | 17145 |
| 61 | Ga0065165_1000033 | 3300005262 | Bacteria | 215827 |
| 62 | Ga0065165_1002490 | 3300005262 | Bacteria | 15444 |
| 63 | Ga0065165_1004363 | 3300005262 | Bacteria | 8852 |
| 64 | Ga0065165_1007452 | 3300005262 | Bacteria | 5371 |
| 65 | Ga0065165_1008586 | 3300005262 | Bacteria | 4748 |
| 66 | Ga0070670_100001104 | 3300005331 | Bacteria | 21445 |
| 67 | Ga0070668_100155931 | 3300005347 | Bacteria | 1850 |
| 68 | Ga0070663_100013668 | 3300005455 | Bacteria | 5186 |
| 69 | Ga0070665_100007074 | 3300005548 | Bacteria | 11401 |
| 70 | Ga0070665_100069762 | 3300005548 | Bacteria | 3523 |
| 71 | Ga0068856_100036153 | 3300005614 | Bacteria | 4843 |
| 72 | Ga0075365_10005037 | 3300006038 | Bacteria | 7086 |
| 73 | Ga0075365_10010140 | 3300006038 | Bacteria | 5469 |
| 74 | Ga0075363_100011370 | 3300006048 | Bacteria | 4260 |
| 75 | Ga0075363_100024884 | 3300006048 | Bacteria | 3047 |
| 76 | Ga0075364_10000029 | 3300006051 | Bacteria | 50718 |
| 77 | Ga0075362_10009629 | 3300006177 | Bacteria | 3743 |
| 78 | Ga0075362_10012636 | 3300006177 | Bacteria | 3360 |
| 79 | Ga0075367_10000779 | 3300006178 | Bacteria | 12517 |
| 80 | Ga0075369_10042472 | 3300006186 | Bacteria | 1949 |
| 81 | Ga0075366_10003058 | 3300006195 | Bacteria | 8734 |
| 82 | Ga0075370_10003951 | 3300006353 | Bacteria | 7122 |
| 83 | Ga0075370_10108910 | 3300006353 | Bacteria | 1608 |
| 84 | Ga0079104_1000015 | 3300006946 | Bacteria | 321803 |
| 85 | Ga0079104_1006455 | 3300006946 | Bacteria | 4434 |
| 86 | Ga0099826_10000462 | 3300006948 | Bacteria | 19553 |
| 87 | Ga0099826_10010687 | 3300006948 | Bacteria | 6885 |
| 88 | Ga0105251_10010023 | 3300009011 | Bacteria | 5538 |
| 89 | Ga0105240_10000014 | 3300009093 | Bacteria | 482033 |
| 90 | Ga0105243_10130163 | 3300009148 | Bacteria | 2134 |
| 91 | Ga0105248_10251851 | 3300009177 | Bacteria | 1988 |
| 92 | Ga0105237_10002158 | 3300009545 | Bacteria | 24754 |
| 93 | Ga0123341_1000035 | 3300009765 | Bacteria | 62072 |
| 94 | Ga0123342_1009440 | 3300009766 | Bacteria | 11684 |
| 95 | Ga0123342_1014884 | 3300009766 | Bacteria | 7280 |
| 96 | Ga0105239_10016073 | 3300010375 | Bacteria | 8280 |
| 97 | Ga0157371_10000017 | 3300013102 | Bacteria | 320830 |
| 98 | Ga0157370_10000329 | 3300013104 | Bacteria | 59662 |
| 99 | Ga0157370_10001031 | 3300013104 | Bacteria | 35059 |
| 100 | Ga0157369_10024034 | 3300013105 | Bacteria | 6781 |
| 101 | Ga0157369_10042281 | 3300013105 | Bacteria | 4972 |
| 102 | Ga0171463_1007 | 3300013249 | Bacteria | 301198 |
| 103 | Ga0182007_10003468 | 3300015262 | Bacteria | 7427 |
| 104 | Ga0182005_1000982 | 3300015265 | Bacteria | 12354 |
| 105 | Ga0183363_1071 | 3300015690 | Bacteria | 30324 |
| 106 | Ga0214544_1000110 | 3300021320 | Bacteria | 113143 |
| 107 | Ga0214542_1000268 | 3300021321 | Bacteria | 87082 |
| 108 | Ga0214543_1000022 | 3300021327 | Bacteria | 241930 |
| 109 | Ga0214543_1000219 | 3300021327 | Bacteria | 87102 |
| 110 | Ga0228711_1000911 | 3300022739 | Bacteria | 40698 |
| 111 | Ga0228710_1001018 | 3300022740 | Bacteria | 40304 |
| 112 | Ga0209435_100027 | 3300025206 | Bacteria | 196217 |
| 113 | Ga0209436_100081 | 3300025208 | Bacteria | 48215 |
| 114 | Ga0209436_101492 | 3300025208 | Bacteria | 8099 |
| 115 | Ga0209563_107790 | 3300025230 | Bacteria | 1734 |
| 116 | Ga0209437_100051 | 3300025233 | Bacteria | 392523 |
| 117 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 118 | Ga0207425_1000046 | 3300025245 | Bacteria | 189433 |
| 119 | Ga0207425_1004231 | 3300025245 | Bacteria | 4356 |
| 120 | Ga0209646_1000086 | 3300025246 | Bacteria | 196217 |
| 121 | Ga0209646_1004688 | 3300025246 | Bacteria | 2466 |
| 122 | Ga0209026_1000082 | 3300025250 | Bacteria | 196315 |
| 123 | Ga0209677_100540 | 3300025253 | Bacteria | 21044 |
| 124 | Ga0209148_1009625 | 3300025254 | Bacteria | 1870 |
| 125 | Ga0209759_1000063 | 3300025256 | Bacteria | 196315 |
| 126 | Ga0209129_1000171 | 3300025258 | Bacteria | 95724 |
| 127 | Ga0209129_1000283 | 3300025258 | Bacteria | 48305 |
| 128 | Ga0209129_1000450 | 3300025258 | Bacteria | 30620 |
| 129 | Ga0209129_1001443 | 3300025258 | Bacteria | 13284 |
| 130 | Ga0209129_1001916 | 3300025258 | Bacteria | 10956 |
| 131 | Ga0209129_1004411 | 3300025258 | Bacteria | 5500 |
| 132 | Ga0209129_1005600 | 3300025258 | Bacteria | 4373 |
| 133 | Ga0209233_1000095 | 3300025261 | Bacteria | 303783 |
| 134 | Ga0209233_1000190 | 3300025261 | Bacteria | 130713 |
| 135 | Ga0209233_1000228 | 3300025261 | Bacteria | 100100 |
| 136 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 137 | Ga0209673_1000025 | 3300025273 | Bacteria | 404572 |
| 138 | Ga0209673_1000112 | 3300025273 | Bacteria | 179676 |
| 139 | Ga0209673_1000637 | 3300025273 | Bacteria | 53013 |
| 140 | Ga0209673_1003653 | 3300025273 | Bacteria | 8892 |
| 141 | Ga0209673_1004043 | 3300025273 | Bacteria | 8113 |
| 142 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 143 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 144 | Ga0209130_1009106 | 3300025284 | Bacteria | 2862 |
| 145 | Ga0209676_1003467 | 3300025292 | Bacteria | 9684 |
| 146 | Ga0209676_1007006 | 3300025292 | Bacteria | 5415 |
| 147 | Ga0209676_1019600 | 3300025292 | Bacteria | 2324 |
| 148 | Ga0209025_1000091 | 3300025294 | Bacteria | 250401 |
| 149 | Ga0209025_1000137 | 3300025294 | Bacteria | 190136 |
| 150 | Ga0209025_1000154 | 3300025294 | Bacteria | 170288 |
| 151 | Ga0209025_1000161 | 3300025294 | Bacteria | 166506 |
| 152 | Ga0209025_1000545 | 3300025294 | Bacteria | 70608 |
| 153 | Ga0209025_1001424 | 3300025294 | Bacteria | 31618 |
| 154 | Ga0209025_1004971 | 3300025294 | Bacteria | 11123 |
| 155 | Ga0209025_1011337 | 3300025294 | Bacteria | 5889 |
| 156 | Ga0209025_1014587 | 3300025294 | Bacteria | 4815 |
| 157 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 158 | Ga0209564_1000564 | 3300025295 | Bacteria | 58801 |
| 159 | Ga0209564_1000672 | 3300025295 | Bacteria | 50497 |
| 160 | Ga0209564_1003798 | 3300025295 | Bacteria | 9803 |
| 161 | Ga0209564_1008415 | 3300025295 | Bacteria | 5092 |
| 162 | Ga0209758_1000058 | 3300025297 | Bacteria | 331603 |
| 163 | Ga0209758_1000123 | 3300025297 | Bacteria | 190136 |
| 164 | Ga0209758_1000725 | 3300025297 | Bacteria | 48331 |
| 165 | Ga0209758_1000863 | 3300025297 | Bacteria | 41967 |
| 166 | Ga0209758_1001901 | 3300025297 | Bacteria | 22797 |
| 167 | Ga0209758_1001960 | 3300025297 | Bacteria | 22253 |
| 168 | Ga0209758_1002718 | 3300025297 | Bacteria | 17421 |
| 169 | Ga0209758_1006925 | 3300025297 | Bacteria | 7909 |
| 170 | Ga0209758_1008591 | 3300025297 | Bacteria | 6570 |
| 171 | Ga0209050_1002725 | 3300025298 | Bacteria | 14282 |
| 172 | Ga0209050_1005641 | 3300025298 | Bacteria | 7757 |
| 173 | Ga0209256_1000153 | 3300025299 | Bacteria | 144736 |
| 174 | Ga0209256_1000914 | 3300025299 | Bacteria | 36121 |
| 175 | Ga0209256_1001132 | 3300025299 | Bacteria | 30392 |
| 176 | Ga0209256_1001499 | 3300025299 | Bacteria | 23682 |
| 177 | Ga0209256_1002031 | 3300025299 | Bacteria | 17999 |
| 178 | Ga0209256_1003097 | 3300025299 | Bacteria | 12188 |
| 179 | Ga0209256_1016662 | 3300025299 | Bacteria | 2489 |
| 180 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 181 | Ga0207426_1000008 | 3300025302 | Bacteria | 848730 |
| 182 | Ga0207426_1000228 | 3300025302 | Bacteria | 129261 |
| 183 | Ga0207426_1020140 | 3300025302 | Bacteria | 2321 |
| 184 | Ga0209051_1000462 | 3300025303 | Bacteria | 53349 |
| 185 | Ga0209051_1000785 | 3300025303 | Bacteria | 33541 |
| 186 | Ga0209051_1001635 | 3300025303 | Bacteria | 18178 |
| 187 | Ga0209051_1007538 | 3300025303 | Bacteria | 5929 |
| 188 | Ga0209051_1021723 | 3300025303 | Bacteria | 2721 |
| 189 | Ga0209051_1022515 | 3300025303 | Bacteria | 2650 |
| 190 | Ga0209051_1028422 | 3300025303 | Bacteria | 2208 |
| 191 | Ga0209257_1003221 | 3300025304 | Bacteria | 14390 |
| 192 | Ga0209257_1018875 | 3300025304 | Bacteria | 2627 |
| 193 | Ga0209257_1043660 | 3300025304 | Bacteria | 1313 |
| 194 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 195 | Ga0207671_10001228 | 3300025914 | Bacteria | 30331 |
| 196 | Ga0207650_10001248 | 3300025925 | Bacteria | 18474 |
| 197 | Ga0207709_10055844 | 3300025935 | Bacteria | 2442 |
| 198 | Ga0207678_10025462 | 3300026067 | Bacteria | 5164 |
| 199 | Ga0207702_10175275 | 3300026078 | Bacteria | 1970 |
| 200 | Ga0207698_10047528 | 3300026142 | Bacteria | 3252 |
| 201 | Ga0209281_1000034 | 3300027111 | Bacteria | 382562 |
| 202 | Ga0209281_1000314 | 3300027111 | Bacteria | 86424 |
| 203 | Ga0209281_1001051 | 3300027111 | Bacteria | 20858 |
| 204 | Ga0209371_1000022 | 3300027312 | Bacteria | 536342 |
| 205 | Ga0209371_1000341 | 3300027312 | Bacteria | 50975 |
| 206 | Ga0209282_1000068 | 3300027666 | Bacteria | 85817 |
| 207 | Ga0209282_1002798 | 3300027666 | Bacteria | 10209 |
| 208 | Ga0268266_10005469 | 3300028379 | Bacteria | 11831 |
| 209 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 210 | Ga0307515_10006213 | 3300028794 | Bacteria | 23994 |
| 211 | Ga0307515_10019245 | 3300028794 | Bacteria | 12305 |
| 212 | Ga0307515_10029550 | 3300028794 | Bacteria | 9255 |
| 213 | Ga0268256_1000019 | 3300030500 | Bacteria | 587949 |
| 214 | Ga0268256_1001403 | 3300030500 | Bacteria | 14620 |
| 215 | Ga0307513_10001095 | 3300031456 | Bacteria | 39184 |
| 216 | Ga0307513_10009210 | 3300031456 | Bacteria | 12501 |
| 217 | Ga0307405_10003197 | 3300031731 | Bacteria | 7461 |
| 218 | Ga0307405_10106434 | 3300031731 | Bacteria | 1892 |
| 219 | Ga0307412_10004052 | 3300031911 | Bacteria | 8165 |
| 220 | Ga0315914_1000937 | 3300031967 | Bacteria | 41175 |
| 221 | Ga0307409_100120972 | 3300031995 | Bacteria | 2217 |
| 222 | Ga0307416_100101011 | 3300032002 | Bacteria | 2511 |
| 223 | Ga0307414_10185448 | 3300032004 | Bacteria | 1678 |
| 224 | Ga0315913_1000094 | 3300033430 | Bacteria | 51134 |
| 225 | Ga0315915_1000007 | 3300033464 | Bacteria | 319225 |
| 226 | Ga0439436_0023412 | 3300041404 | Bacteria | 1827 |
| 227 | Ga0439465_0035999 | 3300041413 | Bacteria | 1588 |
| 228 | Ga0451841_0039604 | 3300041498 | Bacteria | 6606 |
| 229 | Ga0451845_0606012 | 3300041501 | Bacteria | 2310 |
| 230 | Ga0451847_0140826 | 3300041503 | Bacteria | 1838 |
| 231 | Ga0451849_0223659 | 3300041505 | Bacteria | 2628 |
| 232 | Ga0451843_0363805 | 3300041509 | Bacteria | 1174 |
| 233 | Ga0451855_1540700 | 3300041511 | Bacteria | 3436 |
| 234 | Ga0439449_0073186 | 3300042007 | Bacteria | 1263 |
| 235 | Ga0466966_0028464 | 3300044684 | Bacteria | 3640 |
| 236 | Ga0466970_0000872 | 3300044765 | Bacteria | 14575 |
| 237 | Ga0495638_0000953 | 3300046460 | Bacteria | 29358 |
| 238 | Ga0495605_0001474 | 3300046474 | Bacteria | 15363 |
| 239 | Ga0495605_0051054 | 3300046474 | Bacteria | 2015 |
| 240 | Ga0495662_0003309 | 3300046476 | Bacteria | 8162 |
| 241 | Ga0495585_0011346 | 3300046492 | Bacteria | 5275 |
| 242 | Ga0495585_0028890 | 3300046492 | Bacteria | 3160 |
| 243 | Ga0495607_0029710 | 3300046501 | Bacteria | 3362 |
| 244 | Ga0495607_0064680 | 3300046501 | Bacteria | 2065 |
| 245 | Ga0495607_0094773 | 3300046501 | Bacteria | 1610 |
| 246 | Ga0495583_0003748 | 3300046506 | Bacteria | 11302 |
| 247 | Ga0495583_0012759 | 3300046506 | Bacteria | 4732 |
| 248 | Ga0495606_0002168 | 3300046507 | Bacteria | 23621 |
| 249 | Ga0495606_0007555 | 3300046507 | Bacteria | 9692 |
| 250 | Ga0495610_0003874 | 3300046512 | Bacteria | 11364 |
| 251 | Ga0495610_0056086 | 3300046512 | Bacteria | 1896 |
| 252 | Ga0495616_0014083 | 3300046513 | Bacteria | 4490 |
| 253 | Ga0495620_0008486 | 3300046515 | Bacteria | 5512 |
| 254 | Ga0495631_0006631 | 3300046518 | Bacteria | 5953 |
| 255 | Ga0495631_0035148 | 3300046518 | Bacteria | 2243 |
| 256 | Ga0495632_0004091 | 3300046519 | Bacteria | 10059 |
| 257 | Ga0495632_0013526 | 3300046519 | Bacteria | 4654 |
| 258 | Ga0495632_0041967 | 3300046519 | Bacteria | 2295 |
| 259 | Ga0495643_0010861 | 3300046522 | Bacteria | 5580 |
| 260 | Ga0495643_0022449 | 3300046522 | Bacteria | 3601 |
| 261 | Ga0495643_0031031 | 3300046522 | Bacteria | 2978 |
| 262 | Ga0495648_0010074 | 3300046524 | Bacteria | 7243 |
| 263 | Ga0495640_0090534 | 3300046533 | Bacteria | 2019 |
| 264 | Ga0495609_0026484 | 3300046538 | Bacteria | 2655 |
| 265 | Ga0495622_0032920 | 3300046557 | Bacteria | 2420 |
| 266 | Ga0495633_0053247 | 3300046558 | Bacteria | 1905 |
| 267 | Ga0495656_0008409 | 3300046615 | Bacteria | 3682 |
| 268 | Ga0495668_0003159 | 3300046616 | Bacteria | 12699 |
| 269 | Ga0495668_0046522 | 3300046616 | Bacteria | 2410 |
| 270 | Ga0495668_0131734 | 3300046616 | Bacteria | 1368 |
| 271 | Ga0495625_0005331 | 3300046660 | Bacteria | 11778 |
| 272 | Ga0495625_0018174 | 3300046660 | Bacteria | 5494 |
| 273 | Ga0495625_0067546 | 3300046660 | Bacteria | 2516 |
| 274 | Ga0495625_0082862 | 3300046660 | Bacteria | 2230 |
| 275 | Ga0495625_0198764 | 3300046660 | Bacteria | 1324 |
| 276 | Ga0495661_0038286 | 3300046665 | Bacteria | 2989 |
| 277 | Ga0495588_0006717 | 3300046674 | Bacteria | 5198 |
| 278 | Ga0495670_0003394 | 3300046691 | Bacteria | 7829 |
| 279 | Ga0495671_0048089 | 3300046692 | Bacteria | 2129 |
| 280 | Ga0495649_0020903 | 3300046694 | Bacteria | 3668 |
| 281 | Ga0495660_0049890 | 3300046810 | Bacteria | 2282 |
| 282 | Ga0495604_0031909 | 3300047317 | Bacteria | 4176 |
| 283 | Ga0495672_0003408 | 3300047320 | Bacteria | 13639 |
| 284 | Ga0495687_026142 | 3300047443 | Bacteria | 2752 |
| 285 | Ga0495681_0010603 | 3300047470 | Bacteria | 5569 |
| 286 | Ga0495681_0024138 | 3300047470 | Bacteria | 3213 |
| 287 | Ga0495686_0004112 | 3300047472 | Bacteria | 12114 |
| 288 | Ga0495686_0011015 | 3300047472 | Bacteria | 6396 |
| 289 | Ga0495686_0024888 | 3300047472 | Bacteria | 3928 |
| 290 | Ga0495686_0055394 | 3300047472 | Bacteria | 2480 |
| 291 | Ga0495686_0090345 | 3300047472 | Bacteria | 1860 |
| 292 | Ga0496100_0027162 | 3300048903 | Bacteria | 3517 |
| 293 | Ga0496102_0004330 | 3300048905 | Bacteria | 12011 |
| 294 | Ga0496102_0218466 | 3300048905 | Bacteria | 1796 |
| 295 | Ga0496103_0005296 | 3300048906 | Bacteria | 7740 |
| 296 | Ga0496104_0015245 | 3300048907 | Bacteria | 6959 |
| 297 | Ga0496104_0025629 | 3300048907 | Bacteria | 5438 |
| 298 | Ga0496105_0117401 | 3300048908 | Bacteria | 2194 |
| 299 | Ga0496106_0001496 | 3300048909 | Bacteria | 17571 |
| 300 | Ga0496106_0069311 | 3300048909 | Bacteria | 2692 |
| 301 | Ga0496106_0118267 | 3300048909 | Bacteria | 2069 |
| 302 | Ga0496108_0245925 | 3300048911 | Bacteria | 1556 |
| 303 | Ga0496110_0128688 | 3300048913 | Bacteria | 2285 |
| 304 | Ga0496110_0138956 | 3300048913 | Bacteria | 2196 |
| 305 | Ga0496111_0000579 | 3300048914 | Bacteria | 19155 |
| 306 | Ga0496113_0093756 | 3300048916 | Bacteria | 2318 |
| 307 | Ga0496114_0443684 | 3300048917 | Bacteria | 1149 |
| 308 | Ga0496116_0000105 | 3300048919 | Bacteria | 192704 |
| 309 | Ga0496116_0010698 | 3300048919 | Bacteria | 7660 |
| 310 | Ga0496116_0015579 | 3300048919 | Bacteria | 6003 |
| 311 | Ga0496116_0040939 | 3300048919 | Bacteria | 3184 |
| 312 | Ga0496116_0069515 | 3300048919 | Bacteria | 2238 |
| 313 | Ga0496116_0073970 | 3300048919 | Bacteria | 2145 |
| 314 | Ga0496116_0117087 | 3300048919 | Bacteria | 1551 |
| 315 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 316 | Ga0496117_0002241 | 3300048920 | Bacteria | 24957 |
| 317 | Ga0496117_0003292 | 3300048920 | Bacteria | 18915 |
| 318 | Ga0496117_0016281 | 3300048920 | Bacteria | 6282 |
| 319 | Ga0496117_0065176 | 3300048920 | Bacteria | 2478 |
| 320 | Ga0496117_0104330 | 3300048920 | Bacteria | 1784 |
| 321 | Ga0496117_0171916 | 3300048920 | Bacteria | 1256 |
| 322 | Ga0496118_0001193 | 3300048921 | Bacteria | 40048 |
| 323 | Ga0496118_0001388 | 3300048921 | Bacteria | 36504 |
| 324 | Ga0496118_0004636 | 3300048921 | Bacteria | 16127 |
| 325 | Ga0496118_0015283 | 3300048921 | Bacteria | 7118 |
| 326 | Ga0496118_0018167 | 3300048921 | Bacteria | 6354 |
| 327 | Ga0496118_0019763 | 3300048921 | Bacteria | 6006 |
| 328 | Ga0496118_0028169 | 3300048921 | Bacteria | 4739 |
| 329 | Ga0496118_0116059 | 3300048921 | Bacteria | 1761 |
| 330 | Ga0496119_0012822 | 3300048922 | Bacteria | 6761 |
| 331 | Ga0496119_0012920 | 3300048922 | Bacteria | 6720 |
| 332 | Ga0496119_0022399 | 3300048922 | Bacteria | 4524 |
| 333 | Ga0496119_0044519 | 3300048922 | Bacteria | 2793 |
| 334 | Ga0496119_0047169 | 3300048922 | Bacteria | 2682 |
| 335 | Ga0496119_0120819 | 3300048922 | Bacteria | 1440 |
| 336 | Ga0496120_0000309 | 3300048923 | Bacteria | 81375 |
| 337 | Ga0496120_0049279 | 3300048923 | Bacteria | 2418 |
| 338 | Ga0496120_0051471 | 3300048923 | Bacteria | 2351 |
| 339 | Ga0496120_0076250 | 3300048923 | Bacteria | 1828 |
| 340 | Ga0496120_0077461 | 3300048923 | Bacteria | 1809 |
| 341 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 342 | Ga0496121_0001287 | 3300048924 | Bacteria | 43216 |
| 343 | Ga0496121_0002836 | 3300048924 | Bacteria | 25580 |
| 344 | Ga0496121_0009257 | 3300048924 | Bacteria | 11372 |
| 345 | Ga0496121_0014795 | 3300048924 | Bacteria | 8242 |
| 346 | Ga0496121_0022524 | 3300048924 | Bacteria | 6108 |
| 347 | Ga0496121_0028932 | 3300048924 | Bacteria | 5143 |
| 348 | Ga0496121_0037292 | 3300048924 | Bacteria | 4320 |
| 349 | Ga0496121_0043048 | 3300048924 | Bacteria | 3916 |
| 350 | Ga0496121_0044847 | 3300048924 | Bacteria | 3807 |
| 351 | Ga0496121_0051874 | 3300048924 | Bacteria | 3451 |
| 352 | Ga0496121_0055438 | 3300048924 | Bacteria | 3302 |
| 353 | Ga0496121_0191893 | 3300048924 | Bacteria | 1464 |
| 354 | Ga0496121_0234592 | 3300048924 | Bacteria | 1283 |
| 355 | Ga0496122_0000004 | 3300048925 | Bacteria | 645283 |
| 356 | Ga0496122_0000414 | 3300048925 | Bacteria | 90664 |
| 357 | Ga0496122_0000462 | 3300048925 | Bacteria | 84546 |
| 358 | Ga0496122_0015193 | 3300048925 | Bacteria | 7376 |
| 359 | Ga0496122_0015640 | 3300048925 | Bacteria | 7237 |
| 360 | Ga0496122_0016318 | 3300048925 | Bacteria | 7039 |
| 361 | Ga0496122_0029531 | 3300048925 | Bacteria | 4622 |
| 362 | Ga0496122_0038867 | 3300048925 | Bacteria | 3803 |
| 363 | Ga0496122_0050047 | 3300048925 | Bacteria | 3190 |
| 364 | Ga0496122_0052128 | 3300048925 | Bacteria | 3101 |
| 365 | Ga0496122_0061915 | 3300048925 | Bacteria | 2742 |
| 366 | Ga0496122_0169991 | 3300048925 | Bacteria | 1315 |
| 367 | Ga0496123_0000007 | 3300048926 | Bacteria | 645283 |
| 368 | Ga0496123_0000048 | 3300048926 | Bacteria | 244152 |
| 369 | Ga0496123_0000147 | 3300048926 | Bacteria | 143834 |
| 370 | Ga0496123_0004704 | 3300048926 | Bacteria | 14130 |
| 371 | Ga0496123_0009287 | 3300048926 | Bacteria | 8877 |
| 372 | Ga0496123_0012460 | 3300048926 | Bacteria | 7247 |
| 373 | Ga0496123_0028162 | 3300048926 | Bacteria | 4166 |
| 374 | Ga0496123_0028649 | 3300048926 | Bacteria | 4117 |
| 375 | Ga0496123_0054736 | 3300048926 | Bacteria | 2624 |
| 376 | Ga0496123_0061061 | 3300048926 | Bacteria | 2425 |
| 377 | Ga0496123_0116613 | 3300048926 | Bacteria | 1512 |
| 378 | Ga0496124_0000067 | 3300048927 | Bacteria | 222576 |
| 379 | Ga0496124_0000348 | 3300048927 | Bacteria | 84728 |
| 380 | Ga0496124_0006920 | 3300048927 | Bacteria | 12188 |
| 381 | Ga0496124_0013437 | 3300048927 | Bacteria | 7990 |
| 382 | Ga0496124_0016988 | 3300048927 | Bacteria | 6887 |
| 383 | Ga0496124_0024351 | 3300048927 | Bacteria | 5506 |
| 384 | Ga0496124_0033989 | 3300048927 | Bacteria | 4480 |
| 385 | Ga0496124_0040694 | 3300048927 | Bacteria | 4018 |
| 386 | Ga0496124_0042986 | 3300048927 | Bacteria | 3887 |
| 387 | Ga0496124_0053449 | 3300048927 | Bacteria | 3423 |
| 388 | Ga0496124_0139661 | 3300048927 | Bacteria | 1913 |
| 389 | Ga0496124_0158035 | 3300048927 | Bacteria | 1770 |
| 390 | Ga0496124_0190127 | 3300048927 | Bacteria | 1572 |
| 391 | Ga0496125_0001144 | 3300048928 | Bacteria | 40287 |
| 392 | Ga0496125_0001465 | 3300048928 | Bacteria | 34178 |
| 393 | Ga0496125_0004586 | 3300048928 | Bacteria | 15799 |
| 394 | Ga0496125_0008427 | 3300048928 | Bacteria | 10794 |
| 395 | Ga0496125_0014864 | 3300048928 | Bacteria | 7559 |
| 396 | Ga0496125_0015081 | 3300048928 | Bacteria | 7500 |
| 397 | Ga0496125_0031593 | 3300048928 | Bacteria | 4716 |
| 398 | Ga0496125_0086451 | 3300048928 | Bacteria | 2371 |
| 399 | Ga0496125_0167019 | 3300048928 | Bacteria | 1485 |
| 400 | Ga0496125_0183520 | 3300048928 | Bacteria | 1390 |
| 401 | Ga0496126_0000188 | 3300048929 | Bacteria | 139625 |
| 402 | Ga0496126_0000879 | 3300048929 | Bacteria | 52860 |
| 403 | Ga0496126_0012445 | 3300048929 | Bacteria | 8714 |
| 404 | Ga0496126_0017664 | 3300048929 | Bacteria | 7106 |
| 405 | Ga0496126_0026521 | 3300048929 | Bacteria | 5555 |
| 406 | Ga0496126_0067348 | 3300048929 | Bacteria | 3199 |
| 407 | Ga0496126_0202470 | 3300048929 | Bacteria | 1675 |
| 408 | Ga0496126_0240564 | 3300048929 | Bacteria | 1512 |
| 409 | Ga0495678_008240 | 3300049459 | Bacteria | 5284 |
| 410 | Ga0501032_0024801 | 3300049569 | Bacteria | 4137 |
| 411 | Ga0501033_0002870 | 3300049570 | Bacteria | 14437 |
| 412 | Ga0501033_0074199 | 3300049570 | Bacteria | 2497 |
| 413 | Ga0501033_0128979 | 3300049570 | Bacteria | 1833 |
| 414 | Ga0501034_0056607 | 3300049571 | Bacteria | 3944 |
| 415 | Ga0501036_0057659 | 3300049572 | Bacteria | 3290 |
| 416 | Ga0501038_0074345 | 3300049574 | Bacteria | 2875 |
| 417 | Ga0501039_0040948 | 3300049575 | Bacteria | 3577 |
| 418 | Ga0501046_0071572 | 3300049580 | Bacteria | 2694 |
| 419 | Ga0501080_0092649 | 3300049742 | Bacteria | 2806 |
| 420 | Ga0501083_0028656 | 3300049744 | Bacteria | 3837 |
| 421 | Ga0501035_0006588 | 3300049822 | Bacteria | 10874 |
| 422 | Ga0501044_0068200 | 3300049823 | Bacteria | 3623 |
| 423 | nmdc:mga03683_8605_c1 | 3300050489 | Bacteria | 3594 |
| 424 | nmdc:mga03n38_14153_c1 | 3300050490 | Bacteria | 3051 |
| 425 | nmdc:mga00v17_144_c1 | 3300050491 | Bacteria | 41064 |
| 426 | nmdc:mga00v17_7_c1 | 3300050491 | Bacteria | 167228 |
| 427 | nmdc:mga0yw44_3218_c1 | 3300050492 | Bacteria | 7189 |
| 428 | nmdc:mga0k408_22786_c1 | 3300050493 | Bacteria | 3529 |
| 429 | nmdc:mga07m45_435_c1 | 3300050496 | Bacteria | 17361 |
| 430 | nmdc:mga0sz30_27411_c1 | 3300050516 | Bacteria | 2340 |
| 431 | Ga0500610_0002704 | 3300053079 | Bacteria | 6610 |
| 432 | Ga0500578_0085440 | 3300053086 | Bacteria | 2004 |
| 433 | Ga0500583_0095092 | 3300053092 | Bacteria | 1454 |
| 434 | Ga0500560_004635 | 3300053107 | Bacteria | 2948 |
| 435 | Ga0500594_0000568 | 3300053118 | Bacteria | 7964 |
| 436 | Ga0500608_060642 | 3300053122 | Bacteria | 1809 |
| 437 | Ga0500618_000056 | 3300053125 | Bacteria | 98509 |
| 438 | Ga0500618_000304 | 3300053125 | Bacteria | 36803 |
| 439 | Ga0500658_0005794 | 3300053134 | Bacteria | 4602 |
| 440 | Ga0500658_0007104 | 3300053134 | Bacteria | 4140 |
| 441 | Ga0500659_0044803 | 3300053135 | Bacteria | 2396 |
| 442 | Ga0500561_0000236 | 3300053137 | Bacteria | 9886 |
| 443 | Ga0500568_0001459 | 3300053139 | Bacteria | 15147 |
| 444 | Ga0500568_0009854 | 3300053139 | Bacteria | 4514 |
| 445 | Ga0500568_0028393 | 3300053139 | Bacteria | 2333 |
| 446 | Ga0500573_0001176 | 3300053140 | Bacteria | 12218 |
| 447 | Ga0500573_0004052 | 3300053140 | Bacteria | 7663 |
| 448 | Ga0500604_0010108 | 3300053151 | Bacteria | 2521 |
| 449 | Ga0500616_0000363 | 3300053153 | Bacteria | 64277 |
| 450 | Ga0500616_0005056 | 3300053153 | Bacteria | 9116 |
| 451 | Ga0500622_0001665 | 3300053156 | Bacteria | 17370 |
| 452 | Ga0500624_001429 | 3300053157 | Bacteria | 3893 |
| 453 | Ga0500627_0019208 | 3300053158 | Bacteria | 2719 |
| 454 | Ga0500627_0036887 | 3300053158 | Bacteria | 2084 |
| 455 | Ga0500633_0004554 | 3300053160 | Bacteria | 3196 |
| 456 | Ga0500634_0027598 | 3300053161 | Bacteria | 3093 |
| 457 | Ga0500636_0000003 | 3300053177 | Bacteria | 240189 |
| 458 | Ga0500636_0001041 | 3300053177 | Bacteria | 14876 |
| 459 | Ga0500636_0138528 | 3300053177 | Bacteria | 1349 |
| 460 | Ga0501082_0076077 | 3300060353 | Bacteria | 2893 |
| 461 | Ga0466962_0044526 | 3300061719 | Bacteria | 2123 |
| 462 | 2509108107 | 2508501122 | Bacteria | 6292184 |
| 463 | 2509376717 | 2509276019 | Bacteria | 6802256 |
| 464 | 2509391731 | 2509276021 | Bacteria | 7634384 |
| 465 | 2509447408 | 2509276033 | Bacteria | 7180565 |
| 466 | 2510134245 | 2510065019 | Bacteria | 6903379 |
| 467 | 2510302711 | 2510065057 | Bacteria | 6649661 |
| 468 | 2510840606 | 2510461069 | Bacteria | 5505000 |
| 469 | 2510895681 | 2510461076 | Bacteria | 8618824 |
| 470 | 2511134088 | 2510917022 | Bacteria | 6504556 |
| 471 | 2511182413 | 2510917028 | Bacteria | 6185411 |
| 472 | 2511199324 | 2510917030 | Bacteria | 7460662 |
| 473 | 2511497762 | 2511231052 | Bacteria | 6974333 |
| 474 | 2512528795 | 2512047086 | Bacteria | 6850303 |
| 475 | 2512969581 | 2512875026 | Bacteria | 6861065 |
| 476 | 2513567678 | 2513237084 | Bacteria | 7231967 |
| 477 | 2513577960 | 2513237085 | Bacteria | 7695351 |
| 478 | 2513584580 | 2513237086 | Bacteria | 7265287 |
| 479 | 2513597606 | 2513237088 | Bacteria | 6927906 |
| 480 | 2513606195 | 2513237089 | Bacteria | 6553624 |
| 481 | 2513616406 | 2513237091 | Bacteria | 6900273 |
| 482 | 2513631887 | 2513237093 | Bacteria | 7545552 |
| 483 | 2513707915 | 2513237103 | Bacteria | 7647401 |
| 484 | 2513870169 | 2513237138 | Bacteria | 7368160 |
| 485 | 2513883873 | 2513237140 | Bacteria | 7076289 |
| 486 | 2513902022 | 2513237143 | Bacteria | 6664116 |
| 487 | 2513908472 | 2513237144 | Bacteria | 7530820 |
| 488 | 2513928164 | 2513237146 | Bacteria | 7166346 |
| 489 | 2513985096 | 2513237156 | Bacteria | 6402557 |
| 490 | 2513997626 | 2513237159 | Bacteria | 6810126 |
| 491 | 2514007910 | 2513237160 | Bacteria | 6650282 |
| 492 | 2514018008 | 2513237162 | Bacteria | 7468464 |
| 493 | 2515113407 | 2515075009 | Bacteria | 7288508 |
| 494 | 2515612027 | 2515154107 | Bacteria | 6795637 |
| 495 | 2515635129 | 2515154113 | Bacteria | 7807172 |
| 496 | 2515645571 | 2515154114 | Bacteria | 7848616 |
| 497 | 2515655048 | 2515154116 | Bacteria | 7552979 |
| 498 | 2515739778 | 2515154134 | Bacteria | 7220242 |
| 499 | 2516206148 | 2516143018 | Bacteria | 6951533 |
| 500 | 2516896587 | 2516653046 | Bacteria | 6989037 |
| 501 | 2517037010 | 2516653077 | Bacteria | 7555578 |
| 502 | 2517077374 | 2516653085 | Bacteria | 7346596 |
| 503 | 2517096133 | 2517093000 | Bacteria | 7412387 |
| 504 | 2517407754 | 2517287029 | Bacteria | 6905599 |
| 505 | 2517565541 | 2517487022 | Bacteria | 7227575 |
| 506 | 2520380348 | 2519899620 | Bacteria | 6499161 |
| 507 | 2524452085 | 2524023207 | Bacteria | 6813453 |
| 508 | 2524458918 | 2524023209 | Bacteria | 6679728 |
| 509 | 2530646504 | 2529292951 | Bacteria | 6916614 |
| 510 | 2535517165 | 2534681796 | Bacteria | 7146037 |
| 511 | 2537877205 | 2537561587 | Bacteria | 5425293 |
| 512 | 2551681444 | 2551306084 | Bacteria | 8942552 |
| 513 | 2551684681 | 2551306085 | Bacteria | 7347181 |
| 514 | 2551697929 | 2551306087 | Bacteria | 7351905 |
| 515 | 2551729139 | 2551306091 | Bacteria | 7086830 |
| 516 | 2551737650 | 2551306092 | Bacteria | 6992595 |
| 517 | 2554248449 | 2554235003 | Bacteria | 5877155 |
| 518 | 2558863918 | 2558860100 | Bacteria | 8458965 |
| 519 | 2559295565 | 2558860242 | Bacteria | 5568029 |
| 520 | 2561469501 | 2558860983 | Bacteria | 4133860 |
| 521 | 2585167501 | 2582581283 | Bacteria | 6030556 |
| 522 | 2585201940 | 2582581294 | Bacteria | 6626667 |
| 523 | 2585225339 | 2582581298 | Bacteria | 7315509 |
| 524 | 2585228583 | 2582581299 | Bacteria | 6518058 |
| 525 | 2585258203 | 2582581304 | Bacteria | 5831370 |
| 526 | 2585265728 | 2582581306 | Bacteria | 6450535 |
| 527 | 2585271407 | 2582581307 | Bacteria | 6597605 |
| 528 | 2585279345 | 2582581308 | Bacteria | 7413247 |
| 529 | 2585323050 | 2582581315 | Bacteria | 7318924 |
| 530 | 2585331162 | 2582581316 | Bacteria | 7774528 |
| 531 | 2585388934 | 2582581865 | Bacteria | 6644329 |
| 532 | 2585395373 | 2582581866 | Bacteria | 6859583 |
| 533 | 2585401022 | 2582581867 | Bacteria | 7184437 |
| 534 | 2585524802 | 2585427526 | Bacteria | 7258840 |
| 535 | 2585531170 | 2585427527 | Bacteria | 7273426 |
| 536 | 2585538483 | 2585427528 | Bacteria | 6842387 |
| 537 | 2585547895 | 2585427529 | Bacteria | 7395659 |
| 538 | 2585552906 | 2585427530 | Bacteria | 7383882 |
| 539 | 2585559150 | 2585427531 | Bacteria | 6992870 |
| 540 | 2585822077 | 2585427590 | Bacteria | 6824633 |
| 541 | 2585836436 | 2585427593 | Bacteria | 7141551 |
| 542 | 2585843544 | 2585427594 | Bacteria | 6180594 |
| 543 | 2585898533 | 2585427608 | Bacteria | 6544331 |
| 544 | 2585903904 | 2585427609 | Bacteria | 6667127 |
| 545 | 2585996768 | 2585427633 | Bacteria | 6413184 |
| 546 | 2586001353 | 2585427634 | Bacteria | 6455027 |
| 547 | 2587980978 | 2585428125 | Bacteria | 6662905 |
| 548 | 2599332046 | 2599185156 | Bacteria | 5403036 |
| 549 | 2599416946 | 2599185170 | Bacteria | 7295545 |
| 550 | 2599601888 | 2599185210 | Bacteria | 5624189 |
| 551 | 2599721720 | 2599185236 | Bacteria | 6875203 |
| 552 | 2600194891 | 2599185352 | Bacteria | 7228948 |
| 553 | 2600374039 | 2600254933 | Bacteria | 4750527 |
| 554 | 2601609858 | 2600255279 | Bacteria | 5605316 |
| 555 | 2601746633 | 2600255308 | Bacteria | 5611129 |
| 556 | 2616293072 | 2615840624 | Bacteria | 6557588 |
| 557 | 2616311088 | 2615840626 | Bacteria | 7921970 |
| 558 | 2616554525 | 2615840698 | Bacteria | 7319877 |
| 559 | 2617385408 | 2617270742 | Bacteria | 6808054 |
| 560 | 2643804151 | 2643221557 | Bacteria | 7184309 |
| 561 | 2643811262 | 2643221558 | Bacteria | 5460675 |
| 562 | 2643856527 | 2643221568 | Bacteria | 5187270 |
| 563 | 2643920117 | 2643221582 | Bacteria | 5804683 |
| 564 | 2644006976 | 2643221599 | Bacteria | 6292121 |
| 565 | 2644050177 | 2643221607 | Bacteria | 6314006 |
| 566 | 2644065073 | 2643221610 | Bacteria | 7480339 |
| 567 | 2644105215 | 2643221618 | Bacteria | 7717186 |
| 568 | 2644145709 | 2643221626 | Bacteria | 8069654 |
| 569 | 2644191757 | 2643221634 | Bacteria | 6705461 |
| 570 | 2644204762 | 2643221636 | Bacteria | 6583769 |
| 571 | 2644208747 | 2643221637 | Bacteria | 5345260 |
| 572 | 2644242616 | 2643221643 | Bacteria | 5749658 |
| 573 | 2644298972 | 2643221653 | Bacteria | 4569637 |
| 574 | 2644309628 | 2643221655 | Bacteria | 7722067 |
| 575 | 2644331204 | 2643221659 | Bacteria | 7890716 |
| 576 | 2644376516 | 2643221668 | Bacteria | 7306521 |
| 577 | 2644416746 | 2643221675 | Bacteria | 7473456 |
| 578 | 2644449786 | 2643221680 | Bacteria | 7473610 |
| 579 | 2644483097 | 2643221686 | Bacteria | 6310811 |
| 580 | 2644494266 | 2643221688 | Bacteria | 5260751 |
| 581 | 2644497744 | 2643221689 | Bacteria | 6042950 |
| 582 | 2644521740 | 2643221693 | Bacteria | 5513853 |
| 583 | 2644543357 | 2643221698 | Bacteria | 7756764 |
| 584 | 2644616152 | 2643221712 | Bacteria | 7729434 |
| 585 | 2644652277 | 2643221718 | Bacteria | 5345506 |
| 586 | 2644657200 | 2643221719 | Bacteria | 4568197 |
| 587 | 2644675778 | 2643221723 | Bacteria | 7095460 |
| 588 | 2644689918 | 2643221726 | Bacteria | 7455827 |
| 589 | 2657681768 | 2657244999 | Bacteria | 5946535 |
| 590 | 2671111157 | 2667528174 | Bacteria | 6435400 |
| 591 | 2692315244 | 2690316117 | Bacteria | 6800650 |
| 592 | 2719182080 | 2718217882 | Bacteria | 6556348 |
| 593 | 2719386697 | 2718217927 | Bacteria | 6972593 |
| 594 | 2719666450 | 2718217997 | Bacteria | 6740740 |
| 595 | 2719732796 | 2718218009 | Bacteria | 6478651 |
| 596 | 2720492870 | 2718218199 | Bacteria | 6740745 |
| 597 | 2720614331 | 2718218232 | Bacteria | 6720332 |
| 598 | 2720621103 | 2718218233 | Bacteria | 6662049 |
| 599 | 2720632429 | 2718218235 | Bacteria | 6630699 |
| 600 | 2720776154 | 2718218269 | Bacteria | 6906114 |
| 601 | 2721148171 | 2718218363 | Bacteria | 6524337 |
| 602 | 2721159624 | 2718218365 | Bacteria | 6274507 |
| 603 | 2721165007 | 2718218366 | Bacteria | 6425255 |
| 604 | 2721400403 | 2718218423 | Bacteria | 6438183 |
| 605 | 2722841177 | 2721755514 | Bacteria | 6424414 |
| 606 | 2723027751 | 2721755556 | Bacteria | 6745503 |
| 607 | 2723561381 | 2721755684 | Bacteria | 6859907 |
| 608 | 2723568004 | 2721755685 | Bacteria | 6704835 |
| 609 | 2724039216 | 2721755809 | Bacteria | 6438790 |
| 610 | 2724045552 | 2721755810 | Bacteria | 6479005 |
| 611 | 2724090761 | 2721755819 | Bacteria | 6906405 |
| 612 | 2724105269 | 2721755822 | Bacteria | 6726041 |
| 613 | 2724111096 | 2721755823 | Bacteria | 6752556 |
| 614 | 2725950356 | 2724679232 | Bacteria | 7646494 |
| 615 | 2730108687 | 2728369352 | Bacteria | 6745171 |
| 616 | 2730165315 | 2728369365 | Bacteria | 6555560 |
| 617 | 2730299256 | 2728369397 | Bacteria | 6274511 |
| 618 | 2738804975 | 2738541293 | Bacteria | 7065685 |
| 619 | 2739033125 | 2738541333 | Bacteria | 7106503 |
| 620 | 2753462397 | 2751185821 | Bacteria | 6189929 |
| 621 | 2766066169 | 2765235942 | Bacteria | 7445910 |
| 622 | 2776914258 | 2775507049 | Bacteria | 6284736 |
| 623 | 2778175707 | 2775507266 | Bacteria | 7392367 |
| 624 | 2792581482 | 2791355082 | Bacteria | 5973319 |
| 625 | 2792620543 | 2791355091 | Bacteria | 6135441 |
| 626 | 2792625901 | 2791355092 | Bacteria | 6248105 |
| 627 | 2792638841 | 2791355094 | Bacteria | 7011481 |
| 628 | 2793280068 | 2791355253 | Bacteria | 5171699 |
| 629 | 2793294144 | 2791355256 | Bacteria | 6798008 |
| 630 | 2793318143 | 2791355259 | Bacteria | 7254731 |
| 631 | 2793319464 | 2791355260 | Bacteria | 6598818 |
| 632 | 2793328909 | 2791355261 | Bacteria | 6661293 |
| 633 | 2793334902 | 2791355262 | Bacteria | 6774204 |
| 634 | 2793339562 | 2791355263 | Bacteria | 6872478 |
| 635 | 2793346967 | 2791355264 | Bacteria | 6429314 |
| 636 | 2793351551 | 2791355265 | Bacteria | 6539969 |
| 637 | 2793362482 | 2791355266 | Bacteria | 7116587 |
| 638 | 2793367605 | 2791355267 | Bacteria | 7222458 |
| 639 | 2802716011 | 2802428858 | Bacteria | 6636079 |
| 640 | 2802722965 | 2802428859 | Bacteria | 6667919 |
| 641 | 2802728903 | 2802428860 | Bacteria | 6525526 |
| 642 | 2802735269 | 2802428861 | Bacteria | 6534206 |
| 643 | 2802742127 | 2802428862 | Bacteria | 6633353 |
| 644 | 2802748574 | 2802428863 | Bacteria | 6410669 |
| 645 | 2804752953 | 2802429268 | Bacteria | 6094027 |
| 646 | 2805926783 | 2802429605 | Bacteria | 6875453 |
| 647 | 2805932695 | 2802429606 | Bacteria | 6346811 |
| 648 | 2806045264 | 2802429633 | Bacteria | 7341974 |
| 649 | 2806049941 | 2802429634 | Bacteria | 7083200 |
| 650 | 2806056779 | 2802429635 | Bacteria | 7650140 |
| 651 | 2806064161 | 2802429636 | Bacteria | 7597525 |
| 652 | 2806071429 | 2802429637 | Bacteria | 7067217 |
| 653 | 2808987702 | 2808606387 | Bacteria | 5697198 |
| 654 | 2819241017 | 2818991272 | Bacteria | 4622173 |
| 655 | 2819559281 | 2818991439 | Bacteria | 6907412 |
| 656 | 2819609413 | 2818991448 | Bacteria | 6772224 |
| 657 | 2819641275 | 2818991453 | Bacteria | 7181617 |
| 658 | 2819685326 | 2818991461 | Bacteria | 7026071 |
| 659 | 2821125835 | 2821123053 | Bacteria | 7836056 |
| 660 | 2838020062 | 2838016132 | Bacteria | 6577831 |
| 661 | 2838023564 | 2838022645 | Bacteria | 6494267 |
| 662 | 2838033324 | 2838029111 | Bacteria | 6603031 |
| 663 | 2838041724 | 2838035591 | Bacteria | 7166484 |
| 664 | 2838045260 | 2838042994 | Bacteria | 6046894 |
| 665 | 2838053264 | 2838048938 | Bacteria | 6044578 |
| 666 | 2838065380 | 2838061910 | Bacteria | 6794874 |
| 667 | 2838069857 | 2838068647 | Bacteria | 6208656 |
| 668 | 2838079747 | 2838074704 | Bacteria | 6785777 |
| 669 | 2838661301 | 2838661181 | Bacteria | 7385261 |
| 670 | 2838674809 | 2838668709 | Bacteria | 6671819 |
| 671 | 2838675548 | 2838675328 | Bacteria | 4909118 |
| 672 | 2838683155 | 2838680041 | Bacteria | 6545511 |
| 673 | 2838686751 | 2838686498 | Bacteria | 7807632 |
| 674 | 2838697901 | 2838694306 | Bacteria | 6853137 |
| 675 | 2838707138 | 2838701080 | Bacteria | 6669771 |
| 676 | 2838711016 | 2838707686 | Bacteria | 6619912 |
| 677 | 2838714429 | 2838714209 | Bacteria | 5525906 |
| 678 | 2838721769 | 2838719591 | Bacteria | 5523910 |
| 679 | 2838725190 | 2838724970 | Bacteria | 4908691 |
| 680 | 2838730291 | 2838729681 | Bacteria | 7400765 |
| 681 | 2838737715 | 2838736955 | Bacteria | 5760694 |
| 682 | 2838742694 | 2838742623 | Bacteria | 7396178 |
| 683 | 2841841916 | 2841840854 | Bacteria | 5761912 |
| 684 | 2841848753 | 2841846520 | Bacteria | 5345850 |
| 685 | 2841854579 | 2841851746 | Bacteria | 7532261 |
| 686 | 2841862355 | 2841859092 | Bacteria | 5436171 |
| 687 | 2841867254 | 2841864319 | Bacteria | 6742987 |
| 688 | 2842079191 | 2842077413 | Bacteria | 6508645 |
| 689 | 2842112971 | 2842110456 | Bacteria | 7656360 |
| 690 | 2842118298 | 2842118031 | Bacteria | 7033875 |
| 691 | 2842125216 | 2842124991 | Bacteria | 5346824 |
| 692 | 2842130443 | 2842130223 | Bacteria | 4909145 |
| 693 | 2842141695 | 2842140634 | Bacteria | 5759631 |
| 694 | 2842151782 | 2842146304 | Bacteria | 5957337 |
| 695 | 2842154387 | 2842152218 | Bacteria | 4908957 |
| 696 | 2842158401 | 2842156927 | Bacteria | 6894975 |
| 697 | 2842170223 | 2842163707 | Bacteria | 6916235 |
| 698 | 2842170672 | 2842170452 | Bacteria | 5525737 |
| 699 | 2842178007 | 2842175837 | Bacteria | 4908771 |
| 700 | 2842182017 | 2842180545 | Bacteria | 6888678 |
| 701 | 2842187538 | 2842187318 | Bacteria | 5524014 |
| 702 | 2842195764 | 2842192696 | Bacteria | 6147454 |
| 703 | 2842199078 | 2842198810 | Bacteria | 6608673 |
| 704 | 2842209521 | 2842205361 | Bacteria | 6340321 |
| 705 | 2842211849 | 2842211629 | Bacteria | 5523832 |
| 706 | 2842218241 | 2842217011 | Bacteria | 7497767 |
| 707 | 2842226531 | 2842224351 | Bacteria | 5524473 |
| 708 | 2842229984 | 2842229732 | Bacteria | 7475766 |
| 709 | 2842240212 | 2842237096 | Bacteria | 6620661 |
| 710 | 2842243873 | 2842243621 | Bacteria | 7421798 |
| 711 | 2842256976 | 2842250916 | Bacteria | 6579627 |
| 712 | 2842258042 | 2842257432 | Bacteria | 7401195 |
| 713 | 2842267780 | 2842264693 | Bacteria | 6472963 |
| 714 | 2842271711 | 2842271015 | Bacteria | 7807131 |
| 715 | 2842282975 | 2842278818 | Bacteria | 6340002 |
| 716 | 2842285318 | 2842285085 | Bacteria | 6011953 |
| 717 | 2842292853 | 2842291075 | Bacteria | 7076806 |
| 718 | 2842298270 | 2842298080 | Bacteria | 6123127 |
| 719 | 2842305342 | 2842304105 | Bacteria | 7023636 |
| 720 | 2842313930 | 2842311132 | Bacteria | 6616990 |
| 721 | 2842319833 | 2842317721 | Bacteria | 6793725 |
| 722 | 2842348142 | 2842341865 | Bacteria | 7003929 |
| 723 | 2842360130 | 2842357229 | Bacteria | 6485165 |
| 724 | 2842368388 | 2842363717 | Bacteria | 6844742 |
| 725 | 2842373785 | 2842370503 | Bacteria | 7038661 |
| 726 | 2842379250 | 2842377471 | Bacteria | 7140707 |
| 727 | 2842384809 | 2842384541 | Bacteria | 7057858 |
| 728 | 2842400048 | 2842395702 | Bacteria | 6780583 |
| 729 | 2842402678 | 2842402390 | Bacteria | 6681310 |
| 730 | 2842409951 | 2842409023 | Bacteria | 6687331 |
| 731 | 2842416599 | 2842415677 | Bacteria | 6596907 |
| 732 | 2842423471 | 2842422224 | Bacteria | 6239196 |
| 733 | 2842430424 | 2842428310 | Bacteria | 6767288 |
| 734 | 2842436764 | 2842434925 | Bacteria | 6502746 |
| 735 | 2842443394 | 2842441272 | Bacteria | 6769273 |
| 736 | 2842449265 | 2842447887 | Bacteria | 6754142 |
| 737 | 2842466678 | 2842462802 | Bacteria | 6588055 |
| 738 | 2842471366 | 2842469257 | Bacteria | 6752936 |
| 739 | 2842480011 | 2842475841 | Bacteria | 6603183 |
| 740 | 2842483794 | 2842482326 | Bacteria | 7212537 |
| 741 | 2842493626 | 2842489311 | Bacteria | 6620893 |
| 742 | 2842497777 | 2842495871 | Bacteria | 6820686 |
| 743 | 2842505204 | 2842502639 | Bacteria | 6604161 |
| 744 | 2842514213 | 2842509118 | Bacteria | 6850950 |
| 745 | 2842519139 | 2842515876 | Bacteria | 5436280 |
| 746 | 2842522131 | 2842521101 | Bacteria | 6569494 |
| 747 | 2842924381 | 2842922631 | Bacteria | 5824079 |
| 748 | 2844163972 | 2844163670 | Bacteria | 7266046 |
| 749 | 2844458048 | 2844454524 | Bacteria | 7952546 |
| 750 | 2847419699 | 2847417321 | Bacteria | 6913799 |
| 751 | 2848994701 | 2848992105 | Bacteria | 6810864 |
| 752 | 2850081719 | 2850079185 | Bacteria | 6848280 |
| 753 | 2852390552 | 2852387548 | Bacteria | 8025568 |
| 754 | 2854901433 | 2854896431 | Bacteria | 5869725 |
| 755 | 2854918954 | 2854916844 | Bacteria | 5725939 |
| 756 | 2855828579 | 2855825444 | Bacteria | 6785811 |
| 757 | 2855843704 | 2855839649 | Bacteria | 7135830 |
| 758 | 2855877216 | 2855872281 | Bacteria | 6964271 |
| 759 | 2857517126 | 2857516855 | Bacteria | 7787325 |
| 760 | 2857532396 | 2857531043 | Bacteria | 6754041 |
| 761 | 2858807050 | 2858800743 | Bacteria | 6603254 |
| 762 | 2891373632 | 2891373044 | Bacteria | 5202277 |
| 763 | 2896391138 | 2896384573 | Bacteria | 7700774 |
| 764 | 2899794045 | 2899792073 | Bacteria | 4926588 |
| 765 | 2899806746 | 2899803654 | Bacteria | 5577784 |
| 766 | 2899848825 | 2899845264 | Bacteria | 5672268 |
| 767 | 2913296158 | 2913295892 | Bacteria | 6333755 |
| 768 | 2915983676 | 2915980308 | Bacteria | 6624279 |
| 769 | 2915988049 | 2915986958 | Bacteria | 6739310 |
| 770 | 2915998173 | 2915993759 | Bacteria | 7016183 |
| 771 | 2916007313 | 2916000859 | Bacteria | 6865702 |
| 772 | 2916011290 | 2916007675 | Bacteria | 6898660 |
| 773 | 2916020551 | 2916014648 | Bacteria | 6946486 |
| 774 | 2916028111 | 2916021584 | Bacteria | 6854472 |
| 775 | 2916032832 | 2916028427 | Bacteria | 6748433 |
| 776 | 2916038218 | 2916035215 | Bacteria | 6755766 |
| 777 | 2916045011 | 2916041962 | Bacteria | 6820487 |
| 778 | 2916051948 | 2916048683 | Bacteria | 6543552 |
| 779 | 2916059484 | 2916055098 | Bacteria | 6758838 |
| 780 | 2916068313 | 2916061851 | Bacteria | 6737736 |
| 781 | 2916077788 | 2916076590 | Bacteria | 6596108 |
| 782 | 2919106158 | 2919100787 | Bacteria | 7710546 |
| 783 | 2919114466 | 2919114240 | Bacteria | 5700270 |
| 784 | 2919169549 | 2919166419 | Bacteria | 4952238 |
| 785 | 2919173062 | 2919171160 | Bacteria | 6499771 |
| 786 | 2919410276 | 2919408235 | Bacteria | 6149349 |
| 787 | 2920761269 | 2920760137 | Bacteria | 7427611 |
| 788 | 2920825531 | 2920822456 | Bacteria | 6897201 |
| 789 | 2921203170 | 2921201388 | Bacteria | 6926299 |
| 790 | 2921213275 | 2921208531 | Bacteria | 6745326 |
| 791 | 2921240542 | 2921237296 | Bacteria | 6876710 |
| 792 | 2921245745 | 2921244191 | Bacteria | 6568419 |
| 793 | 2921256915 | 2921250672 | Bacteria | 6677771 |
| 794 | 2921260057 | 2921257292 | Bacteria | 6808382 |
| 795 | 2921268431 | 2921263974 | Bacteria | 6864552 |
| 796 | 2921284654 | 2921282425 | Bacteria | 6826397 |
| 797 | 2921292127 | 2921289301 | Bacteria | 7316391 |
| 798 | 2921296992 | 2921296804 | Bacteria | 7176999 |
| 799 | 2923561154 | 2923556063 | Bacteria | 6793593 |
| 800 | 2924148130 | 2924144063 | Bacteria | 6883928 |
| 801 | 2924154753 | 2924150972 | Bacteria | 7169444 |
| 802 | 2924163936 | 2924158325 | Bacteria | 7188855 |
| 803 | 2924168427 | 2924165586 | Bacteria | 7260590 |
| 804 | 2924177195 | 2924172951 | Bacteria | 6749356 |
| 805 | 2924182048 | 2924179722 | Bacteria | 6843264 |
| 806 | 2924188923 | 2924186466 | Bacteria | 6876637 |
| 807 | 2924195774 | 2924193448 | Bacteria | 6955718 |
| 808 | 2924202957 | 2924200457 | Bacteria | 6757188 |
| 809 | 2924209991 | 2924207177 | Bacteria | 6917007 |
| 810 | 2924221317 | 2924214083 | Bacteria | 7080103 |
| 811 | 2924228374 | 2924221636 | Bacteria | 7113495 |
| 812 | 2924233772 | 2924228884 | Bacteria | 6633132 |
| 813 | 2926755480 | 2926754445 | Bacteria | 5964435 |
| 814 | 2926762611 | 2926760298 | Bacteria | 5505990 |
| 815 | 2929141079 | 2929138655 | Bacteria | 5810547 |
| 816 | 2933009032 | 2933006813 | Bacteria | 4912075 |
| 817 | 2933014687 | 2933011516 | Bacteria | 5439334 |
| 818 | 2933018550 | 2933016740 | Bacteria | 6355406 |
| 819 | 2933571149 | 2933570622 | Bacteria | 7023390 |
| 820 | 2933588972 | 2933586486 | Bacteria | 7667493 |
| 821 | 2933596369 | 2933594066 | Bacteria | 5594265 |
| 822 | 2933600663 | 2933599457 | Bacteria | 5858799 |
| 823 | 2935896714 | 2935894831 | Bacteria | 6620579 |
| 824 | 2935901657 | 2935901341 | Bacteria | 7341747 |
| 825 | 2936371749 | 2936367885 | Bacteria | 7324495 |
| 826 | 2936379584 | 2936375103 | Bacteria | 6652732 |
| 827 | 2936388396 | 2936381700 | Bacteria | 7006523 |
| 828 | 2937001540 | 2936996657 | Bacteria | 6298727 |
| 829 | 2937005871 | 2937002841 | Bacteria | 6934057 |
| 830 | 2937014294 | 2937009748 | Bacteria | 6746052 |
| 831 | 2937021567 | 2937016420 | Bacteria | 6782579 |
| 832 | 2937023954 | 2937023124 | Bacteria | 6815156 |
| 833 | 2937035028 | 2937029754 | Bacteria | 6424026 |
| 834 | 2937039259 | 2937036028 | Bacteria | 6846469 |
| 835 | 2937043362 | 2937042894 | Bacteria | 6741576 |
| 836 | 2937054051 | 2937049772 | Bacteria | 6757901 |
| 837 | 2937056848 | 2937056579 | Bacteria | 7107896 |
| 838 | 2937066089 | 2937063883 | Bacteria | 7199456 |
| 839 | 2937075405 | 2937071275 | Bacteria | 6984483 |
| 840 | 2937084328 | 2937078374 | Bacteria | 6610289 |
| 841 | 2937090730 | 2937084907 | Bacteria | 6618516 |
| 842 | 2937096117 | 2937091812 | Bacteria | 6979387 |
| 843 | 2937105167 | 2937098957 | Bacteria | 7249374 |
| 844 | 2937110530 | 2937106411 | Bacteria | 6947143 |
| 845 | 2937118844 | 2937113482 | Bacteria | 6505872 |
| 846 | 2937125814 | 2937119839 | Bacteria | 6597547 |
| 847 | 2937131061 | 2937126314 | Bacteria | 6771275 |
| 848 | 2941504685 | 2941499720 | Bacteria | 7599444 |
| 849 | 2957379056 | 2957375807 | Bacteria | 6425588 |
| 850 | 2957383000 | 2957382221 | Bacteria | 6737050 |
| 851 | 2957391955 | 2957388812 | Bacteria | 6778072 |
| 852 | 2957396267 | 2957395598 | Bacteria | 6822399 |
| 853 | 2957402948 | 2957402308 | Bacteria | 6741770 |
| 854 | 2957410720 | 2957408893 | Bacteria | 6558585 |
| 855 | 2957421349 | 2957415311 | Bacteria | 6991633 |
| 856 | 2957427274 | 2957422303 | Bacteria | 7172205 |
| 857 | 2957435269 | 2957430029 | Bacteria | 7022557 |
| 858 | 2957440569 | 2957437181 | Bacteria | 6568994 |
| 859 | 2957445226 | 2957443900 | Bacteria | 6869977 |
| 860 | 2957454893 | 2957450854 | Bacteria | 6765715 |
| 861 | 2957459353 | 2957457609 | Bacteria | 6967680 |
| 862 | 2957464842 | 2957464669 | Bacteria | 6568877 |
| 863 | 2957476847 | 2957471148 | Bacteria | 6797643 |
| 864 | 2957482398 | 2957478035 | Bacteria | 6756658 |
| 865 | 2957490026 | 2957484790 | Bacteria | 6703082 |
| 866 | 2957491707 | 2957491536 | Bacteria | 6695180 |
| 867 | 2957501626 | 2957498199 | Bacteria | 7126688 |
| 868 | 2957510248 | 2957505466 | Bacteria | 7253085 |
| 869 | 2960585010 | 2960584000 | Bacteria | 6864594 |
| 870 | 2960596748 | 2960591022 | Bacteria | 6622873 |
| 871 | 2960598452 | 2960597568 | Bacteria | 6550735 |
| 872 | 2960609520 | 2960603979 | Bacteria | 6898737 |
| 873 | 2960614235 | 2960610863 | Bacteria | 6691244 |
| 874 | 2960621881 | 2960617483 | Bacteria | 6727748 |
| 875 | 2960629127 | 2960624210 | Bacteria | 6875384 |
| 876 | 2960634396 | 2960631154 | Bacteria | 6732508 |
| 877 | 2960642797 | 2960637947 | Bacteria | 7296468 |
| 878 | 2960645658 | 2960645483 | Bacteria | 7211087 |
| 879 | 2960658117 | 2960652885 | Bacteria | 7083688 |
| 880 | 2960661983 | 2960660292 | Bacteria | 7041660 |
| 881 | 2960669757 | 2960667422 | Bacteria | 6763020 |
| 882 | 2960680337 | 2960674078 | Bacteria | 6609048 |
| 883 | 2960683376 | 2960680706 | Bacteria | 6624464 |
| 884 | 2960690869 | 2960687367 | Bacteria | 6535474 |
| 885 | 2960695227 | 2960693952 | Bacteria | 6749742 |
| 886 | 2964610781 | 2964607997 | Bacteria | 7101408 |
| 887 | 2964619299 | 2964615318 | Bacteria | 6809089 |
| 888 | 2964624191 | 2964621998 | Bacteria | 6834995 |
| 889 | 2964632550 | 2964628898 | Bacteria | 7083044 |
| 890 | 2964640658 | 2964636051 | Bacteria | 7091832 |
| 891 | 2964644588 | 2964643177 | Bacteria | 6820887 |
| 892 | 2964655034 | 2964649959 | Bacteria | 6675118 |
| 893 | 2964661699 | 2964656573 | Bacteria | 7100150 |
| 894 | 2964666807 | 2964663802 | Bacteria | 7019362 |
| 895 | 2964679736 | 2964678106 | Bacteria | 6792020 |
| 896 | 2964689293 | 2964685014 | Bacteria | 6839111 |
| 897 | 2964692548 | 2964691889 | Bacteria | 6802758 |
| 898 | 2964703236 | 2964698721 | Bacteria | 6765331 |
| 899 | 2964709575 | 2964705432 | Bacteria | 7114648 |
| 900 | 2964714014 | 2964712639 | Bacteria | 6695970 |
| 901 | 2964725284 | 2964719344 | Bacteria | 7286602 |
| 902 | 2967668551 | 2967664464 | Bacteria | 6948836 |
| 903 | 2967677069 | 2967671571 | Bacteria | 7021409 |
| 904 | 2967684741 | 2967678726 | Bacteria | 7264382 |
| 905 | 2967687949 | 2967686174 | Bacteria | 6678622 |
| 906 | 2967697813 | 2967693043 | Bacteria | 6804451 |
| 907 | 2967700283 | 2967699805 | Bacteria | 6854538 |
| 908 | 2967707663 | 2967706974 | Bacteria | 7186053 |
| 909 | 2967725191 | 2967721400 | Bacteria | 7073753 |
| 910 | 2967732707 | 2967728569 | Bacteria | 6641507 |
| 911 | 2967736542 | 2967735183 | Bacteria | 6827012 |
| 912 | 2967745661 | 2967742019 | Bacteria | 6794534 |
| 913 | 2967750843 | 2967748971 | Bacteria | 6733771 |
| 914 | 2967761673 | 2967755722 | Bacteria | 6814706 |
| 915 | 2967766026 | 2967762386 | Bacteria | 6923502 |
| 916 | 2967772293 | 2967769361 | Bacteria | 6587838 |
| 917 | 2970023542 | 2970019648 | Bacteria | 7072033 |
| 918 | 2970028870 | 2970026789 | Bacteria | 6785236 |
| 919 | 2970038245 | 2970033650 | Bacteria | 7118744 |
| 920 | 2970046511 | 2970040964 | Bacteria | 6731123 |
| 921 | 2970053724 | 2970047711 | Bacteria | 7088379 |
| 922 | 2970058655 | 2970054988 | Bacteria | 6611507 |
| 923 | 2970062404 | 2970061556 | Bacteria | 7099761 |
| 924 | 2970071292 | 2970068827 | Bacteria | 7123112 |
| 925 | 2970083975 | 2970082768 | Bacteria | 6183754 |
| 926 | 2970094757 | 2970088815 | Bacteria | 6933825 |
| 927 | 2970097357 | 2970095765 | Bacteria | 6936963 |
| 928 | 2970105832 | 2970102677 | Bacteria | 6812532 |
| 929 | 2970114803 | 2970109326 | Bacteria | 6863976 |
| 930 | 2970119604 | 2970116247 | Bacteria | 6501857 |
| 931 | 2970126633 | 2970122695 | Bacteria | 6625855 |
| 932 | 2970134942 | 2970129317 | Bacteria | 6806560 |
| 933 | 2970148408 | 2970143518 | Bacteria | 6446480 |
| 934 | 2970154119 | 2970149975 | Bacteria | 6779706 |
| 935 | 2970162943 | 2970156795 | Bacteria | 7168044 |
| 936 | 2970164639 | 2970164137 | Bacteria | 6861252 |
| 937 | 2970174305 | 2970170962 | Bacteria | 6876229 |
| 938 | 2970182353 | 2970177841 | Bacteria | 6768001 |
| 939 | 2970189393 | 2970184632 | Bacteria | 7054431 |
| 940 | 2970194667 | 2970191845 | Bacteria | 7032787 |
| 941 | 2977518804 | 2977516862 | Bacteria | 6940108 |
| 942 | 2977526619 | 2977523885 | Bacteria | 6960446 |
| 943 | 2977533874 | 2977530762 | Bacteria | 6951399 |
| 944 | 2977541327 | 2977537788 | Bacteria | 6929320 |
| 945 | 2977547962 | 2977544691 | Bacteria | 6875412 |
| 946 | 2977557711 | 2977551784 | Bacteria | 7125765 |
| 947 | 2977559578 | 2977558990 | Bacteria | 6863948 |
| 948 | 2977569222 | 2977565890 | Bacteria | 6901543 |
| 949 | 2977578765 | 2977572785 | Bacteria | 6763888 |
| 950 | 2977584708 | 2977579622 | Bacteria | 6772100 |
| 951 | 2978971952 | 2978969890 | Bacteria | 5400756 |
| 952 | 2979092077 | 2979089926 | Bacteria | 5670289 |
| 953 | 2979100534 | 2979095461 | Bacteria | 5669583 |
| 954 | 2979104136 | 2979100975 | Bacteria | 5423623 |
| 955 | 2984511294 | 2984509177 | Bacteria | 5274802 |
| 956 | 2984522345 | 2984518228 | Bacteria | 5277463 |
| 957 | 2984541647 | 2984537506 | Bacteria | 5277481 |
| 958 | 2984590237 | 2984587000 | Bacteria | 5263363 |
| 959 | 2984603920 | 2984601300 | Bacteria | 5455244 |
| 960 | 2989350112 | 2989349275 | Bacteria | 6349068 |
| 961 | 2989773257 | 2989771324 | Bacteria | 5605128 |
| 962 | 2989779540 | 2989776772 | Bacteria | 4843317 |
| 963 | 2996892753 | 2996887358 | Bacteria | 5795980 |
| 964 | 2996897935 | 2996893221 | Bacteria | 5823108 |
| 965 | 3003934521 | 3003930520 | Bacteria | 5667563 |
| 966 | 3005414265 | 3005409236 | Bacteria | 7188837 |
| 967 | 3005418903 | 3005416602 | Bacteria | 7064308 |
| 968 | 3005448746 | 3005445848 | Bacteria | 6906074 |
| 969 | 3005454981 | 3005452660 | Bacteria | 5889319 |
| 970 | 639649465 | 639633055 | Bacteria | 7751309 |
| 971 | 643826595 | 643692032 | Bacteria | 6891900 |
| 972 | 648739906 | 648276728 | Bacteria | 6968865 |
| 973 | 650740774 | 650716007 | Bacteria | 5573770 |
| 974 | 8003571850 | 8003570095 | Bacteria | 5747666 |
| 975 | 8003996265 | 8003992118 | Bacteria | 7266902 |
| 976 | 8004004018 | 8003999396 | Bacteria | 7063185 |
| 977 | 8005249854 | 8005246636 | Bacteria | 4933972 |
| 978 | 8005259480 | 8005258706 | Bacteria | 6184835 |
| 979 | 8005281507 | 8005275841 | Bacteria | 6929066 |
| 980 | 8005284524 | 8005282627 | Bacteria | 6675747 |
| 981 | 8005295806 | 8005289223 | Bacteria | 6634003 |
| 982 | 8005303414 | 8005301065 | Bacteria | 6614431 |
| 983 | 8005313894 | 8005307578 | Bacteria | 7395396 |
| 984 | 8005318205 | 8005314921 | Bacteria | 7072929 |
| 985 | 8005327280 | 8005321885 | Bacteria | 5795980 |
| 986 | 8005381218 | 8005376324 | Bacteria | 6590079 |
| 987 | 8005388821 | 8005382845 | Bacteria | 6732062 |
| 988 | 8005395802 | 8005395548 | Bacteria | 6806915 |
| 989 | 8005437573 | 8005430974 | Bacteria | 6689030 |
| 990 | 8005464091 | 8005460587 | Bacteria | 7157962 |
| 991 | 8005488918 | 8005484373 | Bacteria | 6297373 |
| 992 | 8005501187 | 8005497431 | Bacteria | 6477605 |
| 993 | 8005545980 | 8005542996 | Bacteria | 7077758 |
| 994 | 8005561512 | 8005556819 | Bacteria | 6908598 |
| 995 | 8005568290 | 8005563573 | Bacteria | 7153261 |
| 996 | 8005573170 | 8005570704 | Bacteria | 6957481 |
| 997 | 8005622554 | 8005619151 | Bacteria | 7030230 |
| 998 | 8005630056 | 8005626139 | Bacteria | 6534237 |
| 999 | 8005646000 | 8005645114 | Bacteria | 6950293 |
| 1000 | 8005658801 | 8005658619 | Bacteria | 4500593 |
| 1001 | 8005672605 | 8005668836 | Bacteria | 6953162 |
| 1002 | 8005682610 | 8005682033 | Bacteria | 6726518 |
| 1003 | 8005691814 | 8005688590 | Bacteria | 6610080 |
| 1004 | 8005697706 | 8005695170 | Bacteria | 6912330 |
| 1005 | 8018127429 | 8018127388 | Bacteria | 7351159 |
| 1006 | 8018151277 | 8018150411 | Bacteria | 5549903 |
| 1007 | 8018164276 | 8018163183 | Bacteria | 7277977 |
| 1008 | 8018179527 | 8018176218 | Bacteria | 6896178 |
| 1009 | 8023682870 | 8023680758 | Bacteria | 7729763 |
| 1010 | 8024486285 | 8024479707 | Bacteria | 6954785 |
| 1011 | 8024488326 | 8024486573 | Bacteria | 6540512 |
| 1012 | 8024504730 | 8024501048 | Bacteria | 6427847 |
| 1013 | 8046772364 | 8046767195 | Bacteria | 7547379 |
| 1014 | 8049295563 | 8049293176 | Bacteria | 6128433 |
| 1015 | 8054463196 | 8054460903 | Bacteria | 4872905 |
| 1016 | 8054561974 | 8054558443 | Bacteria | 5204801 |
| 1017 | 8056377550 | 8056375014 | Bacteria | 7006639 |
| 1018 | 8056387202 | 8056382006 | Bacteria | 6408074 |
| 1019 | 8056875852 | 8056875544 | Bacteria | 4355797 |
| 1020 | 8057576680 | 8057575449 | Bacteria | 7367519 |
| 1021 | 8057882062 | 8057874678 | Bacteria | 7494653 |
| 1022 | Ga0495654_0000758 | |||
| 1023 | JGI24740J21852_10007862 | |||
| 1024 | JGI25155J39150_1000014 | |||
| 1025 | JGI25156J39149_1000083 | |||
| 1026 | JGI25162J39368_1000217 | |||
| 1027 | JGI25162J39368_1000272 | |||
| 1028 | JGI25162J39368_1000416 | |||
| 1029 | JGI25154J39366_1000052 | |||
| 1030 | JGI25158J39367_1000097 | |||
| 1031 | JGI25157J39369_1000110 | |||
| 1032 | JGI25152J39213_1002158 | |||
| 1033 | JGI25152J39213_1005874 | |||
| 1034 | JGI25152J39213_1019264 | |||
| 1035 | JGI25152J39213_1019273 | |||
| 1036 | JGI25150J39212_1000100 | |||
| 1037 | JGI25150J39212_1002765 | |||
| 1038 | JGI25159J45721_1000004 | |||
| 1039 | JGI25159J45721_1002615 | |||
| 1040 | JGI25151J46595_10000146 | |||
| 1041 | JGI25151J46595_10003013 | |||
| 1042 | JGI25151J46595_10012519 | |||
| 1043 | JGI25151J46595_10017075 | |||
| 1044 | JGI25151J46595_10020722 | |||
| 1045 | JGI25165J46597_1000363 | |||
| 1046 | JGI25165J46597_1000767 | |||
| 1047 | JGI25153J46596_10000764 | |||
| 1048 | JGI25153J46596_10002359 | |||
| 1049 | JGI25153J46596_10004820 | |||
| 1050 | JGI25153J46596_10048278 | |||
| 1051 | JGI25153J46596_10048289 | |||
| 1052 | rootH1_10055212 | |||
| 1053 | rootH2_10026824 | |||
| 1054 | rootH1_10042649 | |||
| 1055 | JGI25160J50197_1000021 | |||
| 1056 | JGI25160J50197_1000351 | |||
| 1057 | JGI25160J50197_1006792 | |||
| 1058 | JGI25160J50197_1008702 | |||
| 1059 | JGI25161J50226_1000167 | |||
| 1060 | JGI25161J50226_1000534 | |||
| 1061 | Ga0055526_1000842 | |||
| 1062 | Ga0055526_1003643 | |||
| 1063 | Ga0055526_1004423 | |||
| 1064 | Ga0055524_1000572 | |||
| 1065 | Ga0055524_1002425 | |||
| 1066 | Ga0055524_1003892 | |||
| 1067 | Ga0055524_1017337 | |||
| 1068 | Ga0055536_1001497 | |||
| 1069 | Ga0055536_1010331 | |||
| 1070 | Ga0055528_1000158 | |||
| 1071 | Ga0055528_1000707 | |||
| 1072 | Ga0055528_1000749 | |||
| 1073 | Ga0055528_1003189 | |||
| 1074 | Ga0055540_1000518 | |||
| 1075 | Ga0055540_1006013 | |||
| 1076 | Ga0055540_1018452 | |||
| 1077 | Ga0055531_10001986 | |||
| 1078 | Ga0058692_1004992 | |||
| 1079 | Ga0055543_1000060 | |||
| 1080 | Ga0055543_1000102 | |||
| 1081 | Ga0055543_1000699 | |||
| 1082 | Ga0065165_1000033 | |||
| 1083 | Ga0065165_1002490 | |||
| 1084 | Ga0065165_1004363 | |||
| 1085 | Ga0065165_1007452 | |||
| 1086 | Ga0065165_1008586 | |||
| 1087 | Ga0070670_100001104 | |||
| 1088 | Ga0070668_100155931 | |||
| 1089 | Ga0070663_100013668 | |||
| 1090 | Ga0070665_100007074 | |||
| 1091 | Ga0070665_100069762 | |||
| 1092 | Ga0068856_100036153 | |||
| 1093 | Ga0075365_10005037 | |||
| 1094 | Ga0075365_10010140 | |||
| 1095 | Ga0075363_100011370 | |||
| 1096 | Ga0075363_100024884 | |||
| 1097 | Ga0075364_10000029 | |||
| 1098 | Ga0075362_10009629 | |||
| 1099 | Ga0075362_10012636 | |||
| 1100 | Ga0075367_10000779 | |||
| 1101 | Ga0075369_10042472 | |||
| 1102 | Ga0075366_10003058 | |||
| 1103 | Ga0075370_10003951 | |||
| 1104 | Ga0075370_10108910 | |||
| 1105 | Ga0079104_1000015 | |||
| 1106 | Ga0079104_1006455 | |||
| 1107 | Ga0099826_10000462 | |||
| 1108 | Ga0099826_10010687 | |||
| 1109 | Ga0105251_10010023 | |||
| 1110 | Ga0105240_10000014 | |||
| 1111 | Ga0105243_10130163 | |||
| 1112 | Ga0105248_10251851 | |||
| 1113 | Ga0105237_10002158 | |||
| 1114 | Ga0123341_1000035 | |||
| 1115 | Ga0123342_1009440 | |||
| 1116 | Ga0123342_1014884 | |||
| 1117 | Ga0105239_10016073 | |||
| 1118 | Ga0157371_10000017 | |||
| 1119 | Ga0157370_10000329 | |||
| 1120 | Ga0157370_10001031 | |||
| 1121 | Ga0157369_10024034 | |||
| 1122 | Ga0157369_10042281 | |||
| 1123 | Ga0171463_1007 | |||
| 1124 | Ga0182007_10003468 | |||
| 1125 | Ga0182005_1000982 | |||
| 1126 | Ga0183363_1071 | |||
| 1127 | Ga0214544_1000110 | |||
| 1128 | Ga0214542_1000268 | |||
| 1129 | Ga0214543_1000022 | |||
| 1130 | Ga0214543_1000219 | |||
| 1131 | Ga0228711_1000911 | |||
| 1132 | Ga0228710_1001018 | |||
| 1133 | Ga0209435_100027 | |||
| 1134 | Ga0209436_100081 | |||
| 1135 | Ga0209436_101492 | |||
| 1136 | Ga0209563_107790 | |||
| 1137 | Ga0209437_100051 | |||
| 1138 | Ga0209437_100060 | |||
| 1139 | Ga0207425_1000046 | |||
| 1140 | Ga0207425_1004231 | |||
| 1141 | Ga0209646_1000086 | |||
| 1142 | Ga0209646_1004688 | |||
| 1143 | Ga0209026_1000082 | |||
| 1144 | Ga0209677_100540 | |||
| 1145 | Ga0209148_1009625 | |||
| 1146 | Ga0209759_1000063 | |||
| 1147 | Ga0209129_1000171 | |||
| 1148 | Ga0209129_1000283 | |||
| 1149 | Ga0209129_1000450 | |||
| 1150 | Ga0209129_1001443 | |||
| 1151 | Ga0209129_1001916 | |||
| 1152 | Ga0209129_1004411 | |||
| 1153 | Ga0209129_1005600 | |||
| 1154 | Ga0209233_1000095 | |||
| 1155 | Ga0209233_1000190 | |||
| 1156 | Ga0209233_1000228 | |||
| 1157 | Ga0209673_1000010 | |||
| 1158 | Ga0209673_1000025 | |||
| 1159 | Ga0209673_1000112 | |||
| 1160 | Ga0209673_1000637 | |||
| 1161 | Ga0209673_1003653 | |||
| 1162 | Ga0209673_1004043 | |||
| 1163 | Ga0209130_1000017 | |||
| 1164 | Ga0209130_1000023 | |||
| 1165 | Ga0209130_1009106 | |||
| 1166 | Ga0209676_1003467 | |||
| 1167 | Ga0209676_1007006 | |||
| 1168 | Ga0209676_1019600 | |||
| 1169 | Ga0209025_1000091 | |||
| 1170 | Ga0209025_1000137 | |||
| 1171 | Ga0209025_1000154 | |||
| 1172 | Ga0209025_1000161 | |||
| 1173 | Ga0209025_1000545 | |||
| 1174 | Ga0209025_1001424 | |||
| 1175 | Ga0209025_1004971 | |||
| 1176 | Ga0209025_1011337 | |||
| 1177 | Ga0209025_1014587 | |||
| 1178 | Ga0209564_1000013 | |||
| 1179 | Ga0209564_1000564 | |||
| 1180 | Ga0209564_1000672 | |||
| 1181 | Ga0209564_1003798 | |||
| 1182 | Ga0209564_1008415 | |||
| 1183 | Ga0209758_1000058 | |||
| 1184 | Ga0209758_1000123 | |||
| 1185 | Ga0209758_1000725 | |||
| 1186 | Ga0209758_1000863 | |||
| 1187 | Ga0209758_1001901 | |||
| 1188 | Ga0209758_1001960 | |||
| 1189 | Ga0209758_1002718 | |||
| 1190 | Ga0209758_1006925 | |||
| 1191 | Ga0209758_1008591 | |||
| 1192 | Ga0209050_1002725 | |||
| 1193 | Ga0209050_1005641 | |||
| 1194 | Ga0209256_1000153 | |||
| 1195 | Ga0209256_1000914 | |||
| 1196 | Ga0209256_1001132 | |||
| 1197 | Ga0209256_1001499 | |||
| 1198 | Ga0209256_1002031 | |||
| 1199 | Ga0209256_1003097 | |||
| 1200 | Ga0209256_1016662 | |||
| 1201 | Ga0207426_1000006 | |||
| 1202 | Ga0207426_1000008 | |||
| 1203 | Ga0207426_1000228 | |||
| 1204 | Ga0207426_1020140 | |||
| 1205 | Ga0209051_1000462 | |||
| 1206 | Ga0209051_1000785 | |||
| 1207 | Ga0209051_1001635 | |||
| 1208 | Ga0209051_1007538 | |||
| 1209 | Ga0209051_1021723 | |||
| 1210 | Ga0209051_1022515 | |||
| 1211 | Ga0209051_1028422 | |||
| 1212 | Ga0209257_1003221 | |||
| 1213 | Ga0209257_1018875 | |||
| 1214 | Ga0209257_1043660 | |||
| 1215 | Ga0207695_10000037 | |||
| 1216 | Ga0207671_10001228 | |||
| 1217 | Ga0207650_10001248 | |||
| 1218 | Ga0207709_10055844 | |||
| 1219 | Ga0207678_10025462 | |||
| 1220 | Ga0207702_10175275 | |||
| 1221 | Ga0207698_10047528 | |||
| 1222 | Ga0209281_1000034 | |||
| 1223 | Ga0209281_1000314 | |||
| 1224 | Ga0209281_1001051 | |||
| 1225 | Ga0209371_1000022 | |||
| 1226 | Ga0209371_1000341 | |||
| 1227 | Ga0209282_1000068 | |||
| 1228 | Ga0209282_1002798 | |||
| 1229 | Ga0268266_10005469 | |||
| 1230 | Ga0307515_10000017 | |||
| 1231 | Ga0307515_10006213 | |||
| 1232 | Ga0307515_10019245 | |||
| 1233 | Ga0307515_10029550 | |||
| 1234 | Ga0268256_1000019 | |||
| 1235 | Ga0268256_1001403 | |||
| 1236 | Ga0307513_10001095 | |||
| 1237 | Ga0307513_10009210 | |||
| 1238 | Ga0307405_10003197 | |||
| 1239 | Ga0307405_10106434 | |||
| 1240 | Ga0307412_10004052 | |||
| 1241 | Ga0315914_1000937 | |||
| 1242 | Ga0307409_100120972 | |||
| 1243 | Ga0307416_100101011 | |||
| 1244 | Ga0307414_10185448 | |||
| 1245 | Ga0315913_1000094 | |||
| 1246 | Ga0315915_1000007 | |||
| 1247 | Ga0439436_0023412 | |||
| 1248 | Ga0439465_0035999 | |||
| 1249 | Ga0451841_0039604 | |||
| 1250 | Ga0451845_0606012 | |||
| 1251 | Ga0451847_0140826 | |||
| 1252 | Ga0451849_0223659 | |||
| 1253 | Ga0451843_0363805 | |||
| 1254 | Ga0451855_1540700 | |||
| 1255 | Ga0439449_0073186 | |||
| 1256 | Ga0466966_0028464 | |||
| 1257 | Ga0466970_0000872 | |||
| 1258 | Ga0495638_0000953 | |||
| 1259 | Ga0495605_0001474 | |||
| 1260 | Ga0495605_0051054 | |||
| 1261 | Ga0495662_0003309 | |||
| 1262 | Ga0495585_0011346 | |||
| 1263 | Ga0495585_0028890 | |||
| 1264 | Ga0495607_0029710 | |||
| 1265 | Ga0495607_0064680 | |||
| 1266 | Ga0495607_0094773 | |||
| 1267 | Ga0495583_0003748 | |||
| 1268 | Ga0495583_0012759 | |||
| 1269 | Ga0495606_0002168 | |||
| 1270 | Ga0495606_0007555 | |||
| 1271 | Ga0495610_0003874 | |||
| 1272 | Ga0495610_0056086 | |||
| 1273 | Ga0495616_0014083 | |||
| 1274 | Ga0495620_0008486 | |||
| 1275 | Ga0495631_0006631 | |||
| 1276 | Ga0495631_0035148 | |||
| 1277 | Ga0495632_0004091 | |||
| 1278 | Ga0495632_0013526 | |||
| 1279 | Ga0495632_0041967 | |||
| 1280 | Ga0495643_0010861 | |||
| 1281 | Ga0495643_0022449 | |||
| 1282 | Ga0495643_0031031 | |||
| 1283 | Ga0495648_0010074 | |||
| 1284 | Ga0495640_0090534 | |||
| 1285 | Ga0495609_0026484 | |||
| 1286 | Ga0495622_0032920 | |||
| 1287 | Ga0495633_0053247 | |||
| 1288 | Ga0495656_0008409 | |||
| 1289 | Ga0495668_0003159 | |||
| 1290 | Ga0495668_0046522 | |||
| 1291 | Ga0495668_0131734 | |||
| 1292 | Ga0495625_0005331 | |||
| 1293 | Ga0495625_0018174 | |||
| 1294 | Ga0495625_0067546 | |||
| 1295 | Ga0495625_0082862 | |||
| 1296 | Ga0495625_0198764 | |||
| 1297 | Ga0495661_0038286 | |||
| 1298 | Ga0495588_0006717 | |||
| 1299 | Ga0495670_0003394 | |||
| 1300 | Ga0495671_0048089 | |||
| 1301 | Ga0495649_0020903 | |||
| 1302 | Ga0495660_0049890 | |||
| 1303 | Ga0495604_0031909 | |||
| 1304 | Ga0495672_0003408 | |||
| 1305 | Ga0495687_026142 | |||
| 1306 | Ga0495681_0010603 | |||
| 1307 | Ga0495681_0024138 | |||
| 1308 | Ga0495686_0004112 | |||
| 1309 | Ga0495686_0011015 | |||
| 1310 | Ga0495686_0024888 | |||
| 1311 | Ga0495686_0055394 | |||
| 1312 | Ga0495686_0090345 | |||
| 1313 | Ga0496100_0027162 | |||
| 1314 | Ga0496102_0004330 | |||
| 1315 | Ga0496102_0218466 | |||
| 1316 | Ga0496103_0005296 | |||
| 1317 | Ga0496104_0015245 | |||
| 1318 | Ga0496104_0025629 | |||
| 1319 | Ga0496105_0117401 | |||
| 1320 | Ga0496106_0001496 | |||
| 1321 | Ga0496106_0069311 | |||
| 1322 | Ga0496106_0118267 | |||
| 1323 | Ga0496108_0245925 | |||
| 1324 | Ga0496110_0128688 | |||
| 1325 | Ga0496110_0138956 | |||
| 1326 | Ga0496111_0000579 | |||
| 1327 | Ga0496113_0093756 | |||
| 1328 | Ga0496114_0443684 | |||
| 1329 | Ga0496116_0000105 | |||
| 1330 | Ga0496116_0010698 | |||
| 1331 | Ga0496116_0015579 | |||
| 1332 | Ga0496116_0040939 | |||
| 1333 | Ga0496116_0069515 | |||
| 1334 | Ga0496116_0073970 | |||
| 1335 | Ga0496116_0117087 | |||
| 1336 | Ga0496117_0000002 | |||
| 1337 | Ga0496117_0002241 | |||
| 1338 | Ga0496117_0003292 | |||
| 1339 | Ga0496117_0016281 | |||
| 1340 | Ga0496117_0065176 | |||
| 1341 | Ga0496117_0104330 | |||
| 1342 | Ga0496117_0171916 | |||
| 1343 | Ga0496118_0001193 | |||
| 1344 | Ga0496118_0001388 | |||
| 1345 | Ga0496118_0004636 | |||
| 1346 | Ga0496118_0015283 | |||
| 1347 | Ga0496118_0018167 | |||
| 1348 | Ga0496118_0019763 | |||
| 1349 | Ga0496118_0028169 | |||
| 1350 | Ga0496118_0116059 | |||
| 1351 | Ga0496119_0012822 | |||
| 1352 | Ga0496119_0012920 | |||
| 1353 | Ga0496119_0022399 | |||
| 1354 | Ga0496119_0044519 | |||
| 1355 | Ga0496119_0047169 | |||
| 1356 | Ga0496119_0120819 | |||
| 1357 | Ga0496120_0000309 | |||
| 1358 | Ga0496120_0049279 | |||
| 1359 | Ga0496120_0051471 | |||
| 1360 | Ga0496120_0076250 | |||
| 1361 | Ga0496120_0077461 | |||
| 1362 | Ga0496121_0000003 | |||
| 1363 | Ga0496121_0001287 | |||
| 1364 | Ga0496121_0002836 | |||
| 1365 | Ga0496121_0009257 | |||
| 1366 | Ga0496121_0014795 | |||
| 1367 | Ga0496121_0022524 | |||
| 1368 | Ga0496121_0028932 | |||
| 1369 | Ga0496121_0037292 | |||
| 1370 | Ga0496121_0043048 | |||
| 1371 | Ga0496121_0044847 | |||
| 1372 | Ga0496121_0051874 | |||
| 1373 | Ga0496121_0055438 | |||
| 1374 | Ga0496121_0191893 | |||
| 1375 | Ga0496121_0234592 | |||
| 1376 | Ga0496122_0000004 | |||
| 1377 | Ga0496122_0000414 | |||
| 1378 | Ga0496122_0000462 | |||
| 1379 | Ga0496122_0015193 | |||
| 1380 | Ga0496122_0015640 | |||
| 1381 | Ga0496122_0016318 | |||
| 1382 | Ga0496122_0029531 | |||
| 1383 | Ga0496122_0038867 | |||
| 1384 | Ga0496122_0050047 | |||
| 1385 | Ga0496122_0052128 | |||
| 1386 | Ga0496122_0061915 | |||
| 1387 | Ga0496122_0169991 | |||
| 1388 | Ga0496123_0000007 | |||
| 1389 | Ga0496123_0000048 | |||
| 1390 | Ga0496123_0000147 | |||
| 1391 | Ga0496123_0004704 | |||
| 1392 | Ga0496123_0009287 | |||
| 1393 | Ga0496123_0012460 | |||
| 1394 | Ga0496123_0028162 | |||
| 1395 | Ga0496123_0028649 | |||
| 1396 | Ga0496123_0054736 | |||
| 1397 | Ga0496123_0061061 | |||
| 1398 | Ga0496123_0116613 | |||
| 1399 | Ga0496124_0000067 | |||
| 1400 | Ga0496124_0000348 | |||
| 1401 | Ga0496124_0006920 | |||
| 1402 | Ga0496124_0013437 | |||
| 1403 | Ga0496124_0016988 | |||
| 1404 | Ga0496124_0024351 | |||
| 1405 | Ga0496124_0033989 | |||
| 1406 | Ga0496124_0040694 | |||
| 1407 | Ga0496124_0042986 | |||
| 1408 | Ga0496124_0053449 | |||
| 1409 | Ga0496124_0139661 | |||
| 1410 | Ga0496124_0158035 | |||
| 1411 | Ga0496124_0190127 | |||
| 1412 | Ga0496125_0001144 | |||
| 1413 | Ga0496125_0001465 | |||
| 1414 | Ga0496125_0004586 | |||
| 1415 | Ga0496125_0008427 | |||
| 1416 | Ga0496125_0014864 | |||
| 1417 | Ga0496125_0015081 | |||
| 1418 | Ga0496125_0031593 | |||
| 1419 | Ga0496125_0086451 | |||
| 1420 | Ga0496125_0167019 | |||
| 1421 | Ga0496125_0183520 | |||
| 1422 | Ga0496126_0000188 | |||
| 1423 | Ga0496126_0000879 | |||
| 1424 | Ga0496126_0012445 | |||
| 1425 | Ga0496126_0017664 | |||
| 1426 | Ga0496126_0026521 | |||
| 1427 | Ga0496126_0067348 | |||
| 1428 | Ga0496126_0202470 | |||
| 1429 | Ga0496126_0240564 | |||
| 1430 | Ga0495678_008240 | |||
| 1431 | Ga0501032_0024801 | |||
| 1432 | Ga0501033_0002870 | |||
| 1433 | Ga0501033_0074199 | |||
| 1434 | Ga0501033_0128979 | |||
| 1435 | Ga0501034_0056607 | |||
| 1436 | Ga0501036_0057659 | |||
| 1437 | Ga0501038_0074345 | |||
| 1438 | Ga0501039_0040948 | |||
| 1439 | Ga0501046_0071572 | |||
| 1440 | Ga0501080_0092649 | |||
| 1441 | Ga0501083_0028656 | |||
| 1442 | Ga0501035_0006588 | |||
| 1443 | Ga0501044_0068200 | |||
| 1444 | nmdc:mga03683_8605_c1 | |||
| 1445 | nmdc:mga03n38_14153_c1 | |||
| 1446 | nmdc:mga00v17_144_c1 | |||
| 1447 | nmdc:mga00v17_7_c1 | |||
| 1448 | nmdc:mga0yw44_3218_c1 | |||
| 1449 | nmdc:mga0k408_22786_c1 | |||
| 1450 | nmdc:mga07m45_435_c1 | |||
| 1451 | nmdc:mga0sz30_27411_c1 | |||
| 1452 | Ga0500610_0002704 | |||
| 1453 | Ga0500578_0085440 | |||
| 1454 | Ga0500583_0095092 | |||
| 1455 | Ga0500560_004635 | |||
| 1456 | Ga0500594_0000568 | |||
| 1457 | Ga0500608_060642 | |||
| 1458 | Ga0500618_000056 | |||
| 1459 | Ga0500618_000304 | |||
| 1460 | Ga0500658_0005794 | |||
| 1461 | Ga0500658_0007104 | |||
| 1462 | Ga0500659_0044803 | |||
| 1463 | Ga0500561_0000236 | |||
| 1464 | Ga0500568_0001459 | |||
| 1465 | Ga0500568_0009854 | |||
| 1466 | Ga0500568_0028393 | |||
| 1467 | Ga0500573_0001176 | |||
| 1468 | Ga0500573_0004052 | |||
| 1469 | Ga0500604_0010108 | |||
| 1470 | Ga0500616_0000363 | |||
| 1471 | Ga0500616_0005056 | |||
| 1472 | Ga0500622_0001665 | |||
| 1473 | Ga0500624_001429 | |||
| 1474 | Ga0500627_0019208 | |||
| 1475 | Ga0500627_0036887 | |||
| 1476 | Ga0500633_0004554 | |||
| 1477 | Ga0500634_0027598 | |||
| 1478 | Ga0500636_0000003 | |||
| 1479 | Ga0500636_0001041 | |||
| 1480 | Ga0500636_0138528 | |||
| 1481 | Ga0501082_0076077 | |||
| 1482 | Ga0466962_0044526 | |||
| 1483 | 2509108107 | |||
| 1484 | 2509376717 | |||
| 1485 | 2509391731 | |||
| 1486 | 2509447408 | |||
| 1487 | 2510134245 | |||
| 1488 | 2510302711 | |||
| 1489 | 2510840606 | |||
| 1490 | 2510895681 | |||
| 1491 | 2511134088 | |||
| 1492 | 2511182413 | |||
| 1493 | 2511199324 | |||
| 1494 | 2511497762 | |||
| 1495 | 2512528795 | |||
| 1496 | 2512969581 | |||
| 1497 | 2513567678 | |||
| 1498 | 2513577960 | |||
| 1499 | 2513584580 | |||
| 1500 | 2513597606 | |||
| 1501 | 2513606195 | |||
| 1502 | 2513616406 | |||
| 1503 | 2513631887 | |||
| 1504 | 2513707915 | |||
| 1505 | 2513870169 | |||
| 1506 | 2513883873 | |||
| 1507 | 2513902022 | |||
| 1508 | 2513908472 | |||
| 1509 | 2513928164 | |||
| 1510 | 2513985096 | |||
| 1511 | 2513997626 | |||
| 1512 | 2514007910 | |||
| 1513 | 2514018008 | |||
| 1514 | 2515113407 | |||
| 1515 | 2515612027 | |||
| 1516 | 2515635129 | |||
| 1517 | 2515645571 | |||
| 1518 | 2515655048 | |||
| 1519 | 2515739778 | |||
| 1520 | 2516206148 | |||
| 1521 | 2516896587 | |||
| 1522 | 2517037010 | |||
| 1523 | 2517077374 | |||
| 1524 | 2517096133 | |||
| 1525 | 2517407754 | |||
| 1526 | 2517565541 | |||
| 1527 | 2520380348 | |||
| 1528 | 2524452085 | |||
| 1529 | 2524458918 | |||
| 1530 | 2530646504 | |||
| 1531 | 2535517165 | |||
| 1532 | 2537877205 | |||
| 1533 | 2551681444 | |||
| 1534 | 2551684681 | |||
| 1535 | 2551697929 | |||
| 1536 | 2551729139 | |||
| 1537 | 2551737650 | |||
| 1538 | 2554248449 | |||
| 1539 | 2558863918 | |||
| 1540 | 2559295565 | |||
| 1541 | 2561469501 | |||
| 1542 | 2585167501 | |||
| 1543 | 2585201940 | |||
| 1544 | 2585225339 | |||
| 1545 | 2585228583 | |||
| 1546 | 2585258203 | |||
| 1547 | 2585265728 | |||
| 1548 | 2585271407 | |||
| 1549 | 2585279345 | |||
| 1550 | 2585323050 | |||
| 1551 | 2585331162 | |||
| 1552 | 2585388934 | |||
| 1553 | 2585395373 | |||
| 1554 | 2585401022 | |||
| 1555 | 2585524802 | |||
| 1556 | 2585531170 | |||
| 1557 | 2585538483 | |||
| 1558 | 2585547895 | |||
| 1559 | 2585552906 | |||
| 1560 | 2585559150 | |||
| 1561 | 2585822077 | |||
| 1562 | 2585836436 | |||
| 1563 | 2585843544 | |||
| 1564 | 2585898533 | |||
| 1565 | 2585903904 | |||
| 1566 | 2585996768 | |||
| 1567 | 2586001353 | |||
| 1568 | 2587980978 | |||
| 1569 | 2599332046 | |||
| 1570 | 2599416946 | |||
| 1571 | 2599601888 | |||
| 1572 | 2599721720 | |||
| 1573 | 2600194891 | |||
| 1574 | 2600374039 | |||
| 1575 | 2601609858 | |||
| 1576 | 2601746633 | |||
| 1577 | 2616293072 | |||
| 1578 | 2616311088 | |||
| 1579 | 2616554525 | |||
| 1580 | 2617385408 | |||
| 1581 | 2643804151 | |||
| 1582 | 2643811262 | |||
| 1583 | 2643856527 | |||
| 1584 | 2643920117 | |||
| 1585 | 2644006976 | |||
| 1586 | 2644050177 | |||
| 1587 | 2644065073 | |||
| 1588 | 2644105215 | |||
| 1589 | 2644145709 | |||
| 1590 | 2644191757 | |||
| 1591 | 2644204762 | |||
| 1592 | 2644208747 | |||
| 1593 | 2644242616 | |||
| 1594 | 2644298972 | |||
| 1595 | 2644309628 | |||
| 1596 | 2644331204 | |||
| 1597 | 2644376516 | |||
| 1598 | 2644416746 | |||
| 1599 | 2644449786 | |||
| 1600 | 2644483097 | |||
| 1601 | 2644494266 | |||
| 1602 | 2644497744 | |||
| 1603 | 2644521740 | |||
| 1604 | 2644543357 | |||
| 1605 | 2644616152 | |||
| 1606 | 2644652277 | |||
| 1607 | 2644657200 | |||
| 1608 | 2644675778 | |||
| 1609 | 2644689918 | |||
| 1610 | 2657681768 | |||
| 1611 | 2671111157 | |||
| 1612 | 2692315244 | |||
| 1613 | 2719182080 | |||
| 1614 | 2719386697 | |||
| 1615 | 2719666450 | |||
| 1616 | 2719732796 | |||
| 1617 | 2720492870 | |||
| 1618 | 2720614331 | |||
| 1619 | 2720621103 | |||
| 1620 | 2720632429 | |||
| 1621 | 2720776154 | |||
| 1622 | 2721148171 | |||
| 1623 | 2721159624 | |||
| 1624 | 2721165007 | |||
| 1625 | 2721400403 | |||
| 1626 | 2722841177 | |||
| 1627 | 2723027751 | |||
| 1628 | 2723561381 | |||
| 1629 | 2723568004 | |||
| 1630 | 2724039216 | |||
| 1631 | 2724045552 | |||
| 1632 | 2724090761 | |||
| 1633 | 2724105269 | |||
| 1634 | 2724111096 | |||
| 1635 | 2725950356 | |||
| 1636 | 2730108687 | |||
| 1637 | 2730165315 | |||
| 1638 | 2730299256 | |||
| 1639 | 2738804975 | |||
| 1640 | 2739033125 | |||
| 1641 | 2753462397 | |||
| 1642 | 2766066169 | |||
| 1643 | 2776914258 | |||
| 1644 | 2778175707 | |||
| 1645 | 2792581482 | |||
| 1646 | 2792620543 | |||
| 1647 | 2792625901 | |||
| 1648 | 2792638841 | |||
| 1649 | 2793280068 | |||
| 1650 | 2793294144 | |||
| 1651 | 2793318143 | |||
| 1652 | 2793319464 | |||
| 1653 | 2793328909 | |||
| 1654 | 2793334902 | |||
| 1655 | 2793339562 | |||
| 1656 | 2793346967 | |||
| 1657 | 2793351551 | |||
| 1658 | 2793362482 | |||
| 1659 | 2793367605 | |||
| 1660 | 2802716011 | |||
| 1661 | 2802722965 | |||
| 1662 | 2802728903 | |||
| 1663 | 2802735269 | |||
| 1664 | 2802742127 | |||
| 1665 | 2802748574 | |||
| 1666 | 2804752953 | |||
| 1667 | 2805926783 | |||
| 1668 | 2805932695 | |||
| 1669 | 2806045264 | |||
| 1670 | 2806049941 | |||
| 1671 | 2806056779 | |||
| 1672 | 2806064161 | |||
| 1673 | 2806071429 | |||
| 1674 | 2808987702 | |||
| 1675 | 2819241017 | |||
| 1676 | 2819559281 | |||
| 1677 | 2819609413 | |||
| 1678 | 2819641275 | |||
| 1679 | 2819685326 | |||
| 1680 | 2821125835 | |||
| 1681 | 2838020062 | |||
| 1682 | 2838023564 | |||
| 1683 | 2838033324 | |||
| 1684 | 2838041724 | |||
| 1685 | 2838045260 | |||
| 1686 | 2838053264 | |||
| 1687 | 2838065380 | |||
| 1688 | 2838069857 | |||
| 1689 | 2838079747 | |||
| 1690 | 2838661301 | |||
| 1691 | 2838674809 | |||
| 1692 | 2838675548 | |||
| 1693 | 2838683155 | |||
| 1694 | 2838686751 | |||
| 1695 | 2838697901 | |||
| 1696 | 2838707138 | |||
| 1697 | 2838711016 | |||
| 1698 | 2838714429 | |||
| 1699 | 2838721769 | |||
| 1700 | 2838725190 | |||
| 1701 | 2838730291 | |||
| 1702 | 2838737715 | |||
| 1703 | 2838742694 | |||
| 1704 | 2841841916 | |||
| 1705 | 2841848753 | |||
| 1706 | 2841854579 | |||
| 1707 | 2841862355 | |||
| 1708 | 2841867254 | |||
| 1709 | 2842079191 | |||
| 1710 | 2842112971 | |||
| 1711 | 2842118298 | |||
| 1712 | 2842125216 | |||
| 1713 | 2842130443 | |||
| 1714 | 2842141695 | |||
| 1715 | 2842151782 | |||
| 1716 | 2842154387 | |||
| 1717 | 2842158401 | |||
| 1718 | 2842170223 | |||
| 1719 | 2842170672 | |||
| 1720 | 2842178007 | |||
| 1721 | 2842182017 | |||
| 1722 | 2842187538 | |||
| 1723 | 2842195764 | |||
| 1724 | 2842199078 | |||
| 1725 | 2842209521 | |||
| 1726 | 2842211849 | |||
| 1727 | 2842218241 | |||
| 1728 | 2842226531 | |||
| 1729 | 2842229984 | |||
| 1730 | 2842240212 | |||
| 1731 | 2842243873 | |||
| 1732 | 2842256976 | |||
| 1733 | 2842258042 | |||
| 1734 | 2842267780 | |||
| 1735 | 2842271711 | |||
| 1736 | 2842282975 | |||
| 1737 | 2842285318 | |||
| 1738 | 2842292853 | |||
| 1739 | 2842298270 | |||
| 1740 | 2842305342 | |||
| 1741 | 2842313930 | |||
| 1742 | 2842319833 | |||
| 1743 | 2842348142 | |||
| 1744 | 2842360130 | |||
| 1745 | 2842368388 | |||
| 1746 | 2842373785 | |||
| 1747 | 2842379250 | |||
| 1748 | 2842384809 | |||
| 1749 | 2842400048 | |||
| 1750 | 2842402678 | |||
| 1751 | 2842409951 | |||
| 1752 | 2842416599 | |||
| 1753 | 2842423471 | |||
| 1754 | 2842430424 | |||
| 1755 | 2842436764 | |||
| 1756 | 2842443394 | |||
| 1757 | 2842449265 | |||
| 1758 | 2842466678 | |||
| 1759 | 2842471366 | |||
| 1760 | 2842480011 | |||
| 1761 | 2842483794 | |||
| 1762 | 2842493626 | |||
| 1763 | 2842497777 | |||
| 1764 | 2842505204 | |||
| 1765 | 2842514213 | |||
| 1766 | 2842519139 | |||
| 1767 | 2842522131 | |||
| 1768 | 2842924381 | |||
| 1769 | 2844163972 | |||
| 1770 | 2844458048 | |||
| 1771 | 2847419699 | |||
| 1772 | 2848994701 | |||
| 1773 | 2850081719 | |||
| 1774 | 2852390552 | |||
| 1775 | 2854901433 | |||
| 1776 | 2854918954 | |||
| 1777 | 2855828579 | |||
| 1778 | 2855843704 | |||
| 1779 | 2855877216 | |||
| 1780 | 2857517126 | |||
| 1781 | 2857532396 | |||
| 1782 | 2858807050 | |||
| 1783 | 2891373632 | |||
| 1784 | 2896391138 | |||
| 1785 | 2899794045 | |||
| 1786 | 2899806746 | |||
| 1787 | 2899848825 | |||
| 1788 | 2913296158 | |||
| 1789 | 2915983676 | |||
| 1790 | 2915988049 | |||
| 1791 | 2915998173 | |||
| 1792 | 2916007313 | |||
| 1793 | 2916011290 | |||
| 1794 | 2916020551 | |||
| 1795 | 2916028111 | |||
| 1796 | 2916032832 | |||
| 1797 | 2916038218 | |||
| 1798 | 2916045011 | |||
| 1799 | 2916051948 | |||
| 1800 | 2916059484 | |||
| 1801 | 2916068313 | |||
| 1802 | 2916077788 | |||
| 1803 | 2919106158 | |||
| 1804 | 2919114466 | |||
| 1805 | 2919169549 | |||
| 1806 | 2919173062 | |||
| 1807 | 2919410276 | |||
| 1808 | 2920761269 | |||
| 1809 | 2920825531 | |||
| 1810 | 2921203170 | |||
| 1811 | 2921213275 | |||
| 1812 | 2921240542 | |||
| 1813 | 2921245745 | |||
| 1814 | 2921256915 | |||
| 1815 | 2921260057 | |||
| 1816 | 2921268431 | |||
| 1817 | 2921284654 | |||
| 1818 | 2921292127 | |||
| 1819 | 2921296992 | |||
| 1820 | 2923561154 | |||
| 1821 | 2924148130 | |||
| 1822 | 2924154753 | |||
| 1823 | 2924163936 | |||
| 1824 | 2924168427 | |||
| 1825 | 2924177195 | |||
| 1826 | 2924182048 | |||
| 1827 | 2924188923 | |||
| 1828 | 2924195774 | |||
| 1829 | 2924202957 | |||
| 1830 | 2924209991 | |||
| 1831 | 2924221317 | |||
| 1832 | 2924228374 | |||
| 1833 | 2924233772 | |||
| 1834 | 2926755480 | |||
| 1835 | 2926762611 | |||
| 1836 | 2929141079 | |||
| 1837 | 2933009032 | |||
| 1838 | 2933014687 | |||
| 1839 | 2933018550 | |||
| 1840 | 2933571149 | |||
| 1841 | 2933588972 | |||
| 1842 | 2933596369 | |||
| 1843 | 2933600663 | |||
| 1844 | 2935896714 | |||
| 1845 | 2935901657 | |||
| 1846 | 2936371749 | |||
| 1847 | 2936379584 | |||
| 1848 | 2936388396 | |||
| 1849 | 2937001540 | |||
| 1850 | 2937005871 | |||
| 1851 | 2937014294 | |||
| 1852 | 2937021567 | |||
| 1853 | 2937023954 | |||
| 1854 | 2937035028 | |||
| 1855 | 2937039259 | |||
| 1856 | 2937043362 | |||
| 1857 | 2937054051 | |||
| 1858 | 2937056848 | |||
| 1859 | 2937066089 | |||
| 1860 | 2937075405 | |||
| 1861 | 2937084328 | |||
| 1862 | 2937090730 | |||
| 1863 | 2937096117 | |||
| 1864 | 2937105167 | |||
| 1865 | 2937110530 | |||
| 1866 | 2937118844 | |||
| 1867 | 2937125814 | |||
| 1868 | 2937131061 | |||
| 1869 | 2941504685 | |||
| 1870 | 2957379056 | |||
| 1871 | 2957383000 | |||
| 1872 | 2957391955 | |||
| 1873 | 2957396267 | |||
| 1874 | 2957402948 | |||
| 1875 | 2957410720 | |||
| 1876 | 2957421349 | |||
| 1877 | 2957427274 | |||
| 1878 | 2957435269 | |||
| 1879 | 2957440569 | |||
| 1880 | 2957445226 | |||
| 1881 | 2957454893 | |||
| 1882 | 2957459353 | |||
| 1883 | 2957464842 | |||
| 1884 | 2957476847 | |||
| 1885 | 2957482398 | |||
| 1886 | 2957490026 | |||
| 1887 | 2957491707 | |||
| 1888 | 2957501626 | |||
| 1889 | 2957510248 | |||
| 1890 | 2960585010 | |||
| 1891 | 2960596748 | |||
| 1892 | 2960598452 | |||
| 1893 | 2960609520 | |||
| 1894 | 2960614235 | |||
| 1895 | 2960621881 | |||
| 1896 | 2960629127 | |||
| 1897 | 2960634396 | |||
| 1898 | 2960642797 | |||
| 1899 | 2960645658 | |||
| 1900 | 2960658117 | |||
| 1901 | 2960661983 | |||
| 1902 | 2960669757 | |||
| 1903 | 2960680337 | |||
| 1904 | 2960683376 | |||
| 1905 | 2960690869 | |||
| 1906 | 2960695227 | |||
| 1907 | 2964610781 | |||
| 1908 | 2964619299 | |||
| 1909 | 2964624191 | |||
| 1910 | 2964632550 | |||
| 1911 | 2964640658 | |||
| 1912 | 2964644588 | |||
| 1913 | 2964655034 | |||
| 1914 | 2964661699 | |||
| 1915 | 2964666807 | |||
| 1916 | 2964679736 | |||
| 1917 | 2964689293 | |||
| 1918 | 2964692548 | |||
| 1919 | 2964703236 | |||
| 1920 | 2964709575 | |||
| 1921 | 2964714014 | |||
| 1922 | 2964725284 | |||
| 1923 | 2967668551 | |||
| 1924 | 2967677069 | |||
| 1925 | 2967684741 | |||
| 1926 | 2967687949 | |||
| 1927 | 2967697813 | |||
| 1928 | 2967700283 | |||
| 1929 | 2967707663 | |||
| 1930 | 2967725191 | |||
| 1931 | 2967732707 | |||
| 1932 | 2967736542 | |||
| 1933 | 2967745661 | |||
| 1934 | 2967750843 | |||
| 1935 | 2967761673 | |||
| 1936 | 2967766026 | |||
| 1937 | 2967772293 | |||
| 1938 | 2970023542 | |||
| 1939 | 2970028870 | |||
| 1940 | 2970038245 | |||
| 1941 | 2970046511 | |||
| 1942 | 2970053724 | |||
| 1943 | 2970058655 | |||
| 1944 | 2970062404 | |||
| 1945 | 2970071292 | |||
| 1946 | 2970083975 | |||
| 1947 | 2970094757 | |||
| 1948 | 2970097357 | |||
| 1949 | 2970105832 | |||
| 1950 | 2970114803 | |||
| 1951 | 2970119604 | |||
| 1952 | 2970126633 | |||
| 1953 | 2970134942 | |||
| 1954 | 2970148408 | |||
| 1955 | 2970154119 | |||
| 1956 | 2970162943 | |||
| 1957 | 2970164639 | |||
| 1958 | 2970174305 | |||
| 1959 | 2970182353 | |||
| 1960 | 2970189393 | |||
| 1961 | 2970194667 | |||
| 1962 | 2977518804 | |||
| 1963 | 2977526619 | |||
| 1964 | 2977533874 | |||
| 1965 | 2977541327 | |||
| 1966 | 2977547962 | |||
| 1967 | 2977557711 | |||
| 1968 | 2977559578 | |||
| 1969 | 2977569222 | |||
| 1970 | 2977578765 | |||
| 1971 | 2977584708 | |||
| 1972 | 2978971952 | |||
| 1973 | 2979092077 | |||
| 1974 | 2979100534 | |||
| 1975 | 2979104136 | |||
| 1976 | 2984511294 | |||
| 1977 | 2984522345 | |||
| 1978 | 2984541647 | |||
| 1979 | 2984590237 | |||
| 1980 | 2984603920 | |||
| 1981 | 2989350112 | |||
| 1982 | 2989773257 | |||
| 1983 | 2989779540 | |||
| 1984 | 2996892753 | |||
| 1985 | 2996897935 | |||
| 1986 | 3003934521 | |||
| 1987 | 3005414265 | |||
| 1988 | 3005418903 | |||
| 1989 | 3005448746 | |||
| 1990 | 3005454981 | |||
| 1991 | 639649465 | |||
| 1992 | 643826595 | |||
| 1993 | 648739906 | |||
| 1994 | 650740774 | |||
| 1995 | 8003571850 | |||
| 1996 | 8003996265 | |||
| 1997 | 8004004018 | |||
| 1998 | 8005249854 | |||
| 1999 | 8005259480 | |||
| 2000 | 8005281507 | |||
| 2001 | 8005284524 | |||
| 2002 | 8005295806 | |||
| 2003 | 8005303414 | |||
| 2004 | 8005313894 | |||
| 2005 | 8005318205 | |||
| 2006 | 8005327280 | |||
| 2007 | 8005381218 | |||
| 2008 | 8005388821 | |||
| 2009 | 8005395802 | |||
| 2010 | 8005437573 | |||
| 2011 | 8005464091 | |||
| 2012 | 8005488918 | |||
| 2013 | 8005501187 | |||
| 2014 | 8005545980 | |||
| 2015 | 8005561512 | |||
| 2016 | 8005568290 | |||
| 2017 | 8005573170 | |||
| 2018 | 8005622554 | |||
| 2019 | 8005630056 | |||
| 2020 | 8005646000 | |||
| 2021 | 8005658801 | |||
| 2022 | 8005672605 | |||
| 2023 | 8005682610 | |||
| 2024 | 8005691814 | |||
| 2025 | 8005697706 | |||
| 2026 | 8018127429 | |||
| 2027 | 8018151277 | |||
| 2028 | 8018164276 | |||
| 2029 | 8018179527 | |||
| 2030 | 8023682870 | |||
| 2031 | 8024486285 | |||
| 2032 | 8024488326 | |||
| 2033 | 8024504730 | |||
| 2034 | 8046772364 | |||
| 2035 | 8049295563 | |||
| 2036 | 8054463196 | |||
| 2037 | 8054561974 | |||
| 2038 | 8056377550 | |||
| 2039 | 8056387202 | |||
| 2040 | 8056875852 | |||
| 2041 | 8057576680 | |||
| 2042 | 8057882062 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5na1-assembly1.cif.gz_A | nadh:quinone oxidoreductase (ndh-ii) from staphylococcus aureus - holoprotein structure - 2.32 a resolution | 0.9311 | 152 | 188 |
| 5na4-assembly1.cif.gz_A | nadh:quinone oxidoreductase (ndh-ii) from staphylococcus aureus - e172s mutant | 0.9306 | 152 | 188 |
| 3klj-assembly1.cif.gz_A | crystal structure of nadh:rubredoxin oxidoreductase from clostridium acetobutylicum | 0.9226 | 153 | 188 |
| 4nwz-assembly1.cif.gz_A | structure of bacterial type ii nadh dehydrogenase from caldalkalibacillus thermarum at 2.5a resolution | 0.9212 | 152 | 188 |
| 4eqw-assembly1.cif.gz_B | crystal structure of the y361f, y419f mutant of staphylococcus aureus coadr | 0.9172 | 153 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5kmpB00 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; | 0.8892 | 152 | 188 | 3.50.50.100 |
| af_Q2FZW0_1_353_3.50.50.100 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; | 0.8636 | 150 | 188 | 3.50.50.100 |
| 1xhcA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8558 | 152 | 191 | 3.50.50.60 |
| 3if9B01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8544 | 3 | 338 | 3.50.50.60 |
| 3vrdB01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8517 | 153 | 189 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A286ICB1-F1-model_v4 | Glycine/D-amino acid oxidase-like deaminating enzyme | 0.9514 | 3 | 354 |
GO:0005737
|
| AF-A0A1U9YYL5-F1-model_v4 | Hydrogen cyanide synthase subunit HcnC (EC 1.4.99.5) | 0.9441 | 1 | 360 |
GO:0005737
GO:0050622 |
| AF-A0A849KV79-F1-model_v4 | FAD-binding oxidoreductase | 0.9418 | 3 | 354 |
GO:0005737
GO:0016020 |
| AF-A0A1U9YYL5-F1-model_v4 | Hydrogen cyanide synthase subunit HcnC (EC 1.4.99.5) | 0.9416 | 1 | 360 |
GO:0005737
GO:0050622 |
| AF-A0A6N1VAT2-F1-model_v4 | FAD-binding oxidoreductase | 0.9365 | 3 | 351 |
GO:0005737
|