F488408

General Info

Members Datasets Scaffolds Average Seq Length
1022 236 2044 153

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10000232|JGI24740J21852_100002324
Length 166
Sequence MTGGGEETAMLRPIAIATAVSGTLDIFWAMILTMTVGKGDIPAMLRFVASGPFGDAPKEWGAGGAVLGLVVHFTLMAIMATIFVLVVRGRPSLLGTLWGTALAFGLITYFVMNWVVVPLRFGTPLPPKPLSIATQLFAHLVLVGIPFALITARTLRPLAIARPATV

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
184 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
223 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
224 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
225 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
228 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
229 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
230 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 4.5
Rhizosphere 95.01
Stem 0
Stem Tuber 0
Unclassified 9.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000232 3300001979 Bacteria 23684
2 JGI24736J21556_1005105 3300001904 Bacteria 2222
3 JGI24736J21556_1011268 3300001904 Bacteria 1456
4 JGI24752J21851_1007009 3300001976 Bacteria 1472
5 JGI24740J21852_10029875 3300001979 Bacteria 1783
6 JGI24740J21852_10054478 3300001979 Bacteria 1129
7 JGI24740J21852_10118206 3300001979 Unclassified 665
8 JGI24739J22299_10001325 3300001989 Bacteria 9292
9 JGI24739J22299_10003044 3300001989 Bacteria 6402
10 JGI24739J22299_10023892 3300001989 Bacteria 2157
11 JGI24739J22299_10215894 3300001989 Unclassified 562
12 JGI24737J22298_10000009 3300001990 Bacteria 58784
13 JGI24737J22298_10001062 3300001990 Bacteria 9708
14 JGI24737J22298_10004972 3300001990 Bacteria 4607
15 JGI24743J22301_10049230 3300001991 Bacteria 856
16 JGI24743J22301_10050425 3300001991 Bacteria 847
17 JGI24735J21928_10049821 3300002067 Bacteria 1210
18 JGI24748J21848_1021625 3300002074 Bacteria 777
19 JGI24738J21930_10001293 3300002075 Bacteria 7002
20 JGI24738J21930_10001301 3300002075 Bacteria 6982
21 JGI24738J21930_10024638 3300002075 Bacteria 1238
22 JGI24742J22300_10068880 3300002244 Unclassified 658
23 Ga0065715_10025108 3300005293 Bacteria 2067
24 Ga0065707_10324378 3300005295 Bacteria 960
25 Ga0070658_10000117 3300005327 Bacteria 71263
26 Ga0070658_10010946 3300005327 Bacteria 7271
27 Ga0070658_10156323 3300005327 Bacteria 1912
28 Ga0070658_10204384 3300005327 Bacteria 1667
29 Ga0070658_10308109 3300005327 Bacteria 1351
30 Ga0070658_10359496 3300005327 Bacteria 1247
31 Ga0070658_10680993 3300005327 Bacteria 892
32 Ga0070658_10787589 3300005327 Unclassified 826
33 Ga0070658_11013962 3300005327 Bacteria 722
34 Ga0070676_10000682 3300005328 Bacteria 16629
35 Ga0070676_10014906 3300005328 Bacteria 4279
36 Ga0070676_10039561 3300005328 Bacteria 2727
37 Ga0070676_10363007 3300005328 Bacteria 998
38 Ga0070676_10389642 3300005328 Bacteria 967
39 Ga0070676_10484252 3300005328 Bacteria 875
40 Ga0070676_10605123 3300005328 Bacteria 791
41 Ga0070683_100001025 3300005329 Bacteria 20971
42 Ga0070683_100810334 3300005329 Bacteria 898
43 Ga0070690_100004112 3300005330 Bacteria 8055
44 Ga0070690_100063447 3300005330 Bacteria 2384
45 Ga0070690_100485261 3300005330 Bacteria 922
46 Ga0070670_100003731 3300005331 Bacteria 12683
47 Ga0070670_100005561 3300005331 Bacteria 10631
48 Ga0070670_100013059 3300005331 Bacteria 7113
49 Ga0070670_100039872 3300005331 Bacteria 4039
50 Ga0070670_100068017 3300005331 Bacteria 3057
51 Ga0070670_100093527 3300005331 Bacteria 2586
52 Ga0070670_100183290 3300005331 Bacteria 1818
53 Ga0070670_100278329 3300005331 Bacteria 1461
54 Ga0070670_100386485 3300005331 Bacteria 1234
55 Ga0070670_100555016 3300005331 Bacteria 1025
56 Ga0070670_101012704 3300005331 Bacteria 756
57 Ga0068869_100000292 3300005334 Bacteria 26686
58 Ga0068869_100270811 3300005334 Bacteria 1362
59 Ga0068869_101061662 3300005334 Unclassified 707
60 Ga0070666_10000341 3300005335 Bacteria 29325
61 Ga0070666_10008470 3300005335 Bacteria 6388
62 Ga0070666_10008770 3300005335 Bacteria 6285
63 Ga0070666_10040650 3300005335 Bacteria 3104
64 Ga0070666_10076420 3300005335 Bacteria 2284
65 Ga0070666_10106476 3300005335 Bacteria 1937
66 Ga0070666_10200276 3300005335 Bacteria 1405
67 Ga0070666_10322546 3300005335 Bacteria 1102
68 Ga0070666_10899307 3300005335 Bacteria 654
69 Ga0070680_100007900 3300005336 Bacteria 8113
70 Ga0070680_100010112 3300005336 Bacteria 7273
71 Ga0070680_100124803 3300005336 Bacteria 2150
72 Ga0070682_100078371 3300005337 Bacteria 2131
73 Ga0068868_100000321 3300005338 Bacteria 32236
74 Ga0068868_100037580 3300005338 Bacteria 3754
75 Ga0068868_100124937 3300005338 Bacteria 2101
76 Ga0068868_100181472 3300005338 Bacteria 1746
77 Ga0068868_101120901 3300005338 Bacteria 725
78 Ga0068868_101349754 3300005338 Bacteria 664
79 Ga0070660_100000142 3300005339 Bacteria 46063
80 Ga0070660_100002896 3300005339 Bacteria 11811
81 Ga0070660_100012979 3300005339 Bacteria 5962
82 Ga0070660_100014388 3300005339 Bacteria 5696
83 Ga0070660_100080107 3300005339 Bacteria 2562
84 Ga0070660_100106045 3300005339 Bacteria 2231
85 Ga0070660_100213327 3300005339 Bacteria 1568
86 Ga0070660_100286680 3300005339 Bacteria 1348
87 Ga0070660_100569563 3300005339 Bacteria 945
88 Ga0070660_100824903 3300005339 Bacteria 780
89 Ga0070660_101132150 3300005339 Bacteria 663
90 Ga0070660_101206210 3300005339 Bacteria 641
91 Ga0070660_101870640 3300005339 Unclassified 511
92 Ga0070689_100352231 3300005340 Bacteria 1235
93 Ga0070689_100467140 3300005340 Bacteria 1076
94 Ga0070689_100609664 3300005340 Bacteria 946
95 Ga0070661_100000079 3300005344 Bacteria 77180
96 Ga0070661_100012388 3300005344 Bacteria 5965
97 Ga0070661_100018641 3300005344 Bacteria 4937
98 Ga0070661_100042668 3300005344 Bacteria 3311
99 Ga0070661_100069387 3300005344 Bacteria 2591
100 Ga0070661_100117172 3300005344 Bacteria 1992
101 Ga0070661_100156081 3300005344 Bacteria 1727
102 Ga0070661_100186216 3300005344 Bacteria 1582
103 Ga0070661_100282243 3300005344 Bacteria 1288
104 Ga0070692_10005689 3300005345 Bacteria 5347
105 Ga0070692_10043401 3300005345 Bacteria 2312
106 Ga0070668_100000496 3300005347 Bacteria 26067
107 Ga0070668_100028097 3300005347 Bacteria 4270
108 Ga0070668_100211970 3300005347 Unclassified 1594
109 Ga0070668_100468882 3300005347 Bacteria 1086
110 Ga0070668_100500724 3300005347 Bacteria 1052
111 Ga0070668_100557506 3300005347 Bacteria 998
112 Ga0070668_100647121 3300005347 Bacteria 928
113 Ga0070668_100908847 3300005347 Bacteria 787
114 Ga0070669_100000605 3300005353 Bacteria 26684
115 Ga0070669_100031657 3300005353 Bacteria 3821
116 Ga0070669_100144806 3300005353 Bacteria 1835
117 Ga0070669_100186108 3300005353 Bacteria 1627
118 Ga0070669_100608967 3300005353 Unclassified 916
119 Ga0070675_100155878 3300005354 Bacteria 1961
120 Ga0070675_100345127 3300005354 Bacteria 1319
121 Ga0070675_100417774 3300005354 Bacteria 1199
122 Ga0070675_100487891 3300005354 Bacteria 1109
123 Ga0070671_100002514 3300005355 Bacteria 14204
124 Ga0070671_100002941 3300005355 Bacteria 13239
125 Ga0070671_100011325 3300005355 Bacteria 7169
126 Ga0070671_100051013 3300005355 Bacteria 3441
127 Ga0070671_100522089 3300005355 Unclassified 1023
128 Ga0070671_100742259 3300005355 Bacteria 853
129 Ga0070671_101305914 3300005355 Unclassified 640
130 Ga0070674_100036555 3300005356 Bacteria 3298
131 Ga0070674_100049778 3300005356 Bacteria 2882
132 Ga0070674_100086848 3300005356 Bacteria 2248
133 Ga0070674_100115247 3300005356 Bacteria 1981
134 Ga0070674_100205832 3300005356 Bacteria 1522
135 Ga0070674_100252852 3300005356 Bacteria 1385
136 Ga0070674_101233174 3300005356 Unclassified 665
137 Ga0070673_100000569 3300005364 Bacteria 19934
138 Ga0070673_100004510 3300005364 Bacteria 8814
139 Ga0070673_100019715 3300005364 Bacteria 4847
140 Ga0070673_100033885 3300005364 Bacteria 3859
141 Ga0070673_100314761 3300005364 Bacteria 1381
142 Ga0070673_100718179 3300005364 Unclassified 918
143 Ga0070673_100725266 3300005364 Bacteria 914
144 Ga0070659_100000125 3300005366 Bacteria 57976
145 Ga0070659_100000469 3300005366 Bacteria 29784
146 Ga0070659_100002238 3300005366 Bacteria 13756
147 Ga0070659_100030435 3300005366 Bacteria 4178
148 Ga0070659_100071154 3300005366 Bacteria 2765
149 Ga0070659_100077824 3300005366 Bacteria 2645
150 Ga0070659_100100313 3300005366 Bacteria 2330
151 Ga0070659_100146979 3300005366 Bacteria 1921
152 Ga0070659_100244976 3300005366 Bacteria 1484
153 Ga0070659_100268239 3300005366 Bacteria 1417
154 Ga0070659_100295716 3300005366 Bacteria 1349
155 Ga0070659_100507975 3300005366 Bacteria 1028
156 Ga0070659_100601929 3300005366 Bacteria 945
157 Ga0070659_100634951 3300005366 Bacteria 920
158 Ga0070659_100700455 3300005366 Bacteria 876
159 Ga0070659_100733732 3300005366 Bacteria 856
160 Ga0070659_101099786 3300005366 Unclassified 700
161 Ga0070659_101300546 3300005366 Bacteria 645
162 Ga0070659_101819837 3300005366 Bacteria 545
163 Ga0070667_100000966 3300005367 Bacteria 26470
164 Ga0070667_100015236 3300005367 Bacteria 6354
165 Ga0070667_100053103 3300005367 Bacteria 3420
166 Ga0070667_100054190 3300005367 Bacteria 3386
167 Ga0070667_100120043 3300005367 Unclassified 2286
168 Ga0070667_100169810 3300005367 Bacteria 1925
169 Ga0070667_100347402 3300005367 Bacteria 1342
170 Ga0070667_100390434 3300005367 Bacteria 1265
171 Ga0070667_100611397 3300005367 Bacteria 1005
172 Ga0070667_101804949 3300005367 Unclassified 575
173 Ga0070714_101793792 3300005435 Unclassified 599
174 Ga0070705_101336897 3300005440 Unclassified 595
175 Ga0070694_100010416 3300005444 Bacteria 5737
176 Ga0070663_100019133 3300005455 Bacteria 4507
177 Ga0070663_100034848 3300005455 Bacteria 3488
178 Ga0070663_100072162 3300005455 Bacteria 2514
179 Ga0070663_100103375 3300005455 Bacteria 2129
180 Ga0070663_100780800 3300005455 Bacteria 818
181 Ga0070663_101257613 3300005455 Bacteria 652
182 Ga0070678_100000821 3300005456 Bacteria 15742
183 Ga0070678_100001663 3300005456 Bacteria 11909
184 Ga0070678_100006295 3300005456 Bacteria 6955
185 Ga0070678_100486413 3300005456 Bacteria 1087
186 Ga0070678_101985633 3300005456 Bacteria 550
187 Ga0070662_100000066 3300005457 Bacteria 57014
188 Ga0070662_100000146 3300005457 Bacteria 40344
189 Ga0070662_100000664 3300005457 Bacteria 20906
190 Ga0070662_100010702 3300005457 Bacteria 6037
191 Ga0070662_100017302 3300005457 Bacteria 4858
192 Ga0070662_100019058 3300005457 Bacteria 4653
193 Ga0070662_100045040 3300005457 Bacteria 3163
194 Ga0070662_100117066 3300005457 Bacteria 2038
195 Ga0070662_100162976 3300005457 Bacteria 1745
196 Ga0070662_100238181 3300005457 Bacteria 1458
197 Ga0070662_100334442 3300005457 Bacteria 1238
198 Ga0070662_100460499 3300005457 Bacteria 1057
199 Ga0070662_100627891 3300005457 Bacteria 905
200 Ga0070662_100658161 3300005457 Unclassified 884
201 Ga0070662_100743451 3300005457 Bacteria 831
202 Ga0070662_101150091 3300005457 Bacteria 666
203 Ga0070681_10697876 3300005458 Bacteria 930
204 Ga0070681_10715241 3300005458 Bacteria 917
205 Ga0068867_100000045 3300005459 Bacteria 75898
206 Ga0068867_100007574 3300005459 Bacteria 7684
207 Ga0068867_100008888 3300005459 Bacteria 7087
208 Ga0068867_100292615 3300005459 Bacteria 1339
209 Ga0068867_100436328 3300005459 Bacteria 1113
210 Ga0070685_10151520 3300005466 Bacteria 1470
211 Ga0070685_11046707 3300005466 Unclassified 614
212 Ga0070679_100206781 3300005530 Bacteria 1927
213 Ga0070679_100733956 3300005530 Bacteria 930
214 Ga0070679_100936460 3300005530 Bacteria 810
215 Ga0070684_100024937 3300005535 Bacteria 5021
216 Ga0070684_102146548 3300005535 Unclassified 527
217 Ga0068853_100000162 3300005539 Bacteria 45622
218 Ga0068853_100000182 3300005539 Bacteria 44164
219 Ga0068853_100095552 3300005539 Bacteria 2621
220 Ga0068853_100153356 3300005539 Bacteria 2075
221 Ga0068853_100188315 3300005539 Bacteria 1874
222 Ga0068853_100405211 3300005539 Bacteria 1277
223 Ga0068853_100635153 3300005539 Unclassified 1015
224 Ga0068853_100690925 3300005539 Bacteria 973
225 Ga0068853_101847585 3300005539 Unclassified 586
226 Ga0070672_100000041 3300005543 Bacteria 56886
227 Ga0070672_100008515 3300005543 Bacteria 7023
228 Ga0070672_100022148 3300005543 Bacteria 4661
229 Ga0070672_100043599 3300005543 Bacteria 3460
230 Ga0070672_100074551 3300005543 Bacteria 2707
231 Ga0070672_100080834 3300005543 Bacteria 2604
232 Ga0070672_100192757 3300005543 Bacteria 1702
233 Ga0070672_100495690 3300005543 Unclassified 1056
234 Ga0070672_100883347 3300005543 Unclassified 789
235 Ga0070672_101273261 3300005543 Bacteria 656
236 Ga0070686_100021540 3300005544 Bacteria 3834
237 Ga0070686_100188577 3300005544 Bacteria 1470
238 Ga0070686_100514722 3300005544 Unclassified 931
239 Ga0070686_100538116 3300005544 Bacteria 912
240 Ga0070695_100131966 3300005545 Bacteria 1722
241 Ga0070696_100008395 3300005546 Bacteria 6910
242 Ga0070696_100368872 3300005546 Bacteria 1116
243 Ga0070696_100912601 3300005546 Bacteria 729
244 Ga0070693_100000475 3300005547 Bacteria 17969
245 Ga0070693_100981345 3300005547 Bacteria 638
246 Ga0070693_100988793 3300005547 Unclassified 636
247 Ga0070665_100002713 3300005548 Bacteria 19193
248 Ga0070665_100082137 3300005548 Bacteria 3227
249 Ga0070665_100097309 3300005548 Bacteria 2948
250 Ga0070665_100115957 3300005548 Bacteria 2681
251 Ga0070665_100291311 3300005548 Bacteria 1635
252 Ga0070665_100792834 3300005548 Bacteria 960
253 Ga0070704_100971594 3300005549 Bacteria 767
254 Ga0068855_100000886 3300005563 Bacteria 37122
255 Ga0068855_100031285 3300005563 Bacteria 6356
256 Ga0068855_100035910 3300005563 Bacteria 5902
257 Ga0068855_100103290 3300005563 Bacteria 3279
258 Ga0068855_100204557 3300005563 Bacteria 2221
259 Ga0068855_100205784 3300005563 Bacteria 2214
260 Ga0068855_100263415 3300005563 Bacteria 1919
261 Ga0068855_101047836 3300005563 Unclassified 855
262 Ga0068855_102127796 3300005563 Bacteria 565
263 Ga0070664_100000195 3300005564 Bacteria 42982
264 Ga0070664_100001042 3300005564 Bacteria 21764
265 Ga0070664_100007554 3300005564 Bacteria 8777
266 Ga0070664_100016860 3300005564 Bacteria 5996
267 Ga0070664_100021481 3300005564 Bacteria 5320
268 Ga0070664_100187085 3300005564 Bacteria 1844
269 Ga0070664_100267403 3300005564 Bacteria 1539
270 Ga0070664_100306853 3300005564 Bacteria 1435
271 Ga0070664_100506886 3300005564 Bacteria 1113
272 Ga0068857_100001494 3300005577 Bacteria 18623
273 Ga0068857_100017124 3300005577 Bacteria 6349
274 Ga0068857_100026491 3300005577 Bacteria 5111
275 Ga0068857_100188621 3300005577 Bacteria 1877
276 Ga0068857_100302015 3300005577 Bacteria 1476
277 Ga0068857_100813925 3300005577 Bacteria 892
278 Ga0068857_100851293 3300005577 Bacteria 872
279 Ga0068854_100000234 3300005578 Bacteria 37807
280 Ga0068854_100079880 3300005578 Bacteria 2413
281 Ga0068854_100082271 3300005578 Bacteria 2379
282 Ga0068854_100127957 3300005578 Bacteria 1936
283 Ga0068854_100173881 3300005578 Bacteria 1678
284 Ga0068854_100442162 3300005578 Bacteria 1084
285 Ga0068854_101356720 3300005578 Bacteria 641
286 Ga0068856_100000235 3300005614 Bacteria 60202
287 Ga0068856_100150026 3300005614 Bacteria 2340
288 Ga0068856_100428158 3300005614 Bacteria 1343
289 Ga0068856_100700369 3300005614 Bacteria 1033
290 Ga0068856_100728650 3300005614 Bacteria 1012
291 Ga0068856_101666467 3300005614 Unclassified 650
292 Ga0068852_100000152 3300005616 Bacteria 46381
293 Ga0068852_100000803 3300005616 Bacteria 20671
294 Ga0068852_100008553 3300005616 Bacteria 7548
295 Ga0068852_100018619 3300005616 Bacteria 5473
296 Ga0068852_100070794 3300005616 Bacteria 3060
297 Ga0068852_100078520 3300005616 Bacteria 2920
298 Ga0068852_100098910 3300005616 Bacteria 2628
299 Ga0068852_100212426 3300005616 Bacteria 1836
300 Ga0068852_100948727 3300005616 Bacteria 878
301 Ga0068859_100000709 3300005617 Bacteria 33516
302 Ga0068859_100012322 3300005617 Bacteria 8603
303 Ga0068859_100266097 3300005617 Bacteria 1806
304 Ga0068859_100398339 3300005617 Bacteria 1472
305 Ga0068859_100450323 3300005617 Bacteria 1383
306 Ga0068859_100603352 3300005617 Bacteria 1191
307 Ga0068859_101760564 3300005617 Bacteria 684
308 Ga0068864_100000484 3300005618 Bacteria 34533
309 Ga0068864_100022759 3300005618 Bacteria 5255
310 Ga0068864_100026504 3300005618 Bacteria 4888
311 Ga0068864_100055180 3300005618 Bacteria 3430
312 Ga0068864_100066492 3300005618 Bacteria 3129
313 Ga0068864_100243483 3300005618 Bacteria 1667
314 Ga0068864_102416221 3300005618 Bacteria 532
315 Ga0068866_10083649 3300005718 Bacteria 1720
316 Ga0068866_10527019 3300005718 Bacteria 786
317 Ga0068861_100125885 3300005719 Bacteria 2073
318 Ga0068861_100299168 3300005719 Bacteria 1393
319 Ga0068851_10011920 3300005834 Bacteria 4089
320 Ga0068851_10018616 3300005834 Bacteria 3347
321 Ga0068851_10144361 3300005834 Bacteria 1297
322 Ga0068851_10154246 3300005834 Bacteria 1257
323 Ga0068851_10580710 3300005834 Unclassified 680
324 Ga0068851_10838322 3300005834 Unclassified 573
325 Ga0068870_10032107 3300005840 Bacteria 2665
326 Ga0068863_100003106 3300005841 Bacteria 16382
327 Ga0068863_100006290 3300005841 Bacteria 11660
328 Ga0068863_100013655 3300005841 Bacteria 7833
329 Ga0068863_100018253 3300005841 Bacteria 6717
330 Ga0068863_100453615 3300005841 Bacteria 1259
331 Ga0068863_100588376 3300005841 Unclassified 1101
332 Ga0068858_100004386 3300005842 Bacteria 13846
333 Ga0068858_100009866 3300005842 Bacteria 9073
334 Ga0068858_100018774 3300005842 Bacteria 6469
335 Ga0068858_100058815 3300005842 Bacteria 3554
336 Ga0068858_100120174 3300005842 Bacteria 2457
337 Ga0068858_100173807 3300005842 Bacteria 2032
338 Ga0068858_100490319 3300005842 Unclassified 1186
339 Ga0068860_100005369 3300005843 Bacteria 13002
340 Ga0068860_100035778 3300005843 Bacteria 4762
341 Ga0068860_100040414 3300005843 Bacteria 4457
342 Ga0068860_100059841 3300005843 Bacteria 3621
343 Ga0068860_100099732 3300005843 Bacteria 2770
344 Ga0068860_100847754 3300005843 Bacteria 928
345 Ga0068862_100017890 3300005844 Bacteria 5901
346 Ga0068862_100020943 3300005844 Bacteria 5464
347 Ga0068862_100074154 3300005844 Bacteria 2941
348 Ga0068862_100354305 3300005844 Unclassified 1362
349 Ga0075364_10294014 3300006051 Bacteria 1106
350 Ga0075427_10084345 3300006194 Bacteria 577
351 Ga0075366_10116022 3300006195 Bacteria 1612
352 Ga0097621_100010997 3300006237 Bacteria 6648
353 Ga0097621_100054433 3300006237 Bacteria 3264
354 Ga0097621_100156089 3300006237 Bacteria 1959
355 Ga0097621_101348975 3300006237 Unclassified 674
356 Ga0068871_100046330 3300006358 Bacteria 3502
357 Ga0068871_100093002 3300006358 Bacteria 2515
358 Ga0068871_100156790 3300006358 Unclassified 1944
359 Ga0068871_100173953 3300006358 Bacteria 1847
360 Ga0068871_100192566 3300006358 Bacteria 1757
361 Ga0068871_100742447 3300006358 Unclassified 902
362 Ga0075428_101008512 3300006844 Bacteria 881
363 Ga0075428_102091520 3300006844 Bacteria 586
364 Ga0075431_100313569 3300006847 Bacteria 1583
365 Ga0075433_10022479 3300006852 Bacteria 5293
366 Ga0075434_100726079 3300006871 Bacteria 1011
367 Ga0075429_100234577 3300006880 Bacteria 1607
368 Ga0068865_100001817 3300006881 Bacteria 12532
369 Ga0068865_100013047 3300006881 Bacteria 5241
370 Ga0068865_100019012 3300006881 Bacteria 4442
371 Ga0068865_100072710 3300006881 Bacteria 2443
372 Ga0068865_100190597 3300006881 Bacteria 1585
373 Ga0097620_100000709 3300006931 Bacteria 33516
374 Ga0097620_100012322 3300006931 Bacteria 8603
375 Ga0097620_100266100 3300006931 Bacteria 1806
376 Ga0097620_100398328 3300006931 Bacteria 1472
377 Ga0097620_100450322 3300006931 Bacteria 1383
378 Ga0097620_100603326 3300006931 Bacteria 1191
379 Ga0097620_101760316 3300006931 Bacteria 684
380 Ga0075435_100687904 3300007076 Unclassified 889
381 Ga0105251_10337078 3300009011 Unclassified 687
382 Ga0105240_10114869 3300009093 Bacteria 3252
383 Ga0105240_10213287 3300009093 Bacteria 2254
384 Ga0105240_10245838 3300009093 Bacteria 2072
385 Ga0105240_10304973 3300009093 Bacteria 1820
386 Ga0105245_10000062 3300009098 Bacteria 115179
387 Ga0105245_10255282 3300009098 Bacteria 1704
388 Ga0114129_10187456 3300009147 Bacteria 2810
389 Ga0105243_10047441 3300009148 Bacteria 3382
390 Ga0105243_10201533 3300009148 Bacteria 1745
391 Ga0105243_10367731 3300009148 Bacteria 1326
392 Ga0105243_10870043 3300009148 Unclassified 894
393 Ga0105243_12731451 3300009148 Bacteria 534
394 Ga0105241_10032348 3300009174 Bacteria 3921
395 Ga0105241_10158237 3300009174 Bacteria 1860
396 Ga0105242_10022212 3300009176 Bacteria 4987
397 Ga0105242_10295389 3300009176 Bacteria 1477
398 Ga0105242_10985362 3300009176 Unclassified 849
399 Ga0105242_12186225 3300009176 Bacteria 598
400 Ga0105248_10000117 3300009177 Bacteria 90169
401 Ga0105248_10000122 3300009177 Bacteria 89560
402 Ga0105248_10004086 3300009177 Bacteria 16141
403 Ga0105248_10023802 3300009177 Bacteria 6808
404 Ga0105248_10071435 3300009177 Bacteria 3899
405 Ga0105248_10108887 3300009177 Bacteria 3124
406 Ga0105248_10116693 3300009177 Bacteria 3010
407 Ga0105248_10117210 3300009177 Bacteria 3003
408 Ga0105248_10264115 3300009177 Bacteria 1938
409 Ga0105248_10345902 3300009177 Bacteria 1674
410 Ga0105248_10563866 3300009177 Bacteria 1285
411 Ga0105248_10581623 3300009177 Unclassified 1263
412 Ga0105238_10012031 3300009551 Bacteria 8717
413 Ga0105238_10016249 3300009551 Bacteria 7533
414 Ga0105238_10078241 3300009551 Bacteria 3298
415 Ga0105238_11247148 3300009551 Unclassified 769
416 Ga0105249_10099059 3300009553 Bacteria 2739
417 Ga0105249_10214710 3300009553 Bacteria 1890
418 Ga0105249_10551335 3300009553 Bacteria 1203
419 Ga0105239_10019409 3300010375 Bacteria 7506
420 Ga0105239_10146742 3300010375 Bacteria 2632
421 Ga0105246_10001831 3300011119 Bacteria 12744
422 Ga0105246_10019051 3300011119 Bacteria 4379
423 Ga0105246_10125454 3300011119 Bacteria 1909
424 Ga0105246_10538172 3300011119 Bacteria 999
425 Ga0105246_10599880 3300011119 Bacteria 951
426 Ga0157373_10005834 3300013100 Bacteria 9216
427 Ga0157373_10013422 3300013100 Bacteria 6009
428 Ga0157373_10124288 3300013100 Bacteria 1814
429 Ga0157373_10145782 3300013100 Bacteria 1665
430 Ga0157373_10182787 3300013100 Bacteria 1476
431 Ga0157373_10234749 3300013100 Bacteria 1296
432 Ga0157373_10236975 3300013100 Bacteria 1289
433 Ga0157373_10284787 3300013100 Bacteria 1171
434 Ga0157373_10470657 3300013100 Bacteria 906
435 Ga0157373_10614303 3300013100 Bacteria 792
436 Ga0157371_10001576 3300013102 Bacteria 23409
437 Ga0157371_10034597 3300013102 Bacteria 3623
438 Ga0157371_10146047 3300013102 Bacteria 1685
439 Ga0157371_10150522 3300013102 Bacteria 1659
440 Ga0157371_10221680 3300013102 Bacteria 1358
441 Ga0157371_10298469 3300013102 Bacteria 1166
442 Ga0157371_10607055 3300013102 Unclassified 814
443 Ga0157370_10285323 3300013104 Bacteria 1525
444 Ga0157370_10302086 3300013104 Unclassified 1477
445 Ga0157370_10395951 3300013104 Bacteria 1271
446 Ga0157369_10002492 3300013105 Bacteria 22063
447 Ga0157369_10052377 3300013105 Bacteria 4416
448 Ga0157369_10118313 3300013105 Bacteria 2812
449 Ga0157369_10190948 3300013105 Bacteria 2152
450 Ga0157369_11241616 3300013105 Bacteria 760
451 Ga0157374_10003140 3300013296 Bacteria 13883
452 Ga0157374_10040842 3300013296 Bacteria 4273
453 Ga0157374_11327494 3300013296 Unclassified 741
454 Ga0157374_11466728 3300013296 Unclassified 705
455 Ga0157378_10000242 3300013297 Bacteria 53256
456 Ga0157378_10023210 3300013297 Bacteria 5460
457 Ga0157378_10173512 3300013297 Bacteria 2024
458 Ga0157378_10189491 3300013297 Bacteria 1939
459 Ga0157378_10325883 3300013297 Bacteria 1493
460 Ga0157378_11351393 3300013297 Bacteria 754
461 Ga0163162_10003750 3300013306 Bacteria 14562
462 Ga0163162_10024784 3300013306 Bacteria 5926
463 Ga0163162_10116229 3300013306 Bacteria 2776
464 Ga0163162_10128856 3300013306 Bacteria 2638
465 Ga0163162_10141169 3300013306 Bacteria 2522
466 Ga0163162_10260465 3300013306 Bacteria 1866
467 Ga0163162_10348202 3300013306 Bacteria 1614
468 Ga0157372_10145762 3300013307 Bacteria 2730
469 Ga0157372_10153067 3300013307 Bacteria 2663
470 Ga0157372_10167654 3300013307 Bacteria 2540
471 Ga0157372_10703402 3300013307 Bacteria 1176
472 Ga0157375_10012250 3300013308 Bacteria 7603
473 Ga0157375_10043165 3300013308 Bacteria 4370
474 Ga0157375_10122329 3300013308 Bacteria 2714
475 Ga0157375_10156163 3300013308 Bacteria 2420
476 Ga0157375_10159263 3300013308 Bacteria 2399
477 Ga0157375_10548496 3300013308 Unclassified 1318
478 Ga0163163_10000357 3300014325 Bacteria 43921
479 Ga0163163_10000903 3300014325 Bacteria 25169
480 Ga0163163_10113176 3300014325 Bacteria 2743
481 Ga0163163_13227964 3300014325 Unclassified 508
482 Ga0157380_10006578 3300014326 Bacteria 8195
483 Ga0157380_10157798 3300014326 Bacteria 1968
484 Ga0157380_10995478 3300014326 Unclassified 871
485 Ga0157377_10011418 3300014745 Bacteria 4433
486 Ga0157377_10139503 3300014745 Bacteria 1488
487 Ga0157379_10019182 3300014968 Bacteria 6038
488 Ga0157379_10316507 3300014968 Bacteria 1424
489 Ga0157379_10574932 3300014968 Bacteria 1050
490 Ga0157376_10004500 3300014969 Bacteria 9712
491 Ga0157376_11141785 3300014969 Bacteria 806
492 Ga0163161_10157683 3300017792 Bacteria 1729
493 Ga0163161_10200556 3300017792 Unclassified 1537
494 Ga0163161_11458745 3300017792 Unclassified 599
495 Ga0207697_10000002 3300025315 Bacteria 92560
496 Ga0207697_10213997 3300025315 Unclassified 849
497 Ga0207656_10006804 3300025321 Bacteria 4134
498 Ga0207656_10170312 3300025321 Bacteria 1041
499 Ga0207682_10089284 3300025893 Bacteria 1334
500 Ga0207688_10025735 3300025901 Bacteria 3234
501 Ga0207688_10113858 3300025901 Bacteria 1573
502 Ga0207688_10486437 3300025901 Bacteria 772
503 Ga0207680_10000275 3300025903 Bacteria 24704
504 Ga0207680_10003154 3300025903 Bacteria 7741
505 Ga0207680_10066582 3300025903 Bacteria 2216
506 Ga0207680_10077205 3300025903 Bacteria 2083
507 Ga0207680_10096139 3300025903 Bacteria 1894
508 Ga0207680_10143936 3300025903 Bacteria 1583
509 Ga0207680_10148198 3300025903 Bacteria 1562
510 Ga0207647_10000095 3300025904 Bacteria 67884
511 Ga0207647_10000304 3300025904 Bacteria 40516
512 Ga0207647_10049152 3300025904 Bacteria 2617
513 Ga0207647_10233612 3300025904 Bacteria 1057
514 Ga0207647_10234540 3300025904 Bacteria 1055
515 Ga0207647_10431120 3300025904 Unclassified 740
516 Ga0207645_10002184 3300025907 Bacteria 15616
517 Ga0207645_10003435 3300025907 Bacteria 12042
518 Ga0207645_10047004 3300025907 Bacteria 2756
519 Ga0207645_10342241 3300025907 Bacteria 1000
520 Ga0207645_10364942 3300025907 Unclassified 968
521 Ga0207705_10000245 3300025909 Bacteria 53348
522 Ga0207705_10026345 3300025909 Bacteria 4146
523 Ga0207705_10088961 3300025909 Bacteria 2259
524 Ga0207705_10164306 3300025909 Unclassified 1669
525 Ga0207705_10168415 3300025909 Bacteria 1649
526 Ga0207705_10614787 3300025909 Unclassified 845
527 Ga0207705_10997807 3300025909 Bacteria 647
528 Ga0207654_10382449 3300025911 Bacteria 975
529 Ga0207707_10520610 3300025912 Bacteria 1013
530 Ga0207695_10042673 3300025913 Bacteria 4840
531 Ga0207695_10229282 3300025913 Bacteria 1762
532 Ga0207671_10359672 3300025914 Bacteria 1155
533 Ga0207660_10000098 3300025917 Bacteria 48203
534 Ga0207660_10008914 3300025917 Bacteria 6489
535 Ga0207660_10302758 3300025917 Bacteria 1273
536 Ga0207662_10096528 3300025918 Bacteria 1826
537 Ga0207657_10000244 3300025919 Bacteria 57833
538 Ga0207657_10003663 3300025919 Bacteria 16359
539 Ga0207657_10004104 3300025919 Bacteria 15469
540 Ga0207657_10018814 3300025919 Bacteria 6578
541 Ga0207657_10041476 3300025919 Bacteria 4069
542 Ga0207657_10053558 3300025919 Bacteria 3495
543 Ga0207657_10147462 3300025919 Bacteria 1918
544 Ga0207657_10189964 3300025919 Bacteria 1657
545 Ga0207657_10268640 3300025919 Bacteria 1356
546 Ga0207657_10351550 3300025919 Bacteria 1162
547 Ga0207657_10468392 3300025919 Bacteria 988
548 Ga0207657_10494265 3300025919 Bacteria 959
549 Ga0207657_10559810 3300025919 Bacteria 894
550 Ga0207649_10001377 3300025920 Bacteria 14401
551 Ga0207649_10010802 3300025920 Bacteria 5020
552 Ga0207649_10054365 3300025920 Bacteria 2491
553 Ga0207649_10070819 3300025920 Bacteria 2225
554 Ga0207649_10126489 3300025920 Bacteria 1730
555 Ga0207649_10234934 3300025920 Bacteria 1313
556 Ga0207649_10392355 3300025920 Bacteria 1037
557 Ga0207649_11049300 3300025920 Unclassified 642
558 Ga0207652_10068312 3300025921 Bacteria 3083
559 Ga0207652_10403164 3300025921 Bacteria 1234
560 Ga0207652_10721165 3300025921 Bacteria 889
561 Ga0207681_10000678 3300025923 Bacteria 22351
562 Ga0207681_10033297 3300025923 Bacteria 3377
563 Ga0207681_10810613 3300025923 Bacteria 782
564 Ga0207694_10004269 3300025924 Bacteria 11189
565 Ga0207694_10006749 3300025924 Bacteria 8718
566 Ga0207694_10238601 3300025924 Unclassified 1485
567 Ga0207694_11064839 3300025924 Bacteria 684
568 Ga0207650_10005531 3300025925 Bacteria 8621
569 Ga0207650_10012207 3300025925 Bacteria 5926
570 Ga0207650_10028562 3300025925 Bacteria 4001
571 Ga0207650_10039667 3300025925 Bacteria 3442
572 Ga0207650_10042652 3300025925 Bacteria 3328
573 Ga0207650_10100341 3300025925 Bacteria 2227
574 Ga0207650_10140075 3300025925 Bacteria 1901
575 Ga0207650_10165187 3300025925 Bacteria 1756
576 Ga0207659_10071658 3300025926 Bacteria 2531
577 Ga0207659_10134443 3300025926 Bacteria 1913
578 Ga0207659_10174688 3300025926 Bacteria 1697
579 Ga0207659_10298454 3300025926 Bacteria 1322
580 Ga0207659_10586577 3300025926 Bacteria 949
581 Ga0207659_10873820 3300025926 Unclassified 773
582 Ga0207687_10000426 3300025927 Bacteria 28498
583 Ga0207687_10482118 3300025927 Bacteria 1033
584 Ga0207644_10000216 3300025931 Bacteria 39644
585 Ga0207644_10000425 3300025931 Bacteria 27368
586 Ga0207644_10003742 3300025931 Bacteria 9859
587 Ga0207644_10008203 3300025931 Bacteria 6841
588 Ga0207644_10031470 3300025931 Bacteria 3696
589 Ga0207644_10240509 3300025931 Bacteria 1441
590 Ga0207644_10301953 3300025931 Bacteria 1290
591 Ga0207690_10000240 3300025932 Bacteria 39829
592 Ga0207690_10004708 3300025932 Bacteria 8054
593 Ga0207690_10027986 3300025932 Bacteria 3568
594 Ga0207690_10049769 3300025932 Bacteria 2795
595 Ga0207690_10066081 3300025932 Bacteria 2476
596 Ga0207690_10075183 3300025932 Bacteria 2342
597 Ga0207690_10194994 3300025932 Bacteria 1534
598 Ga0207690_10266372 3300025932 Bacteria 1329
599 Ga0207690_10445384 3300025932 Bacteria 1040
600 Ga0207690_10685712 3300025932 Unclassified 841
601 Ga0207690_10719981 3300025932 Bacteria 821
602 Ga0207690_11125204 3300025932 Bacteria 655
603 Ga0207690_11128527 3300025932 Unclassified 654
604 Ga0207706_10000335 3300025933 Bacteria 51098
605 Ga0207706_10000461 3300025933 Bacteria 43387
606 Ga0207706_10001976 3300025933 Bacteria 20116
607 Ga0207706_10003509 3300025933 Bacteria 14976
608 Ga0207706_10004122 3300025933 Bacteria 13712
609 Ga0207706_10005979 3300025933 Bacteria 11315
610 Ga0207706_10013808 3300025933 Bacteria 7329
611 Ga0207706_10025169 3300025933 Bacteria 5336
612 Ga0207706_10044646 3300025933 Bacteria 3928
613 Ga0207706_10048873 3300025933 Bacteria 3740
614 Ga0207706_10171559 3300025933 Bacteria 1906
615 Ga0207706_10175704 3300025933 Bacteria 1881
616 Ga0207706_10542268 3300025933 Bacteria 1002
617 Ga0207706_10608797 3300025933 Bacteria 938
618 Ga0207706_10610375 3300025933 Bacteria 936
619 Ga0207686_10006392 3300025934 Bacteria 6340
620 Ga0207686_10032580 3300025934 Bacteria 3103
621 Ga0207686_10063216 3300025934 Bacteria 2353
622 Ga0207709_10005223 3300025935 Bacteria 7389
623 Ga0207709_10035747 3300025935 Bacteria 2939
624 Ga0207670_10004327 3300025936 Bacteria 7627
625 Ga0207670_10406272 3300025936 Bacteria 1090
626 Ga0207669_10012733 3300025937 Bacteria 4147
627 Ga0207669_10013820 3300025937 Bacteria 4027
628 Ga0207669_10063137 3300025937 Bacteria 2285
629 Ga0207669_10073515 3300025937 Bacteria 2157
630 Ga0207669_10079853 3300025937 Bacteria 2090
631 Ga0207704_10001794 3300025938 Bacteria 9622
632 Ga0207704_10018877 3300025938 Bacteria 3610
633 Ga0207704_10023938 3300025938 Bacteria 3301
634 Ga0207704_10056752 3300025938 Bacteria 2401
635 Ga0207704_10282269 3300025938 Bacteria 1263
636 Ga0207704_10405856 3300025938 Bacteria 1076
637 Ga0207691_10000133 3300025940 Bacteria 68368
638 Ga0207691_10003304 3300025940 Bacteria 15712
639 Ga0207691_10027722 3300025940 Bacteria 5309
640 Ga0207691_10031002 3300025940 Bacteria 4993
641 Ga0207691_10036112 3300025940 Bacteria 4580
642 Ga0207691_10063390 3300025940 Bacteria 3352
643 Ga0207691_10224097 3300025940 Bacteria 1630
644 Ga0207691_10252909 3300025940 Bacteria 1520
645 Ga0207711_10000245 3300025941 Bacteria 58210
646 Ga0207711_10005739 3300025941 Bacteria 10475
647 Ga0207711_10006525 3300025941 Bacteria 9823
648 Ga0207711_10013738 3300025941 Bacteria 6724
649 Ga0207711_10017919 3300025941 Bacteria 5885
650 Ga0207711_10043655 3300025941 Bacteria 3825
651 Ga0207711_10049124 3300025941 Bacteria 3611
652 Ga0207711_10146862 3300025941 Bacteria 2125
653 Ga0207711_10231088 3300025941 Bacteria 1694
654 Ga0207711_10318283 3300025941 Bacteria 1437
655 Ga0207711_10378905 3300025941 Bacteria 1313
656 Ga0207711_10384004 3300025941 Bacteria 1303
657 Ga0207711_10573498 3300025941 Bacteria 1053
658 Ga0207689_10000002 3300025942 Bacteria 198437
659 Ga0207689_10053969 3300025942 Bacteria 3311
660 Ga0207689_11364077 3300025942 Bacteria 595
661 Ga0207661_10002671 3300025944 Bacteria 12269
662 Ga0207661_10542702 3300025944 Bacteria 1065
663 Ga0207679_10000147 3300025945 Bacteria 57784
664 Ga0207679_10005442 3300025945 Bacteria 7977
665 Ga0207679_10013893 3300025945 Bacteria 5278
666 Ga0207679_10019733 3300025945 Bacteria 4536
667 Ga0207679_10107178 3300025945 Bacteria 2198
668 Ga0207679_10133428 3300025945 Bacteria 1995
669 Ga0207679_10138339 3300025945 Bacteria 1964
670 Ga0207679_10830056 3300025945 Bacteria 843
671 Ga0207679_10907587 3300025945 Bacteria 806
672 Ga0207679_11029186 3300025945 Unclassified 755
673 Ga0207679_11253978 3300025945 Bacteria 680
674 Ga0207667_10001485 3300025949 Bacteria 29439
675 Ga0207667_10014799 3300025949 Bacteria 8876
676 Ga0207667_10093682 3300025949 Bacteria 3102
677 Ga0207667_10269733 3300025949 Bacteria 1740
678 Ga0207667_10300491 3300025949 Bacteria 1640
679 Ga0207667_11803417 3300025949 Unclassified 576
680 Ga0207651_10001487 3300025960 Bacteria 10657
681 Ga0207651_10042540 3300025960 Bacteria 3024
682 Ga0207651_10083222 3300025960 Bacteria 2313
683 Ga0207651_10089511 3300025960 Bacteria 2247
684 Ga0207651_10155441 3300025960 Bacteria 1786
685 Ga0207651_10506867 3300025960 Unclassified 1044
686 Ga0207651_10707698 3300025960 Bacteria 888
687 Ga0207651_10973118 3300025960 Unclassified 758
688 Ga0207712_10000817 3300025961 Bacteria 22905
689 Ga0207712_10111493 3300025961 Bacteria 2053
690 Ga0207712_10479291 3300025961 Bacteria 1060
691 Ga0207668_10000176 3300025972 Bacteria 43587
692 Ga0207668_10058526 3300025972 Bacteria 2694
693 Ga0207668_10302397 3300025972 Bacteria 1321
694 Ga0207668_10641254 3300025972 Bacteria 929
695 Ga0207668_11142960 3300025972 Bacteria 699
696 Ga0207668_11151537 3300025972 Unclassified 696
697 Ga0207668_11334763 3300025972 Bacteria 646
698 Ga0207640_10000349 3300025981 Bacteria 30129
699 Ga0207640_10026584 3300025981 Bacteria 3516
700 Ga0207640_10290719 3300025981 Bacteria 1288
701 Ga0207640_11231084 3300025981 Unclassified 666
702 Ga0207658_10003010 3300025986 Bacteria 12053
703 Ga0207658_10038183 3300025986 Bacteria 3457
704 Ga0207658_10053673 3300025986 Bacteria 2979
705 Ga0207658_10126455 3300025986 Bacteria 2046
706 Ga0207658_10130453 3300025986 Bacteria 2018
707 Ga0207658_10170891 3300025986 Bacteria 1791
708 Ga0207658_10497349 3300025986 Unclassified 1085
709 Ga0207658_10532839 3300025986 Bacteria 1049
710 Ga0207677_10000758 3300026023 Bacteria 18605
711 Ga0207677_10002060 3300026023 Bacteria 10589
712 Ga0207677_10283258 3300026023 Bacteria 1361
713 Ga0207677_10507293 3300026023 Bacteria 1044
714 Ga0207677_10799432 3300026023 Unclassified 844
715 Ga0207677_11192174 3300026023 Bacteria 697
716 Ga0207703_10003215 3300026035 Bacteria 13738
717 Ga0207703_10008264 3300026035 Bacteria 8220
718 Ga0207703_10026756 3300026035 Bacteria 4543
719 Ga0207703_10030405 3300026035 Bacteria 4268
720 Ga0207703_10074506 3300026035 Bacteria 2811
721 Ga0207703_10333949 3300026035 Bacteria 1391
722 Ga0207703_10619640 3300026035 Unclassified 1025
723 Ga0207639_10000135 3300026041 Bacteria 54465
724 Ga0207639_10000400 3300026041 Bacteria 29922
725 Ga0207639_10064303 3300026041 Bacteria 2844
726 Ga0207639_10081577 3300026041 Bacteria 2562
727 Ga0207639_10203850 3300026041 Bacteria 1698
728 Ga0207639_10468506 3300026041 Bacteria 1146
729 Ga0207639_10663728 3300026041 Unclassified 965
730 Ga0207639_10670229 3300026041 Bacteria 961
731 Ga0207639_10698582 3300026041 Bacteria 941
732 Ga0207678_10010891 3300026067 Bacteria 7991
733 Ga0207678_10032820 3300026067 Bacteria 4525
734 Ga0207678_10060142 3300026067 Bacteria 3268
735 Ga0207678_10093157 3300026067 Bacteria 2574
736 Ga0207702_10001164 3300026078 Bacteria 26836
737 Ga0207702_10287507 3300026078 Bacteria 1557
738 Ga0207702_10380795 3300026078 Bacteria 1357
739 Ga0207641_10009291 3300026088 Bacteria 8111
740 Ga0207641_10012234 3300026088 Bacteria 7042
741 Ga0207641_10024495 3300026088 Bacteria 4974
742 Ga0207641_10099691 3300026088 Bacteria 2556
743 Ga0207641_10591633 3300026088 Unclassified 1085
744 Ga0207648_10000088 3300026089 Bacteria 86596
745 Ga0207648_10001235 3300026089 Bacteria 28702
746 Ga0207648_10005627 3300026089 Bacteria 12592
747 Ga0207648_10289809 3300026089 Bacteria 1465
748 Ga0207648_10741250 3300026089 Bacteria 912
749 Ga0207648_10884523 3300026089 Unclassified 834
750 Ga0207676_10025482 3300026095 Bacteria 4388
751 Ga0207676_10030018 3300026095 Bacteria 4075
752 Ga0207676_10040446 3300026095 Bacteria 3573
753 Ga0207676_10068185 3300026095 Bacteria 2844
754 Ga0207676_11198313 3300026095 Bacteria 752
755 Ga0207676_11752653 3300026095 Bacteria 619
756 Ga0207674_10000742 3300026116 Bacteria 42731
757 Ga0207674_10001363 3300026116 Bacteria 31621
758 Ga0207674_10060680 3300026116 Bacteria 3823
759 Ga0207674_10064362 3300026116 Bacteria 3699
760 Ga0207674_10146193 3300026116 Bacteria 2322
761 Ga0207674_10333986 3300026116 Bacteria 1465
762 Ga0207675_100106817 3300026118 Bacteria 2639
763 Ga0207675_100224276 3300026118 Bacteria 1811
764 Ga0207675_100390555 3300026118 Bacteria 1370
765 Ga0207675_100426692 3300026118 Unclassified 1310
766 Ga0207683_10008913 3300026121 Bacteria 8547
767 Ga0207683_10009993 3300026121 Bacteria 8098
768 Ga0207683_10027044 3300026121 Bacteria 4957
769 Ga0207683_10038396 3300026121 Bacteria 4173
770 Ga0207683_10073642 3300026121 Bacteria 3021
771 Ga0207683_11752910 3300026121 Bacteria 570
772 Ga0207698_10000344 3300026142 Bacteria 27432
773 Ga0207698_10010420 3300026142 Bacteria 5971
774 Ga0207698_10051136 3300026142 Bacteria 3157
775 Ga0207698_10051553 3300026142 Bacteria 3147
776 Ga0207698_10196711 3300026142 Bacteria 1802
777 Ga0207698_10385332 3300026142 Bacteria 1335
778 Ga0207698_10656558 3300026142 Bacteria 1039
779 Ga0207698_10714871 3300026142 Bacteria 998
780 Ga0207698_11023731 3300026142 Unclassified 837
781 Ga0209970_1012842 3300027614 Bacteria 1386
782 Ga0209983_1139022 3300027665 Bacteria 556
783 Ga0209974_10005626 3300027876 Bacteria 4399
784 Ga0268266_10074425 3300028379 Bacteria 2949
785 Ga0268266_10268590 3300028379 Bacteria 1583
786 Ga0268266_10284578 3300028379 Bacteria 1538
787 Ga0268266_10462300 3300028379 Bacteria 1207
788 Ga0268265_10002950 3300028380 Bacteria 12466
789 Ga0268265_10022091 3300028380 Bacteria 4466
790 Ga0268265_10023913 3300028380 Bacteria 4315
791 Ga0268265_10077657 3300028380 Bacteria 2608
792 Ga0268264_10003191 3300028381 Bacteria 14203
793 Ga0268264_10018984 3300028381 Bacteria 5621
794 Ga0268264_10038046 3300028381 Bacteria 3969
795 Ga0268264_10089146 3300028381 Bacteria 2656
796 Ga0268264_10252499 3300028381 Bacteria 1639
797 Ga0268264_10257109 3300028381 Bacteria 1625
798 Ga0268264_10700058 3300028381 Bacteria 1006
799 Ga0307408_100009048 3300031548 Bacteria 6579
800 Ga0307408_100055854 3300031548 Bacteria 2861
801 Ga0307408_100138214 3300031548 Bacteria 1909
802 Ga0307408_100522935 3300031548 Unclassified 1042
803 Ga0307405_10009522 3300031731 Bacteria 4984
804 Ga0307405_10019778 3300031731 Bacteria 3749
805 Ga0307405_11476672 3300031731 Bacteria 597
806 Ga0307413_10016649 3300031824 Bacteria 3805
807 Ga0307413_10036381 3300031824 Bacteria 2833
808 Ga0307413_10696086 3300031824 Bacteria 844
809 Ga0307413_11123413 3300031824 Bacteria 680
810 Ga0307410_10037887 3300031852 Bacteria 3154
811 Ga0307410_10040687 3300031852 Bacteria 3060
812 Ga0307410_10085889 3300031852 Bacteria 2222
813 Ga0307410_10125680 3300031852 Bacteria 1877
814 Ga0307410_10155703 3300031852 Bacteria 1706
815 Ga0307410_10323515 3300031852 Bacteria 1224
816 Ga0307410_10459600 3300031852 Bacteria 1040
817 Ga0307410_10529838 3300031852 Bacteria 973
818 Ga0307410_10645643 3300031852 Bacteria 887
819 Ga0307406_10058308 3300031901 Bacteria 2481
820 Ga0307406_10352833 3300031901 Bacteria 1150
821 Ga0307407_10006604 3300031903 Bacteria 5177
822 Ga0307407_10147083 3300031903 Bacteria 1527
823 Ga0307407_10254882 3300031903 Bacteria 1204
824 Ga0307407_10573244 3300031903 Bacteria 837
825 Ga0307412_10021540 3300031911 Bacteria 3939
826 Ga0307412_10054807 3300031911 Bacteria 2649
827 Ga0307412_10231859 3300031911 Bacteria 1422
828 Ga0307412_10261771 3300031911 Bacteria 1349
829 Ga0307412_10351259 3300031911 Bacteria 1184
830 Ga0307409_100063021 3300031995 Bacteria 2905
831 Ga0307409_100108641 3300031995 Bacteria 2320
832 Ga0307409_100190490 3300031995 Bacteria 1825
833 Ga0307409_100214016 3300031995 Bacteria 1734
834 Ga0307409_100218411 3300031995 Bacteria 1719
835 Ga0307409_100286487 3300031995 Bacteria 1525
836 Ga0307409_100552015 3300031995 Bacteria 1131
837 Ga0307409_100596711 3300031995 Bacteria 1091
838 Ga0307409_101599020 3300031995 Unclassified 680
839 Ga0307416_100009614 3300032002 Bacteria 6339
840 Ga0307416_100023344 3300032002 Bacteria 4487
841 Ga0307416_100086658 3300032002 Bacteria 2670
842 Ga0307416_100361762 3300032002 Bacteria 1473
843 Ga0307416_100483990 3300032002 Bacteria 1298
844 Ga0307416_100495309 3300032002 Bacteria 1285
845 Ga0307414_10027542 3300032004 Bacteria 3675
846 Ga0307414_10031691 3300032004 Bacteria 3471
847 Ga0307414_10138729 3300032004 Bacteria 1900
848 Ga0307414_10177961 3300032004 Bacteria 1707
849 Ga0307414_10241959 3300032004 Bacteria 1494
850 Ga0307414_10278085 3300032004 Bacteria 1405
851 Ga0307414_10353408 3300032004 Bacteria 1262
852 Ga0307414_10534404 3300032004 Bacteria 1042
853 Ga0307414_11107351 3300032004 Unclassified 731
854 Ga0307411_10007250 3300032005 Bacteria 5627
855 Ga0307411_10031234 3300032005 Bacteria 3274
856 Ga0307411_10043772 3300032005 Bacteria 2866
857 Ga0307411_10072248 3300032005 Bacteria 2342
858 Ga0307411_10212418 3300032005 Bacteria 1495
859 Ga0307411_10485268 3300032005 Bacteria 1041
860 Ga0307415_100198558 3300032126 Bacteria 1589
861 Ga0307415_100239577 3300032126 Bacteria 1466
862 Ga0307415_100307429 3300032126 Bacteria 1316
863 Ga0307415_100340828 3300032126 Bacteria 1258
864 Ga0307415_100367981 3300032126 Bacteria 1216
865 Ga0307415_100526903 3300032126 Unclassified 1038
866 Ga0373948_0058023 3300034817 Bacteria 845
867 Ga0373938_0021824 3300034957 Bacteria 1302
868 Ga0373951_0078763 3300035091 Bacteria 850
869 Ga0373939_0271470 3300035114 Unclassified 667
870 Ga0373960_0078462 3300035121 Bacteria 1035
871 Ga0373943_0693480 3300035170 Bacteria 603
872 Ga0373961_0021345 3300035241 Bacteria 1722
873 Ga0373931_0003481 3300035691 Bacteria 7078
874 Ga0373935_0106250 3300035692 Bacteria 1858
875 Ga0395899_0003722 3300037312 Bacteria 12067
876 Ga0395899_0025132 3300037312 Bacteria 4497
877 Ga0395899_0056137 3300037312 Bacteria 2911
878 Ga0395899_0078448 3300037312 Bacteria 2407
879 Ga0395899_0111393 3300037312 Bacteria 1967
880 Ga0395899_0148175 3300037312 Bacteria 1665
881 Ga0395899_0337433 3300037312 Bacteria 1011
882 Ga0395899_0423725 3300037312 Bacteria 876
883 Ga0395899_0475966 3300037312 Bacteria 814
884 Ga0395900_0039751 3300037418 Bacteria 4846
885 Ga0395900_0049160 3300037418 Bacteria 4344
886 Ga0395900_0054482 3300037418 Bacteria 4118
887 Ga0395900_0069849 3300037418 Bacteria 3611
888 Ga0395900_0158049 3300037418 Bacteria 2314
889 Ga0395900_0206634 3300037418 Bacteria 1984
890 Ga0395900_0257806 3300037418 Bacteria 1742
891 Ga0395900_0308185 3300037418 Bacteria 1567
892 Ga0395900_0317773 3300037418 Bacteria 1538
893 Ga0395900_0396785 3300037418 Bacteria 1344
894 Ga0395900_0463818 3300037418 Bacteria 1221
895 Ga0395900_0497915 3300037418 Bacteria 1169
896 Ga0395900_0594576 3300037418 Bacteria 1047
897 Ga0395900_0658514 3300037418 Bacteria 983
898 Ga0395900_0723305 3300037418 Bacteria 927
899 Ga0395900_0796033 3300037418 Bacteria 873
900 Ga0395900_0992857 3300037418 Bacteria 760
901 Ga0395900_1222773 3300037418 Bacteria 666
902 Ga0395900_1728988 3300037418 Bacteria 536
903 Ga0395898_0003591 3300037466 Bacteria 17291
904 Ga0395898_0029997 3300037466 Bacteria 5444
905 Ga0395898_0137589 3300037466 Bacteria 2338
906 Ga0395898_0269743 3300037466 Bacteria 1623
907 Ga0395898_0716269 3300037466 Bacteria 942
908 Ga0395898_1143411 3300037466 Unclassified 711
909 Ga0395898_1656985 3300037466 Unclassified 563
910 Ga0395905_0001242 3300037471 Bacteria 31620
911 Ga0395905_0005799 3300037471 Bacteria 12544
912 Ga0395905_0013710 3300037471 Bacteria 7761
913 Ga0395905_0020190 3300037471 Bacteria 6311
914 Ga0395905_0033231 3300037471 Bacteria 4846
915 Ga0395905_0040804 3300037471 Bacteria 4354
916 Ga0395905_0052778 3300037471 Bacteria 3805
917 Ga0395905_0100072 3300037471 Bacteria 2722
918 Ga0395905_0143481 3300037471 Bacteria 2247
919 Ga0395905_0152368 3300037471 Bacteria 2175
920 Ga0395905_0152529 3300037471 Bacteria 2173
921 Ga0395905_0160086 3300037471 Bacteria 2116
922 Ga0395905_0241229 3300037471 Bacteria 1689
923 Ga0395905_0250027 3300037471 Bacteria 1656
924 Ga0395905_0270099 3300037471 Bacteria 1586
925 Ga0395905_0271533 3300037471 Bacteria 1582
926 Ga0395905_0566233 3300037471 Bacteria 1037
927 Ga0395905_0616506 3300037471 Bacteria 987
928 Ga0395905_0789564 3300037471 Unclassified 852
929 Ga0395905_1034767 3300037471 Bacteria 724
930 Ga0395905_1186596 3300037471 Bacteria 667
931 Ga0395905_1368250 3300037471 Bacteria 612
932 Ga0395901_0038232 3300038443 Bacteria 4964
933 Ga0395901_0040734 3300038443 Bacteria 4811
934 Ga0395901_0041240 3300038443 Bacteria 4783
935 Ga0395901_0142099 3300038443 Bacteria 2522
936 Ga0395901_0271904 3300038443 Bacteria 1762
937 Ga0395901_0334381 3300038443 Bacteria 1565
938 Ga0395901_0335853 3300038443 Bacteria 1561
939 Ga0395901_0365762 3300038443 Unclassified 1486
940 Ga0395901_0432261 3300038443 Bacteria 1349
941 Ga0395901_0484814 3300038443 Bacteria 1261
942 Ga0395901_0649440 3300038443 Unclassified 1058
943 Ga0395901_0702635 3300038443 Bacteria 1009
944 Ga0395901_1040036 3300038443 Unclassified 792
945 Ga0466960_0948166 3300044901 Unclassified 527
946 Ga0466967_0346597 3300045976 Bacteria 1437
947 Ga0466967_0377507 3300045976 Bacteria 1376
948 Ga0495584_0283390 3300046491 Bacteria 842
949 Ga0495643_0098522 3300046522 Bacteria 1501
950 Ga0495643_0263813 3300046522 Unclassified 799
951 Ga0495642_0192705 3300046528 Bacteria 888
952 Ga0495621_0244942 3300046539 Unclassified 731
953 Ga0495668_0068471 3300046616 Bacteria 1952
954 Ga0495668_0296325 3300046616 Unclassified 886
955 Ga0495669_0004837 3300046684 Bacteria 5589
956 Ga0495669_0016890 3300046684 Bacteria 3130
957 Ga0495669_0140896 3300046684 Unclassified 1138
958 Ga0495669_0229470 3300046684 Unclassified 890
959 Ga0495677_0093915 3300047445 Bacteria 1132
960 Ga0496100_0002542 3300048903 Bacteria 9297
961 Ga0496100_0074726 3300048903 Bacteria 2271
962 Ga0496101_0002504 3300048904 Bacteria 11288
963 Ga0496101_0066389 3300048904 Bacteria 2631
964 Ga0496101_0168416 3300048904 Bacteria 1683
965 Ga0496101_1099540 3300048904 Bacteria 624
966 Ga0496102_0169710 3300048905 Bacteria 2054
967 Ga0496102_0188829 3300048905 Bacteria 1942
968 Ga0496103_0135466 3300048906 Bacteria 1574
969 Ga0496104_0038127 3300048907 Bacteria 4496
970 Ga0496104_0974670 3300048907 Bacteria 752
971 Ga0496105_0113732 3300048908 Bacteria 2233
972 Ga0496105_0354635 3300048908 Bacteria 1171
973 Ga0496106_0348935 3300048909 Unclassified 1189
974 Ga0496107_0008638 3300048910 Bacteria 7057
975 Ga0496107_0066685 3300048910 Bacteria 2610
976 Ga0496107_0086208 3300048910 Bacteria 2292
977 Ga0496107_0116101 3300048910 Bacteria 1970
978 Ga0496107_0354648 3300048910 Bacteria 1091
979 Ga0496107_1198466 3300048910 Bacteria 546
980 Ga0496108_0003163 3300048911 Bacteria 13247
981 Ga0496108_0009750 3300048911 Bacteria 7779
982 Ga0496109_0012771 3300048912 Bacteria 7260
983 Ga0496109_0119753 3300048912 Bacteria 2451
984 Ga0496109_0150391 3300048912 Bacteria 2180
985 Ga0496109_0381552 3300048912 Bacteria 1331
986 Ga0496110_0007791 3300048913 Bacteria 8581
987 Ga0496110_0019871 3300048913 Bacteria 5661
988 Ga0496110_0205734 3300048913 Bacteria 1789
989 Ga0496110_0222550 3300048913 Bacteria 1716
990 Ga0496110_0298362 3300048913 Bacteria 1468
991 Ga0496111_0029951 3300048914 Bacteria 3868
992 Ga0496111_0115668 3300048914 Bacteria 1977
993 Ga0496111_0591423 3300048914 Unclassified 813
994 Ga0496111_0616530 3300048914 Unclassified 793
995 Ga0496112_0008002 3300048915 Bacteria 9431
996 Ga0496112_0010868 3300048915 Bacteria 8284
997 Ga0496112_0028399 3300048915 Bacteria 5400
998 Ga0496112_0098970 3300048915 Bacteria 2886
999 Ga0496112_0222481 3300048915 Bacteria 1843
1000 Ga0496113_0029573 3300048916 Bacteria 3958
1001 Ga0496113_0144783 3300048916 Bacteria 1871
1002 Ga0496113_0263509 3300048916 Unclassified 1377
1003 Ga0496114_0023975 3300048917 Bacteria 4979
1004 Ga0496114_0223945 3300048917 Bacteria 1651
1005 Ga0496115_0008740 3300048918 Bacteria 7509
1006 Ga0501068_0190334 3300049584 Bacteria 1299
1007 Ga0501070_1384819 3300049586 Unclassified 535
1008 Ga0501230_049849 3300049667 Bacteria 830
1009 Ga0501233_251104 3300049668 Bacteria 532
1010 Ga0501249_023422 3300049679 Bacteria 1356
1011 Ga0501252_024766 3300049682 Bacteria 804
1012 Ga0501080_0020584 3300049742 Bacteria 6109
1013 Ga0501263_034662 3300049760 Bacteria 724
1014 Ga0501267_005746 3300049764 Bacteria 1179
1015 Ga0501268_017303 3300049765 Bacteria 1202
1016 Ga0501272_004511 3300049769 Bacteria 1448
1017 nmdc:mga03683_418981_c1 3300050489 Bacteria 641
1018 nmdc:mga00v17_498032_c1 3300050491 Bacteria 790
1019 nmdc:mga06r32_362456_c1 3300050510 Bacteria 1433
1020 nmdc:mga0a205_31720_c1 3300050515 Bacteria 5064
1021 Ga0495655_0016356 3300053083 Unclassified 1596
1022 Ga0500658_0000022 3300053134 Bacteria 129341
1023 JGI24740J21852_10000232
1024 JGI24736J21556_1005105
1025 JGI24736J21556_1011268
1026 JGI24752J21851_1007009
1027 JGI24740J21852_10029875
1028 JGI24740J21852_10054478
1029 JGI24740J21852_10118206
1030 JGI24739J22299_10001325
1031 JGI24739J22299_10003044
1032 JGI24739J22299_10023892
1033 JGI24739J22299_10215894
1034 JGI24737J22298_10000009
1035 JGI24737J22298_10001062
1036 JGI24737J22298_10004972
1037 JGI24743J22301_10049230
1038 JGI24743J22301_10050425
1039 JGI24735J21928_10049821
1040 JGI24748J21848_1021625
1041 JGI24738J21930_10001293
1042 JGI24738J21930_10001301
1043 JGI24738J21930_10024638
1044 JGI24742J22300_10068880
1045 Ga0065715_10025108
1046 Ga0065707_10324378
1047 Ga0070658_10000117
1048 Ga0070658_10010946
1049 Ga0070658_10156323
1050 Ga0070658_10204384
1051 Ga0070658_10308109
1052 Ga0070658_10359496
1053 Ga0070658_10680993
1054 Ga0070658_10787589
1055 Ga0070658_11013962
1056 Ga0070676_10000682
1057 Ga0070676_10014906
1058 Ga0070676_10039561
1059 Ga0070676_10363007
1060 Ga0070676_10389642
1061 Ga0070676_10484252
1062 Ga0070676_10605123
1063 Ga0070683_100001025
1064 Ga0070683_100810334
1065 Ga0070690_100004112
1066 Ga0070690_100063447
1067 Ga0070690_100485261
1068 Ga0070670_100003731
1069 Ga0070670_100005561
1070 Ga0070670_100013059
1071 Ga0070670_100039872
1072 Ga0070670_100068017
1073 Ga0070670_100093527
1074 Ga0070670_100183290
1075 Ga0070670_100278329
1076 Ga0070670_100386485
1077 Ga0070670_100555016
1078 Ga0070670_101012704
1079 Ga0068869_100000292
1080 Ga0068869_100270811
1081 Ga0068869_101061662
1082 Ga0070666_10000341
1083 Ga0070666_10008470
1084 Ga0070666_10008770
1085 Ga0070666_10040650
1086 Ga0070666_10076420
1087 Ga0070666_10106476
1088 Ga0070666_10200276
1089 Ga0070666_10322546
1090 Ga0070666_10899307
1091 Ga0070680_100007900
1092 Ga0070680_100010112
1093 Ga0070680_100124803
1094 Ga0070682_100078371
1095 Ga0068868_100000321
1096 Ga0068868_100037580
1097 Ga0068868_100124937
1098 Ga0068868_100181472
1099 Ga0068868_101120901
1100 Ga0068868_101349754
1101 Ga0070660_100000142
1102 Ga0070660_100002896
1103 Ga0070660_100012979
1104 Ga0070660_100014388
1105 Ga0070660_100080107
1106 Ga0070660_100106045
1107 Ga0070660_100213327
1108 Ga0070660_100286680
1109 Ga0070660_100569563
1110 Ga0070660_100824903
1111 Ga0070660_101132150
1112 Ga0070660_101206210
1113 Ga0070660_101870640
1114 Ga0070689_100352231
1115 Ga0070689_100467140
1116 Ga0070689_100609664
1117 Ga0070661_100000079
1118 Ga0070661_100012388
1119 Ga0070661_100018641
1120 Ga0070661_100042668
1121 Ga0070661_100069387
1122 Ga0070661_100117172
1123 Ga0070661_100156081
1124 Ga0070661_100186216
1125 Ga0070661_100282243
1126 Ga0070692_10005689
1127 Ga0070692_10043401
1128 Ga0070668_100000496
1129 Ga0070668_100028097
1130 Ga0070668_100211970
1131 Ga0070668_100468882
1132 Ga0070668_100500724
1133 Ga0070668_100557506
1134 Ga0070668_100647121
1135 Ga0070668_100908847
1136 Ga0070669_100000605
1137 Ga0070669_100031657
1138 Ga0070669_100144806
1139 Ga0070669_100186108
1140 Ga0070669_100608967
1141 Ga0070675_100155878
1142 Ga0070675_100345127
1143 Ga0070675_100417774
1144 Ga0070675_100487891
1145 Ga0070671_100002514
1146 Ga0070671_100002941
1147 Ga0070671_100011325
1148 Ga0070671_100051013
1149 Ga0070671_100522089
1150 Ga0070671_100742259
1151 Ga0070671_101305914
1152 Ga0070674_100036555
1153 Ga0070674_100049778
1154 Ga0070674_100086848
1155 Ga0070674_100115247
1156 Ga0070674_100205832
1157 Ga0070674_100252852
1158 Ga0070674_101233174
1159 Ga0070673_100000569
1160 Ga0070673_100004510
1161 Ga0070673_100019715
1162 Ga0070673_100033885
1163 Ga0070673_100314761
1164 Ga0070673_100718179
1165 Ga0070673_100725266
1166 Ga0070659_100000125
1167 Ga0070659_100000469
1168 Ga0070659_100002238
1169 Ga0070659_100030435
1170 Ga0070659_100071154
1171 Ga0070659_100077824
1172 Ga0070659_100100313
1173 Ga0070659_100146979
1174 Ga0070659_100244976
1175 Ga0070659_100268239
1176 Ga0070659_100295716
1177 Ga0070659_100507975
1178 Ga0070659_100601929
1179 Ga0070659_100634951
1180 Ga0070659_100700455
1181 Ga0070659_100733732
1182 Ga0070659_101099786
1183 Ga0070659_101300546
1184 Ga0070659_101819837
1185 Ga0070667_100000966
1186 Ga0070667_100015236
1187 Ga0070667_100053103
1188 Ga0070667_100054190
1189 Ga0070667_100120043
1190 Ga0070667_100169810
1191 Ga0070667_100347402
1192 Ga0070667_100390434
1193 Ga0070667_100611397
1194 Ga0070667_101804949
1195 Ga0070714_101793792
1196 Ga0070705_101336897
1197 Ga0070694_100010416
1198 Ga0070663_100019133
1199 Ga0070663_100034848
1200 Ga0070663_100072162
1201 Ga0070663_100103375
1202 Ga0070663_100780800
1203 Ga0070663_101257613
1204 Ga0070678_100000821
1205 Ga0070678_100001663
1206 Ga0070678_100006295
1207 Ga0070678_100486413
1208 Ga0070678_101985633
1209 Ga0070662_100000066
1210 Ga0070662_100000146
1211 Ga0070662_100000664
1212 Ga0070662_100010702
1213 Ga0070662_100017302
1214 Ga0070662_100019058
1215 Ga0070662_100045040
1216 Ga0070662_100117066
1217 Ga0070662_100162976
1218 Ga0070662_100238181
1219 Ga0070662_100334442
1220 Ga0070662_100460499
1221 Ga0070662_100627891
1222 Ga0070662_100658161
1223 Ga0070662_100743451
1224 Ga0070662_101150091
1225 Ga0070681_10697876
1226 Ga0070681_10715241
1227 Ga0068867_100000045
1228 Ga0068867_100007574
1229 Ga0068867_100008888
1230 Ga0068867_100292615
1231 Ga0068867_100436328
1232 Ga0070685_10151520
1233 Ga0070685_11046707
1234 Ga0070679_100206781
1235 Ga0070679_100733956
1236 Ga0070679_100936460
1237 Ga0070684_100024937
1238 Ga0070684_102146548
1239 Ga0068853_100000162
1240 Ga0068853_100000182
1241 Ga0068853_100095552
1242 Ga0068853_100153356
1243 Ga0068853_100188315
1244 Ga0068853_100405211
1245 Ga0068853_100635153
1246 Ga0068853_100690925
1247 Ga0068853_101847585
1248 Ga0070672_100000041
1249 Ga0070672_100008515
1250 Ga0070672_100022148
1251 Ga0070672_100043599
1252 Ga0070672_100074551
1253 Ga0070672_100080834
1254 Ga0070672_100192757
1255 Ga0070672_100495690
1256 Ga0070672_100883347
1257 Ga0070672_101273261
1258 Ga0070686_100021540
1259 Ga0070686_100188577
1260 Ga0070686_100514722
1261 Ga0070686_100538116
1262 Ga0070695_100131966
1263 Ga0070696_100008395
1264 Ga0070696_100368872
1265 Ga0070696_100912601
1266 Ga0070693_100000475
1267 Ga0070693_100981345
1268 Ga0070693_100988793
1269 Ga0070665_100002713
1270 Ga0070665_100082137
1271 Ga0070665_100097309
1272 Ga0070665_100115957
1273 Ga0070665_100291311
1274 Ga0070665_100792834
1275 Ga0070704_100971594
1276 Ga0068855_100000886
1277 Ga0068855_100031285
1278 Ga0068855_100035910
1279 Ga0068855_100103290
1280 Ga0068855_100204557
1281 Ga0068855_100205784
1282 Ga0068855_100263415
1283 Ga0068855_101047836
1284 Ga0068855_102127796
1285 Ga0070664_100000195
1286 Ga0070664_100001042
1287 Ga0070664_100007554
1288 Ga0070664_100016860
1289 Ga0070664_100021481
1290 Ga0070664_100187085
1291 Ga0070664_100267403
1292 Ga0070664_100306853
1293 Ga0070664_100506886
1294 Ga0068857_100001494
1295 Ga0068857_100017124
1296 Ga0068857_100026491
1297 Ga0068857_100188621
1298 Ga0068857_100302015
1299 Ga0068857_100813925
1300 Ga0068857_100851293
1301 Ga0068854_100000234
1302 Ga0068854_100079880
1303 Ga0068854_100082271
1304 Ga0068854_100127957
1305 Ga0068854_100173881
1306 Ga0068854_100442162
1307 Ga0068854_101356720
1308 Ga0068856_100000235
1309 Ga0068856_100150026
1310 Ga0068856_100428158
1311 Ga0068856_100700369
1312 Ga0068856_100728650
1313 Ga0068856_101666467
1314 Ga0068852_100000152
1315 Ga0068852_100000803
1316 Ga0068852_100008553
1317 Ga0068852_100018619
1318 Ga0068852_100070794
1319 Ga0068852_100078520
1320 Ga0068852_100098910
1321 Ga0068852_100212426
1322 Ga0068852_100948727
1323 Ga0068859_100000709
1324 Ga0068859_100012322
1325 Ga0068859_100266097
1326 Ga0068859_100398339
1327 Ga0068859_100450323
1328 Ga0068859_100603352
1329 Ga0068859_101760564
1330 Ga0068864_100000484
1331 Ga0068864_100022759
1332 Ga0068864_100026504
1333 Ga0068864_100055180
1334 Ga0068864_100066492
1335 Ga0068864_100243483
1336 Ga0068864_102416221
1337 Ga0068866_10083649
1338 Ga0068866_10527019
1339 Ga0068861_100125885
1340 Ga0068861_100299168
1341 Ga0068851_10011920
1342 Ga0068851_10018616
1343 Ga0068851_10144361
1344 Ga0068851_10154246
1345 Ga0068851_10580710
1346 Ga0068851_10838322
1347 Ga0068870_10032107
1348 Ga0068863_100003106
1349 Ga0068863_100006290
1350 Ga0068863_100013655
1351 Ga0068863_100018253
1352 Ga0068863_100453615
1353 Ga0068863_100588376
1354 Ga0068858_100004386
1355 Ga0068858_100009866
1356 Ga0068858_100018774
1357 Ga0068858_100058815
1358 Ga0068858_100120174
1359 Ga0068858_100173807
1360 Ga0068858_100490319
1361 Ga0068860_100005369
1362 Ga0068860_100035778
1363 Ga0068860_100040414
1364 Ga0068860_100059841
1365 Ga0068860_100099732
1366 Ga0068860_100847754
1367 Ga0068862_100017890
1368 Ga0068862_100020943
1369 Ga0068862_100074154
1370 Ga0068862_100354305
1371 Ga0075364_10294014
1372 Ga0075427_10084345
1373 Ga0075366_10116022
1374 Ga0097621_100010997
1375 Ga0097621_100054433
1376 Ga0097621_100156089
1377 Ga0097621_101348975
1378 Ga0068871_100046330
1379 Ga0068871_100093002
1380 Ga0068871_100156790
1381 Ga0068871_100173953
1382 Ga0068871_100192566
1383 Ga0068871_100742447
1384 Ga0075428_101008512
1385 Ga0075428_102091520
1386 Ga0075431_100313569
1387 Ga0075433_10022479
1388 Ga0075434_100726079
1389 Ga0075429_100234577
1390 Ga0068865_100001817
1391 Ga0068865_100013047
1392 Ga0068865_100019012
1393 Ga0068865_100072710
1394 Ga0068865_100190597
1395 Ga0097620_100000709
1396 Ga0097620_100012322
1397 Ga0097620_100266100
1398 Ga0097620_100398328
1399 Ga0097620_100450322
1400 Ga0097620_100603326
1401 Ga0097620_101760316
1402 Ga0075435_100687904
1403 Ga0105251_10337078
1404 Ga0105240_10114869
1405 Ga0105240_10213287
1406 Ga0105240_10245838
1407 Ga0105240_10304973
1408 Ga0105245_10000062
1409 Ga0105245_10255282
1410 Ga0114129_10187456
1411 Ga0105243_10047441
1412 Ga0105243_10201533
1413 Ga0105243_10367731
1414 Ga0105243_10870043
1415 Ga0105243_12731451
1416 Ga0105241_10032348
1417 Ga0105241_10158237
1418 Ga0105242_10022212
1419 Ga0105242_10295389
1420 Ga0105242_10985362
1421 Ga0105242_12186225
1422 Ga0105248_10000117
1423 Ga0105248_10000122
1424 Ga0105248_10004086
1425 Ga0105248_10023802
1426 Ga0105248_10071435
1427 Ga0105248_10108887
1428 Ga0105248_10116693
1429 Ga0105248_10117210
1430 Ga0105248_10264115
1431 Ga0105248_10345902
1432 Ga0105248_10563866
1433 Ga0105248_10581623
1434 Ga0105238_10012031
1435 Ga0105238_10016249
1436 Ga0105238_10078241
1437 Ga0105238_11247148
1438 Ga0105249_10099059
1439 Ga0105249_10214710
1440 Ga0105249_10551335
1441 Ga0105239_10019409
1442 Ga0105239_10146742
1443 Ga0105246_10001831
1444 Ga0105246_10019051
1445 Ga0105246_10125454
1446 Ga0105246_10538172
1447 Ga0105246_10599880
1448 Ga0157373_10005834
1449 Ga0157373_10013422
1450 Ga0157373_10124288
1451 Ga0157373_10145782
1452 Ga0157373_10182787
1453 Ga0157373_10234749
1454 Ga0157373_10236975
1455 Ga0157373_10284787
1456 Ga0157373_10470657
1457 Ga0157373_10614303
1458 Ga0157371_10001576
1459 Ga0157371_10034597
1460 Ga0157371_10146047
1461 Ga0157371_10150522
1462 Ga0157371_10221680
1463 Ga0157371_10298469
1464 Ga0157371_10607055
1465 Ga0157370_10285323
1466 Ga0157370_10302086
1467 Ga0157370_10395951
1468 Ga0157369_10002492
1469 Ga0157369_10052377
1470 Ga0157369_10118313
1471 Ga0157369_10190948
1472 Ga0157369_11241616
1473 Ga0157374_10003140
1474 Ga0157374_10040842
1475 Ga0157374_11327494
1476 Ga0157374_11466728
1477 Ga0157378_10000242
1478 Ga0157378_10023210
1479 Ga0157378_10173512
1480 Ga0157378_10189491
1481 Ga0157378_10325883
1482 Ga0157378_11351393
1483 Ga0163162_10003750
1484 Ga0163162_10024784
1485 Ga0163162_10116229
1486 Ga0163162_10128856
1487 Ga0163162_10141169
1488 Ga0163162_10260465
1489 Ga0163162_10348202
1490 Ga0157372_10145762
1491 Ga0157372_10153067
1492 Ga0157372_10167654
1493 Ga0157372_10703402
1494 Ga0157375_10012250
1495 Ga0157375_10043165
1496 Ga0157375_10122329
1497 Ga0157375_10156163
1498 Ga0157375_10159263
1499 Ga0157375_10548496
1500 Ga0163163_10000357
1501 Ga0163163_10000903
1502 Ga0163163_10113176
1503 Ga0163163_13227964
1504 Ga0157380_10006578
1505 Ga0157380_10157798
1506 Ga0157380_10995478
1507 Ga0157377_10011418
1508 Ga0157377_10139503
1509 Ga0157379_10019182
1510 Ga0157379_10316507
1511 Ga0157379_10574932
1512 Ga0157376_10004500
1513 Ga0157376_11141785
1514 Ga0163161_10157683
1515 Ga0163161_10200556
1516 Ga0163161_11458745
1517 Ga0207697_10000002
1518 Ga0207697_10213997
1519 Ga0207656_10006804
1520 Ga0207656_10170312
1521 Ga0207682_10089284
1522 Ga0207688_10025735
1523 Ga0207688_10113858
1524 Ga0207688_10486437
1525 Ga0207680_10000275
1526 Ga0207680_10003154
1527 Ga0207680_10066582
1528 Ga0207680_10077205
1529 Ga0207680_10096139
1530 Ga0207680_10143936
1531 Ga0207680_10148198
1532 Ga0207647_10000095
1533 Ga0207647_10000304
1534 Ga0207647_10049152
1535 Ga0207647_10233612
1536 Ga0207647_10234540
1537 Ga0207647_10431120
1538 Ga0207645_10002184
1539 Ga0207645_10003435
1540 Ga0207645_10047004
1541 Ga0207645_10342241
1542 Ga0207645_10364942
1543 Ga0207705_10000245
1544 Ga0207705_10026345
1545 Ga0207705_10088961
1546 Ga0207705_10164306
1547 Ga0207705_10168415
1548 Ga0207705_10614787
1549 Ga0207705_10997807
1550 Ga0207654_10382449
1551 Ga0207707_10520610
1552 Ga0207695_10042673
1553 Ga0207695_10229282
1554 Ga0207671_10359672
1555 Ga0207660_10000098
1556 Ga0207660_10008914
1557 Ga0207660_10302758
1558 Ga0207662_10096528
1559 Ga0207657_10000244
1560 Ga0207657_10003663
1561 Ga0207657_10004104
1562 Ga0207657_10018814
1563 Ga0207657_10041476
1564 Ga0207657_10053558
1565 Ga0207657_10147462
1566 Ga0207657_10189964
1567 Ga0207657_10268640
1568 Ga0207657_10351550
1569 Ga0207657_10468392
1570 Ga0207657_10494265
1571 Ga0207657_10559810
1572 Ga0207649_10001377
1573 Ga0207649_10010802
1574 Ga0207649_10054365
1575 Ga0207649_10070819
1576 Ga0207649_10126489
1577 Ga0207649_10234934
1578 Ga0207649_10392355
1579 Ga0207649_11049300
1580 Ga0207652_10068312
1581 Ga0207652_10403164
1582 Ga0207652_10721165
1583 Ga0207681_10000678
1584 Ga0207681_10033297
1585 Ga0207681_10810613
1586 Ga0207694_10004269
1587 Ga0207694_10006749
1588 Ga0207694_10238601
1589 Ga0207694_11064839
1590 Ga0207650_10005531
1591 Ga0207650_10012207
1592 Ga0207650_10028562
1593 Ga0207650_10039667
1594 Ga0207650_10042652
1595 Ga0207650_10100341
1596 Ga0207650_10140075
1597 Ga0207650_10165187
1598 Ga0207659_10071658
1599 Ga0207659_10134443
1600 Ga0207659_10174688
1601 Ga0207659_10298454
1602 Ga0207659_10586577
1603 Ga0207659_10873820
1604 Ga0207687_10000426
1605 Ga0207687_10482118
1606 Ga0207644_10000216
1607 Ga0207644_10000425
1608 Ga0207644_10003742
1609 Ga0207644_10008203
1610 Ga0207644_10031470
1611 Ga0207644_10240509
1612 Ga0207644_10301953
1613 Ga0207690_10000240
1614 Ga0207690_10004708
1615 Ga0207690_10027986
1616 Ga0207690_10049769
1617 Ga0207690_10066081
1618 Ga0207690_10075183
1619 Ga0207690_10194994
1620 Ga0207690_10266372
1621 Ga0207690_10445384
1622 Ga0207690_10685712
1623 Ga0207690_10719981
1624 Ga0207690_11125204
1625 Ga0207690_11128527
1626 Ga0207706_10000335
1627 Ga0207706_10000461
1628 Ga0207706_10001976
1629 Ga0207706_10003509
1630 Ga0207706_10004122
1631 Ga0207706_10005979
1632 Ga0207706_10013808
1633 Ga0207706_10025169
1634 Ga0207706_10044646
1635 Ga0207706_10048873
1636 Ga0207706_10171559
1637 Ga0207706_10175704
1638 Ga0207706_10542268
1639 Ga0207706_10608797
1640 Ga0207706_10610375
1641 Ga0207686_10006392
1642 Ga0207686_10032580
1643 Ga0207686_10063216
1644 Ga0207709_10005223
1645 Ga0207709_10035747
1646 Ga0207670_10004327
1647 Ga0207670_10406272
1648 Ga0207669_10012733
1649 Ga0207669_10013820
1650 Ga0207669_10063137
1651 Ga0207669_10073515
1652 Ga0207669_10079853
1653 Ga0207704_10001794
1654 Ga0207704_10018877
1655 Ga0207704_10023938
1656 Ga0207704_10056752
1657 Ga0207704_10282269
1658 Ga0207704_10405856
1659 Ga0207691_10000133
1660 Ga0207691_10003304
1661 Ga0207691_10027722
1662 Ga0207691_10031002
1663 Ga0207691_10036112
1664 Ga0207691_10063390
1665 Ga0207691_10224097
1666 Ga0207691_10252909
1667 Ga0207711_10000245
1668 Ga0207711_10005739
1669 Ga0207711_10006525
1670 Ga0207711_10013738
1671 Ga0207711_10017919
1672 Ga0207711_10043655
1673 Ga0207711_10049124
1674 Ga0207711_10146862
1675 Ga0207711_10231088
1676 Ga0207711_10318283
1677 Ga0207711_10378905
1678 Ga0207711_10384004
1679 Ga0207711_10573498
1680 Ga0207689_10000002
1681 Ga0207689_10053969
1682 Ga0207689_11364077
1683 Ga0207661_10002671
1684 Ga0207661_10542702
1685 Ga0207679_10000147
1686 Ga0207679_10005442
1687 Ga0207679_10013893
1688 Ga0207679_10019733
1689 Ga0207679_10107178
1690 Ga0207679_10133428
1691 Ga0207679_10138339
1692 Ga0207679_10830056
1693 Ga0207679_10907587
1694 Ga0207679_11029186
1695 Ga0207679_11253978
1696 Ga0207667_10001485
1697 Ga0207667_10014799
1698 Ga0207667_10093682
1699 Ga0207667_10269733
1700 Ga0207667_10300491
1701 Ga0207667_11803417
1702 Ga0207651_10001487
1703 Ga0207651_10042540
1704 Ga0207651_10083222
1705 Ga0207651_10089511
1706 Ga0207651_10155441
1707 Ga0207651_10506867
1708 Ga0207651_10707698
1709 Ga0207651_10973118
1710 Ga0207712_10000817
1711 Ga0207712_10111493
1712 Ga0207712_10479291
1713 Ga0207668_10000176
1714 Ga0207668_10058526
1715 Ga0207668_10302397
1716 Ga0207668_10641254
1717 Ga0207668_11142960
1718 Ga0207668_11151537
1719 Ga0207668_11334763
1720 Ga0207640_10000349
1721 Ga0207640_10026584
1722 Ga0207640_10290719
1723 Ga0207640_11231084
1724 Ga0207658_10003010
1725 Ga0207658_10038183
1726 Ga0207658_10053673
1727 Ga0207658_10126455
1728 Ga0207658_10130453
1729 Ga0207658_10170891
1730 Ga0207658_10497349
1731 Ga0207658_10532839
1732 Ga0207677_10000758
1733 Ga0207677_10002060
1734 Ga0207677_10283258
1735 Ga0207677_10507293
1736 Ga0207677_10799432
1737 Ga0207677_11192174
1738 Ga0207703_10003215
1739 Ga0207703_10008264
1740 Ga0207703_10026756
1741 Ga0207703_10030405
1742 Ga0207703_10074506
1743 Ga0207703_10333949
1744 Ga0207703_10619640
1745 Ga0207639_10000135
1746 Ga0207639_10000400
1747 Ga0207639_10064303
1748 Ga0207639_10081577
1749 Ga0207639_10203850
1750 Ga0207639_10468506
1751 Ga0207639_10663728
1752 Ga0207639_10670229
1753 Ga0207639_10698582
1754 Ga0207678_10010891
1755 Ga0207678_10032820
1756 Ga0207678_10060142
1757 Ga0207678_10093157
1758 Ga0207702_10001164
1759 Ga0207702_10287507
1760 Ga0207702_10380795
1761 Ga0207641_10009291
1762 Ga0207641_10012234
1763 Ga0207641_10024495
1764 Ga0207641_10099691
1765 Ga0207641_10591633
1766 Ga0207648_10000088
1767 Ga0207648_10001235
1768 Ga0207648_10005627
1769 Ga0207648_10289809
1770 Ga0207648_10741250
1771 Ga0207648_10884523
1772 Ga0207676_10025482
1773 Ga0207676_10030018
1774 Ga0207676_10040446
1775 Ga0207676_10068185
1776 Ga0207676_11198313
1777 Ga0207676_11752653
1778 Ga0207674_10000742
1779 Ga0207674_10001363
1780 Ga0207674_10060680
1781 Ga0207674_10064362
1782 Ga0207674_10146193
1783 Ga0207674_10333986
1784 Ga0207675_100106817
1785 Ga0207675_100224276
1786 Ga0207675_100390555
1787 Ga0207675_100426692
1788 Ga0207683_10008913
1789 Ga0207683_10009993
1790 Ga0207683_10027044
1791 Ga0207683_10038396
1792 Ga0207683_10073642
1793 Ga0207683_11752910
1794 Ga0207698_10000344
1795 Ga0207698_10010420
1796 Ga0207698_10051136
1797 Ga0207698_10051553
1798 Ga0207698_10196711
1799 Ga0207698_10385332
1800 Ga0207698_10656558
1801 Ga0207698_10714871
1802 Ga0207698_11023731
1803 Ga0209970_1012842
1804 Ga0209983_1139022
1805 Ga0209974_10005626
1806 Ga0268266_10074425
1807 Ga0268266_10268590
1808 Ga0268266_10284578
1809 Ga0268266_10462300
1810 Ga0268265_10002950
1811 Ga0268265_10022091
1812 Ga0268265_10023913
1813 Ga0268265_10077657
1814 Ga0268264_10003191
1815 Ga0268264_10018984
1816 Ga0268264_10038046
1817 Ga0268264_10089146
1818 Ga0268264_10252499
1819 Ga0268264_10257109
1820 Ga0268264_10700058
1821 Ga0307408_100009048
1822 Ga0307408_100055854
1823 Ga0307408_100138214
1824 Ga0307408_100522935
1825 Ga0307405_10009522
1826 Ga0307405_10019778
1827 Ga0307405_11476672
1828 Ga0307413_10016649
1829 Ga0307413_10036381
1830 Ga0307413_10696086
1831 Ga0307413_11123413
1832 Ga0307410_10037887
1833 Ga0307410_10040687
1834 Ga0307410_10085889
1835 Ga0307410_10125680
1836 Ga0307410_10155703
1837 Ga0307410_10323515
1838 Ga0307410_10459600
1839 Ga0307410_10529838
1840 Ga0307410_10645643
1841 Ga0307406_10058308
1842 Ga0307406_10352833
1843 Ga0307407_10006604
1844 Ga0307407_10147083
1845 Ga0307407_10254882
1846 Ga0307407_10573244
1847 Ga0307412_10021540
1848 Ga0307412_10054807
1849 Ga0307412_10231859
1850 Ga0307412_10261771
1851 Ga0307412_10351259
1852 Ga0307409_100063021
1853 Ga0307409_100108641
1854 Ga0307409_100190490
1855 Ga0307409_100214016
1856 Ga0307409_100218411
1857 Ga0307409_100286487
1858 Ga0307409_100552015
1859 Ga0307409_100596711
1860 Ga0307409_101599020
1861 Ga0307416_100009614
1862 Ga0307416_100023344
1863 Ga0307416_100086658
1864 Ga0307416_100361762
1865 Ga0307416_100483990
1866 Ga0307416_100495309
1867 Ga0307414_10027542
1868 Ga0307414_10031691
1869 Ga0307414_10138729
1870 Ga0307414_10177961
1871 Ga0307414_10241959
1872 Ga0307414_10278085
1873 Ga0307414_10353408
1874 Ga0307414_10534404
1875 Ga0307414_11107351
1876 Ga0307411_10007250
1877 Ga0307411_10031234
1878 Ga0307411_10043772
1879 Ga0307411_10072248
1880 Ga0307411_10212418
1881 Ga0307411_10485268
1882 Ga0307415_100198558
1883 Ga0307415_100239577
1884 Ga0307415_100307429
1885 Ga0307415_100340828
1886 Ga0307415_100367981
1887 Ga0307415_100526903
1888 Ga0373948_0058023
1889 Ga0373938_0021824
1890 Ga0373951_0078763
1891 Ga0373939_0271470
1892 Ga0373960_0078462
1893 Ga0373943_0693480
1894 Ga0373961_0021345
1895 Ga0373931_0003481
1896 Ga0373935_0106250
1897 Ga0395899_0003722
1898 Ga0395899_0025132
1899 Ga0395899_0056137
1900 Ga0395899_0078448
1901 Ga0395899_0111393
1902 Ga0395899_0148175
1903 Ga0395899_0337433
1904 Ga0395899_0423725
1905 Ga0395899_0475966
1906 Ga0395900_0039751
1907 Ga0395900_0049160
1908 Ga0395900_0054482
1909 Ga0395900_0069849
1910 Ga0395900_0158049
1911 Ga0395900_0206634
1912 Ga0395900_0257806
1913 Ga0395900_0308185
1914 Ga0395900_0317773
1915 Ga0395900_0396785
1916 Ga0395900_0463818
1917 Ga0395900_0497915
1918 Ga0395900_0594576
1919 Ga0395900_0658514
1920 Ga0395900_0723305
1921 Ga0395900_0796033
1922 Ga0395900_0992857
1923 Ga0395900_1222773
1924 Ga0395900_1728988
1925 Ga0395898_0003591
1926 Ga0395898_0029997
1927 Ga0395898_0137589
1928 Ga0395898_0269743
1929 Ga0395898_0716269
1930 Ga0395898_1143411
1931 Ga0395898_1656985
1932 Ga0395905_0001242
1933 Ga0395905_0005799
1934 Ga0395905_0013710
1935 Ga0395905_0020190
1936 Ga0395905_0033231
1937 Ga0395905_0040804
1938 Ga0395905_0052778
1939 Ga0395905_0100072
1940 Ga0395905_0143481
1941 Ga0395905_0152368
1942 Ga0395905_0152529
1943 Ga0395905_0160086
1944 Ga0395905_0241229
1945 Ga0395905_0250027
1946 Ga0395905_0270099
1947 Ga0395905_0271533
1948 Ga0395905_0566233
1949 Ga0395905_0616506
1950 Ga0395905_0789564
1951 Ga0395905_1034767
1952 Ga0395905_1186596
1953 Ga0395905_1368250
1954 Ga0395901_0038232
1955 Ga0395901_0040734
1956 Ga0395901_0041240
1957 Ga0395901_0142099
1958 Ga0395901_0271904
1959 Ga0395901_0334381
1960 Ga0395901_0335853
1961 Ga0395901_0365762
1962 Ga0395901_0432261
1963 Ga0395901_0484814
1964 Ga0395901_0649440
1965 Ga0395901_0702635
1966 Ga0395901_1040036
1967 Ga0466960_0948166
1968 Ga0466967_0346597
1969 Ga0466967_0377507
1970 Ga0495584_0283390
1971 Ga0495643_0098522
1972 Ga0495643_0263813
1973 Ga0495642_0192705
1974 Ga0495621_0244942
1975 Ga0495668_0068471
1976 Ga0495668_0296325
1977 Ga0495669_0004837
1978 Ga0495669_0016890
1979 Ga0495669_0140896
1980 Ga0495669_0229470
1981 Ga0495677_0093915
1982 Ga0496100_0002542
1983 Ga0496100_0074726
1984 Ga0496101_0002504
1985 Ga0496101_0066389
1986 Ga0496101_0168416
1987 Ga0496101_1099540
1988 Ga0496102_0169710
1989 Ga0496102_0188829
1990 Ga0496103_0135466
1991 Ga0496104_0038127
1992 Ga0496104_0974670
1993 Ga0496105_0113732
1994 Ga0496105_0354635
1995 Ga0496106_0348935
1996 Ga0496107_0008638
1997 Ga0496107_0066685
1998 Ga0496107_0086208
1999 Ga0496107_0116101
2000 Ga0496107_0354648
2001 Ga0496107_1198466
2002 Ga0496108_0003163
2003 Ga0496108_0009750
2004 Ga0496109_0012771
2005 Ga0496109_0119753
2006 Ga0496109_0150391
2007 Ga0496109_0381552
2008 Ga0496110_0007791
2009 Ga0496110_0019871
2010 Ga0496110_0205734
2011 Ga0496110_0222550
2012 Ga0496110_0298362
2013 Ga0496111_0029951
2014 Ga0496111_0115668
2015 Ga0496111_0591423
2016 Ga0496111_0616530
2017 Ga0496112_0008002
2018 Ga0496112_0010868
2019 Ga0496112_0028399
2020 Ga0496112_0098970
2021 Ga0496112_0222481
2022 Ga0496113_0029573
2023 Ga0496113_0144783
2024 Ga0496113_0263509
2025 Ga0496114_0023975
2026 Ga0496114_0223945
2027 Ga0496115_0008740
2028 Ga0501068_0190334
2029 Ga0501070_1384819
2030 Ga0501230_049849
2031 Ga0501233_251104
2032 Ga0501249_023422
2033 Ga0501252_024766
2034 Ga0501080_0020584
2035 Ga0501263_034662
2036 Ga0501267_005746
2037 Ga0501268_017303
2038 Ga0501272_004511
2039 nmdc:mga03683_418981_c1
2040 nmdc:mga00v17_498032_c1
2041 nmdc:mga06r32_362456_c1
2042 nmdc:mga0a205_31720_c1
2043 Ga0495655_0016356
2044 Ga0500658_0000022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6h-assembly1.cif.gz_EG cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.3613 70 150
1g0a-assembly1.cif.gz_D carbonmonoxy liganded bovine hemoglobin ph 8.5 0.2968 8 139
3qjc-assembly1.cif.gz_B-2 human hemoglobin a mutant beta h63l carbonmonoxy-form 0.2965 8 145
8b6h-assembly1.cif.gz_EG cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.2942 70 150
6wpw-assembly1.cif.gz_R gcgr-gs signaling complex bound to a designed glucagon derivative 0.2885 18 150
ID Description Score Start End Superfamily
af_D3Z5L6_227_437_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4376 4 154 1.20.1250.20
af_Q9P6J0_262_460_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4189 3 153 1.20.1250.20
af_P53322_313_509_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4144 8 154 1.20.1250.20
af_Q63ZE4_120_534_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4125 34 146 1.20.1250.20
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.403 3 146 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A2U1FZ02-F1-model_v4 deleted 0.9744 1 151
AF-A0A4Q5S4D8-F1-model_v4 DUF1440 domain-containing protein 0.9666 3 143 GO:0016020
AF-A0A7X9ZN18-F1-model_v4 DUF1440 domain-containing protein 0.9607 3 142 GO:0016020
AF-A0A4Q5SJI0-F1-model_v4 DUF1440 domain-containing protein 0.9587 3 143 GO:0016020
AF-A0A7G5Z8I3-F1-model_v4 DUF1440 domain-containing protein 0.9492 1 146 GO:0016020

Map