F488433

General Info

Members Datasets Scaffolds Average Seq Length
1023 504 957 446

Family's Representative Sequence

Representative Sequence 3300003751|Ga0055538_1000013|Ga0055538_1000013113
Length 477
Sequence MIQDGMRRGPAVSRETGRGGPGLRHKKEKDKADMAAKYFGTDGVRGRVGVAPITPDFVMRLGYAAGKVLAKAKDGMARPTVLIGKDTRISGYMLEAALEAGFAAAGVDVWLPGPVPTPAVAYLTRALRLSAGVVISASHNPYHDNGIKFFSANGNKLPDAVEADIEAALEQPMDCVPSEKLGKARRLSDAPGRYIEFCKSTFPSAMNLRGMRLVVDCAHGAAYNIAPHVFHELGAEVITIGNQPDGLNINEDCGATAPKTLVASVREYRADLGIALDGDADRLIMVDGEGRIYNGDELLYLMVKDRLATGPVEGAVGTLMTNMALEVAFRKMGVPFERAKVGDRYVLEVLQEKGWLLGGEGSGHLLALDKHTTGDGIVSALQVLTALKRSGQTLAEMTADITMYPQSLVNVKIPAGYDWKSNAALQAEKAAVEEELGERGRVLLRPSGTEPLIRVMVEAQQADLARSMAQRIAAKVL

Samples

Sample ID Description Type Environment
1 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
6 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
7 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
8 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
9 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
10 2643221556 Massilia sp. Root1485 Isolate Unclassified
11 2643221638 Duganella sp. Root336D2 Isolate Unclassified
12 2643221645 Massilia sp. Root351 Isolate Unclassified
13 2643221664 Massilia sp. Root418 Isolate Unclassified
14 2643221684 Massilia sp. Root133 Isolate Unclassified
15 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
16 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
17 2738541280 Massilia sp. GV090 Isolate Unclassified
18 2738541297 Duganella sp. GV083 Isolate Unclassified
19 2738541300 Massilia sp. GV016 Isolate Unclassified
20 2738541357 Duganella sp. GV053 Isolate Unclassified
21 2738543003 Duganella sp. GV066 Isolate Unclassified
22 2738543018 Massilia sp. GV045 Isolate Unclassified
23 2738543026 Duganella sp. GV089 Isolate Unclassified
24 2738543029 Duganella sp. GV039 Isolate Unclassified
25 2738543030 Massilia sp. GV097 Isolate Unclassified
26 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
27 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
28 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
29 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
30 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
31 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
32 2818991436 Collimonas arenae 515 Isolate Unclassified
33 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
34 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
35 2821131069 Duganella sp. 1224 Isolate Unclassified
36 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
37 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
38 2842711865 Duganella sp. R-73148 Isolate Unclassified
39 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
40 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
41 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
42 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
43 2857553236 Duganella sp. R-74557 Isolate Unclassified
44 2857558681 Duganella sp. R-74565 Isolate Unclassified
45 2857564685 Duganella sp. R-74599 Isolate Unclassified
46 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
47 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
48 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
49 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
50 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
51 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
52 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
53 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
54 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
55 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
56 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
57 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
58 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
59 2919476304 Duganella sp. 3397 Isolate Unclassified
60 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
61 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
62 2952252522 Salinicola sp. DM10 Isolate Unclassified
63 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
64 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
65 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
66 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
67 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
68 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
69 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
70 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
71 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
72 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
73 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
74 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
75 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
76 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
77 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
78 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
80 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
81 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
82 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
83 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
84 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
85 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
86 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
87 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
88 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
89 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
90 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
91 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
92 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
93 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
94 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
95 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
96 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
97 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
98 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
99 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
100 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
101 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
102 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
103 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
104 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
105 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
106 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
107 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
108 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
109 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
110 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
111 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
112 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
113 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
114 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
115 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
116 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
117 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
118 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
119 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
120 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
121 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
122 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
123 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
124 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
125 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
126 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
127 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
128 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
129 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
130 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
131 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
132 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
133 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
134 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
135 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
136 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
137 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
138 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
139 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
140 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
141 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
142 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
143 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
144 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
145 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
146 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
147 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
148 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
149 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
150 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
151 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
152 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
153 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
155 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
156 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
157 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
158 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
159 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
160 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
161 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
162 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
163 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
164 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
165 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
166 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
167 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
168 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
169 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
170 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
171 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
172 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
173 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
174 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
175 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
176 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
177 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
178 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
179 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
182 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
183 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
184 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
185 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
186 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
187 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
188 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
189 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
190 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
191 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
192 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
193 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
195 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
196 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
197 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
198 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
200 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
206 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
207 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
209 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
210 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
211 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
214 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
215 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
216 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
217 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
220 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
222 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
223 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
224 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
226 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
227 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
228 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
278 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
280 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
281 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
282 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
283 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
284 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
285 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
286 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
287 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
288 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
289 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
290 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
291 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
294 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
295 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
297 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
298 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
299 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
300 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
301 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
302 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
303 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
304 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
305 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
306 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
307 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
308 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
309 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
310 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
311 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
312 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
313 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
314 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
315 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
316 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
317 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
318 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
319 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
320 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
321 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
322 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
323 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
324 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
325 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
326 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
327 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
328 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
329 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
330 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
331 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
332 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
333 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
334 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
335 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
336 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
337 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
338 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
339 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
340 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
341 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
342 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
343 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
344 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
345 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
346 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
347 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
348 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
349 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
350 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
351 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
352 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
353 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
354 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
355 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
356 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
357 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
358 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
359 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
360 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
361 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
362 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
363 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
364 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
365 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
366 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
367 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
368 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
369 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
370 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
371 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
372 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
373 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
374 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
375 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
376 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
377 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
378 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
379 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
380 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
381 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
382 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
383 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
384 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
385 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
386 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
387 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
388 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
389 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
390 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
391 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
392 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
393 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
394 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
395 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
396 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
397 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
398 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
399 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
400 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
401 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
402 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
403 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
404 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
405 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
406 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
407 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
408 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
409 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
410 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
411 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
412 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
413 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
414 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
415 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
416 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
417 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
418 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
419 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
420 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
421 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
422 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
423 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
424 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
425 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
426 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
427 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
428 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
429 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
430 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
431 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
432 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
433 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
434 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
435 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
436 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
437 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
438 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
439 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
440 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
441 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
442 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
443 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
444 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
445 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
446 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
447 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
448 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
449 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
450 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
451 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
452 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
453 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
454 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
455 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
456 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
457 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
467 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
468 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
469 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
470 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
471 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
472 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
473 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
474 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
475 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
476 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
477 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
478 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
479 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
480 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
483 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
484 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
485 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
486 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
487 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
488 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
489 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
490 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
491 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
492 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
493 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
494 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
495 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
496 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
497 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
498 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
499 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
500 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
501 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
502 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
503 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
504 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.47
Metatranscriptomes 1.08
Isolates 6.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.48
Nodule 0.68
Rhizoplane 3.03
Rhizosphere 77.61
Stem 0
Stem Tuber 0
Unclassified 9.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001895 3300001979 Bacteria 9587
2 JGI24751J29686_10008669 3300002459 Bacteria 2083
3 JGI25155J39150_1000275 3300002704 Bacteria 18778
4 JGI25155J39150_1000300 3300002704 Bacteria 16946
5 JGI25156J39149_1000654 3300002705 Bacteria 18946
6 JGI25154J39366_1001008 3300002738 Bacteria 11332
7 JGI25154J39366_1001607 3300002738 Bacteria 7679
8 JGI25158J39367_1002873 3300002739 Bacteria 2730
9 JGI25158J39367_1003610 3300002739 Bacteria 2374
10 JGI25157J39369_1000620 3300002741 Bacteria 20062
11 JGI25152J39213_1001570 3300002773 Bacteria 9614
12 JGI25150J39212_1002715 3300002774 Bacteria 4308
13 JGI25150J39212_1002852 3300002774 Bacteria 4185
14 JGI25150J39212_1006946 3300002774 Bacteria 2302
15 JGI25165J46597_1000172 3300003214 Bacteria 101521
16 JGI25153J46596_10016740 3300003215 Bacteria 2920
17 Ga0007417J51691_1020175 3300003544 Bacteria 5032
18 Ga0007410J51695_1027423 3300003574 Bacteria 4817
19 Ga0007409J51694_1021755 3300003575 Bacteria 2972
20 Ga0007409J51694_1027849 3300003575 Bacteria 1871
21 Ga0007416J51690_1014475 3300003577 Bacteria 7645
22 Ga0032354_1020813 3300003693 Bacteria 5526
23 Ga0055538_1000013 3300003751 Bacteria 348596
24 Ga0055538_1000063 3300003751 Bacteria 101521
25 Ga0055539_1000018 3300003752 Bacteria 348596
26 Ga0055539_1000096 3300003752 Bacteria 101521
27 Ga0055533_1000022 3300003756 Bacteria 348596
28 Ga0055533_1000107 3300003756 Bacteria 101521
29 Ga0055532_1000017 3300003758 Bacteria 306880
30 Ga0055525_1000024 3300003759 Bacteria 348596
31 Ga0055525_1000047 3300003759 Bacteria 261507
32 Ga0055525_1000140 3300003759 Bacteria 101521
33 Ga0055535_1006068 3300003761 Bacteria 2516
34 Ga0055526_1016792 3300003771 Bacteria 2839
35 Ga0055537_1000330 3300003773 Bacteria 32350
36 Ga0055524_1001358 3300003775 Bacteria 14234
37 Ga0055524_1011067 3300003775 Bacteria 3548
38 Ga0055524_1012021 3300003775 Bacteria 3347
39 Ga0055534_1000606 3300003784 Bacteria 18579
40 Ga0055528_1000364 3300003790 Bacteria 36795
41 Ga0055530_10013065 3300003791 Bacteria 2855
42 Ga0055530_10014339 3300003791 Bacteria 2646
43 Ga0055531_10004518 3300003794 Bacteria 8447
44 Ga0055531_10028903 3300003794 Bacteria 1901
45 Ga0055541_1000013 3300003841 Bacteria 348596
46 Ga0055541_1000064 3300003841 Bacteria 101521
47 Ga0055543_1003234 3300004625 Bacteria 4931
48 Ga0055543_1006226 3300004625 Bacteria 2915
49 Ga0065165_1000039 3300005262 Bacteria 208372
50 Ga0065165_1015571 3300005262 Bacteria 2892
51 Ga0070658_10023663 3300005327 Bacteria 4926
52 Ga0070658_10086252 3300005327 Bacteria 2582
53 Ga0070658_10094454 3300005327 Bacteria 2467
54 Ga0070658_10098905 3300005327 Bacteria 2410
55 Ga0070676_10068657 3300005328 Bacteria 2122
56 Ga0070690_100001150 3300005330 Bacteria 13626
57 Ga0070670_100023041 3300005331 Bacteria 5357
58 Ga0070670_100069835 3300005331 Bacteria 3016
59 Ga0068869_100001768 3300005334 Bacteria 12934
60 Ga0070680_100009999 3300005336 Bacteria 7309
61 Ga0070682_100034778 3300005337 Bacteria 3071
62 Ga0068868_100121854 3300005338 Bacteria 2128
63 Ga0068868_100153756 3300005338 Bacteria 1896
64 Ga0070660_100156513 3300005339 Bacteria 1834
65 Ga0070689_100002574 3300005340 Bacteria 11891
66 Ga0070689_100009280 3300005340 Bacteria 6970
67 Ga0070689_100119308 3300005340 Bacteria 2106
68 Ga0070689_100170526 3300005340 Bacteria 1763
69 Ga0070691_10008035 3300005341 Bacteria 4826
70 Ga0070691_10043259 3300005341 Bacteria 2133
71 Ga0070692_10003248 3300005345 Bacteria 6550
72 Ga0070692_10004046 3300005345 Bacteria 6057
73 Ga0070668_100010282 3300005347 Bacteria 6946
74 Ga0070675_100001897 3300005354 Bacteria 15424
75 Ga0070675_100024312 3300005354 Bacteria 4851
76 Ga0070671_100001411 3300005355 Bacteria 17952
77 Ga0070674_100073081 3300005356 Bacteria 2430
78 Ga0070674_100144524 3300005356 Bacteria 1789
79 Ga0070673_100106735 3300005364 Bacteria 2316
80 Ga0070688_100023396 3300005365 Bacteria 3633
81 Ga0070688_100163434 3300005365 Bacteria 1531
82 Ga0070659_100033847 3300005366 Bacteria 3972
83 Ga0070709_10013484 3300005434 Bacteria 4598
84 Ga0070709_10050553 3300005434 Bacteria 2605
85 Ga0070714_100037629 3300005435 Bacteria 4066
86 Ga0070714_100154152 3300005435 Bacteria 2073
87 Ga0070713_100001388 3300005436 Bacteria 15519
88 Ga0070711_100025581 3300005439 Bacteria 3864
89 Ga0070705_100034973 3300005440 Bacteria 2813
90 Ga0070700_100002896 3300005441 Bacteria 8816
91 Ga0070694_100061363 3300005444 Bacteria 2566
92 Ga0070663_100005913 3300005455 Bacteria 7321
93 Ga0070678_100034928 3300005456 Bacteria 3505
94 Ga0070681_10006572 3300005458 Bacteria 11321
95 Ga0070681_10026817 3300005458 Bacteria 5792
96 Ga0068867_100003190 3300005459 Bacteria 11555
97 Ga0070685_10065099 3300005466 Bacteria 2145
98 Ga0070706_100017426 3300005467 Bacteria 6627
99 Ga0070706_100040072 3300005467 Bacteria 4324
100 Ga0070707_100214422 3300005468 Bacteria 1876
101 Ga0070679_100030112 3300005530 Bacteria 5357
102 Ga0070679_100096088 3300005530 Bacteria 2951
103 Ga0070684_100034767 3300005535 Bacteria 4310
104 Ga0070684_100142665 3300005535 Bacteria 2167
105 Ga0070672_100040575 3300005543 Bacteria 3572
106 Ga0070686_100001567 3300005544 Bacteria 12852
107 Ga0070695_100016701 3300005545 Bacteria 4444
108 Ga0070695_100060199 3300005545 Bacteria 2461
109 Ga0070696_100009218 3300005546 Bacteria 6605
110 Ga0070696_100031219 3300005546 Bacteria 3651
111 Ga0070696_100031224 3300005546 Bacteria 3650
112 Ga0070693_100000782 3300005547 Bacteria 14044
113 Ga0070693_100000927 3300005547 Bacteria 13023
114 Ga0070693_100011430 3300005547 Bacteria 4471
115 Ga0070693_100020661 3300005547 Bacteria 3477
116 Ga0070665_100018219 3300005548 Bacteria 7043
117 Ga0070665_100153626 3300005548 Bacteria 2304
118 Ga0070704_100015546 3300005549 Bacteria 4784
119 Ga0068855_100000037 3300005563 Bacteria 158161
120 Ga0068855_100020817 3300005563 Bacteria 7864
121 Ga0068855_100056268 3300005563 Bacteria 4616
122 Ga0068855_100057771 3300005563 Bacteria 4547
123 Ga0068855_100120706 3300005563 Bacteria 3000
124 Ga0068854_100004957 3300005578 Bacteria 8391
125 Ga0068856_100024700 3300005614 Bacteria 5852
126 Ga0068856_100107915 3300005614 Bacteria 2780
127 Ga0070702_100000492 3300005615 Bacteria 14190
128 Ga0070702_100003343 3300005615 Bacteria 7161
129 Ga0068852_100024959 3300005616 Bacteria 4837
130 Ga0068852_100027944 3300005616 Bacteria 4607
131 Ga0068852_100046693 3300005616 Bacteria 3691
132 Ga0068859_100061203 3300005617 Bacteria 3793
133 Ga0068859_100076106 3300005617 Bacteria 3397
134 Ga0068866_10004054 3300005718 Bacteria 6013
135 Ga0068861_100005425 3300005719 Bacteria 8632
136 Ga0068870_10000308 3300005840 Bacteria 18098
137 Ga0068863_100010004 3300005841 Bacteria 9231
138 Ga0068858_100031576 3300005842 Bacteria 4920
139 Ga0068858_100032854 3300005842 Bacteria 4819
140 Ga0068858_100043474 3300005842 Bacteria 4165
141 Ga0068860_100020008 3300005843 Bacteria 6487
142 Ga0068862_100009752 3300005844 Bacteria 7940
143 Ga0068862_100028139 3300005844 Bacteria 4733
144 Ga0081539_10000178 3300005985 Bacteria 149201
145 Ga0070717_10061684 3300006028 Bacteria 3108
146 Ga0070717_10074695 3300006028 Bacteria 2834
147 Ga0075366_10006563 3300006195 Bacteria 6381
148 Ga0097621_100023306 3300006237 Bacteria 4818
149 Ga0097621_100221051 3300006237 Bacteria 1650
150 Ga0068871_100024724 3300006358 Bacteria 4662
151 Ga0068871_100087396 3300006358 Bacteria 2592
152 Ga0075428_100069025 3300006844 Bacteria 3866
153 Ga0075431_100051695 3300006847 Bacteria 4237
154 Ga0075434_100121819 3300006871 Bacteria 2624
155 Ga0075434_100197302 3300006871 Bacteria 2032
156 Ga0075429_100067974 3300006880 Bacteria 3101
157 Ga0075429_100099229 3300006880 Bacteria 2541
158 Ga0068865_100000273 3300006881 Bacteria 28375
159 Ga0075436_100001288 3300006914 Bacteria 17039
160 Ga0097620_100061206 3300006931 Bacteria 3793
161 Ga0097620_100076112 3300006931 Bacteria 3397
162 Ga0075435_100091052 3300007076 Bacteria 2516
163 Ga0099794_10078515 3300007265 Bacteria 1625
164 Ga0105240_10039974 3300009093 Bacteria 6004
165 Ga0105240_10056621 3300009093 Bacteria 4905
166 Ga0105240_10057195 3300009093 Bacteria 4875
167 Ga0105240_10074646 3300009093 Bacteria 4185
168 Ga0111539_10000505 3300009094 Bacteria 49662
169 Ga0111539_10089558 3300009094 Bacteria 3616
170 Ga0105245_10000207 3300009098 Bacteria 55562
171 Ga0105245_10034497 3300009098 Bacteria 4489
172 Ga0105245_10053839 3300009098 Bacteria 3613
173 Ga0105245_10090782 3300009098 Bacteria 2810
174 Ga0105247_10005715 3300009101 Bacteria 7784
175 Ga0114129_10100461 3300009147 Bacteria 4003
176 Ga0105243_10027012 3300009148 Bacteria 4396
177 Ga0105241_10007546 3300009174 Bacteria 7997
178 Ga0105242_10003135 3300009176 Bacteria 12906
179 Ga0105242_10019320 3300009176 Bacteria 5338
180 Ga0105242_10022750 3300009176 Bacteria 4935
181 Ga0105248_10017721 3300009177 Bacteria 7855
182 Ga0105248_10047726 3300009177 Bacteria 4802
183 Ga0105248_10377723 3300009177 Bacteria 1595
184 Ga0105237_10015031 3300009545 Bacteria 8066
185 Ga0105238_10006983 3300009551 Bacteria 11285
186 Ga0105238_10032802 3300009551 Bacteria 5286
187 Ga0105238_10051992 3300009551 Bacteria 4119
188 Ga0105238_10100019 3300009551 Bacteria 2883
189 Ga0105238_10133784 3300009551 Bacteria 2457
190 Ga0105249_10016805 3300009553 Bacteria 6492
191 Ga0105239_10013663 3300010375 Bacteria 9016
192 Ga0105246_10002707 3300011119 Bacteria 10724
193 Ga0157373_10089301 3300013100 Bacteria 2170
194 Ga0157370_10014186 3300013104 Bacteria 8166
195 Ga0157370_10081754 3300013104 Bacteria 3040
196 Ga0157369_10040213 3300013105 Bacteria 5106
197 Ga0157374_10056395 3300013296 Bacteria 3667
198 Ga0157378_10004564 3300013297 Bacteria 12147
199 Ga0157378_10057431 3300013297 Bacteria 3468
200 Ga0157378_10078856 3300013297 Bacteria 2972
201 Ga0157372_10013542 3300013307 Bacteria 8717
202 Ga0157372_10059774 3300013307 Bacteria 4264
203 Ga0157375_10086055 3300013308 Bacteria 3193
204 Ga0157375_10148969 3300013308 Bacteria 2474
205 Ga0157380_10005531 3300014326 Bacteria 8832
206 Ga0157380_10020047 3300014326 Bacteria 4993
207 Ga0157380_10050206 3300014326 Bacteria 3294
208 Ga0182008_10063228 3300014497 Bacteria 1823
209 Ga0157377_10027254 3300014745 Bacteria 3067
210 Ga0157377_10034828 3300014745 Bacteria 2757
211 Ga0157379_10053926 3300014968 Bacteria 3592
212 Ga0157379_10140774 3300014968 Bacteria 2175
213 Ga0157376_10073516 3300014969 Bacteria 2911
214 Ga0182006_1006807 3300015261 Bacteria 5273
215 Ga0182005_1000013 3300015265 Bacteria 396391
216 Ga0182005_1001875 3300015265 Bacteria 7977
217 Ga0163161_10046295 3300017792 Bacteria 3138
218 Ga0206356_10349654 3300020070 Bacteria 2843
219 Ga0206354_10556897 3300020081 Bacteria 3162
220 Ga0213872_10000020 3300021361 Bacteria 159607
221 Ga0213872_10001428 3300021361 Bacteria 15611
222 Ga0213872_10030827 3300021361 Bacteria 2457
223 Ga0224712_10007566 3300022467 Bacteria 3169
224 Ga0209435_100015 3300025206 Bacteria 321177
225 Ga0209435_100309 3300025206 Bacteria 11753
226 Ga0209760_101815 3300025207 Bacteria 2118
227 Ga0209436_100728 3300025208 Bacteria 13735
228 Ga0209436_101841 3300025208 Bacteria 6877
229 Ga0209436_102839 3300025208 Bacteria 4915
230 Ga0209784_100005 3300025224 Bacteria 1040422
231 Ga0209784_100079 3300025224 Bacteria 136351
232 Ga0209566_100005 3300025225 Bacteria 1040422
233 Ga0209566_100093 3300025225 Bacteria 136351
234 Ga0209674_100009 3300025226 Bacteria 1040422
235 Ga0209674_100115 3300025226 Bacteria 136351
236 Ga0209147_100004 3300025229 Bacteria 1371850
237 Ga0209563_100003 3300025230 Bacteria 1932942
238 Ga0209563_100012 3300025230 Bacteria 1040422
239 Ga0209563_100113 3300025230 Bacteria 136351
240 Ga0207427_100262 3300025231 Bacteria 40896
241 Ga0209437_100176 3300025233 Bacteria 136351
242 Ga0209437_100329 3300025233 Bacteria 59120
243 Ga0209258_100523 3300025242 Bacteria 36787
244 Ga0207425_1000014 3300025245 Bacteria 481113
245 Ga0207425_1000109 3300025245 Bacteria 77611
246 Ga0207425_1000122 3300025245 Bacteria 73381
247 Ga0207425_1000678 3300025245 Bacteria 18557
248 Ga0209646_1000020 3300025246 Bacteria 462204
249 Ga0209646_1000040 3300025246 Bacteria 347867
250 Ga0209026_1000034 3300025250 Bacteria 306953
251 Ga0209026_1001477 3300025250 Bacteria 10363
252 Ga0209677_100006 3300025253 Bacteria 1040422
253 Ga0209677_100072 3300025253 Bacteria 136351
254 Ga0209148_1001634 3300025254 Bacteria 10288
255 Ga0209759_1000049 3300025256 Bacteria 221692
256 Ga0209759_1000656 3300025256 Bacteria 32085
257 Ga0209129_1000017 3300025258 Bacteria 480935
258 Ga0209233_1000183 3300025261 Bacteria 136351
259 Ga0209565_1000003 3300025263 Bacteria 1099648
260 Ga0209565_1004651 3300025263 Bacteria 4132
261 Ga0209565_1006069 3300025263 Bacteria 3439
262 Ga0209455_1001230 3300025272 Bacteria 12113
263 Ga0209673_1000017 3300025273 Bacteria 492994
264 Ga0209130_1000171 3300025284 Bacteria 94371
265 Ga0209130_1000177 3300025284 Bacteria 90450
266 Ga0209675_1000119 3300025291 Bacteria 110218
267 Ga0209675_1001621 3300025291 Bacteria 12654
268 Ga0209025_1001025 3300025294 Bacteria 41120
269 Ga0209025_1005080 3300025294 Bacteria 10956
270 Ga0209564_1000016 3300025295 Bacteria 613131
271 Ga0209564_1005005 3300025295 Bacteria 7781
272 Ga0209758_1000038 3300025297 Bacteria 433771
273 Ga0209758_1000228 3300025297 Bacteria 119948
274 Ga0209050_1000011 3300025298 Bacteria 914037
275 Ga0209050_1003602 3300025298 Bacteria 11239
276 Ga0209256_1000210 3300025299 Bacteria 110217
277 Ga0209256_1000987 3300025299 Bacteria 34068
278 Ga0209256_1002009 3300025299 Bacteria 18158
279 Ga0209256_1009131 3300025299 Bacteria 4412
280 Ga0207426_1006741 3300025302 Bacteria 4922
281 Ga0207426_1023189 3300025302 Bacteria 2120
282 Ga0209051_1020910 3300025303 Bacteria 2803
283 Ga0209257_1000003 3300025304 Bacteria 1702593
284 Ga0209257_1013499 3300025304 Bacteria 3624
285 Ga0207642_10002492 3300025899 Bacteria 5731
286 Ga0207710_10017733 3300025900 Bacteria 3021
287 Ga0207699_10041965 3300025906 Bacteria 2646
288 Ga0207645_10101655 3300025907 Bacteria 1855
289 Ga0207643_10000100 3300025908 Bacteria 58884
290 Ga0207643_10005317 3300025908 Bacteria 6888
291 Ga0207705_10011250 3300025909 Bacteria 6487
292 Ga0207705_10017296 3300025909 Bacteria 5162
293 Ga0207705_10018257 3300025909 Bacteria 5016
294 Ga0207705_10059148 3300025909 Bacteria 2765
295 Ga0207654_10000706 3300025911 Bacteria 18618
296 Ga0207654_10019815 3300025911 Bacteria 3557
297 Ga0207707_10015157 3300025912 Bacteria 6710
298 Ga0207707_10043300 3300025912 Bacteria 3927
299 Ga0207707_10117374 3300025912 Bacteria 2326
300 Ga0207695_10001485 3300025913 Bacteria 39195
301 Ga0207695_10041793 3300025913 Bacteria 4904
302 Ga0207695_10042043 3300025913 Bacteria 4886
303 Ga0207693_10026392 3300025915 Bacteria 4597
304 Ga0207662_10042222 3300025918 Bacteria 2688
305 Ga0207657_10051371 3300025919 Bacteria 3583
306 Ga0207657_10076687 3300025919 Bacteria 2819
307 Ga0207652_10056420 3300025921 Bacteria 3381
308 Ga0207652_10241492 3300025921 Bacteria 1628
309 Ga0207646_10232375 3300025922 Bacteria 1666
310 Ga0207694_10001079 3300025924 Bacteria 23684
311 Ga0207694_10040962 3300025924 Bacteria 3569
312 Ga0207694_10103237 3300025924 Bacteria 2261
313 Ga0207659_10091323 3300025926 Bacteria 2274
314 Ga0207659_10135247 3300025926 Bacteria 1907
315 Ga0207687_10005397 3300025927 Bacteria 8451
316 Ga0207700_10145112 3300025928 Bacteria 1955
317 Ga0207664_10044984 3300025929 Bacteria 3460
318 Ga0207664_10068997 3300025929 Bacteria 2842
319 Ga0207690_10009825 3300025932 Bacteria 5686
320 Ga0207690_10057472 3300025932 Bacteria 2628
321 Ga0207706_10088654 3300025933 Bacteria 2720
322 Ga0207706_10101869 3300025933 Bacteria 2527
323 Ga0207706_10174827 3300025933 Bacteria 1886
324 Ga0207686_10012873 3300025934 Bacteria 4612
325 Ga0207686_10020448 3300025934 Bacteria 3782
326 Ga0207686_10172580 3300025934 Bacteria 1526
327 Ga0207709_10069197 3300025935 Bacteria 2233
328 Ga0207670_10002019 3300025936 Bacteria 10648
329 Ga0207670_10059474 3300025936 Bacteria 2599
330 Ga0207670_10059722 3300025936 Bacteria 2594
331 Ga0207704_10001365 3300025938 Bacteria 10908
332 Ga0207691_10011498 3300025940 Bacteria 8494
333 Ga0207691_10028165 3300025940 Bacteria 5262
334 Ga0207711_10051181 3300025941 Bacteria 3537
335 Ga0207711_10095643 3300025941 Bacteria 2620
336 Ga0207689_10001285 3300025942 Bacteria 24212
337 Ga0207689_10002332 3300025942 Bacteria 17776
338 Ga0207689_10082728 3300025942 Bacteria 2639
339 Ga0207661_10001249 3300025944 Bacteria 16984
340 Ga0207661_10265592 3300025944 Bacteria 1530
341 Ga0207679_10002148 3300025945 Bacteria 12202
342 Ga0207679_10130250 3300025945 Bacteria 2017
343 Ga0207667_10000053 3300025949 Bacteria 226712
344 Ga0207667_10010379 3300025949 Bacteria 10885
345 Ga0207667_10012404 3300025949 Bacteria 9823
346 Ga0207667_10024176 3300025949 Bacteria 6675
347 Ga0207667_10038157 3300025949 Bacteria 5132
348 Ga0207667_10169730 3300025949 Bacteria 2242
349 Ga0207712_10031274 3300025961 Bacteria 3583
350 Ga0207668_10019908 3300025972 Bacteria 4253
351 Ga0207640_10004866 3300025981 Bacteria 7295
352 Ga0207677_10014417 3300026023 Bacteria 4615
353 Ga0207677_10108350 3300026023 Bacteria 2063
354 Ga0207677_10131423 3300026023 Bacteria 1901
355 Ga0207703_10013747 3300026035 Bacteria 6310
356 Ga0207703_10040395 3300026035 Bacteria 3733
357 Ga0207639_10036345 3300026041 Bacteria 3650
358 Ga0207678_10001325 3300026067 Bacteria 22864
359 Ga0207678_10212027 3300026067 Bacteria 1657
360 Ga0207708_10000156 3300026075 Bacteria 54425
361 Ga0207708_10030948 3300026075 Bacteria 4061
362 Ga0207702_10045740 3300026078 Bacteria 3682
363 Ga0207702_10085554 3300026078 Bacteria 2748
364 Ga0207702_10124137 3300026078 Bacteria 2315
365 Ga0207641_10012080 3300026088 Bacteria 7081
366 Ga0207648_10005383 3300026089 Bacteria 12907
367 Ga0207676_10001137 3300026095 Bacteria 20095
368 Ga0207674_10023254 3300026116 Bacteria 6639
369 Ga0207675_100001059 3300026118 Bacteria 27297
370 Ga0207683_10000565 3300026121 Bacteria 34282
371 Ga0207683_10085260 3300026121 Bacteria 2808
372 Ga0207698_10002155 3300026142 Bacteria 11626
373 Ga0207698_10005052 3300026142 Bacteria 8094
374 Ga0209971_1003987 3300027682 Bacteria 3491
375 Ga0207428_10003457 3300027907 Bacteria 15332
376 Ga0207428_10012488 3300027907 Bacteria 7460
377 Ga0268264_10022554 3300028381 Bacteria 5138
378 Ga0316177_1194028 3300030731 Bacteria 9231
379 Ga0265331_10010555 3300031250 Bacteria 5103
380 Ga0265327_10000639 3300031251 Bacteria 56852
381 Ga0307408_100000140 3300031548 Bacteria 80709
382 Ga0307408_100020196 3300031548 Bacteria 4492
383 Ga0307408_100101106 3300031548 Bacteria 2197
384 Ga0307408_100109124 3300031548 Bacteria 2122
385 Ga0307408_100175360 3300031548 Bacteria 1715
386 Ga0316579_10000043 3300031691 Bacteria 29246
387 Ga0265314_10032195 3300031711 Bacteria 3859
388 Ga0316578_10002920 3300031728 Bacteria 7666
389 Ga0316578_10052727 3300031728 Bacteria 2384
390 Ga0316577_10001045 3300031733 Bacteria 12508
391 Ga0307416_100007520 3300032002 Bacteria 6939
392 Ga0307416_100205343 3300032002 Bacteria 1874
393 Ga0307414_10093485 3300032004 Bacteria 2242
394 Ga0316585_10000368 3300032137 Bacteria 10376
395 Ga0316580_10000200 3300032139 Bacteria 12217
396 Ga0316593_10000016 3300032168 Bacteria 16636
397 Ga0316588_1000731 3300033528 Bacteria 4851
398 Ga0373944_0033084 3300035089 Bacteria 1565
399 Ga0373923_0002011 3300035111 Bacteria 6119
400 Ga0373936_0002769 3300035113 Bacteria 6534
401 Ga0373953_0000495 3300035117 Bacteria 10925
402 Ga0373954_0005296 3300035118 Bacteria 5572
403 Ga0373954_0009358 3300035118 Bacteria 4310
404 Ga0373956_0003206 3300035119 Bacteria 6608
405 Ga0373956_0011273 3300035119 Bacteria 3681
406 Ga0373943_0005190 3300035170 Bacteria 5862
407 Ga0373946_0069834 3300035171 Bacteria 1514
408 Ga0373955_0008004 3300035172 Bacteria 4887
409 Ga0373955_0039940 3300035172 Bacteria 2507
410 Ga0373955_0149637 3300035172 Bacteria 1373
411 Ga0316574_0000879 3300035398 Bacteria 13274
412 Ga0316574_0003444 3300035398 Bacteria 8153
413 Ga0373924_0011263 3300035410 Bacteria 3318
414 Ga0373931_0055874 3300035691 Bacteria 2114
415 Ga0373935_0001464 3300035692 Bacteria 13100
416 Ga0373927_0061227 3300035695 Bacteria 2435
417 Ga0373933_0005221 3300035724 Bacteria 7086
418 Ga0373947_0017109 3300035725 Bacteria 4169
419 Ga0373937_0001406 3300036401 Bacteria 20084
420 Ga0373937_0108327 3300036401 Bacteria 2583
421 Ga0373937_0189820 3300036401 Bacteria 1930
422 Ga0316582_0002490 3300036647 Bacteria 8674
423 Ga0316582_0090944 3300036647 Bacteria 2008
424 Ga0373925_0080980 3300037068 Bacteria 2468
425 Ga0395899_0000183 3300037312 Bacteria 91818
426 Ga0395899_0001628 3300037312 Bacteria 18785
427 Ga0395899_0011441 3300037312 Bacteria 6792
428 Ga0395899_0012998 3300037312 Bacteria 6369
429 Ga0395899_0045159 3300037312 Bacteria 3282
430 Ga0395900_0000331 3300037418 Bacteria 69780
431 Ga0395900_0001669 3300037418 Bacteria 25883
432 Ga0395900_0005509 3300037418 Bacteria 13249
433 Ga0395900_0011725 3300037418 Bacteria 8961
434 Ga0395900_0034481 3300037418 Bacteria 5212
435 Ga0395900_0039342 3300037418 Bacteria 4872
436 Ga0395900_0039766 3300037418 Bacteria 4846
437 Ga0395900_0057317 3300037418 Bacteria 4010
438 Ga0395900_0073550 3300037418 Bacteria 3514
439 Ga0395900_0082870 3300037418 Bacteria 3295
440 Ga0395900_0088453 3300037418 Bacteria 3184
441 Ga0395900_0177584 3300037418 Bacteria 2165
442 Ga0395898_0048223 3300037466 Bacteria 4178
443 Ga0395898_0081519 3300037466 Bacteria 3119
444 Ga0395898_0085096 3300037466 Bacteria 3048
445 Ga0395898_0350191 3300037466 Bacteria 1408
446 Ga0395905_0004758 3300037471 Bacteria 14030
447 Ga0395905_0069234 3300037471 Bacteria 3305
448 Ga0395905_0072426 3300037471 Bacteria 3230
449 Ga0395905_0090323 3300037471 Bacteria 2871
450 Ga0395905_0107847 3300037471 Bacteria 2614
451 Ga0395905_0208272 3300037471 Bacteria 1832
452 Ga0395901_0000097 3300038443 Bacteria 118528
453 Ga0395901_0002053 3300038443 Bacteria 20648
454 Ga0395901_0002114 3300038443 Bacteria 20373
455 Ga0395901_0028671 3300038443 Bacteria 5726
456 Ga0395901_0098268 3300038443 Bacteria 3069
457 Ga0395901_0147689 3300038443 Bacteria 2471
458 Ga0400484_39392 3300038725 Bacteria 10100
459 Ga0400490_44514 3300038726 Bacteria 11139
460 Ga0400490_47396 3300038726 Bacteria 26208
461 Ga0400490_50054 3300038726 Bacteria 3415
462 Ga0400485_05209 3300038735 Bacteria 3685
463 Ga0400488_06787 3300038741 Bacteria 6328
464 Ga0400486_31155 3300038742 Bacteria 2918
465 Ga0400483_014751 3300039062 Bacteria 5758
466 Ga0400483_117873 3300039062 Bacteria 2251
467 Ga0400483_118802 3300039062 Bacteria 1971
468 Ga0400483_161191 3300039062 Bacteria 11695
469 Ga0400483_239730 3300039062 Bacteria 3646
470 Ga0400483_263105 3300039062 Bacteria 3824
471 Ga0400483_279956 3300039062 Bacteria 11884
472 Ga0400489_49372 3300039093 Bacteria 3852
473 Ga0400487_57745 3300039110 Bacteria 5068
474 Ga0436361_0204853 3300039447 Bacteria 15869
475 Ga0436361_0594223 3300039447 Bacteria 49801
476 Ga0436361_0901422 3300039447 Bacteria 18634
477 Ga0436361_0922237 3300039447 Bacteria 22454
478 Ga0436361_0954113 3300039447 Bacteria 4461
479 Ga0439441_001907 3300042001 Bacteria 2851
480 Ga0439448_0005556 3300042005 Bacteria 3597
481 Ga0439448_0010451 3300042005 Bacteria 2755
482 Ga0450911_000539 3300042115 Bacteria 11803
483 Ga0450904_000213 3300042139 Bacteria 12602
484 Ga0439446_0002039 3300042156 Bacteria 4786
485 Ga0439459_0006044 3300042438 Bacteria 2007
486 Ga0439460_0015679 3300042461 Bacteria 2009
487 Ga0451577_0010210 3300042876 Bacteria 8993
488 Ga0451577_0047164 3300042876 Bacteria 3853
489 Ga0466972_0000275 3300044658 Bacteria 32437
490 Ga0466972_0027692 3300044658 Bacteria 2803
491 Ga0466965_0052353 3300044683 Bacteria 2027
492 Ga0466965_0071145 3300044683 Bacteria 1749
493 Ga0466966_0006240 3300044684 Bacteria 7882
494 Ga0466966_0026496 3300044684 Bacteria 3784
495 Ga0466966_0039322 3300044684 Bacteria 3046
496 Ga0466961_0066942 3300044693 Bacteria 2281
497 Ga0466964_0002459 3300044706 Bacteria 6590
498 Ga0466964_0056952 3300044706 Bacteria 1617
499 Ga0466970_0014159 3300044765 Bacteria 4090
500 Ga0466957_0003310 3300044842 Bacteria 8824
501 Ga0466957_0023223 3300044842 Bacteria 3665
502 Ga0466957_0037108 3300044842 Bacteria 2933
503 Ga0466957_0107941 3300044842 Bacteria 1762
504 Ga0466957_0192967 3300044842 Bacteria 1335
505 Ga0466960_0019925 3300044901 Bacteria 2963
506 Ga0466959_0015602 3300045049 Bacteria 5538
507 Ga0466959_0114682 3300045049 Bacteria 1920
508 Ga0451576_0009713 3300045051 Bacteria 11126
509 Ga0451576_0146409 3300045051 Bacteria 2463
510 Ga0466958_0019882 3300045836 Bacteria 3912
511 Ga0466958_0095612 3300045836 Bacteria 1842
512 Ga0466967_0026135 3300045976 Bacteria 4830
513 Ga0466967_0049377 3300045976 Bacteria 3679
514 Ga0495617_000004 3300046452 Bacteria 511274
515 Ga0495617_000009 3300046452 Bacteria 312936
516 Ga0495617_000407 3300046452 Bacteria 23876
517 Ga0495617_009926 3300046452 Bacteria 3264
518 Ga0495617_021504 3300046452 Bacteria 2178
519 Ga0495627_000008 3300046453 Bacteria 572150
520 Ga0495627_000255 3300046453 Bacteria 54602
521 Ga0495627_001629 3300046453 Bacteria 12537
522 Ga0495592_0015317 3300046454 Bacteria 5819
523 Ga0495592_0042407 3300046454 Bacteria 3407
524 Ga0495603_0017245 3300046455 Bacteria 4371
525 Ga0495590_0000010 3300046457 Bacteria 317890
526 Ga0495590_0000669 3300046457 Bacteria 15860
527 Ga0495590_0002180 3300046457 Bacteria 8199
528 Ga0495591_001902 3300046458 Bacteria 12252
529 Ga0495629_0065510 3300046459 Bacteria 2536
530 Ga0495638_0000042 3300046460 Bacteria 232752
531 Ga0495641_0005536 3300046461 Bacteria 8484
532 Ga0495651_0003157 3300046462 Bacteria 12694
533 Ga0495653_0000010 3300046463 Bacteria 274131
534 Ga0495653_0031870 3300046463 Bacteria 4188
535 Ga0495653_0078741 3300046463 Bacteria 2443
536 Ga0495650_0000011 3300046471 Bacteria 615329
537 Ga0495650_0000165 3300046471 Bacteria 146945
538 Ga0495650_0000429 3300046471 Bacteria 68004
539 Ga0495650_0000494 3300046471 Bacteria 59876
540 Ga0495650_0000500 3300046471 Bacteria 59272
541 Ga0495650_0000593 3300046471 Bacteria 50088
542 Ga0495650_0015190 3300046471 Bacteria 3960
543 Ga0495650_0017535 3300046471 Bacteria 3588
544 Ga0495650_0017859 3300046471 Bacteria 3543
545 Ga0495650_0025561 3300046471 Bacteria 2765
546 Ga0495650_0052606 3300046471 Bacteria 1671
547 Ga0495580_0004251 3300046472 Bacteria 12046
548 Ga0495605_0000022 3300046474 Bacteria 248321
549 Ga0495605_0000024 3300046474 Bacteria 236016
550 Ga0495605_0000236 3300046474 Bacteria 67212
551 Ga0495605_0002652 3300046474 Bacteria 10953
552 Ga0495605_0012754 3300046474 Bacteria 4652
553 Ga0495605_0022425 3300046474 Bacteria 3335
554 Ga0495605_0045363 3300046474 Bacteria 2166
555 Ga0495639_0008995 3300046475 Bacteria 4282
556 Ga0495639_0019621 3300046475 Bacteria 2951
557 Ga0495662_0016721 3300046476 Bacteria 3553
558 Ga0495584_0000003 3300046491 Bacteria 323768
559 Ga0495584_0000145 3300046491 Bacteria 49520
560 Ga0495584_0001720 3300046491 Bacteria 12796
561 Ga0495584_0002824 3300046491 Bacteria 9693
562 Ga0495584_0025456 3300046491 Bacteria 3000
563 Ga0495584_0041540 3300046491 Bacteria 2321
564 Ga0495584_0041841 3300046491 Bacteria 2312
565 Ga0495585_0000130 3300046492 Bacteria 81689
566 Ga0495585_0000996 3300046492 Bacteria 23676
567 Ga0495585_0001018 3300046492 Bacteria 23309
568 Ga0495585_0002381 3300046492 Bacteria 13490
569 Ga0495585_0002914 3300046492 Bacteria 11849
570 Ga0495585_0028439 3300046492 Bacteria 3188
571 Ga0495585_0035009 3300046492 Bacteria 2839
572 Ga0495585_0050119 3300046492 Bacteria 2316
573 Ga0495585_0098533 3300046492 Bacteria 1566
574 Ga0495594_0022348 3300046499 Bacteria 3383
575 Ga0495596_0001402 3300046500 Bacteria 13827
576 Ga0495596_0003382 3300046500 Bacteria 8103
577 Ga0495596_0004245 3300046500 Bacteria 7027
578 Ga0495596_0004507 3300046500 Bacteria 6772
579 Ga0495596_0006613 3300046500 Bacteria 5318
580 Ga0495596_0017410 3300046500 Bacteria 2975
581 Ga0495607_0000615 3300046501 Bacteria 34548
582 Ga0495607_0003741 3300046501 Bacteria 11513
583 Ga0495607_0009001 3300046501 Bacteria 6791
584 Ga0495607_0016447 3300046501 Bacteria 4773
585 Ga0495607_0017184 3300046501 Bacteria 4652
586 Ga0495607_0021131 3300046501 Bacteria 4098
587 Ga0495607_0031141 3300046501 Bacteria 3267
588 Ga0495607_0036706 3300046501 Bacteria 2950
589 Ga0495607_0080074 3300046501 Bacteria 1797
590 Ga0495583_0000006 3300046506 Bacteria 436893
591 Ga0495583_0000235 3300046506 Bacteria 91939
592 Ga0495583_0000560 3300046506 Bacteria 51454
593 Ga0495583_0000654 3300046506 Bacteria 45704
594 Ga0495583_0004372 3300046506 Bacteria 10176
595 Ga0495583_0028477 3300046506 Bacteria 2745
596 Ga0495606_0000014 3300046507 Bacteria 289347
597 Ga0495606_0000111 3300046507 Bacteria 138144
598 Ga0495606_0000580 3300046507 Bacteria 58150
599 Ga0495606_0000927 3300046507 Bacteria 43195
600 Ga0495606_0001555 3300046507 Bacteria 30156
601 Ga0495606_0006256 3300046507 Bacteria 11051
602 Ga0495606_0006476 3300046507 Bacteria 10776
603 Ga0495606_0015030 3300046507 Bacteria 5996
604 Ga0495606_0029563 3300046507 Bacteria 3843
605 Ga0495606_0051056 3300046507 Bacteria 2700
606 Ga0495606_0059306 3300046507 Bacteria 2455
607 Ga0495608_0011071 3300046511 Bacteria 6283
608 Ga0495608_0026379 3300046511 Bacteria 3961
609 Ga0495610_0000010 3300046512 Bacteria 538821
610 Ga0495610_0001639 3300046512 Bacteria 19681
611 Ga0495610_0006477 3300046512 Bacteria 8048
612 Ga0495616_0000542 3300046513 Bacteria 28451
613 Ga0495616_0000648 3300046513 Bacteria 25880
614 Ga0495616_0000816 3300046513 Bacteria 22705
615 Ga0495616_0002434 3300046513 Bacteria 12372
616 Ga0495616_0007257 3300046513 Bacteria 6637
617 Ga0495616_0020804 3300046513 Bacteria 3564
618 Ga0495616_0080572 3300046513 Bacteria 1559
619 Ga0495618_0015550 3300046514 Bacteria 4645
620 Ga0495628_0077781 3300046516 Bacteria 2580
621 Ga0495630_0006438 3300046517 Bacteria 8352
622 Ga0495630_0054277 3300046517 Bacteria 3002
623 Ga0495631_0001791 3300046518 Bacteria 12743
624 Ga0495631_0002889 3300046518 Bacteria 9518
625 Ga0495631_0003258 3300046518 Bacteria 8922
626 Ga0495631_0029473 3300046518 Bacteria 2495
627 Ga0495632_0000073 3300046519 Bacteria 104293
628 Ga0495632_0000203 3300046519 Bacteria 60607
629 Ga0495632_0000225 3300046519 Bacteria 57394
630 Ga0495632_0001091 3300046519 Bacteria 23243
631 Ga0495632_0022132 3300046519 Bacteria 3412
632 Ga0495632_0040635 3300046519 Bacteria 2341
633 Ga0495637_0000069 3300046520 Bacteria 84826
634 Ga0495643_0001442 3300046522 Bacteria 21926
635 Ga0495643_0007966 3300046522 Bacteria 6756
636 Ga0495643_0037200 3300046522 Bacteria 2671
637 Ga0495644_0024587 3300046523 Bacteria 2291
638 Ga0495648_0000003 3300046524 Bacteria 386817
639 Ga0495648_0000290 3300046524 Bacteria 57025
640 Ga0495648_0001863 3300046524 Bacteria 20176
641 Ga0495648_0006527 3300046524 Bacteria 9495
642 Ga0495648_0017919 3300046524 Bacteria 5041
643 Ga0495663_0042045 3300046525 Bacteria 1392
644 Ga0495642_0000065 3300046528 Bacteria 63401
645 Ga0495642_0003872 3300046528 Bacteria 5869
646 Ga0495642_0010459 3300046528 Bacteria 3555
647 Ga0495642_0023058 3300046528 Bacteria 2456
648 Ga0495642_0033354 3300046528 Bacteria 2070
649 Ga0495652_0037529 3300046529 Bacteria 4202
650 Ga0495652_0044005 3300046529 Bacteria 3846
651 Ga0495652_0138551 3300046529 Bacteria 1916
652 Ga0495654_0000002 3300046530 Bacteria 1021205
653 Ga0495654_0011052 3300046530 Bacteria 4902
654 Ga0495654_0017135 3300046530 Bacteria 3814
655 Ga0495665_0035295 3300046531 Bacteria 2671
656 Ga0495640_0008997 3300046533 Bacteria 7797
657 Ga0495586_0038260 3300046535 Bacteria 2575
658 Ga0495587_0003065 3300046536 Bacteria 11165
659 Ga0495609_0000030 3300046538 Bacteria 215885
660 Ga0495609_0000072 3300046538 Bacteria 125273
661 Ga0495609_0000542 3300046538 Bacteria 29919
662 Ga0495609_0003180 3300046538 Bacteria 9549
663 Ga0495609_0006964 3300046538 Bacteria 5703
664 Ga0495609_0010364 3300046538 Bacteria 4473
665 Ga0495609_0018313 3300046538 Bacteria 3245
666 Ga0495609_0026724 3300046538 Bacteria 2641
667 Ga0495597_0000111 3300046542 Bacteria 72653
668 Ga0495597_0000219 3300046542 Bacteria 52473
669 Ga0495597_0001941 3300046542 Bacteria 13942
670 Ga0495597_0006433 3300046542 Bacteria 6078
671 Ga0495597_0019384 3300046542 Bacteria 3184
672 Ga0495597_0022494 3300046542 Bacteria 2923
673 Ga0495645_0001557 3300046543 Bacteria 15525
674 Ga0495645_0018519 3300046543 Bacteria 5003
675 Ga0495645_0045214 3300046543 Bacteria 3212
676 Ga0495645_0115655 3300046543 Bacteria 1894
677 Ga0495622_0000116 3300046557 Bacteria 69072
678 Ga0495633_0000124 3300046558 Bacteria 104617
679 Ga0495633_0000553 3300046558 Bacteria 36816
680 Ga0495633_0002706 3300046558 Bacteria 12291
681 Ga0495633_0007242 3300046558 Bacteria 6420
682 Ga0495633_0010500 3300046558 Bacteria 5047
683 Ga0495633_0014935 3300046558 Bacteria 4038
684 Ga0495667_0013108 3300046559 Bacteria 5615
685 Ga0495656_0121263 3300046615 Bacteria 1234
686 Ga0495668_0000038 3300046616 Bacteria 232122
687 Ga0495668_0000071 3300046616 Bacteria 168801
688 Ga0495668_0000366 3300046616 Bacteria 59612
689 Ga0495668_0000843 3300046616 Bacteria 34761
690 Ga0495668_0001445 3300046616 Bacteria 22973
691 Ga0495668_0006030 3300046616 Bacteria 8036
692 Ga0495668_0016824 3300046616 Bacteria 4248
693 Ga0495668_0020642 3300046616 Bacteria 3786
694 Ga0495668_0031335 3300046616 Bacteria 2997
695 Ga0495668_0038717 3300046616 Bacteria 2663
696 Ga0495634_0004770 3300046642 Bacteria 10539
697 Ga0495634_0012880 3300046642 Bacteria 6054
698 Ga0495611_0000944 3300046648 Bacteria 15586
699 Ga0495611_0008302 3300046648 Bacteria 4398
700 Ga0495625_0000218 3300046660 Bacteria 90741
701 Ga0495625_0002241 3300046660 Bacteria 21344
702 Ga0495625_0002638 3300046660 Bacteria 19153
703 Ga0495625_0026750 3300046660 Bacteria 4352
704 Ga0495625_0038134 3300046660 Bacteria 3519
705 Ga0495625_0038762 3300046660 Bacteria 3485
706 Ga0495625_0049337 3300046660 Bacteria 3026
707 Ga0495625_0050334 3300046660 Bacteria 2990
708 Ga0495635_0025139 3300046663 Bacteria 4149
709 Ga0495659_0000240 3300046664 Bacteria 23009
710 Ga0495659_0003268 3300046664 Bacteria 5197
711 Ga0495659_0014299 3300046664 Bacteria 2597
712 Ga0495661_0000209 3300046665 Bacteria 67580
713 Ga0495661_0003296 3300046665 Bacteria 11978
714 Ga0495661_0005018 3300046665 Bacteria 9450
715 Ga0495661_0009420 3300046665 Bacteria 6703
716 Ga0495661_0016457 3300046665 Bacteria 4901
717 Ga0495661_0018929 3300046665 Bacteria 4518
718 Ga0495661_0023930 3300046665 Bacteria 3957
719 Ga0495661_0024398 3300046665 Bacteria 3914
720 Ga0495661_0029152 3300046665 Bacteria 3525
721 Ga0495661_0034208 3300046665 Bacteria 3198
722 Ga0495661_0034544 3300046665 Bacteria 3180
723 Ga0495661_0034622 3300046665 Bacteria 3177
724 Ga0495661_0058618 3300046665 Bacteria 2294
725 Ga0495588_0000078 3300046674 Bacteria 214254
726 Ga0495588_0030499 3300046674 Bacteria 2710
727 Ga0495657_0022230 3300046675 Bacteria 4546
728 Ga0495599_0010681 3300046678 Bacteria 5621
729 Ga0495599_0013096 3300046678 Bacteria 5123
730 Ga0495623_0008017 3300046679 Bacteria 6864
731 Ga0495623_0033389 3300046679 Bacteria 3302
732 Ga0495646_0010240 3300046680 Bacteria 5964
733 Ga0495646_0013711 3300046680 Bacteria 5152
734 Ga0495646_0035421 3300046680 Bacteria 3096
735 Ga0495658_0117709 3300046683 Bacteria 1604
736 Ga0495669_0001554 3300046684 Bacteria 9437
737 Ga0495669_0014220 3300046684 Bacteria 3403
738 Ga0495669_0024677 3300046684 Bacteria 2618
739 Ga0495670_0000223 3300046691 Bacteria 25806
740 Ga0495670_0018262 3300046691 Bacteria 3453
741 Ga0495670_0046089 3300046691 Bacteria 2177
742 Ga0495670_0141502 3300046691 Bacteria 1258
743 Ga0495671_0000002 3300046692 Bacteria 1136189
744 Ga0495671_0000382 3300046692 Bacteria 36493
745 Ga0495671_0000812 3300046692 Bacteria 22323
746 Ga0495671_0004041 3300046692 Bacteria 8861
747 Ga0495649_0000363 3300046694 Bacteria 39271
748 Ga0495649_0002963 3300046694 Bacteria 11694
749 Ga0495649_0018097 3300046694 Bacteria 3970
750 Ga0495589_0000021 3300046794 Bacteria 197941
751 Ga0495589_0000193 3300046794 Bacteria 53197
752 Ga0495589_0007813 3300046794 Bacteria 5599
753 Ga0495600_0001052 3300046809 Bacteria 14949
754 Ga0495600_0003954 3300046809 Bacteria 8806
755 Ga0495600_0043602 3300046809 Bacteria 2926
756 Ga0495600_0134184 3300046809 Bacteria 1608
757 Ga0495660_0000173 3300046810 Bacteria 69912
758 Ga0495660_0001379 3300046810 Bacteria 16695
759 Ga0495660_0003764 3300046810 Bacteria 9306
760 Ga0495660_0009880 3300046810 Bacteria 5552
761 Ga0495660_0012363 3300046810 Bacteria 4954
762 Ga0495660_0034184 3300046810 Bacteria 2846
763 Ga0495660_0105555 3300046810 Bacteria 1444
764 Ga0495604_0001639 3300047317 Bacteria 18388
765 Ga0495604_0019580 3300047317 Bacteria 5417
766 Ga0495636_0009917 3300047318 Bacteria 3750
767 Ga0495672_0000178 3300047320 Bacteria 91834
768 Ga0495672_0001371 3300047320 Bacteria 24097
769 Ga0495672_0002544 3300047320 Bacteria 16635
770 Ga0495672_0002881 3300047320 Bacteria 15233
771 Ga0495672_0008348 3300047320 Bacteria 7660
772 Ga0495672_0020474 3300047320 Bacteria 4335
773 Ga0495676_0159698 3300047321 Bacteria 1596
774 Ga0495680_0019175 3300047322 Bacteria 5785
775 Ga0495680_0080171 3300047322 Bacteria 2467
776 Ga0495683_0000660 3300047323 Bacteria 25526
777 Ga0495683_0001145 3300047323 Bacteria 18245
778 Ga0495683_0006365 3300047323 Bacteria 6452
779 Ga0495683_0006608 3300047323 Bacteria 6323
780 Ga0495683_0008983 3300047323 Bacteria 5333
781 Ga0495683_0011073 3300047323 Bacteria 4755
782 Ga0495683_0017116 3300047323 Bacteria 3760
783 Ga0495683_0032082 3300047323 Bacteria 2676
784 Ga0495683_0077191 3300047323 Bacteria 1628
785 Ga0495687_000012 3300047443 Bacteria 391586
786 Ga0495687_000276 3300047443 Bacteria 67876
787 Ga0495687_000279 3300047443 Bacteria 67230
788 Ga0495687_000319 3300047443 Bacteria 62530
789 Ga0495687_000545 3300047443 Bacteria 45047
790 Ga0495687_000965 3300047443 Bacteria 29302
791 Ga0495687_000991 3300047443 Bacteria 28486
792 Ga0495687_013143 3300047443 Bacteria 4334
793 Ga0495687_036245 3300047443 Bacteria 2209
794 Ga0495675_0032064 3300047444 Bacteria 3355
795 Ga0495675_0051543 3300047444 Bacteria 2613
796 Ga0495677_0000050 3300047445 Bacteria 67980
797 Ga0495677_0000934 3300047445 Bacteria 11759
798 Ga0495677_0004733 3300047445 Bacteria 5185
799 Ga0495677_0005481 3300047445 Bacteria 4811
800 Ga0495677_0027690 3300047445 Bacteria 2056
801 Ga0495679_006510 3300047446 Bacteria 5007
802 Ga0495679_012045 3300047446 Bacteria 3312
803 Ga0495679_022962 3300047446 Bacteria 2124
804 Ga0495685_002889 3300047447 Bacteria 5429
805 Ga0495673_0000005 3300047469 Bacteria 943364
806 Ga0495673_0000026 3300047469 Bacteria 476378
807 Ga0495673_0000028 3300047469 Bacteria 473418
808 Ga0495681_0000744 3300047470 Bacteria 25082
809 Ga0495681_0000807 3300047470 Bacteria 24161
810 Ga0495681_0017085 3300047470 Bacteria 4041
811 Ga0495681_0023498 3300047470 Bacteria 3273
812 Ga0495681_0034729 3300047470 Bacteria 2509
813 Ga0495684_0022699 3300047471 Bacteria 4826
814 Ga0495684_0145098 3300047471 Bacteria 1778
815 Ga0495686_0000495 3300047472 Bacteria 57870
816 Ga0495686_0001546 3300047472 Bacteria 24576
817 Ga0495686_0002818 3300047472 Bacteria 15756
818 Ga0495686_0053915 3300047472 Bacteria 2519
819 Ga0495615_0004504 3300048090 Bacteria 2438
820 Ga0495626_0000017 3300048091 Bacteria 231648
821 Ga0495626_0000386 3300048091 Bacteria 45608
822 Ga0495626_0000425 3300048091 Bacteria 43228
823 Ga0495626_0005936 3300048091 Bacteria 7027
824 Ga0495626_0035411 3300048091 Bacteria 2382
825 Ga0496101_0059228 3300048904 Bacteria 2775
826 Ga0496101_0239903 3300048904 Bacteria 1410
827 Ga0496102_0000829 3300048905 Bacteria 29800
828 Ga0496102_0016019 3300048905 Bacteria 6544
829 Ga0496102_0029433 3300048905 Bacteria 4914
830 Ga0496102_0045157 3300048905 Bacteria 3999
831 Ga0496103_0018656 3300048906 Bacteria 4162
832 Ga0496103_0037110 3300048906 Bacteria 2986
833 Ga0496103_0037452 3300048906 Bacteria 2972
834 Ga0496104_0051486 3300048907 Bacteria 3886
835 Ga0496104_0120702 3300048907 Bacteria 2517
836 Ga0496104_0209741 3300048907 Bacteria 1860
837 Ga0496105_0036700 3300048908 Bacteria 4038
838 Ga0496105_0099411 3300048908 Bacteria 2403
839 Ga0496105_0118365 3300048908 Bacteria 2185
840 Ga0496106_0064727 3300048909 Bacteria 2782
841 Ga0496107_0027620 3300048910 Bacteria 4030
842 Ga0496108_0200177 3300048911 Bacteria 1733
843 Ga0496109_0057844 3300048912 Bacteria 3540
844 Ga0496109_0060710 3300048912 Bacteria 3455
845 Ga0496109_0063033 3300048912 Bacteria 3390
846 Ga0496110_0000070 3300048913 Bacteria 51596
847 Ga0496110_0040532 3300048913 Bacteria 4058
848 Ga0496110_0226540 3300048913 Bacteria 1700
849 Ga0496111_0018763 3300048914 Bacteria 4794
850 Ga0496112_0077032 3300048915 Bacteria 3298
851 Ga0496112_0091673 3300048915 Bacteria 3008
852 Ga0496113_0038171 3300048916 Bacteria 3530
853 Ga0496113_0067247 3300048916 Bacteria 2716
854 Ga0496113_0136051 3300048916 Bacteria 1931
855 Ga0496115_0203182 3300048918 Bacteria 1637
856 Ga0496116_0025999 3300048919 Bacteria 4290
857 Ga0496116_0050726 3300048919 Bacteria 2762
858 Ga0496117_0085225 3300048920 Bacteria 2058
859 Ga0496118_0009602 3300048921 Bacteria 9740
860 Ga0496121_0002960 3300048924 Bacteria 24756
861 Ga0496121_0012291 3300048924 Bacteria 9369
862 Ga0496121_0067635 3300048924 Bacteria 2894
863 Ga0496121_0101059 3300048924 Bacteria 2225
864 Ga0496122_0000452 3300048925 Bacteria 85514
865 Ga0496122_0003862 3300048925 Bacteria 19222
866 Ga0496122_0049890 3300048925 Bacteria 3197
867 Ga0496122_0055182 3300048925 Bacteria 2976
868 Ga0496122_0127976 3300048925 Bacteria 1621
869 Ga0496123_0000514 3300048926 Bacteria 67374
870 Ga0496123_0003055 3300048926 Bacteria 19252
871 Ga0496123_0091043 3300048926 Bacteria 1810
872 Ga0496124_0057706 3300048927 Bacteria 3270
873 Ga0496124_0063627 3300048927 Bacteria 3081
874 Ga0496124_0083110 3300048927 Bacteria 2628
875 Ga0496124_0119203 3300048927 Bacteria 2111
876 Ga0496125_0000572 3300048928 Bacteria 63057
877 Ga0496125_0001421 3300048928 Bacteria 34916
878 Ga0496125_0001986 3300048928 Bacteria 27786
879 Ga0496126_0049386 3300048929 Bacteria 3841
880 Ga0495678_000006 3300049459 Bacteria 463690
881 Ga0495678_000293 3300049459 Bacteria 54963
882 Ga0495678_000671 3300049459 Bacteria 31406
883 Ga0495678_000936 3300049459 Bacteria 25387
884 Ga0495678_001164 3300049459 Bacteria 21704
885 Ga0495678_001549 3300049459 Bacteria 17735
886 Ga0495678_002684 3300049459 Bacteria 11749
887 Ga0495678_006615 3300049459 Bacteria 6142
888 Ga0495678_016210 3300049459 Bacteria 3413
889 Ga0501032_0007810 3300049569 Bacteria 7798
890 Ga0501032_0106611 3300049569 Bacteria 1856
891 Ga0501034_0000468 3300049571 Bacteria 66573
892 Ga0501034_0000781 3300049571 Bacteria 47646
893 Ga0501036_0018715 3300049572 Bacteria 5808
894 Ga0501037_0009794 3300049573 Bacteria 7035
895 Ga0501037_0022546 3300049573 Bacteria 4657
896 Ga0501037_0102118 3300049573 Bacteria 2069
897 Ga0501038_0002776 3300049574 Bacteria 16288
898 Ga0501038_0080830 3300049574 Bacteria 2739
899 Ga0501039_0039391 3300049575 Bacteria 3650
900 Ga0501039_0089498 3300049575 Bacteria 2399
901 Ga0501046_0006098 3300049580 Bacteria 10716
902 Ga0501047_0019305 3300049581 Bacteria 6539
903 Ga0501048_0088728 3300049582 Bacteria 2181
904 Ga0501067_0076997 3300049583 Bacteria 1848
905 Ga0501069_0001751 3300049585 Bacteria 10826
906 Ga0501070_0003149 3300049586 Bacteria 14367
907 Ga0501070_0013289 3300049586 Bacteria 6942
908 Ga0501070_0015596 3300049586 Bacteria 6389
909 Ga0501070_0020637 3300049586 Bacteria 5526
910 Ga0501070_0031671 3300049586 Bacteria 4430
911 Ga0501071_0009404 3300049587 Bacteria 6511
912 Ga0501072_0033189 3300049588 Bacteria 4045
913 Ga0501072_0036798 3300049588 Bacteria 3838
914 Ga0501073_0000278 3300049589 Bacteria 33962
915 Ga0501073_0033039 3300049589 Bacteria 3687
916 Ga0501074_0002070 3300049590 Bacteria 13861
917 Ga0501074_0013897 3300049590 Bacteria 5851
918 Ga0501075_0001807 3300049591 Bacteria 14085
919 Ga0501076_0000702 3300049592 Bacteria 21561
920 Ga0501076_0044313 3300049592 Bacteria 3508
921 Ga0501079_0050326 3300049741 Bacteria 3216
922 Ga0501079_0210185 3300049741 Bacteria 1520
923 Ga0501080_0007743 3300049742 Bacteria 9711
924 Ga0501080_0014652 3300049742 Bacteria 7221
925 Ga0501080_0042531 3300049742 Bacteria 4230
926 Ga0501081_0010281 3300049743 Bacteria 6109
927 Ga0501083_0007253 3300049744 Bacteria 7872
928 Ga0501279_004229 3300049775 Bacteria 1883
929 Ga0501035_0011898 3300049822 Bacteria 8053
930 Ga0501044_0097554 3300049823 Bacteria 2960
931 Ga0501045_0002691 3300049824 Bacteria 12125
932 nmdc:mga00v17_22542_c1 3300050491 Bacteria 3634
933 nmdc:mga0k408_1373_c1 3300050493 Bacteria 13133
934 nmdc:mga09592_18475_c1 3300050508 Bacteria 5718
935 nmdc:mga09592_237415_c1 3300050508 Bacteria 1579
936 nmdc:mga09592_24967_c1 3300050508 Bacteria 4943
937 nmdc:mga06r32_118952_c1 3300050510 Bacteria 2605
938 nmdc:mga08y16_785_c1 3300050511 Bacteria 30306
939 nmdc:mga0n895_10431_c1 3300050512 Bacteria 8206
940 nmdc:mga0n895_51391_c1 3300050512 Bacteria 4044
941 nmdc:mga0rr50_13135_c1 3300050513 Bacteria 5379
942 nmdc:mga0rr50_75146_c1 3300050513 Bacteria 2589
943 nmdc:mga08x19_745_c1 3300050514 Bacteria 20774
944 nmdc:mga08x19_9110_c1 3300050514 Bacteria 5926
945 nmdc:mga0a205_60904_c1 3300050515 Bacteria 3645
946 nmdc:mga0a205_8626_c1 3300050515 Bacteria 9275
947 Ga0495601_0007578 3300053077 Bacteria 6373
948 Ga0495619_0038154 3300053085 Bacteria 3133
949 Ga0500594_0001376 3300053118 Bacteria 5273
950 Ga0500595_002472 3300053119 Bacteria 9144
951 Ga0500618_001366 3300053125 Bacteria 11094
952 Ga0500618_002052 3300053125 Bacteria 8118
953 Ga0500619_000135 3300053154 Bacteria 19002
954 Ga0501084_0015416 3300054114 Bacteria 6337
955 Ga0501082_0017408 3300060353 Bacteria 6191
956 Ga0501082_0025637 3300060353 Bacteria 5080
957 Ga0530510_0010709 3300061734 Bacteria 6432

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0192967 Ga0466957_0192967_265_1317 341
2 3300045051 Ga0451576_0146409 Ga0451576_0146409_1308_2447 374
3 3300046615 Ga0495656_0121263 Ga0495656_0121263_14_1174 386
4 3300046691 Ga0495670_0141502 Ga0495670_0141502_79_1239 386
5 3300046809 Ga0495600_0134184 Ga0495600_0134184_431_1591 386
6 3300046525 Ga0495663_0042045 Ga0495663_0042045_163_1359 398
7 3300046794 Ga0495589_0007813 Ga0495589_0007813_4387_5583 398
8 3300047323 Ga0495683_0077191 Ga0495683_0077191_11_1207 398
9 3300025907 Ga0207645_10101655 Ga0207645_101016551 401
10 3300044693 Ga0466961_0066942 Ga0466961_0066942_43_1386 404
11 3300044684 Ga0466966_0026496 Ga0466966_0026496_226_1569 405
12 3300045049 Ga0466959_0114682 Ga0466959_0114682_448_1791 405
13 3300045836 Ga0466958_0095612 Ga0466958_0095612_277_1620 405
14 iso_pu_bacteria 2921643360 2921647972 409
15 3300038742 Ga0400486_31155 Ga0400486_31155_598_1941 412
16 3300039093 Ga0400489_49372 Ga0400489_49372_529_1872 414
17 3300038735 Ga0400485_05209 Ga0400485_05209_629_1972 415
18 3300048921 Ga0496118_0009602 Ga0496118_0009602_17_1279 416
19 3300037312 Ga0395899_0001628 Ga0395899_0001628_14745_16034 417
20 3300046810 Ga0495660_0009880 Ga0495660_0009880_2482_3840 417
21 3300005614 Ga0068856_100024700 Ga0068856_1000247002 419
22 3300026078 Ga0207702_10045740 Ga0207702_100457401 419
23 3300046471 Ga0495650_0000011 Ga0495650_0000011_254_1591 419
24 3300038725 Ga0400484_39392 Ga0400484_39392_743_2086 420
25 3300037466 Ga0395898_0350191 Ga0395898_0350191_39_1304 421
26 3300046471 Ga0495650_0015190 Ga0495650_0015190_1474_2811 421
27 3300005434 Ga0070709_10013484 Ga0070709_100134843 422
28 3300005435 Ga0070714_100154152 Ga0070714_1001541522 422
29 3300005436 Ga0070713_100001388 Ga0070713_1000013889 422
30 3300006028 Ga0070717_10074695 Ga0070717_100746951 422
31 3300025915 Ga0207693_10026392 Ga0207693_100263922 422
32 3300025928 Ga0207700_10145112 Ga0207700_101451121 422
33 3300025929 Ga0207664_10068997 Ga0207664_100689974 422
34 3300005434 Ga0070709_10050553 Ga0070709_100505532 423
35 3300025906 Ga0207699_10041965 Ga0207699_100419652 423
36 3300035089 Ga0373944_0033084 Ga0373944_0033084_275_1549 423
37 3300035171 Ga0373946_0069834 Ga0373946_0069834_44_1318 423
38 3300039062 Ga0400483_014751 Ga0400483_014751_619_1962 425
39 3300039062 Ga0400483_263105 Ga0400483_263105_1529_2872 425
40 3300042139 Ga0450904_000213 Ga0450904_000213_2017_3354 425
41 3300031691 Ga0316579_10000043 Ga0316579_1000004320 426
42 3300031728 Ga0316578_10002920 Ga0316578_100029206 426
43 3300031733 Ga0316577_10001045 Ga0316577_100010459 426
44 3300032137 Ga0316585_10000368 Ga0316585_100003687 426
45 3300032139 Ga0316580_10000200 Ga0316580_100002002 426
46 3300033528 Ga0316588_1000731 Ga0316588_10007312 426
47 3300035398 Ga0316574_0000879 Ga0316574_0000879_3900_5240 426
48 3300036647 Ga0316582_0002490 Ga0316582_0002490_3435_4775 426
49 3300048919 Ga0496116_0050726 Ga0496116_0050726_207_1550 426
50 3300025303 Ga0209051_1020910 Ga0209051_10209102 430
51 3300031548 Ga0307408_100101106 Ga0307408_1001011062 430
52 3300037418 Ga0395900_0073550 Ga0395900_0073550_232_1572 430
53 3300046810 Ga0495660_0105555 Ga0495660_0105555_10_1308 432
54 3300050515 nmdc:mga0a205_60904_c1 nmdc:mga0a205_60904_c1_988_2343 432
55 3300037418 Ga0395900_0088453 Ga0395900_0088453_1252_2589 433
56 3300049586 Ga0501070_0015596 Ga0501070_0015596_1354_2706 433
57 3300049741 Ga0501079_0210185 Ga0501079_0210185_61_1422 434
58 3300006847 Ga0075431_100051695 Ga0075431_1000516952 436
59 3300027682 Ga0209971_1003987 Ga0209971_10039872 436
60 3300037312 Ga0395899_0011441 Ga0395899_0011441_2493_3830 436
61 3300037466 Ga0395898_0048223 Ga0395898_0048223_1426_2763 436
62 3300038726 Ga0400490_50054 Ga0400490_50054_1614_2960 436
63 3300039062 Ga0400483_117873 Ga0400483_117873_431_1774 436
64 3300039062 Ga0400483_161191 Ga0400483_161191_815_2158 436
65 3300039062 Ga0400483_239730 Ga0400483_239730_574_1920 436
66 3300042001 Ga0439441_001907 Ga0439441_001907_555_1907 436
67 3300042461 Ga0439460_0015679 Ga0439460_0015679_597_1949 436
68 3300046528 Ga0495642_0010459 Ga0495642_0010459_883_2223 436
69 3300046542 Ga0495597_0019384 Ga0495597_0019384_1539_2879 436
70 3300046665 Ga0495661_0003296 Ga0495661_0003296_884_2224 436
71 3300047443 Ga0495687_013143 Ga0495687_013143_185_1525 436
72 3300048913 Ga0496110_0226540 Ga0496110_0226540_325_1665 436
73 3300050508 nmdc:mga09592_18475_c1 nmdc:mga09592_18475_c1_1382_2734 436
74 3300002459 JGI24751J29686_10008669 JGI24751J29686_100086692 437
75 3300005327 Ga0070658_10098905 Ga0070658_100989052 437
76 3300005328 Ga0070676_10068657 Ga0070676_100686572 437
77 3300005331 Ga0070670_100023041 Ga0070670_1000230413 437
78 3300005336 Ga0070680_100009999 Ga0070680_1000099996 437
79 3300005337 Ga0070682_100034778 Ga0070682_1000347781 437
80 3300005340 Ga0070689_100170526 Ga0070689_1001705262 437
81 3300005341 Ga0070691_10043259 Ga0070691_100432592 437
82 3300005345 Ga0070692_10004046 Ga0070692_100040462 437
83 3300005354 Ga0070675_100024312 Ga0070675_1000243122 437
84 3300005355 Ga0070671_100001411 Ga0070671_1000014113 437
85 3300005366 Ga0070659_100033847 Ga0070659_1000338474 437
86 3300005435 Ga0070714_100037629 Ga0070714_1000376295 437
87 3300005455 Ga0070663_100005913 Ga0070663_1000059136 437
88 3300005456 Ga0070678_100034928 Ga0070678_1000349284 437
89 3300005458 Ga0070681_10026817 Ga0070681_100268174 437
90 3300005530 Ga0070679_100030112 Ga0070679_1000301123 437
91 3300005543 Ga0070672_100040575 Ga0070672_1000405755 437
92 3300005547 Ga0070693_100000782 Ga0070693_1000007822 437
93 3300005548 Ga0070665_100018219 Ga0070665_1000182193 437
94 3300005563 Ga0068855_100056268 Ga0068855_1000562682 437
95 3300005563 Ga0068855_100120706 Ga0068855_1001207063 437
96 3300005615 Ga0070702_100000492 Ga0070702_1000004926 437
97 3300005616 Ga0068852_100046693 Ga0068852_1000466934 437
98 3300005617 Ga0068859_100076106 Ga0068859_1000761063 437
99 3300005840 Ga0068870_10000308 Ga0068870_100003081 437
100 3300005841 Ga0068863_100010004 Ga0068863_1000100046 437
101 3300006028 Ga0070717_10061684 Ga0070717_100616842 437
102 3300006358 Ga0068871_100024724 Ga0068871_1000247243 437
103 3300006844 Ga0075428_100069025 Ga0075428_1000690253 437
104 3300006871 Ga0075434_100197302 Ga0075434_1001973022 437
105 3300006880 Ga0075429_100067974 Ga0075429_1000679741 437
106 3300006914 Ga0075436_100001288 Ga0075436_1000012886 437
107 3300006931 Ga0097620_100076112 Ga0097620_1000761123 437
108 3300007076 Ga0075435_100091052 Ga0075435_1000910523 437
109 3300009093 Ga0105240_10039974 Ga0105240_100399745 437
110 3300009093 Ga0105240_10057195 Ga0105240_100571955 437
111 3300009094 Ga0111539_10089558 Ga0111539_100895581 437
112 3300009098 Ga0105245_10090782 Ga0105245_100907823 437
113 3300009101 Ga0105247_10005715 Ga0105247_100057153 437
114 3300009147 Ga0114129_10100461 Ga0114129_101004614 437
115 3300009174 Ga0105241_10007546 Ga0105241_100075466 437
116 3300009177 Ga0105248_10047726 Ga0105248_100477265 437
117 3300009551 Ga0105238_10032802 Ga0105238_100328025 437
118 3300011119 Ga0105246_10002707 Ga0105246_100027076 437
119 3300014326 Ga0157380_10050206 Ga0157380_100502063 437
120 3300014497 Ga0182008_10063228 Ga0182008_100632282 437
121 3300014745 Ga0157377_10027254 Ga0157377_100272543 437
122 3300020070 Ga0206356_10349654 Ga0206356_103496541 437
123 3300020081 Ga0206354_10556897 Ga0206354_105568974 437
124 3300022467 Ga0224712_10007566 Ga0224712_100075664 437
125 3300025900 Ga0207710_10017733 Ga0207710_100177334 437
126 3300025908 Ga0207643_10000100 Ga0207643_1000010029 437
127 3300025909 Ga0207705_10011250 Ga0207705_100112505 437
128 3300025912 Ga0207707_10043300 Ga0207707_100433003 437
129 3300025913 Ga0207695_10042043 Ga0207695_100420433 437
130 3300025918 Ga0207662_10042222 Ga0207662_100422221 437
131 3300025929 Ga0207664_10044984 Ga0207664_100449842 437
132 3300025932 Ga0207690_10009825 Ga0207690_100098254 437
133 3300025933 Ga0207706_10088654 Ga0207706_100886542 437
134 3300025936 Ga0207670_10059474 Ga0207670_100594743 437
135 3300025940 Ga0207691_10028165 Ga0207691_100281651 437
136 3300025942 Ga0207689_10001285 Ga0207689_100012857 437
137 3300025944 Ga0207661_10001249 Ga0207661_100012495 437
138 3300025945 Ga0207679_10002148 Ga0207679_1000214812 437
139 3300025981 Ga0207640_10004866 Ga0207640_100048663 437
140 3300026023 Ga0207677_10014417 Ga0207677_100144175 437
141 3300026067 Ga0207678_10001325 Ga0207678_1000132521 437
142 3300026088 Ga0207641_10012080 Ga0207641_100120804 437
143 3300026095 Ga0207676_10001137 Ga0207676_100011374 437
144 3300026116 Ga0207674_10023254 Ga0207674_100232547 437
145 3300026121 Ga0207683_10000565 Ga0207683_1000056518 437
146 3300026142 Ga0207698_10005052 Ga0207698_100050526 437
147 3300027907 Ga0207428_10012488 Ga0207428_100124883 437
148 3300037418 Ga0395900_0039342 Ga0395900_0039342_880_2217 437
149 3300038443 Ga0395901_0028671 Ga0395901_0028671_550_1887 437
150 3300038443 Ga0395901_0147689 Ga0395901_0147689_809_2140 437
151 3300038726 Ga0400490_44514 Ga0400490_44514_6830_8173 437
152 3300042005 Ga0439448_0010451 Ga0439448_0010451_919_2250 437
153 3300044658 Ga0466972_0000275 Ga0466972_0000275_25199_26566 437
154 3300048904 Ga0496101_0059228 Ga0496101_0059228_1105_2436 437
155 3300048905 Ga0496102_0016019 Ga0496102_0016019_2235_3566 437
156 3300048908 Ga0496105_0036700 Ga0496105_0036700_730_2061 437
157 3300048909 Ga0496106_0064727 Ga0496106_0064727_974_2305 437
158 3300048910 Ga0496107_0027620 Ga0496107_0027620_1179_2510 437
159 3300048912 Ga0496109_0057844 Ga0496109_0057844_506_1837 437
160 3300048916 Ga0496113_0038171 Ga0496113_0038171_671_2002 437
161 3300050508 nmdc:mga09592_237415_c1 nmdc:mga09592_237415_c1_97_1428 437
162 3300050510 nmdc:mga06r32_118952_c1 nmdc:mga06r32_118952_c1_999_2330 437
163 3300050512 nmdc:mga0n895_51391_c1 nmdc:mga0n895_51391_c1_1011_2342 437
164 3300050514 nmdc:mga08x19_9110_c1 nmdc:mga08x19_9110_c1_2028_3359 437
165 3300050515 nmdc:mga0a205_8626_c1 nmdc:mga0a205_8626_c1_3813_5144 437
166 3300035172 Ga0373955_0149637 Ga0373955_0149637_27_1346 438
167 3300036401 Ga0373937_0108327 Ga0373937_0108327_27_1346 438
168 3300036401 Ga0373937_0189820 Ga0373937_0189820_585_1904 438
169 3300037418 Ga0395900_0039766 Ga0395900_0039766_2771_4108 438
170 3300046535 Ga0495586_0038260 Ga0495586_0038260_27_1346 438
171 3300046543 Ga0495645_0115655 Ga0495645_0115655_308_1645 438
172 3300046680 Ga0495646_0013711 Ga0495646_0013711_1372_2709 438
173 iso_pu_bacteria 2547132103 2547372050 439
174 iso_pu_bacteria 2808606373 2808906792 439
175 iso_pu_bacteria 2843690924 2843694804 439
176 iso_pu_bacteria 2846037992 2846040252 439
177 iso_pu_bacteria 8057160832 8057163418 439
178 3300007265 Ga0099794_10078515 Ga0099794_100785151 440
179 iso_pu_bacteria 2511231026 2511387745 440
180 iso_pu_bacteria 2521172590 2521557304 440
181 iso_pu_bacteria 2551306416 2553005345 440
182 iso_pu_bacteria 2765235838 2765568431 440
183 iso_pu_bacteria 2808606386 2808981186 440
184 iso_pu_bacteria 2808606415 2809131761 440
185 iso_pu_bacteria 2808606419 2809151427 440
186 iso_pu_bacteria 2818991449 2819617701 440
187 iso_pu_bacteria 2839094727 2839095331 440
188 iso_pu_bacteria 2846033681 2846033726 440
189 iso_pu_bacteria 2852618963 2852620909 440
190 iso_pu_bacteria 2904439833 2904439961 440
191 iso_pu_bacteria 2904530477 2904531094 440
192 iso_pu_bacteria 2904584206 2904587261 440
193 iso_pu_bacteria 2904589729 2904592704 440
194 iso_pu_bacteria 2904601388 2904604513 440
195 iso_pu_bacteria 2919046199 2919050283 440
196 iso_pu_bacteria 2919079590 2919082335 440
197 iso_pu_bacteria 2928130867 2928133273 440
198 3300046492 Ga0495585_0050119 Ga0495585_0050119_591_1931 441
199 3300046691 Ga0495670_0018262 Ga0495670_0018262_1523_2863 441
200 3300047318 Ga0495636_0009917 Ga0495636_0009917_1911_3251 441
201 3300048920 Ga0496117_0085225 Ga0496117_0085225_366_1703 441
202 3300048924 Ga0496121_0002960 Ga0496121_0002960_20617_22026 441
203 iso_pu_bacteria 2511231003 2511250002 441
204 iso_pu_bacteria 2548876994 2550695285 441
205 iso_pu_bacteria 2738541297 2738828840 441
206 iso_pu_bacteria 2738541357 2739152636 441
207 iso_pu_bacteria 2738543003 2739194556 441
208 iso_pu_bacteria 2738543026 2739321032 441
209 iso_pu_bacteria 2738543029 2739339273 441
210 iso_pu_bacteria 2818991436 2819541227 441
211 iso_pu_bacteria 2818991445 2819591986 441
212 iso_pu_bacteria 2884811622 2884813759 441
213 iso_pu_bacteria 2884836552 2884840601 441
214 iso_pu_bacteria 2884852848 2884855858 441
215 iso_pu_bacteria 2885080285 2885085797 441
216 iso_pu_bacteria 2896154374 2896157217 441
217 3300021361 Ga0213872_10001428 Ga0213872_100014284 442
218 3300032004 Ga0307414_10093485 Ga0307414_100934853 442
219 3300039447 Ga0436361_0922237 Ga0436361_0922237_9265_10596 442
220 3300047323 Ga0495683_0017116 Ga0495683_0017116_1269_2597 442
221 iso_pu_bacteria 2643221556 2643802804 442
222 iso_pu_bacteria 2643221684 2644472309 442
223 iso_pu_bacteria 2808606418 2809142740 442
224 iso_pu_bacteria 8047673197 8047678596 442
225 3300032168 Ga0316593_10000016 Ga0316593_1000001618 443
226 3300037418 Ga0395900_0034481 Ga0395900_0034481_628_1986 443
227 3300038726 Ga0400490_47396 Ga0400490_47396_7124_8467 443
228 3300038741 Ga0400488_06787 Ga0400488_06787_2385_3728 443
229 3300039062 Ga0400483_118802 Ga0400483_118802_393_1736 443
230 3300039062 Ga0400483_279956 Ga0400483_279956_6983_8347 443
231 3300039110 Ga0400487_57745 Ga0400487_57745_2396_3739 443
232 3300039447 Ga0436361_0954113 Ga0436361_0954113_2583_3917 443
233 3300042115 Ga0450911_000539 Ga0450911_000539_3531_4868 443
234 3300042156 Ga0439446_0002039 Ga0439446_0002039_1370_2707 443
235 3300042438 Ga0439459_0006044 Ga0439459_0006044_121_1458 443
236 3300049569 Ga0501032_0106611 Ga0501032_0106611_251_1594 443
237 3300049573 Ga0501037_0009794 Ga0501037_0009794_2642_3988 443
238 3300049573 Ga0501037_0022546 Ga0501037_0022546_577_1920 443
239 3300049573 Ga0501037_0102118 Ga0501037_0102118_345_1688 443
240 3300049574 Ga0501038_0002776 Ga0501038_0002776_5970_7316 443
241 3300049575 Ga0501039_0039391 Ga0501039_0039391_865_2208 443
242 3300049580 Ga0501046_0006098 Ga0501046_0006098_3440_4783 443
243 3300049586 Ga0501070_0003149 Ga0501070_0003149_7094_8437 443
244 3300049586 Ga0501070_0020637 Ga0501070_0020637_1135_2478 443
245 3300049586 Ga0501070_0031671 Ga0501070_0031671_792_2138 443
246 3300049588 Ga0501072_0033189 Ga0501072_0033189_2613_3959 443
247 3300049589 Ga0501073_0033039 Ga0501073_0033039_1082_2425 443
248 3300049590 Ga0501074_0013897 Ga0501074_0013897_3232_4578 443
249 3300049742 Ga0501080_0007743 Ga0501080_0007743_3577_4923 443
250 iso_pu_bacteria 2513237150 2513956411 443
251 iso_pu_bacteria 2513237165 2514041511 443
252 iso_pu_bacteria 2687453129 2687580699 443
253 iso_pu_bacteria 2834641062 2834645031 443
254 iso_pu_bacteria 2842711865 2842714761 443
255 iso_pu_bacteria 2857558681 2857563326 443
256 iso_pu_bacteria 2858688981 2858695231 443
257 iso_pu_bacteria 644736347 644748291 443
258 iso_pu_bacteria 8003400568 8003401417 443
259 3300003751 Ga0055538_1000013 Ga0055538_1000013113 444
260 3300003752 Ga0055539_1000018 Ga0055539_1000018113 444
261 3300003756 Ga0055533_1000022 Ga0055533_1000022113 444
262 3300003759 Ga0055525_1000024 Ga0055525_1000024113 444
263 3300003841 Ga0055541_1000013 Ga0055541_1000013113 444
264 3300005563 Ga0068855_100000037 Ga0068855_10000003721 444
265 3300005578 Ga0068854_100004957 Ga0068854_1000049578 444
266 3300009093 Ga0105240_10074646 Ga0105240_100746463 444
267 3300009545 Ga0105237_10015031 Ga0105237_100150316 444
268 3300009551 Ga0105238_10006983 Ga0105238_100069833 444
269 3300010375 Ga0105239_10013663 Ga0105239_100136637 444
270 3300015261 Ga0182006_1006807 Ga0182006_10068073 444
271 3300021361 Ga0213872_10030827 Ga0213872_100308272 444
272 3300025224 Ga0209784_100005 Ga0209784_100005610 444
273 3300025225 Ga0209566_100005 Ga0209566_100005610 444
274 3300025226 Ga0209674_100009 Ga0209674_100009610 444
275 3300025230 Ga0209563_100012 Ga0209563_100012610 444
276 3300025253 Ga0209677_100006 Ga0209677_100006610 444
277 3300025913 Ga0207695_10001485 Ga0207695_100014856 444
278 3300025924 Ga0207694_10001079 Ga0207694_1000107918 444
279 3300025949 Ga0207667_10000053 Ga0207667_10000053165 444
280 3300025949 Ga0207667_10010379 Ga0207667_100103795 444
281 3300039447 Ga0436361_0204853 Ga0436361_0204853_13165_14499 444
282 3300047472 Ga0495686_0000495 Ga0495686_0000495_1529_2863 444
283 3300048906 Ga0496103_0037110 Ga0496103_0037110_135_1469 444
284 3300053125 Ga0500618_002052 Ga0500618_002052_1736_3070 444
285 iso_pu_bacteria 2643221645 2644251905 444
286 iso_pu_bacteria 2643221664 2644360555 444
287 iso_pu_bacteria 2721755763 2723876863 444
288 iso_pu_bacteria 2738541280 2738740390 444
289 iso_pu_bacteria 2738541300 2738843359 444
290 iso_pu_bacteria 2738543018 2739275568 444
291 iso_pu_bacteria 2738543030 2739344612 444
292 iso_pu_bacteria 2821131069 2821133074 444
293 iso_pu_bacteria 2857564685 2857567271 444
294 3300002704 JGI25155J39150_1000275 JGI25155J39150_10002759 445
295 3300002704 JGI25155J39150_1000300 JGI25155J39150_10003004 445
296 3300002705 JGI25156J39149_1000654 JGI25156J39149_10006547 445
297 3300002738 JGI25154J39366_1001008 JGI25154J39366_10010087 445
298 3300002738 JGI25154J39366_1001607 JGI25154J39366_10016077 445
299 3300002741 JGI25157J39369_1000620 JGI25157J39369_10006207 445
300 3300003214 JGI25165J46597_1000172 JGI25165J46597_10001726 445
301 3300003544 Ga0007417J51691_1020175 Ga0007417J51691_10201754 445
302 3300003574 Ga0007410J51695_1027423 Ga0007410J51695_10274234 445
303 3300003575 Ga0007409J51694_1021755 Ga0007409J51694_10217552 445
304 3300003577 Ga0007416J51690_1014475 Ga0007416J51690_10144758 445
305 3300003693 Ga0032354_1020813 Ga0032354_10208134 445
306 3300003751 Ga0055538_1000063 Ga0055538_100006386 445
307 3300003752 Ga0055539_1000096 Ga0055539_100009686 445
308 3300003756 Ga0055533_1000107 Ga0055533_100010786 445
309 3300003758 Ga0055532_1000017 Ga0055532_100001781 445
310 3300003759 Ga0055525_1000047 Ga0055525_100004718 445
311 3300003759 Ga0055525_1000140 Ga0055525_100014086 445
312 3300003761 Ga0055535_1006068 Ga0055535_10060682 445
313 3300003841 Ga0055541_1000064 Ga0055541_100006486 445
314 3300005327 Ga0070658_10094454 Ga0070658_100944542 445
315 3300005331 Ga0070670_100069835 Ga0070670_1000698354 445
316 3300005339 Ga0070660_100156513 Ga0070660_1001565132 445
317 3300005365 Ga0070688_100163434 Ga0070688_1001634341 445
318 3300005530 Ga0070679_100096088 Ga0070679_1000960884 445
319 3300005563 Ga0068855_100057771 Ga0068855_1000577712 445
320 3300005614 Ga0068856_100107915 Ga0068856_1001079153 445
321 3300005616 Ga0068852_100024959 Ga0068852_1000249594 445
322 3300005985 Ga0081539_10000178 Ga0081539_1000017820 445
323 3300009093 Ga0105240_10056621 Ga0105240_100566213 445
324 3300015265 Ga0182005_1001875 Ga0182005_10018753 445
325 3300017792 Ga0163161_10046295 Ga0163161_100462953 445
326 3300025206 Ga0209435_100015 Ga0209435_10001595 445
327 3300025206 Ga0209435_100309 Ga0209435_1003092 445
328 3300025207 Ga0209760_101815 Ga0209760_1018151 445
329 3300025224 Ga0209784_100079 Ga0209784_100079138 445
330 3300025225 Ga0209566_100093 Ga0209566_100093138 445
331 3300025226 Ga0209674_100115 Ga0209674_100115138 445
332 3300025229 Ga0209147_100004 Ga0209147_1000041131 445
333 3300025230 Ga0209563_100003 Ga0209563_100003548 445
334 3300025230 Ga0209563_100113 Ga0209563_100113138 445
335 3300025231 Ga0207427_100262 Ga0207427_10026232 445
336 3300025233 Ga0209437_100176 Ga0209437_100176138 445
337 3300025233 Ga0209437_100329 Ga0209437_10032927 445
338 3300025242 Ga0209258_100523 Ga0209258_1005238 445
339 3300025246 Ga0209646_1000020 Ga0209646_100002076 445
340 3300025246 Ga0209646_1000040 Ga0209646_1000040125 445
341 3300025250 Ga0209026_1000034 Ga0209026_1000034194 445
342 3300025250 Ga0209026_1001477 Ga0209026_10014774 445
343 3300025253 Ga0209677_100072 Ga0209677_100072138 445
344 3300025256 Ga0209759_1000049 Ga0209759_10000499 445
345 3300025256 Ga0209759_1000656 Ga0209759_10006567 445
346 3300025261 Ga0209233_1000183 Ga0209233_1000183138 445
347 3300025272 Ga0209455_1001230 Ga0209455_10012307 445
348 3300025912 Ga0207707_10015157 Ga0207707_100151573 445
349 3300025913 Ga0207695_10041793 Ga0207695_100417933 445
350 3300025919 Ga0207657_10051371 Ga0207657_100513713 445
351 3300025921 Ga0207652_10241492 Ga0207652_102414922 445
352 3300025932 Ga0207690_10057472 Ga0207690_100574723 445
353 3300025933 Ga0207706_10174827 Ga0207706_101748272 445
354 3300025949 Ga0207667_10024176 Ga0207667_100241763 445
355 3300026078 Ga0207702_10085554 Ga0207702_100855543 445
356 3300037312 Ga0395899_0000183 Ga0395899_0000183_88957_90294 445
357 3300037312 Ga0395899_0012998 Ga0395899_0012998_2143_3480 445
358 3300037418 Ga0395900_0005509 Ga0395900_0005509_6376_7713 445
359 3300037418 Ga0395900_0011725 Ga0395900_0011725_872_2209 445
360 3300037418 Ga0395900_0177584 Ga0395900_0177584_23_1360 445
361 3300037466 Ga0395898_0085096 Ga0395898_0085096_1696_3033 445
362 3300037471 Ga0395905_0004758 Ga0395905_0004758_9023_10360 445
363 3300038443 Ga0395901_0002114 Ga0395901_0002114_3494_4831 445
364 3300042876 Ga0451577_0047164 Ga0451577_0047164_1461_2843 445
365 3300044765 Ga0466970_0014159 Ga0466970_0014159_385_1722 445
366 3300045049 Ga0466959_0015602 Ga0466959_0015602_402_1739 445
367 3300046452 Ga0495617_000004 Ga0495617_000004_56440_57777 445
368 3300046463 Ga0495653_0000010 Ga0495653_0000010_268526_269863 445
369 3300046471 Ga0495650_0000494 Ga0495650_0000494_16952_18289 445
370 3300046471 Ga0495650_0052606 Ga0495650_0052606_251_1588 445
371 3300046492 Ga0495585_0002914 Ga0495585_0002914_1734_3071 445
372 3300046507 Ga0495606_0000014 Ga0495606_0000014_165047_166384 445
373 3300046507 Ga0495606_0000111 Ga0495606_0000111_98884_100221 445
374 3300046507 Ga0495606_0000580 Ga0495606_0000580_2121_3458 445
375 3300046511 Ga0495608_0011071 Ga0495608_0011071_455_1792 445
376 3300046512 Ga0495610_0000010 Ga0495610_0000010_414825_416162 445
377 3300046512 Ga0495610_0006477 Ga0495610_0006477_3343_4680 445
378 3300046514 Ga0495618_0015550 Ga0495618_0015550_1752_3089 445
379 3300046524 Ga0495648_0001863 Ga0495648_0001863_1000_2337 445
380 3300046529 Ga0495652_0037529 Ga0495652_0037529_1268_2605 445
381 3300046542 Ga0495597_0001941 Ga0495597_0001941_1625_2962 445
382 3300046543 Ga0495645_0018519 Ga0495645_0018519_2369_3706 445
383 3300046558 Ga0495633_0007242 Ga0495633_0007242_58_1395 445
384 3300046616 Ga0495668_0000038 Ga0495668_0000038_42344_43681 445
385 3300046660 Ga0495625_0002638 Ga0495625_0002638_16097_17434 445
386 3300046664 Ga0495659_0014299 Ga0495659_0014299_1227_2567 445
387 3300046678 Ga0495599_0013096 Ga0495599_0013096_3692_5029 445
388 3300046680 Ga0495646_0035421 Ga0495646_0035421_479_1816 445
389 3300046692 Ga0495671_0000002 Ga0495671_0000002_467809_469146 445
390 3300046809 Ga0495600_0001052 Ga0495600_0001052_12498_13835 445
391 3300047317 Ga0495604_0001639 Ga0495604_0001639_2828_4165 445
392 3300047323 Ga0495683_0006608 Ga0495683_0006608_1695_3032 445
393 3300047443 Ga0495687_036245 Ga0495687_036245_564_1901 445
394 3300047446 Ga0495679_022962 Ga0495679_022962_516_1853 445
395 3300047469 Ga0495673_0000026 Ga0495673_0000026_355311_356648 445
396 3300047472 Ga0495686_0053915 Ga0495686_0053915_1169_2506 445
397 3300048090 Ga0495615_0004504 Ga0495615_0004504_246_1583 445
398 3300048091 Ga0495626_0005936 Ga0495626_0005936_4198_5535 445
399 3300048905 Ga0496102_0000829 Ga0496102_0000829_26668_28005 445
400 3300048905 Ga0496102_0029433 Ga0496102_0029433_1855_3192 445
401 3300048905 Ga0496102_0045157 Ga0496102_0045157_62_1399 445
402 3300048906 Ga0496103_0018656 Ga0496103_0018656_1926_3263 445
403 3300048907 Ga0496104_0120702 Ga0496104_0120702_161_1498 445
404 3300048908 Ga0496105_0099411 Ga0496105_0099411_649_1986 445
405 3300048912 Ga0496109_0060710 Ga0496109_0060710_1948_3285 445
406 3300048913 Ga0496110_0040532 Ga0496110_0040532_2195_3532 445
407 3300048914 Ga0496111_0018763 Ga0496111_0018763_2614_3951 445
408 3300048915 Ga0496112_0091673 Ga0496112_0091673_686_2023 445
409 3300048919 Ga0496116_0025999 Ga0496116_0025999_2543_3880 445
410 3300048924 Ga0496121_0012291 Ga0496121_0012291_1808_3145 445
411 3300048924 Ga0496121_0101059 Ga0496121_0101059_624_1961 445
412 3300048925 Ga0496122_0003862 Ga0496122_0003862_16013_17350 445
413 3300048925 Ga0496122_0055182 Ga0496122_0055182_1283_2620 445
414 3300048926 Ga0496123_0003055 Ga0496123_0003055_1924_3261 445
415 3300048926 Ga0496123_0091043 Ga0496123_0091043_199_1536 445
416 3300048927 Ga0496124_0083110 Ga0496124_0083110_1036_2373 445
417 3300048928 Ga0496125_0001421 Ga0496125_0001421_29110_30447 445
418 3300048928 Ga0496125_0001986 Ga0496125_0001986_1923_3260 445
419 3300049459 Ga0495678_002684 Ga0495678_002684_7491_8828 445
420 3300049588 Ga0501072_0036798 Ga0501072_0036798_1223_2563 445
421 3300050512 nmdc:mga0n895_10431_c1 nmdc:mga0n895_10431_c1_1427_2767 445
422 3300050513 nmdc:mga0rr50_13135_c1 nmdc:mga0rr50_13135_c1_1763_3103 445
423 3300053119 Ga0500595_002472 Ga0500595_002472_1743_3080 445
424 3300053154 Ga0500619_000135 Ga0500619_000135_16108_17445 445
425 iso_pu_bacteria 2643221638 2644211847 445
426 3300003575 Ga0007409J51694_1027849 Ga0007409J51694_10278492 446
427 3300005327 Ga0070658_10086252 Ga0070658_100862521 446
428 3300005563 Ga0068855_100020817 Ga0068855_1000208171 446
429 3300013100 Ga0157373_10089301 Ga0157373_100893013 446
430 3300013297 Ga0157378_10057431 Ga0157378_100574313 446
431 3300025254 Ga0209148_1001634 Ga0209148_10016348 446
432 3300025909 Ga0207705_10059148 Ga0207705_100591482 446
433 3300025911 Ga0207654_10000706 Ga0207654_1000070613 446
434 3300025919 Ga0207657_10076687 Ga0207657_100766873 446
435 3300025949 Ga0207667_10012404 Ga0207667_100124048 446
436 3300025949 Ga0207667_10169730 Ga0207667_101697302 446
437 3300030731 Ga0316177_1194028 Ga0316177_119402812 446
438 3300037312 Ga0395899_0045159 Ga0395899_0045159_160_1500 446
439 3300037418 Ga0395900_0000331 Ga0395900_0000331_5401_6741 446
440 3300037418 Ga0395900_0001669 Ga0395900_0001669_3801_5141 446
441 3300037418 Ga0395900_0057317 Ga0395900_0057317_1761_3101 446
442 3300037466 Ga0395898_0081519 Ga0395898_0081519_449_1789 446
443 3300037471 Ga0395905_0072426 Ga0395905_0072426_1730_3070 446
444 3300037471 Ga0395905_0090323 Ga0395905_0090323_396_1736 446
445 3300037471 Ga0395905_0107847 Ga0395905_0107847_713_2053 446
446 3300037471 Ga0395905_0208272 Ga0395905_0208272_83_1423 446
447 3300038443 Ga0395901_0000097 Ga0395901_0000097_39029_40369 446
448 3300038443 Ga0395901_0002053 Ga0395901_0002053_1083_2423 446
449 3300042005 Ga0439448_0005556 Ga0439448_0005556_338_1678 446
450 3300044658 Ga0466972_0027692 Ga0466972_0027692_698_2038 446
451 3300044683 Ga0466965_0052353 Ga0466965_0052353_522_1862 446
452 3300044684 Ga0466966_0006240 Ga0466966_0006240_6273_7613 446
453 3300044684 Ga0466966_0039322 Ga0466966_0039322_981_2321 446
454 3300044706 Ga0466964_0002459 Ga0466964_0002459_3584_4924 446
455 3300044706 Ga0466964_0056952 Ga0466964_0056952_165_1505 446
456 3300044842 Ga0466957_0003310 Ga0466957_0003310_4757_6097 446
457 3300044842 Ga0466957_0023223 Ga0466957_0023223_747_2087 446
458 3300044842 Ga0466957_0037108 Ga0466957_0037108_1454_2794 446
459 3300044842 Ga0466957_0107941 Ga0466957_0107941_19_1359 446
460 3300044901 Ga0466960_0019925 Ga0466960_0019925_875_2215 446
461 3300045976 Ga0466967_0026135 Ga0466967_0026135_1375_2715 446
462 3300045976 Ga0466967_0049377 Ga0466967_0049377_832_2172 446
463 3300046452 Ga0495617_000009 Ga0495617_000009_154786_156126 446
464 3300046452 Ga0495617_000407 Ga0495617_000407_3861_5201 446
465 3300046452 Ga0495617_021504 Ga0495617_021504_677_2017 446
466 3300046453 Ga0495627_000255 Ga0495627_000255_1836_3176 446
467 3300046453 Ga0495627_001629 Ga0495627_001629_819_2159 446
468 3300046455 Ga0495603_0017245 Ga0495603_0017245_1759_3099 446
469 3300046457 Ga0495590_0000669 Ga0495590_0000669_9645_10985 446
470 3300046457 Ga0495590_0002180 Ga0495590_0002180_5474_6814 446
471 3300046458 Ga0495591_001902 Ga0495591_001902_1869_3209 446
472 3300046463 Ga0495653_0031870 Ga0495653_0031870_1574_2914 446
473 3300046463 Ga0495653_0078741 Ga0495653_0078741_124_1464 446
474 3300046471 Ga0495650_0000593 Ga0495650_0000593_6317_7657 446
475 3300046471 Ga0495650_0025561 Ga0495650_0025561_946_2286 446
476 3300046474 Ga0495605_0000024 Ga0495605_0000024_77636_78976 446
477 3300046474 Ga0495605_0000236 Ga0495605_0000236_1798_3138 446
478 3300046474 Ga0495605_0002652 Ga0495605_0002652_7899_9239 446
479 3300046474 Ga0495605_0012754 Ga0495605_0012754_1989_3329 446
480 3300046474 Ga0495605_0022425 Ga0495605_0022425_1034_2374 446
481 3300046474 Ga0495605_0045363 Ga0495605_0045363_424_1764 446
482 3300046491 Ga0495584_0000003 Ga0495584_0000003_256497_257837 446
483 3300046491 Ga0495584_0000145 Ga0495584_0000145_46598_47938 446
484 3300046491 Ga0495584_0001720 Ga0495584_0001720_2910_4250 446
485 3300046491 Ga0495584_0002824 Ga0495584_0002824_8318_9658 446
486 3300046491 Ga0495584_0025456 Ga0495584_0025456_191_1531 446
487 3300046491 Ga0495584_0041841 Ga0495584_0041841_518_1858 446
488 3300046492 Ga0495585_0000130 Ga0495585_0000130_6492_7832 446
489 3300046492 Ga0495585_0000996 Ga0495585_0000996_1299_2639 446
490 3300046492 Ga0495585_0001018 Ga0495585_0001018_1335_2675 446
491 3300046492 Ga0495585_0002381 Ga0495585_0002381_3390_4730 446
492 3300046492 Ga0495585_0028439 Ga0495585_0028439_1565_2905 446
493 3300046492 Ga0495585_0035009 Ga0495585_0035009_313_1653 446
494 3300046492 Ga0495585_0098533 Ga0495585_0098533_118_1458 446
495 3300046500 Ga0495596_0001402 Ga0495596_0001402_627_1967 446
496 3300046500 Ga0495596_0003382 Ga0495596_0003382_1750_3090 446
497 3300046500 Ga0495596_0004245 Ga0495596_0004245_3917_5257 446
498 3300046500 Ga0495596_0004507 Ga0495596_0004507_3803_5143 446
499 3300046500 Ga0495596_0006613 Ga0495596_0006613_2642_3982 446
500 3300046500 Ga0495596_0017410 Ga0495596_0017410_1588_2928 446
501 3300046501 Ga0495607_0003741 Ga0495607_0003741_8285_9625 446
502 3300046501 Ga0495607_0009001 Ga0495607_0009001_1786_3126 446
503 3300046501 Ga0495607_0016447 Ga0495607_0016447_1849_3189 446
504 3300046501 Ga0495607_0017184 Ga0495607_0017184_1842_3182 446
505 3300046501 Ga0495607_0021131 Ga0495607_0021131_1805_3145 446
506 3300046506 Ga0495583_0000235 Ga0495583_0000235_62478_63818 446
507 3300046506 Ga0495583_0000560 Ga0495583_0000560_48364_49704 446
508 3300046506 Ga0495583_0000654 Ga0495583_0000654_1833_3173 446
509 3300046506 Ga0495583_0004372 Ga0495583_0004372_864_2204 446
510 3300046506 Ga0495583_0028477 Ga0495583_0028477_395_1735 446
511 3300046507 Ga0495606_0006256 Ga0495606_0006256_8225_9565 446
512 3300046507 Ga0495606_0029563 Ga0495606_0029563_2267_3607 446
513 3300046507 Ga0495606_0051056 Ga0495606_0051056_1076_2416 446
514 3300046507 Ga0495606_0059306 Ga0495606_0059306_79_1419 446
515 3300046512 Ga0495610_0001639 Ga0495610_0001639_6215_7555 446
516 3300046513 Ga0495616_0000542 Ga0495616_0000542_1771_3111 446
517 3300046513 Ga0495616_0000648 Ga0495616_0000648_21675_23015 446
518 3300046513 Ga0495616_0000816 Ga0495616_0000816_1759_3099 446
519 3300046513 Ga0495616_0002434 Ga0495616_0002434_9826_11166 446
520 3300046513 Ga0495616_0007257 Ga0495616_0007257_3625_4965 446
521 3300046513 Ga0495616_0020804 Ga0495616_0020804_1924_3264 446
522 3300046513 Ga0495616_0080572 Ga0495616_0080572_54_1394 446
523 3300046517 Ga0495630_0054277 Ga0495630_0054277_1186_2526 446
524 3300046518 Ga0495631_0001791 Ga0495631_0001791_2851_4191 446
525 3300046518 Ga0495631_0002889 Ga0495631_0002889_7797_9137 446
526 3300046518 Ga0495631_0003258 Ga0495631_0003258_1871_3211 446
527 3300046518 Ga0495631_0029473 Ga0495631_0029473_109_1449 446
528 3300046519 Ga0495632_0000073 Ga0495632_0000073_101141_102481 446
529 3300046519 Ga0495632_0000203 Ga0495632_0000203_57608_58948 446
530 3300046519 Ga0495632_0000225 Ga0495632_0000225_1602_2942 446
531 3300046519 Ga0495632_0022132 Ga0495632_0022132_1556_2896 446
532 3300046519 Ga0495632_0040635 Ga0495632_0040635_946_2286 446
533 3300046522 Ga0495643_0007966 Ga0495643_0007966_3813_5153 446
534 3300046522 Ga0495643_0037200 Ga0495643_0037200_1145_2485 446
535 3300046523 Ga0495644_0024587 Ga0495644_0024587_378_1718 446
536 3300046524 Ga0495648_0000003 Ga0495648_0000003_315328_316668 446
537 3300046524 Ga0495648_0000290 Ga0495648_0000290_51429_52769 446
538 3300046524 Ga0495648_0017919 Ga0495648_0017919_1731_3071 446
539 3300046528 Ga0495642_0000065 Ga0495642_0000065_59376_60716 446
540 3300046528 Ga0495642_0003872 Ga0495642_0003872_1614_2954 446
541 3300046528 Ga0495642_0023058 Ga0495642_0023058_228_1568 446
542 3300046530 Ga0495654_0011052 Ga0495654_0011052_1833_3173 446
543 3300046538 Ga0495609_0000030 Ga0495609_0000030_92943_94283 446
544 3300046538 Ga0495609_0003180 Ga0495609_0003180_1544_2884 446
545 3300046538 Ga0495609_0006964 Ga0495609_0006964_1722_3062 446
546 3300046538 Ga0495609_0010364 Ga0495609_0010364_1476_2816 446
547 3300046538 Ga0495609_0018313 Ga0495609_0018313_1747_3087 446
548 3300046538 Ga0495609_0026724 Ga0495609_0026724_652_1992 446
549 3300046542 Ga0495597_0000219 Ga0495597_0000219_49288_50628 446
550 3300046542 Ga0495597_0022494 Ga0495597_0022494_1278_2618 446
551 3300046543 Ga0495645_0045214 Ga0495645_0045214_681_2021 446
552 3300046558 Ga0495633_0002706 Ga0495633_0002706_9153_10493 446
553 3300046558 Ga0495633_0010500 Ga0495633_0010500_1394_2734 446
554 3300046558 Ga0495633_0014935 Ga0495633_0014935_1020_2360 446
555 3300046616 Ga0495668_0000366 Ga0495668_0000366_1719_3059 446
556 3300046616 Ga0495668_0001445 Ga0495668_0001445_20087_21427 446
557 3300046616 Ga0495668_0006030 Ga0495668_0006030_2097_3437 446
558 3300046616 Ga0495668_0016824 Ga0495668_0016824_1743_3083 446
559 3300046616 Ga0495668_0020642 Ga0495668_0020642_1722_3062 446
560 3300046616 Ga0495668_0038717 Ga0495668_0038717_155_1495 446
561 3300046642 Ga0495634_0012880 Ga0495634_0012880_3931_5271 446
562 3300046648 Ga0495611_0000944 Ga0495611_0000944_5700_7040 446
563 3300046648 Ga0495611_0008302 Ga0495611_0008302_1391_2731 446
564 3300046660 Ga0495625_0038762 Ga0495625_0038762_1871_3211 446
565 3300046660 Ga0495625_0050334 Ga0495625_0050334_1518_2858 446
566 3300046665 Ga0495661_0000209 Ga0495661_0000209_1804_3144 446
567 3300046665 Ga0495661_0009420 Ga0495661_0009420_1487_2827 446
568 3300046665 Ga0495661_0016457 Ga0495661_0016457_1683_3023 446
569 3300046665 Ga0495661_0018929 Ga0495661_0018929_892_2232 446
570 3300046665 Ga0495661_0023930 Ga0495661_0023930_1920_3260 446
571 3300046665 Ga0495661_0024398 Ga0495661_0024398_982_2322 446
572 3300046665 Ga0495661_0029152 Ga0495661_0029152_1775_3115 446
573 3300046665 Ga0495661_0034208 Ga0495661_0034208_625_1965 446
574 3300046665 Ga0495661_0034544 Ga0495661_0034544_215_1555 446
575 3300046665 Ga0495661_0058618 Ga0495661_0058618_711_2051 446
576 3300046674 Ga0495588_0000078 Ga0495588_0000078_21127_22467 446
577 3300046674 Ga0495588_0030499 Ga0495588_0030499_930_2270 446
578 3300046679 Ga0495623_0033389 Ga0495623_0033389_1413_2753 446
579 3300046684 Ga0495669_0014220 Ga0495669_0014220_1725_3065 446
580 3300046684 Ga0495669_0024677 Ga0495669_0024677_908_2248 446
581 3300046691 Ga0495670_0000223 Ga0495670_0000223_1384_2724 446
582 3300046691 Ga0495670_0046089 Ga0495670_0046089_543_1883 446
583 3300046692 Ga0495671_0000812 Ga0495671_0000812_1797_3137 446
584 3300046692 Ga0495671_0004041 Ga0495671_0004041_237_1577 446
585 3300046694 Ga0495649_0000363 Ga0495649_0000363_1884_3224 446
586 3300046694 Ga0495649_0002963 Ga0495649_0002963_1747_3087 446
587 3300046794 Ga0495589_0000021 Ga0495589_0000021_93243_94583 446
588 3300046794 Ga0495589_0000193 Ga0495589_0000193_36200_37540 446
589 3300046810 Ga0495660_0000173 Ga0495660_0000173_65692_67032 446
590 3300046810 Ga0495660_0012363 Ga0495660_0012363_1790_3130 446
591 3300046810 Ga0495660_0034184 Ga0495660_0034184_1062_2402 446
592 3300047320 Ga0495672_0000178 Ga0495672_0000178_80819_82159 446
593 3300047320 Ga0495672_0001371 Ga0495672_0001371_1650_2990 446
594 3300047320 Ga0495672_0002544 Ga0495672_0002544_13810_15150 446
595 3300047320 Ga0495672_0008348 Ga0495672_0008348_148_1488 446
596 3300047321 Ga0495676_0159698 Ga0495676_0159698_89_1429 446
597 3300047323 Ga0495683_0000660 Ga0495683_0000660_22171_23511 446
598 3300047323 Ga0495683_0001145 Ga0495683_0001145_8440_9780 446
599 3300047323 Ga0495683_0006365 Ga0495683_0006365_708_2048 446
600 3300047323 Ga0495683_0008983 Ga0495683_0008983_532_1872 446
601 3300047323 Ga0495683_0011073 Ga0495683_0011073_1841_3181 446
602 3300047323 Ga0495683_0032082 Ga0495683_0032082_905_2245 446
603 3300047443 Ga0495687_000012 Ga0495687_000012_320586_321926 446
604 3300047443 Ga0495687_000276 Ga0495687_000276_64649_65989 446
605 3300047443 Ga0495687_000279 Ga0495687_000279_64079_65419 446
606 3300047443 Ga0495687_000319 Ga0495687_000319_58289_59629 446
607 3300047443 Ga0495687_000545 Ga0495687_000545_1831_3171 446
608 3300047444 Ga0495675_0032064 Ga0495675_0032064_309_1649 446
609 3300047445 Ga0495677_0000050 Ga0495677_0000050_2195_3535 446
610 3300047445 Ga0495677_0000934 Ga0495677_0000934_1539_2879 446
611 3300047445 Ga0495677_0004733 Ga0495677_0004733_1977_3317 446
612 3300047445 Ga0495677_0005481 Ga0495677_0005481_1806_3146 446
613 3300047445 Ga0495677_0027690 Ga0495677_0027690_264_1604 446
614 3300047446 Ga0495679_006510 Ga0495679_006510_2172_3512 446
615 3300047446 Ga0495679_012045 Ga0495679_012045_1769_3109 446
616 3300047447 Ga0495685_002889 Ga0495685_002889_2321_3661 446
617 3300047470 Ga0495681_0000744 Ga0495681_0000744_1802_3142 446
618 3300047470 Ga0495681_0000807 Ga0495681_0000807_21003_22343 446
619 3300047470 Ga0495681_0017085 Ga0495681_0017085_1104_2444 446
620 3300047470 Ga0495681_0034729 Ga0495681_0034729_854_2194 446
621 3300047472 Ga0495686_0002818 Ga0495686_0002818_12589_13929 446
622 3300048091 Ga0495626_0000017 Ga0495626_0000017_224097_225437 446
623 3300048091 Ga0495626_0000386 Ga0495626_0000386_1661_3001 446
624 3300048091 Ga0495626_0000425 Ga0495626_0000425_1802_3142 446
625 3300048904 Ga0496101_0239903 Ga0496101_0239903_19_1359 446
626 3300048906 Ga0496103_0037452 Ga0496103_0037452_558_1898 446
627 3300048908 Ga0496105_0118365 Ga0496105_0118365_643_1983 446
628 3300048911 Ga0496108_0200177 Ga0496108_0200177_230_1570 446
629 3300048912 Ga0496109_0063033 Ga0496109_0063033_187_1527 446
630 3300048913 Ga0496110_0000070 Ga0496110_0000070_1790_3130 446
631 3300048915 Ga0496112_0077032 Ga0496112_0077032_631_1971 446
632 3300048916 Ga0496113_0067247 Ga0496113_0067247_454_1794 446
633 3300048918 Ga0496115_0203182 Ga0496115_0203182_266_1606 446
634 3300048925 Ga0496122_0000452 Ga0496122_0000452_82338_83678 446
635 3300048925 Ga0496122_0049890 Ga0496122_0049890_1572_2912 446
636 3300048925 Ga0496122_0127976 Ga0496122_0127976_205_1545 446
637 3300048926 Ga0496123_0000514 Ga0496123_0000514_1618_2958 446
638 3300048927 Ga0496124_0057706 Ga0496124_0057706_283_1623 446
639 3300048927 Ga0496124_0063627 Ga0496124_0063627_21_1361 446
640 3300048927 Ga0496124_0119203 Ga0496124_0119203_600_1940 446
641 3300048928 Ga0496125_0000572 Ga0496125_0000572_60093_61433 446
642 3300049459 Ga0495678_000293 Ga0495678_000293_1763_3103 446
643 3300049459 Ga0495678_000671 Ga0495678_000671_1748_3088 446
644 3300049459 Ga0495678_001164 Ga0495678_001164_18751_20091 446
645 3300049459 Ga0495678_001549 Ga0495678_001549_7527_8867 446
646 3300049459 Ga0495678_016210 Ga0495678_016210_419_1759 446
647 3300049822 Ga0501035_0011898 Ga0501035_0011898_4869_6209 446
648 3300049823 Ga0501044_0097554 Ga0501044_0097554_242_1582 446
649 3300053125 Ga0500618_001366 Ga0500618_001366_2639_3985 446
650 iso_pu_bacteria 2526164512 2526211196 446
651 iso_pu_bacteria 2857553236 2857558356 446
652 iso_pu_bacteria 2919476304 2919479858 446
653 iso_pu_bacteria 2952252522 2952254926 446
654 3300003775 Ga0055524_1011067 Ga0055524_10110671 447
655 3300005546 Ga0070696_100031224 Ga0070696_1000312242 447
656 3300025294 Ga0209025_1001025 Ga0209025_100102532 447
657 3300025922 Ga0207646_10232375 Ga0207646_102323751 447
658 3300042876 Ga0451577_0010210 Ga0451577_0010210_7549_8901 447
659 3300045051 Ga0451576_0009713 Ga0451576_0009713_5356_6708 447
660 3300046452 Ga0495617_009926 Ga0495617_009926_1652_2998 447
661 3300046507 Ga0495606_0000927 Ga0495606_0000927_6291_7637 447
662 3300046660 Ga0495625_0026750 Ga0495625_0026750_1437_2783 447
663 3300047469 Ga0495673_0000028 Ga0495673_0000028_57442_58788 447
664 3300048907 Ga0496104_0209741 Ga0496104_0209741_424_1767 447
665 3300049571 Ga0501034_0000781 Ga0501034_0000781_7938_9281 447
666 3300049572 Ga0501036_0018715 Ga0501036_0018715_951_2303 447
667 3300049574 Ga0501038_0080830 Ga0501038_0080830_644_1996 447
668 3300049575 Ga0501039_0089498 Ga0501039_0089498_822_2174 447
669 3300049582 Ga0501048_0088728 Ga0501048_0088728_131_1483 447
670 3300049587 Ga0501071_0009404 Ga0501071_0009404_2915_4267 447
671 3300049591 Ga0501075_0001807 Ga0501075_0001807_6835_8187 447
672 3300049592 Ga0501076_0000702 Ga0501076_0000702_15675_17027 447
673 3300049592 Ga0501076_0044313 Ga0501076_0044313_1258_2613 447
674 3300049741 Ga0501079_0050326 Ga0501079_0050326_622_1974 447
675 3300049742 Ga0501080_0042531 Ga0501080_0042531_1652_3004 447
676 3300049743 Ga0501081_0010281 Ga0501081_0010281_2975_4327 447
677 3300049824 Ga0501045_0002691 Ga0501045_0002691_663_2015 447
678 3300053118 Ga0500594_0001376 Ga0500594_0001376_3314_4660 447
679 3300060353 Ga0501082_0017408 Ga0501082_0017408_3148_4500 447
680 3300061734 Ga0530510_0010709 Ga0530510_0010709_3887_5239 447
681 3300002774 JGI25150J39212_1002852 JGI25150J39212_10028526 448
682 3300002774 JGI25150J39212_1006946 JGI25150J39212_10069462 448
683 3300005458 Ga0070681_10006572 Ga0070681_1000657216 448
684 3300005467 Ga0070706_100017426 Ga0070706_1000174268 448
685 3300005468 Ga0070707_100214422 Ga0070707_1002144222 448
686 3300005545 Ga0070695_100060199 Ga0070695_1000601993 448
687 3300021361 Ga0213872_10000020 Ga0213872_1000002064 448
688 3300025245 Ga0207425_1000678 Ga0207425_100067813 448
689 3300025294 Ga0209025_1005080 Ga0209025_10050809 448
690 3300025297 Ga0209758_1000228 Ga0209758_100022813 448
691 3300025935 Ga0207709_10069197 Ga0207709_100691972 448
692 3300031548 Ga0307408_100020196 Ga0307408_1000201961 448
693 3300031711 Ga0265314_10032195 Ga0265314_100321953 448
694 3300035111 Ga0373923_0002011 Ga0373923_0002011_3249_4598 448
695 3300035113 Ga0373936_0002769 Ga0373936_0002769_956_2305 448
696 3300035117 Ga0373953_0000495 Ga0373953_0000495_242_1591 448
697 3300035118 Ga0373954_0005296 Ga0373954_0005296_1129_2478 448
698 3300035118 Ga0373954_0009358 Ga0373954_0009358_1533_2882 448
699 3300035119 Ga0373956_0003206 Ga0373956_0003206_1949_3298 448
700 3300035119 Ga0373956_0011273 Ga0373956_0011273_1103_2452 448
701 3300035170 Ga0373943_0005190 Ga0373943_0005190_2438_3787 448
702 3300035172 Ga0373955_0008004 Ga0373955_0008004_2672_4021 448
703 3300035692 Ga0373935_0001464 Ga0373935_0001464_3977_5326 448
704 3300035724 Ga0373933_0005221 Ga0373933_0005221_2587_3936 448
705 3300035725 Ga0373947_0017109 Ga0373947_0017109_2314_3663 448
706 3300036401 Ga0373937_0001406 Ga0373937_0001406_6506_7855 448
707 3300037068 Ga0373925_0080980 Ga0373925_0080980_746_2095 448
708 3300039447 Ga0436361_0594223 Ga0436361_0594223_18310_19659 448
709 3300039447 Ga0436361_0901422 Ga0436361_0901422_14451_15800 448
710 3300044683 Ga0466965_0071145 Ga0466965_0071145_113_1462 448
711 3300046454 Ga0495592_0042407 Ga0495592_0042407_96_1445 448
712 3300046457 Ga0495590_0000010 Ga0495590_0000010_6968_8317 448
713 3300046459 Ga0495629_0065510 Ga0495629_0065510_563_1912 448
714 3300046460 Ga0495638_0000042 Ga0495638_0000042_182949_184298 448
715 3300046461 Ga0495641_0005536 Ga0495641_0005536_3169_4518 448
716 3300046462 Ga0495651_0003157 Ga0495651_0003157_3885_5234 448
717 3300046471 Ga0495650_0000165 Ga0495650_0000165_3888_5237 448
718 3300046471 Ga0495650_0000429 Ga0495650_0000429_65187_66536 448
719 3300046471 Ga0495650_0000500 Ga0495650_0000500_6479_7828 448
720 3300046471 Ga0495650_0017535 Ga0495650_0017535_2054_3403 448
721 3300046471 Ga0495650_0017859 Ga0495650_0017859_2009_3358 448
722 3300046472 Ga0495580_0004251 Ga0495580_0004251_1213_2562 448
723 3300046474 Ga0495605_0000022 Ga0495605_0000022_2554_3903 448
724 3300046475 Ga0495639_0008995 Ga0495639_0008995_479_1828 448
725 3300046475 Ga0495639_0019621 Ga0495639_0019621_1076_2425 448
726 3300046476 Ga0495662_0016721 Ga0495662_0016721_1640_2989 448
727 3300046499 Ga0495594_0022348 Ga0495594_0022348_974_2323 448
728 3300046501 Ga0495607_0036706 Ga0495607_0036706_172_1521 448
729 3300046501 Ga0495607_0080074 Ga0495607_0080074_324_1673 448
730 3300046506 Ga0495583_0000006 Ga0495583_0000006_1929_3278 448
731 3300046507 Ga0495606_0001555 Ga0495606_0001555_21090_22439 448
732 3300046507 Ga0495606_0006476 Ga0495606_0006476_1509_2858 448
733 3300046507 Ga0495606_0015030 Ga0495606_0015030_1509_2858 448
734 3300046511 Ga0495608_0026379 Ga0495608_0026379_1230_2579 448
735 3300046516 Ga0495628_0077781 Ga0495628_0077781_1136_2485 448
736 3300046517 Ga0495630_0006438 Ga0495630_0006438_5205_6554 448
737 3300046520 Ga0495637_0000069 Ga0495637_0000069_81794_83143 448
738 3300046522 Ga0495643_0001442 Ga0495643_0001442_18734_20083 448
739 3300046524 Ga0495648_0006527 Ga0495648_0006527_928_2277 448
740 3300046528 Ga0495642_0033354 Ga0495642_0033354_256_1605 448
741 3300046529 Ga0495652_0138551 Ga0495652_0138551_385_1734 448
742 3300046530 Ga0495654_0000002 Ga0495654_0000002_406100_407449 448
743 3300046530 Ga0495654_0017135 Ga0495654_0017135_2232_3581 448
744 3300046531 Ga0495665_0035295 Ga0495665_0035295_844_2193 448
745 3300046533 Ga0495640_0008997 Ga0495640_0008997_1116_2465 448
746 3300046536 Ga0495587_0003065 Ga0495587_0003065_2665_4014 448
747 3300046542 Ga0495597_0000111 Ga0495597_0000111_50660_52009 448
748 3300046542 Ga0495597_0006433 Ga0495597_0006433_700_2049 448
749 3300046557 Ga0495622_0000116 Ga0495622_0000116_1314_2663 448
750 3300046558 Ga0495633_0000124 Ga0495633_0000124_7214_8563 448
751 3300046558 Ga0495633_0000553 Ga0495633_0000553_33788_35137 448
752 3300046616 Ga0495668_0000843 Ga0495668_0000843_1994_3343 448
753 3300046616 Ga0495668_0031335 Ga0495668_0031335_1453_2802 448
754 3300046642 Ga0495634_0004770 Ga0495634_0004770_2836_4185 448
755 3300046660 Ga0495625_0000218 Ga0495625_0000218_87109_88458 448
756 3300046660 Ga0495625_0002241 Ga0495625_0002241_1508_2857 448
757 3300046660 Ga0495625_0049337 Ga0495625_0049337_162_1511 448
758 3300046663 Ga0495635_0025139 Ga0495635_0025139_1115_2464 448
759 3300046664 Ga0495659_0000240 Ga0495659_0000240_20028_21377 448
760 3300046675 Ga0495657_0022230 Ga0495657_0022230_1230_2579 448
761 3300046680 Ga0495646_0010240 Ga0495646_0010240_2732_4078 448
762 3300046692 Ga0495671_0000382 Ga0495671_0000382_33628_34977 448
763 3300046809 Ga0495600_0003954 Ga0495600_0003954_4253_5602 448
764 3300047317 Ga0495604_0019580 Ga0495604_0019580_1024_2373 448
765 3300047320 Ga0495672_0002881 Ga0495672_0002881_7041_8390 448
766 3300047320 Ga0495672_0020474 Ga0495672_0020474_1416_2765 448
767 3300047322 Ga0495680_0019175 Ga0495680_0019175_988_2337 448
768 3300047443 Ga0495687_000965 Ga0495687_000965_27672_29021 448
769 3300047443 Ga0495687_000991 Ga0495687_000991_26856_28205 448
770 3300047444 Ga0495675_0051543 Ga0495675_0051543_649_1998 448
771 3300047469 Ga0495673_0000005 Ga0495673_0000005_298922_300271 448
772 3300047471 Ga0495684_0022699 Ga0495684_0022699_2037_3386 448
773 3300048924 Ga0496121_0067635 Ga0496121_0067635_128_1477 448
774 3300048929 Ga0496126_0049386 Ga0496126_0049386_1495_2844 448
775 3300049459 Ga0495678_000936 Ga0495678_000936_1965_3314 448
776 3300049459 Ga0495678_006615 Ga0495678_006615_3639_4988 448
777 3300002739 JGI25158J39367_1002873 JGI25158J39367_10028731 449
778 3300002739 JGI25158J39367_1003610 JGI25158J39367_10036103 449
779 3300002773 JGI25152J39213_1001570 JGI25152J39213_10015702 449
780 3300002774 JGI25150J39212_1002715 JGI25150J39212_10027154 449
781 3300003215 JGI25153J46596_10016740 JGI25153J46596_100167404 449
782 3300003771 Ga0055526_1016792 Ga0055526_10167921 449
783 3300003773 Ga0055537_1000330 Ga0055537_100033021 449
784 3300003775 Ga0055524_1001358 Ga0055524_100135810 449
785 3300003775 Ga0055524_1012021 Ga0055524_10120213 449
786 3300003784 Ga0055534_1000606 Ga0055534_10006068 449
787 3300003790 Ga0055528_1000364 Ga0055528_100036424 449
788 3300003791 Ga0055530_10013065 Ga0055530_100130652 449
789 3300003791 Ga0055530_10014339 Ga0055530_100143393 449
790 3300003794 Ga0055531_10004518 Ga0055531_100045186 449
791 3300003794 Ga0055531_10028903 Ga0055531_100289032 449
792 3300004625 Ga0055543_1003234 Ga0055543_10032343 449
793 3300004625 Ga0055543_1006226 Ga0055543_10062262 449
794 3300005262 Ga0065165_1000039 Ga0065165_100003915 449
795 3300005262 Ga0065165_1015571 Ga0065165_10155711 449
796 3300005327 Ga0070658_10023663 Ga0070658_100236633 449
797 3300005535 Ga0070684_100034767 Ga0070684_1000347674 449
798 3300005535 Ga0070684_100142665 Ga0070684_1001426652 449
799 3300005616 Ga0068852_100027944 Ga0068852_1000279446 449
800 3300006880 Ga0075429_100099229 Ga0075429_1000992292 449
801 3300009094 Ga0111539_10000505 Ga0111539_100005053 449
802 3300009098 Ga0105245_10053839 Ga0105245_100538393 449
803 3300009551 Ga0105238_10051992 Ga0105238_100519925 449
804 3300009551 Ga0105238_10100019 Ga0105238_101000192 449
805 3300013104 Ga0157370_10014186 Ga0157370_100141863 449
806 3300013104 Ga0157370_10081754 Ga0157370_100817542 449
807 3300013105 Ga0157369_10040213 Ga0157369_100402133 449
808 3300013307 Ga0157372_10013542 Ga0157372_100135423 449
809 3300013307 Ga0157372_10059774 Ga0157372_100597742 449
810 3300025208 Ga0209436_100728 Ga0209436_10072820 449
811 3300025208 Ga0209436_101841 Ga0209436_1018418 449
812 3300025208 Ga0209436_102839 Ga0209436_1028392 449
813 3300025245 Ga0207425_1000014 Ga0207425_10000144 449
814 3300025245 Ga0207425_1000109 Ga0207425_10001098 449
815 3300025245 Ga0207425_1000122 Ga0207425_100012272 449
816 3300025258 Ga0209129_1000017 Ga0209129_1000017457 449
817 3300025263 Ga0209565_1000003 Ga0209565_10000038 449
818 3300025263 Ga0209565_1004651 Ga0209565_10046516 449
819 3300025263 Ga0209565_1006069 Ga0209565_10060692 449
820 3300025273 Ga0209673_1000017 Ga0209673_1000017379 449
821 3300025284 Ga0209130_1000171 Ga0209130_100017177 449
822 3300025284 Ga0209130_1000177 Ga0209130_100017788 449
823 3300025291 Ga0209675_1000119 Ga0209675_10001198 449
824 3300025291 Ga0209675_1001621 Ga0209675_10016218 449
825 3300025295 Ga0209564_1000016 Ga0209564_1000016107 449
826 3300025295 Ga0209564_1005005 Ga0209564_10050052 449
827 3300025297 Ga0209758_1000038 Ga0209758_10000384 449
828 3300025298 Ga0209050_1000011 Ga0209050_1000011540 449
829 3300025298 Ga0209050_1003602 Ga0209050_10036029 449
830 3300025299 Ga0209256_1000210 Ga0209256_10002108 449
831 3300025299 Ga0209256_1000987 Ga0209256_100098737 449
832 3300025299 Ga0209256_1002009 Ga0209256_10020093 449
833 3300025299 Ga0209256_1009131 Ga0209256_10091313 449
834 3300025302 Ga0207426_1006741 Ga0207426_10067412 449
835 3300025302 Ga0207426_1023189 Ga0207426_10231892 449
836 3300025304 Ga0209257_1000003 Ga0209257_10000031312 449
837 3300025304 Ga0209257_1013499 Ga0209257_10134993 449
838 3300025909 Ga0207705_10017296 Ga0207705_100172962 449
839 3300025909 Ga0207705_10018257 Ga0207705_100182573 449
840 3300025911 Ga0207654_10019815 Ga0207654_100198153 449
841 3300025921 Ga0207652_10056420 Ga0207652_100564202 449
842 3300025924 Ga0207694_10040962 Ga0207694_100409623 449
843 3300025945 Ga0207679_10130250 Ga0207679_101302502 449
844 3300025949 Ga0207667_10038157 Ga0207667_100381572 449
845 3300026041 Ga0207639_10036345 Ga0207639_100363453 449
846 3300026067 Ga0207678_10212027 Ga0207678_102120271 449
847 3300026078 Ga0207702_10124137 Ga0207702_101241372 449
848 3300027907 Ga0207428_10003457 Ga0207428_100034573 449
849 3300031548 Ga0307408_100000140 Ga0307408_10000014087 449
850 3300031548 Ga0307408_100109124 Ga0307408_1001091242 449
851 3300031548 Ga0307408_100175360 Ga0307408_1001753602 449
852 3300031728 Ga0316578_10052727 Ga0316578_100527272 449
853 3300032002 Ga0307416_100007520 Ga0307416_1000075204 449
854 3300035398 Ga0316574_0003444 Ga0316574_0003444_1001_2371 449
855 3300036647 Ga0316582_0090944 Ga0316582_0090944_304_1662 449
856 3300037418 Ga0395900_0082870 Ga0395900_0082870_552_1916 449
857 3300037471 Ga0395905_0069234 Ga0395905_0069234_149_1501 449
858 3300038443 Ga0395901_0098268 Ga0395901_0098268_509_1873 449
859 3300045836 Ga0466958_0019882 Ga0466958_0019882_2142_3506 449
860 3300046491 Ga0495584_0041540 Ga0495584_0041540_720_2072 449
861 3300046501 Ga0495607_0000615 Ga0495607_0000615_31375_32727 449
862 3300046501 Ga0495607_0031141 Ga0495607_0031141_384_1736 449
863 3300046519 Ga0495632_0001091 Ga0495632_0001091_1708_3060 449
864 3300046538 Ga0495609_0000072 Ga0495609_0000072_1996_3348 449
865 3300046616 Ga0495668_0000071 Ga0495668_0000071_7494_8846 449
866 3300046660 Ga0495625_0038134 Ga0495625_0038134_76_1428 449
867 3300046664 Ga0495659_0003268 Ga0495659_0003268_1002_2354 449
868 3300046665 Ga0495661_0005018 Ga0495661_0005018_6298_7650 449
869 3300046665 Ga0495661_0034622 Ga0495661_0034622_704_2056 449
870 3300046684 Ga0495669_0001554 Ga0495669_0001554_1907_3259 449
871 3300046694 Ga0495649_0018097 Ga0495649_0018097_638_1990 449
872 3300047470 Ga0495681_0023498 Ga0495681_0023498_178_1530 449
873 3300047472 Ga0495686_0001546 Ga0495686_0001546_1503_2855 449
874 3300048091 Ga0495626_0035411 Ga0495626_0035411_37_1389 449
875 3300048916 Ga0496113_0136051 Ga0496113_0136051_249_1601 449
876 3300049581 Ga0501047_0019305 Ga0501047_0019305_5071_6438 449
877 3300049583 Ga0501067_0076997 Ga0501067_0076997_65_1432 449
878 3300049585 Ga0501069_0001751 Ga0501069_0001751_3056_4423 449
879 3300049586 Ga0501070_0013289 Ga0501070_0013289_2455_3822 449
880 3300049589 Ga0501073_0000278 Ga0501073_0000278_17144_18511 449
881 3300049590 Ga0501074_0002070 Ga0501074_0002070_11539_12906 449
882 3300049742 Ga0501080_0014652 Ga0501080_0014652_1125_2492 449
883 3300049744 Ga0501083_0007253 Ga0501083_0007253_3229_4596 449
884 3300049775 Ga0501279_004229 Ga0501279_004229_355_1707 449
885 3300050491 nmdc:mga00v17_22542_c1 nmdc:mga00v17_22542_c1_360_1727 449
886 3300050508 nmdc:mga09592_24967_c1 nmdc:mga09592_24967_c1_1827_3191 449
887 3300050511 nmdc:mga08y16_785_c1 nmdc:mga08y16_785_c1_1005_2369 449
888 3300054114 Ga0501084_0015416 Ga0501084_0015416_1929_3296 449
889 3300060353 Ga0501082_0025637 Ga0501082_0025637_2408_3775 449
890 3300005330 Ga0070690_100001150 Ga0070690_10000115013 450
891 3300005334 Ga0068869_100001768 Ga0068869_10000176811 450
892 3300005338 Ga0068868_100121854 Ga0068868_1001218542 450
893 3300005338 Ga0068868_100153756 Ga0068868_1001537561 450
894 3300005340 Ga0070689_100002574 Ga0070689_10000257410 450
895 3300005340 Ga0070689_100009280 Ga0070689_1000092807 450
896 3300005340 Ga0070689_100119308 Ga0070689_1001193081 450
897 3300005341 Ga0070691_10008035 Ga0070691_100080354 450
898 3300005345 Ga0070692_10003248 Ga0070692_100032485 450
899 3300005354 Ga0070675_100001897 Ga0070675_10000189711 450
900 3300005356 Ga0070674_100073081 Ga0070674_1000730812 450
901 3300005356 Ga0070674_100144524 Ga0070674_1001445241 450
902 3300005364 Ga0070673_100106735 Ga0070673_1001067352 450
903 3300005365 Ga0070688_100023396 Ga0070688_1000233963 450
904 3300005439 Ga0070711_100025581 Ga0070711_1000255813 450
905 3300005440 Ga0070705_100034973 Ga0070705_1000349733 450
906 3300005441 Ga0070700_100002896 Ga0070700_1000028962 450
907 3300005444 Ga0070694_100061363 Ga0070694_1000613632 450
908 3300005459 Ga0068867_100003190 Ga0068867_1000031903 450
909 3300005466 Ga0070685_10065099 Ga0070685_100650991 450
910 3300005467 Ga0070706_100040072 Ga0070706_1000400722 450
911 3300005544 Ga0070686_100001567 Ga0070686_1000015676 450
912 3300005545 Ga0070695_100016701 Ga0070695_1000167013 450
913 3300005546 Ga0070696_100009218 Ga0070696_1000092185 450
914 3300005546 Ga0070696_100031219 Ga0070696_1000312192 450
915 3300005547 Ga0070693_100000927 Ga0070693_1000009273 450
916 3300005547 Ga0070693_100011430 Ga0070693_1000114304 450
917 3300005547 Ga0070693_100020661 Ga0070693_1000206611 450
918 3300005548 Ga0070665_100153626 Ga0070665_1001536262 450
919 3300005615 Ga0070702_100003343 Ga0070702_1000033436 450
920 3300005718 Ga0068866_10004054 Ga0068866_100040542 450
921 3300005719 Ga0068861_100005425 Ga0068861_1000054252 450
922 3300005842 Ga0068858_100032854 Ga0068858_1000328543 450
923 3300005842 Ga0068858_100043474 Ga0068858_1000434742 450
924 3300005843 Ga0068860_100020008 Ga0068860_1000200086 450
925 3300005844 Ga0068862_100009752 Ga0068862_1000097525 450
926 3300006195 Ga0075366_10006563 Ga0075366_100065637 450
927 3300006237 Ga0097621_100023306 Ga0097621_1000233064 450
928 3300006237 Ga0097621_100221051 Ga0097621_1002210512 450
929 3300006358 Ga0068871_100087396 Ga0068871_1000873962 450
930 3300006871 Ga0075434_100121819 Ga0075434_1001218193 450
931 3300006881 Ga0068865_100000273 Ga0068865_10000027315 450
932 3300009098 Ga0105245_10000207 Ga0105245_100002076 450
933 3300009098 Ga0105245_10034497 Ga0105245_100344974 450
934 3300009148 Ga0105243_10027012 Ga0105243_100270124 450
935 3300009176 Ga0105242_10003135 Ga0105242_1000313510 450
936 3300009176 Ga0105242_10019320 Ga0105242_100193202 450
937 3300009176 Ga0105242_10022750 Ga0105242_100227502 450
938 3300009177 Ga0105248_10017721 Ga0105248_100177212 450
939 3300009177 Ga0105248_10377723 Ga0105248_103777231 450
940 3300009551 Ga0105238_10133784 Ga0105238_101337843 450
941 3300009553 Ga0105249_10016805 Ga0105249_100168055 450
942 3300013296 Ga0157374_10056395 Ga0157374_100563955 450
943 3300013297 Ga0157378_10004564 Ga0157378_100045646 450
944 3300013308 Ga0157375_10086055 Ga0157375_100860553 450
945 3300014326 Ga0157380_10005531 Ga0157380_1000553110 450
946 3300014745 Ga0157377_10034828 Ga0157377_100348283 450
947 3300014968 Ga0157379_10053926 Ga0157379_100539264 450
948 3300014968 Ga0157379_10140774 Ga0157379_101407742 450
949 3300014969 Ga0157376_10073516 Ga0157376_100735163 450
950 3300015265 Ga0182005_1000013 Ga0182005_1000013316 450
951 3300025899 Ga0207642_10002492 Ga0207642_100024923 450
952 3300025908 Ga0207643_10005317 Ga0207643_100053173 450
953 3300025912 Ga0207707_10117374 Ga0207707_101173741 450
954 3300025924 Ga0207694_10103237 Ga0207694_101032372 450
955 3300025926 Ga0207659_10091323 Ga0207659_100913232 450
956 3300025926 Ga0207659_10135247 Ga0207659_101352472 450
957 3300025927 Ga0207687_10005397 Ga0207687_100053973 450
958 3300025933 Ga0207706_10101869 Ga0207706_101018692 450
959 3300025934 Ga0207686_10012873 Ga0207686_100128732 450
960 3300025934 Ga0207686_10020448 Ga0207686_100204484 450
961 3300025936 Ga0207670_10002019 Ga0207670_100020199 450
962 3300025936 Ga0207670_10059722 Ga0207670_100597223 450
963 3300025938 Ga0207704_10001365 Ga0207704_100013657 450
964 3300025940 Ga0207691_10011498 Ga0207691_1001149810 450
965 3300025941 Ga0207711_10051181 Ga0207711_100511815 450
966 3300025941 Ga0207711_10095643 Ga0207711_100956433 450
967 3300025942 Ga0207689_10002332 Ga0207689_1000233214 450
968 3300025944 Ga0207661_10265592 Ga0207661_102655922 450
969 3300025961 Ga0207712_10031274 Ga0207712_100312742 450
970 3300026023 Ga0207677_10108350 Ga0207677_101083502 450
971 3300026023 Ga0207677_10131423 Ga0207677_101314231 450
972 3300026035 Ga0207703_10013747 Ga0207703_100137472 450
973 3300026035 Ga0207703_10040395 Ga0207703_100403956 450
974 3300026075 Ga0207708_10000156 Ga0207708_1000015645 450
975 3300026075 Ga0207708_10030948 Ga0207708_100309482 450
976 3300026089 Ga0207648_10005383 Ga0207648_100053836 450
977 3300026118 Ga0207675_100001059 Ga0207675_10000105916 450
978 3300026121 Ga0207683_10085260 Ga0207683_100852603 450
979 3300026142 Ga0207698_10002155 Ga0207698_1000215512 450
980 3300028381 Ga0268264_10022554 Ga0268264_100225542 450
981 3300032002 Ga0307416_100205343 Ga0307416_1002053432 450
982 3300035172 Ga0373955_0039940 Ga0373955_0039940_1129_2496 450
983 3300035410 Ga0373924_0011263 Ga0373924_0011263_1355_2722 450
984 3300035691 Ga0373931_0055874 Ga0373931_0055874_641_2008 450
985 3300035695 Ga0373927_0061227 Ga0373927_0061227_287_1645 450
986 3300046453 Ga0495627_000008 Ga0495627_000008_376005_377360 450
987 3300046454 Ga0495592_0015317 Ga0495592_0015317_2087_3454 450
988 3300046529 Ga0495652_0044005 Ga0495652_0044005_1400_2767 450
989 3300046538 Ga0495609_0000542 Ga0495609_0000542_26429_27784 450
990 3300046543 Ga0495645_0001557 Ga0495645_0001557_8107_9474 450
991 3300046559 Ga0495667_0013108 Ga0495667_0013108_1221_2588 450
992 3300046678 Ga0495599_0010681 Ga0495599_0010681_1190_2557 450
993 3300046679 Ga0495623_0008017 Ga0495623_0008017_940_2307 450
994 3300046809 Ga0495600_0043602 Ga0495600_0043602_442_1809 450
995 3300046810 Ga0495660_0001379 Ga0495660_0001379_1554_2909 450
996 3300046810 Ga0495660_0003764 Ga0495660_0003764_2852_4207 450
997 3300047322 Ga0495680_0080171 Ga0495680_0080171_868_2235 450
998 3300047471 Ga0495684_0145098 Ga0495684_0145098_365_1732 450
999 3300048907 Ga0496104_0051486 Ga0496104_0051486_217_1617 450
1000 3300049459 Ga0495678_000006 Ga0495678_000006_391786_393141 450
1001 3300049571 Ga0501034_0000468 Ga0501034_0000468_61325_62695 450
1002 3300050493 nmdc:mga0k408_1373_c1 nmdc:mga0k408_1373_c1_4884_6251 450
1003 3300050513 nmdc:mga0rr50_75146_c1 nmdc:mga0rr50_75146_c1_328_1695 450
1004 3300050514 nmdc:mga08x19_745_c1 nmdc:mga08x19_745_c1_3170_4537 450
1005 3300053077 Ga0495601_0007578 Ga0495601_0007578_2644_4011 450
1006 3300053085 Ga0495619_0038154 Ga0495619_0038154_1150_2517 450
1007 3300005347 Ga0070668_100010282 Ga0070668_1000102824 451
1008 3300005549 Ga0070704_100015546 Ga0070704_1000155464 451
1009 3300005617 Ga0068859_100061203 Ga0068859_1000612032 451
1010 3300005842 Ga0068858_100031576 Ga0068858_1000315763 451
1011 3300005844 Ga0068862_100028139 Ga0068862_1000281394 451
1012 3300006931 Ga0097620_100061206 Ga0097620_1000612062 451
1013 3300013297 Ga0157378_10078856 Ga0157378_100788562 451
1014 3300013308 Ga0157375_10148969 Ga0157375_101489691 451
1015 3300014326 Ga0157380_10020047 Ga0157380_100200473 451
1016 3300025934 Ga0207686_10172580 Ga0207686_101725801 451
1017 3300025942 Ga0207689_10082728 Ga0207689_100827282 451
1018 3300025972 Ga0207668_10019908 Ga0207668_100199084 451
1019 3300031250 Ga0265331_10010555 Ga0265331_100105552 451
1020 3300031251 Ga0265327_10000639 Ga0265327_1000063937 451
1021 3300046683 Ga0495658_0117709 Ga0495658_0117709_67_1458 451
1022 3300049569 Ga0501032_0007810 Ga0501032_0007810_5067_6428 451
1023 3300001979 JGI24740J21852_10001895 JGI24740J21852_100018959 453

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00408

PGM_PMM_IV

Phosphoglucomutase/phosphomannomutase, C-terminal domain

408

475

0.98

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

36

174

0.97

PF02880

PGM_PMM_III

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III

294

404

0.94

PF02879

PGM_PMM_II

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

192

290

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gyz-assembly1.cif.gz_B crystal structure of glmm from staphylococcus aureus 0.9494 4 451
7olh-assembly3.cif.gz_E bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) 0.9447 4 375
7olh-assembly3.cif.gz_E bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) 0.9422 4 375
6gyz-assembly1.cif.gz_B crystal structure of glmm from staphylococcus aureus 0.9411 4 451
3i3w-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9319 4 449
ID Description Score Start End Superfamily
6gyzB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9828 162 262 3.40.120.10
af_P31120_370_445_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.9713 376 449 3.30.310.50
af_P9WN41_373_447_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.9596 376 450 3.30.310.50
af_P31120_3_154_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9551 3 159 3.40.120.10
af_P9WN41_373_447_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.9473 376 450 3.30.310.50
ID Description Score Start End GO Terms
AF-A0A381EZZ9-F1-model_v4 deleted 0.9858 80 234
AF-A4MZY5-F1-model_v4 deleted 0.9855 51 449
AF-A0A1G0KTN6-F1-model_v4 Phosphoglucosamine mutase (EC 5.4.2.10) 0.985 1 451 GO:0000287
GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-A0A1F8U9G8-F1-model_v4 Phosphoglucosamine mutase (EC 5.4.2.10) 0.9846 101 450 GO:0000287
GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-A0A382VFH7-F1-model_v4 Alpha-D-phosphohexomutase alpha/beta/alpha domain-containing protein 0.9839 103 269 GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252

Feature Viewer

pLDDT pTM Quality
92.94 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map