F488433
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1023 | 504 | 957 | 446 |
Family's Representative Sequence
| Representative Sequence | 3300003751|Ga0055538_1000013|Ga0055538_1000013113 |
| Length | 477 |
| Sequence | MIQDGMRRGPAVSRETGRGGPGLRHKKEKDKADMAAKYFGTDGVRGRVGVAPITPDFVMRLGYAAGKVLAKAKDGMARPTVLIGKDTRISGYMLEAALEAGFAAAGVDVWLPGPVPTPAVAYLTRALRLSAGVVISASHNPYHDNGIKFFSANGNKLPDAVEADIEAALEQPMDCVPSEKLGKARRLSDAPGRYIEFCKSTFPSAMNLRGMRLVVDCAHGAAYNIAPHVFHELGAEVITIGNQPDGLNINEDCGATAPKTLVASVREYRADLGIALDGDADRLIMVDGEGRIYNGDELLYLMVKDRLATGPVEGAVGTLMTNMALEVAFRKMGVPFERAKVGDRYVLEVLQEKGWLLGGEGSGHLLALDKHTTGDGIVSALQVLTALKRSGQTLAEMTADITMYPQSLVNVKIPAGYDWKSNAALQAEKAAVEEELGERGRVLLRPSGTEPLIRVMVEAQQADLARSMAQRIAAKVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 2 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 3 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 4 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 5 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 6 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 7 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 8 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 9 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 10 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 11 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 12 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 13 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 14 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 15 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 16 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 17 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 18 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 19 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 20 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 21 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 22 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 23 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 24 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 25 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 26 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 27 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 28 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 29 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 30 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 31 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 32 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 33 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 34 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 35 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 36 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 37 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 38 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 39 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 40 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 41 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 42 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 43 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 44 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 45 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 46 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 47 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 48 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 49 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 50 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 51 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 52 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 53 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 54 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 55 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 56 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 57 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 58 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 59 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 60 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 61 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 62 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 63 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 64 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 65 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 66 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 67 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 68 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 69 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 70 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 71 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 72 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 73 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 74 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 75 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 76 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 77 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 78 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 80 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 83 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 86 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 87 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 88 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 90 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 91 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 92 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 93 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 94 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 95 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 98 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 100 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 101 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 102 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 103 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 105 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 113 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 121 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 124 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 125 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 127 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 128 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 129 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 132 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 138 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 139 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 140 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 142 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 143 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 144 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 145 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 146 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 147 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 148 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 149 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 150 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 151 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 153 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 155 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 156 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 157 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 158 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 159 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 160 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 161 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 163 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 164 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 187 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 191 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 192 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 194 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 195 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 196 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 197 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 198 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 209 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 210 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 211 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 214 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 217 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 219 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 221 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 223 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 226 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 278 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 280 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 281 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 282 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 283 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 284 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 285 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 286 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 287 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 288 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 289 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 290 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 291 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 294 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 296 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 298 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 299 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 300 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 301 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 302 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 303 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 304 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 305 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 306 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 307 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 308 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 309 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 311 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 312 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 313 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 314 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 315 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 316 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 317 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 318 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 319 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 320 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 321 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 322 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 323 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 324 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 325 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 326 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 327 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 328 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 329 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 330 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 331 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 332 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 333 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 334 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 335 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 336 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 337 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 338 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 339 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 340 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 341 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 342 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 343 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 344 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 345 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 346 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 435 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 436 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 437 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 438 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 439 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 440 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 443 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 444 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 445 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 446 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 447 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 448 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 449 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 450 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 451 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 452 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 453 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 454 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 455 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 456 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 480 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 484 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 485 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 486 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 487 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 488 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 495 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 496 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 497 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 498 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 501 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 502 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 503 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 504 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.47 |
| Metatranscriptomes | 1.08 |
| Isolates | 6.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.48 |
| Nodule | 0.68 |
| Rhizoplane | 3.03 |
| Rhizosphere | 77.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001895 | 3300001979 | Bacteria | 9587 |
| 2 | JGI24751J29686_10008669 | 3300002459 | Bacteria | 2083 |
| 3 | JGI25155J39150_1000275 | 3300002704 | Bacteria | 18778 |
| 4 | JGI25155J39150_1000300 | 3300002704 | Bacteria | 16946 |
| 5 | JGI25156J39149_1000654 | 3300002705 | Bacteria | 18946 |
| 6 | JGI25154J39366_1001008 | 3300002738 | Bacteria | 11332 |
| 7 | JGI25154J39366_1001607 | 3300002738 | Bacteria | 7679 |
| 8 | JGI25158J39367_1002873 | 3300002739 | Bacteria | 2730 |
| 9 | JGI25158J39367_1003610 | 3300002739 | Bacteria | 2374 |
| 10 | JGI25157J39369_1000620 | 3300002741 | Bacteria | 20062 |
| 11 | JGI25152J39213_1001570 | 3300002773 | Bacteria | 9614 |
| 12 | JGI25150J39212_1002715 | 3300002774 | Bacteria | 4308 |
| 13 | JGI25150J39212_1002852 | 3300002774 | Bacteria | 4185 |
| 14 | JGI25150J39212_1006946 | 3300002774 | Bacteria | 2302 |
| 15 | JGI25165J46597_1000172 | 3300003214 | Bacteria | 101521 |
| 16 | JGI25153J46596_10016740 | 3300003215 | Bacteria | 2920 |
| 17 | Ga0007417J51691_1020175 | 3300003544 | Bacteria | 5032 |
| 18 | Ga0007410J51695_1027423 | 3300003574 | Bacteria | 4817 |
| 19 | Ga0007409J51694_1021755 | 3300003575 | Bacteria | 2972 |
| 20 | Ga0007409J51694_1027849 | 3300003575 | Bacteria | 1871 |
| 21 | Ga0007416J51690_1014475 | 3300003577 | Bacteria | 7645 |
| 22 | Ga0032354_1020813 | 3300003693 | Bacteria | 5526 |
| 23 | Ga0055538_1000013 | 3300003751 | Bacteria | 348596 |
| 24 | Ga0055538_1000063 | 3300003751 | Bacteria | 101521 |
| 25 | Ga0055539_1000018 | 3300003752 | Bacteria | 348596 |
| 26 | Ga0055539_1000096 | 3300003752 | Bacteria | 101521 |
| 27 | Ga0055533_1000022 | 3300003756 | Bacteria | 348596 |
| 28 | Ga0055533_1000107 | 3300003756 | Bacteria | 101521 |
| 29 | Ga0055532_1000017 | 3300003758 | Bacteria | 306880 |
| 30 | Ga0055525_1000024 | 3300003759 | Bacteria | 348596 |
| 31 | Ga0055525_1000047 | 3300003759 | Bacteria | 261507 |
| 32 | Ga0055525_1000140 | 3300003759 | Bacteria | 101521 |
| 33 | Ga0055535_1006068 | 3300003761 | Bacteria | 2516 |
| 34 | Ga0055526_1016792 | 3300003771 | Bacteria | 2839 |
| 35 | Ga0055537_1000330 | 3300003773 | Bacteria | 32350 |
| 36 | Ga0055524_1001358 | 3300003775 | Bacteria | 14234 |
| 37 | Ga0055524_1011067 | 3300003775 | Bacteria | 3548 |
| 38 | Ga0055524_1012021 | 3300003775 | Bacteria | 3347 |
| 39 | Ga0055534_1000606 | 3300003784 | Bacteria | 18579 |
| 40 | Ga0055528_1000364 | 3300003790 | Bacteria | 36795 |
| 41 | Ga0055530_10013065 | 3300003791 | Bacteria | 2855 |
| 42 | Ga0055530_10014339 | 3300003791 | Bacteria | 2646 |
| 43 | Ga0055531_10004518 | 3300003794 | Bacteria | 8447 |
| 44 | Ga0055531_10028903 | 3300003794 | Bacteria | 1901 |
| 45 | Ga0055541_1000013 | 3300003841 | Bacteria | 348596 |
| 46 | Ga0055541_1000064 | 3300003841 | Bacteria | 101521 |
| 47 | Ga0055543_1003234 | 3300004625 | Bacteria | 4931 |
| 48 | Ga0055543_1006226 | 3300004625 | Bacteria | 2915 |
| 49 | Ga0065165_1000039 | 3300005262 | Bacteria | 208372 |
| 50 | Ga0065165_1015571 | 3300005262 | Bacteria | 2892 |
| 51 | Ga0070658_10023663 | 3300005327 | Bacteria | 4926 |
| 52 | Ga0070658_10086252 | 3300005327 | Bacteria | 2582 |
| 53 | Ga0070658_10094454 | 3300005327 | Bacteria | 2467 |
| 54 | Ga0070658_10098905 | 3300005327 | Bacteria | 2410 |
| 55 | Ga0070676_10068657 | 3300005328 | Bacteria | 2122 |
| 56 | Ga0070690_100001150 | 3300005330 | Bacteria | 13626 |
| 57 | Ga0070670_100023041 | 3300005331 | Bacteria | 5357 |
| 58 | Ga0070670_100069835 | 3300005331 | Bacteria | 3016 |
| 59 | Ga0068869_100001768 | 3300005334 | Bacteria | 12934 |
| 60 | Ga0070680_100009999 | 3300005336 | Bacteria | 7309 |
| 61 | Ga0070682_100034778 | 3300005337 | Bacteria | 3071 |
| 62 | Ga0068868_100121854 | 3300005338 | Bacteria | 2128 |
| 63 | Ga0068868_100153756 | 3300005338 | Bacteria | 1896 |
| 64 | Ga0070660_100156513 | 3300005339 | Bacteria | 1834 |
| 65 | Ga0070689_100002574 | 3300005340 | Bacteria | 11891 |
| 66 | Ga0070689_100009280 | 3300005340 | Bacteria | 6970 |
| 67 | Ga0070689_100119308 | 3300005340 | Bacteria | 2106 |
| 68 | Ga0070689_100170526 | 3300005340 | Bacteria | 1763 |
| 69 | Ga0070691_10008035 | 3300005341 | Bacteria | 4826 |
| 70 | Ga0070691_10043259 | 3300005341 | Bacteria | 2133 |
| 71 | Ga0070692_10003248 | 3300005345 | Bacteria | 6550 |
| 72 | Ga0070692_10004046 | 3300005345 | Bacteria | 6057 |
| 73 | Ga0070668_100010282 | 3300005347 | Bacteria | 6946 |
| 74 | Ga0070675_100001897 | 3300005354 | Bacteria | 15424 |
| 75 | Ga0070675_100024312 | 3300005354 | Bacteria | 4851 |
| 76 | Ga0070671_100001411 | 3300005355 | Bacteria | 17952 |
| 77 | Ga0070674_100073081 | 3300005356 | Bacteria | 2430 |
| 78 | Ga0070674_100144524 | 3300005356 | Bacteria | 1789 |
| 79 | Ga0070673_100106735 | 3300005364 | Bacteria | 2316 |
| 80 | Ga0070688_100023396 | 3300005365 | Bacteria | 3633 |
| 81 | Ga0070688_100163434 | 3300005365 | Bacteria | 1531 |
| 82 | Ga0070659_100033847 | 3300005366 | Bacteria | 3972 |
| 83 | Ga0070709_10013484 | 3300005434 | Bacteria | 4598 |
| 84 | Ga0070709_10050553 | 3300005434 | Bacteria | 2605 |
| 85 | Ga0070714_100037629 | 3300005435 | Bacteria | 4066 |
| 86 | Ga0070714_100154152 | 3300005435 | Bacteria | 2073 |
| 87 | Ga0070713_100001388 | 3300005436 | Bacteria | 15519 |
| 88 | Ga0070711_100025581 | 3300005439 | Bacteria | 3864 |
| 89 | Ga0070705_100034973 | 3300005440 | Bacteria | 2813 |
| 90 | Ga0070700_100002896 | 3300005441 | Bacteria | 8816 |
| 91 | Ga0070694_100061363 | 3300005444 | Bacteria | 2566 |
| 92 | Ga0070663_100005913 | 3300005455 | Bacteria | 7321 |
| 93 | Ga0070678_100034928 | 3300005456 | Bacteria | 3505 |
| 94 | Ga0070681_10006572 | 3300005458 | Bacteria | 11321 |
| 95 | Ga0070681_10026817 | 3300005458 | Bacteria | 5792 |
| 96 | Ga0068867_100003190 | 3300005459 | Bacteria | 11555 |
| 97 | Ga0070685_10065099 | 3300005466 | Bacteria | 2145 |
| 98 | Ga0070706_100017426 | 3300005467 | Bacteria | 6627 |
| 99 | Ga0070706_100040072 | 3300005467 | Bacteria | 4324 |
| 100 | Ga0070707_100214422 | 3300005468 | Bacteria | 1876 |
| 101 | Ga0070679_100030112 | 3300005530 | Bacteria | 5357 |
| 102 | Ga0070679_100096088 | 3300005530 | Bacteria | 2951 |
| 103 | Ga0070684_100034767 | 3300005535 | Bacteria | 4310 |
| 104 | Ga0070684_100142665 | 3300005535 | Bacteria | 2167 |
| 105 | Ga0070672_100040575 | 3300005543 | Bacteria | 3572 |
| 106 | Ga0070686_100001567 | 3300005544 | Bacteria | 12852 |
| 107 | Ga0070695_100016701 | 3300005545 | Bacteria | 4444 |
| 108 | Ga0070695_100060199 | 3300005545 | Bacteria | 2461 |
| 109 | Ga0070696_100009218 | 3300005546 | Bacteria | 6605 |
| 110 | Ga0070696_100031219 | 3300005546 | Bacteria | 3651 |
| 111 | Ga0070696_100031224 | 3300005546 | Bacteria | 3650 |
| 112 | Ga0070693_100000782 | 3300005547 | Bacteria | 14044 |
| 113 | Ga0070693_100000927 | 3300005547 | Bacteria | 13023 |
| 114 | Ga0070693_100011430 | 3300005547 | Bacteria | 4471 |
| 115 | Ga0070693_100020661 | 3300005547 | Bacteria | 3477 |
| 116 | Ga0070665_100018219 | 3300005548 | Bacteria | 7043 |
| 117 | Ga0070665_100153626 | 3300005548 | Bacteria | 2304 |
| 118 | Ga0070704_100015546 | 3300005549 | Bacteria | 4784 |
| 119 | Ga0068855_100000037 | 3300005563 | Bacteria | 158161 |
| 120 | Ga0068855_100020817 | 3300005563 | Bacteria | 7864 |
| 121 | Ga0068855_100056268 | 3300005563 | Bacteria | 4616 |
| 122 | Ga0068855_100057771 | 3300005563 | Bacteria | 4547 |
| 123 | Ga0068855_100120706 | 3300005563 | Bacteria | 3000 |
| 124 | Ga0068854_100004957 | 3300005578 | Bacteria | 8391 |
| 125 | Ga0068856_100024700 | 3300005614 | Bacteria | 5852 |
| 126 | Ga0068856_100107915 | 3300005614 | Bacteria | 2780 |
| 127 | Ga0070702_100000492 | 3300005615 | Bacteria | 14190 |
| 128 | Ga0070702_100003343 | 3300005615 | Bacteria | 7161 |
| 129 | Ga0068852_100024959 | 3300005616 | Bacteria | 4837 |
| 130 | Ga0068852_100027944 | 3300005616 | Bacteria | 4607 |
| 131 | Ga0068852_100046693 | 3300005616 | Bacteria | 3691 |
| 132 | Ga0068859_100061203 | 3300005617 | Bacteria | 3793 |
| 133 | Ga0068859_100076106 | 3300005617 | Bacteria | 3397 |
| 134 | Ga0068866_10004054 | 3300005718 | Bacteria | 6013 |
| 135 | Ga0068861_100005425 | 3300005719 | Bacteria | 8632 |
| 136 | Ga0068870_10000308 | 3300005840 | Bacteria | 18098 |
| 137 | Ga0068863_100010004 | 3300005841 | Bacteria | 9231 |
| 138 | Ga0068858_100031576 | 3300005842 | Bacteria | 4920 |
| 139 | Ga0068858_100032854 | 3300005842 | Bacteria | 4819 |
| 140 | Ga0068858_100043474 | 3300005842 | Bacteria | 4165 |
| 141 | Ga0068860_100020008 | 3300005843 | Bacteria | 6487 |
| 142 | Ga0068862_100009752 | 3300005844 | Bacteria | 7940 |
| 143 | Ga0068862_100028139 | 3300005844 | Bacteria | 4733 |
| 144 | Ga0081539_10000178 | 3300005985 | Bacteria | 149201 |
| 145 | Ga0070717_10061684 | 3300006028 | Bacteria | 3108 |
| 146 | Ga0070717_10074695 | 3300006028 | Bacteria | 2834 |
| 147 | Ga0075366_10006563 | 3300006195 | Bacteria | 6381 |
| 148 | Ga0097621_100023306 | 3300006237 | Bacteria | 4818 |
| 149 | Ga0097621_100221051 | 3300006237 | Bacteria | 1650 |
| 150 | Ga0068871_100024724 | 3300006358 | Bacteria | 4662 |
| 151 | Ga0068871_100087396 | 3300006358 | Bacteria | 2592 |
| 152 | Ga0075428_100069025 | 3300006844 | Bacteria | 3866 |
| 153 | Ga0075431_100051695 | 3300006847 | Bacteria | 4237 |
| 154 | Ga0075434_100121819 | 3300006871 | Bacteria | 2624 |
| 155 | Ga0075434_100197302 | 3300006871 | Bacteria | 2032 |
| 156 | Ga0075429_100067974 | 3300006880 | Bacteria | 3101 |
| 157 | Ga0075429_100099229 | 3300006880 | Bacteria | 2541 |
| 158 | Ga0068865_100000273 | 3300006881 | Bacteria | 28375 |
| 159 | Ga0075436_100001288 | 3300006914 | Bacteria | 17039 |
| 160 | Ga0097620_100061206 | 3300006931 | Bacteria | 3793 |
| 161 | Ga0097620_100076112 | 3300006931 | Bacteria | 3397 |
| 162 | Ga0075435_100091052 | 3300007076 | Bacteria | 2516 |
| 163 | Ga0099794_10078515 | 3300007265 | Bacteria | 1625 |
| 164 | Ga0105240_10039974 | 3300009093 | Bacteria | 6004 |
| 165 | Ga0105240_10056621 | 3300009093 | Bacteria | 4905 |
| 166 | Ga0105240_10057195 | 3300009093 | Bacteria | 4875 |
| 167 | Ga0105240_10074646 | 3300009093 | Bacteria | 4185 |
| 168 | Ga0111539_10000505 | 3300009094 | Bacteria | 49662 |
| 169 | Ga0111539_10089558 | 3300009094 | Bacteria | 3616 |
| 170 | Ga0105245_10000207 | 3300009098 | Bacteria | 55562 |
| 171 | Ga0105245_10034497 | 3300009098 | Bacteria | 4489 |
| 172 | Ga0105245_10053839 | 3300009098 | Bacteria | 3613 |
| 173 | Ga0105245_10090782 | 3300009098 | Bacteria | 2810 |
| 174 | Ga0105247_10005715 | 3300009101 | Bacteria | 7784 |
| 175 | Ga0114129_10100461 | 3300009147 | Bacteria | 4003 |
| 176 | Ga0105243_10027012 | 3300009148 | Bacteria | 4396 |
| 177 | Ga0105241_10007546 | 3300009174 | Bacteria | 7997 |
| 178 | Ga0105242_10003135 | 3300009176 | Bacteria | 12906 |
| 179 | Ga0105242_10019320 | 3300009176 | Bacteria | 5338 |
| 180 | Ga0105242_10022750 | 3300009176 | Bacteria | 4935 |
| 181 | Ga0105248_10017721 | 3300009177 | Bacteria | 7855 |
| 182 | Ga0105248_10047726 | 3300009177 | Bacteria | 4802 |
| 183 | Ga0105248_10377723 | 3300009177 | Bacteria | 1595 |
| 184 | Ga0105237_10015031 | 3300009545 | Bacteria | 8066 |
| 185 | Ga0105238_10006983 | 3300009551 | Bacteria | 11285 |
| 186 | Ga0105238_10032802 | 3300009551 | Bacteria | 5286 |
| 187 | Ga0105238_10051992 | 3300009551 | Bacteria | 4119 |
| 188 | Ga0105238_10100019 | 3300009551 | Bacteria | 2883 |
| 189 | Ga0105238_10133784 | 3300009551 | Bacteria | 2457 |
| 190 | Ga0105249_10016805 | 3300009553 | Bacteria | 6492 |
| 191 | Ga0105239_10013663 | 3300010375 | Bacteria | 9016 |
| 192 | Ga0105246_10002707 | 3300011119 | Bacteria | 10724 |
| 193 | Ga0157373_10089301 | 3300013100 | Bacteria | 2170 |
| 194 | Ga0157370_10014186 | 3300013104 | Bacteria | 8166 |
| 195 | Ga0157370_10081754 | 3300013104 | Bacteria | 3040 |
| 196 | Ga0157369_10040213 | 3300013105 | Bacteria | 5106 |
| 197 | Ga0157374_10056395 | 3300013296 | Bacteria | 3667 |
| 198 | Ga0157378_10004564 | 3300013297 | Bacteria | 12147 |
| 199 | Ga0157378_10057431 | 3300013297 | Bacteria | 3468 |
| 200 | Ga0157378_10078856 | 3300013297 | Bacteria | 2972 |
| 201 | Ga0157372_10013542 | 3300013307 | Bacteria | 8717 |
| 202 | Ga0157372_10059774 | 3300013307 | Bacteria | 4264 |
| 203 | Ga0157375_10086055 | 3300013308 | Bacteria | 3193 |
| 204 | Ga0157375_10148969 | 3300013308 | Bacteria | 2474 |
| 205 | Ga0157380_10005531 | 3300014326 | Bacteria | 8832 |
| 206 | Ga0157380_10020047 | 3300014326 | Bacteria | 4993 |
| 207 | Ga0157380_10050206 | 3300014326 | Bacteria | 3294 |
| 208 | Ga0182008_10063228 | 3300014497 | Bacteria | 1823 |
| 209 | Ga0157377_10027254 | 3300014745 | Bacteria | 3067 |
| 210 | Ga0157377_10034828 | 3300014745 | Bacteria | 2757 |
| 211 | Ga0157379_10053926 | 3300014968 | Bacteria | 3592 |
| 212 | Ga0157379_10140774 | 3300014968 | Bacteria | 2175 |
| 213 | Ga0157376_10073516 | 3300014969 | Bacteria | 2911 |
| 214 | Ga0182006_1006807 | 3300015261 | Bacteria | 5273 |
| 215 | Ga0182005_1000013 | 3300015265 | Bacteria | 396391 |
| 216 | Ga0182005_1001875 | 3300015265 | Bacteria | 7977 |
| 217 | Ga0163161_10046295 | 3300017792 | Bacteria | 3138 |
| 218 | Ga0206356_10349654 | 3300020070 | Bacteria | 2843 |
| 219 | Ga0206354_10556897 | 3300020081 | Bacteria | 3162 |
| 220 | Ga0213872_10000020 | 3300021361 | Bacteria | 159607 |
| 221 | Ga0213872_10001428 | 3300021361 | Bacteria | 15611 |
| 222 | Ga0213872_10030827 | 3300021361 | Bacteria | 2457 |
| 223 | Ga0224712_10007566 | 3300022467 | Bacteria | 3169 |
| 224 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 225 | Ga0209435_100309 | 3300025206 | Bacteria | 11753 |
| 226 | Ga0209760_101815 | 3300025207 | Bacteria | 2118 |
| 227 | Ga0209436_100728 | 3300025208 | Bacteria | 13735 |
| 228 | Ga0209436_101841 | 3300025208 | Bacteria | 6877 |
| 229 | Ga0209436_102839 | 3300025208 | Bacteria | 4915 |
| 230 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 231 | Ga0209784_100079 | 3300025224 | Bacteria | 136351 |
| 232 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 233 | Ga0209566_100093 | 3300025225 | Bacteria | 136351 |
| 234 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 235 | Ga0209674_100115 | 3300025226 | Bacteria | 136351 |
| 236 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 237 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 238 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 239 | Ga0209563_100113 | 3300025230 | Bacteria | 136351 |
| 240 | Ga0207427_100262 | 3300025231 | Bacteria | 40896 |
| 241 | Ga0209437_100176 | 3300025233 | Bacteria | 136351 |
| 242 | Ga0209437_100329 | 3300025233 | Bacteria | 59120 |
| 243 | Ga0209258_100523 | 3300025242 | Bacteria | 36787 |
| 244 | Ga0207425_1000014 | 3300025245 | Bacteria | 481113 |
| 245 | Ga0207425_1000109 | 3300025245 | Bacteria | 77611 |
| 246 | Ga0207425_1000122 | 3300025245 | Bacteria | 73381 |
| 247 | Ga0207425_1000678 | 3300025245 | Bacteria | 18557 |
| 248 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 249 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 250 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 251 | Ga0209026_1001477 | 3300025250 | Bacteria | 10363 |
| 252 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 253 | Ga0209677_100072 | 3300025253 | Bacteria | 136351 |
| 254 | Ga0209148_1001634 | 3300025254 | Bacteria | 10288 |
| 255 | Ga0209759_1000049 | 3300025256 | Bacteria | 221692 |
| 256 | Ga0209759_1000656 | 3300025256 | Bacteria | 32085 |
| 257 | Ga0209129_1000017 | 3300025258 | Bacteria | 480935 |
| 258 | Ga0209233_1000183 | 3300025261 | Bacteria | 136351 |
| 259 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 260 | Ga0209565_1004651 | 3300025263 | Bacteria | 4132 |
| 261 | Ga0209565_1006069 | 3300025263 | Bacteria | 3439 |
| 262 | Ga0209455_1001230 | 3300025272 | Bacteria | 12113 |
| 263 | Ga0209673_1000017 | 3300025273 | Bacteria | 492994 |
| 264 | Ga0209130_1000171 | 3300025284 | Bacteria | 94371 |
| 265 | Ga0209130_1000177 | 3300025284 | Bacteria | 90450 |
| 266 | Ga0209675_1000119 | 3300025291 | Bacteria | 110218 |
| 267 | Ga0209675_1001621 | 3300025291 | Bacteria | 12654 |
| 268 | Ga0209025_1001025 | 3300025294 | Bacteria | 41120 |
| 269 | Ga0209025_1005080 | 3300025294 | Bacteria | 10956 |
| 270 | Ga0209564_1000016 | 3300025295 | Bacteria | 613131 |
| 271 | Ga0209564_1005005 | 3300025295 | Bacteria | 7781 |
| 272 | Ga0209758_1000038 | 3300025297 | Bacteria | 433771 |
| 273 | Ga0209758_1000228 | 3300025297 | Bacteria | 119948 |
| 274 | Ga0209050_1000011 | 3300025298 | Bacteria | 914037 |
| 275 | Ga0209050_1003602 | 3300025298 | Bacteria | 11239 |
| 276 | Ga0209256_1000210 | 3300025299 | Bacteria | 110217 |
| 277 | Ga0209256_1000987 | 3300025299 | Bacteria | 34068 |
| 278 | Ga0209256_1002009 | 3300025299 | Bacteria | 18158 |
| 279 | Ga0209256_1009131 | 3300025299 | Bacteria | 4412 |
| 280 | Ga0207426_1006741 | 3300025302 | Bacteria | 4922 |
| 281 | Ga0207426_1023189 | 3300025302 | Bacteria | 2120 |
| 282 | Ga0209051_1020910 | 3300025303 | Bacteria | 2803 |
| 283 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 284 | Ga0209257_1013499 | 3300025304 | Bacteria | 3624 |
| 285 | Ga0207642_10002492 | 3300025899 | Bacteria | 5731 |
| 286 | Ga0207710_10017733 | 3300025900 | Bacteria | 3021 |
| 287 | Ga0207699_10041965 | 3300025906 | Bacteria | 2646 |
| 288 | Ga0207645_10101655 | 3300025907 | Bacteria | 1855 |
| 289 | Ga0207643_10000100 | 3300025908 | Bacteria | 58884 |
| 290 | Ga0207643_10005317 | 3300025908 | Bacteria | 6888 |
| 291 | Ga0207705_10011250 | 3300025909 | Bacteria | 6487 |
| 292 | Ga0207705_10017296 | 3300025909 | Bacteria | 5162 |
| 293 | Ga0207705_10018257 | 3300025909 | Bacteria | 5016 |
| 294 | Ga0207705_10059148 | 3300025909 | Bacteria | 2765 |
| 295 | Ga0207654_10000706 | 3300025911 | Bacteria | 18618 |
| 296 | Ga0207654_10019815 | 3300025911 | Bacteria | 3557 |
| 297 | Ga0207707_10015157 | 3300025912 | Bacteria | 6710 |
| 298 | Ga0207707_10043300 | 3300025912 | Bacteria | 3927 |
| 299 | Ga0207707_10117374 | 3300025912 | Bacteria | 2326 |
| 300 | Ga0207695_10001485 | 3300025913 | Bacteria | 39195 |
| 301 | Ga0207695_10041793 | 3300025913 | Bacteria | 4904 |
| 302 | Ga0207695_10042043 | 3300025913 | Bacteria | 4886 |
| 303 | Ga0207693_10026392 | 3300025915 | Bacteria | 4597 |
| 304 | Ga0207662_10042222 | 3300025918 | Bacteria | 2688 |
| 305 | Ga0207657_10051371 | 3300025919 | Bacteria | 3583 |
| 306 | Ga0207657_10076687 | 3300025919 | Bacteria | 2819 |
| 307 | Ga0207652_10056420 | 3300025921 | Bacteria | 3381 |
| 308 | Ga0207652_10241492 | 3300025921 | Bacteria | 1628 |
| 309 | Ga0207646_10232375 | 3300025922 | Bacteria | 1666 |
| 310 | Ga0207694_10001079 | 3300025924 | Bacteria | 23684 |
| 311 | Ga0207694_10040962 | 3300025924 | Bacteria | 3569 |
| 312 | Ga0207694_10103237 | 3300025924 | Bacteria | 2261 |
| 313 | Ga0207659_10091323 | 3300025926 | Bacteria | 2274 |
| 314 | Ga0207659_10135247 | 3300025926 | Bacteria | 1907 |
| 315 | Ga0207687_10005397 | 3300025927 | Bacteria | 8451 |
| 316 | Ga0207700_10145112 | 3300025928 | Bacteria | 1955 |
| 317 | Ga0207664_10044984 | 3300025929 | Bacteria | 3460 |
| 318 | Ga0207664_10068997 | 3300025929 | Bacteria | 2842 |
| 319 | Ga0207690_10009825 | 3300025932 | Bacteria | 5686 |
| 320 | Ga0207690_10057472 | 3300025932 | Bacteria | 2628 |
| 321 | Ga0207706_10088654 | 3300025933 | Bacteria | 2720 |
| 322 | Ga0207706_10101869 | 3300025933 | Bacteria | 2527 |
| 323 | Ga0207706_10174827 | 3300025933 | Bacteria | 1886 |
| 324 | Ga0207686_10012873 | 3300025934 | Bacteria | 4612 |
| 325 | Ga0207686_10020448 | 3300025934 | Bacteria | 3782 |
| 326 | Ga0207686_10172580 | 3300025934 | Bacteria | 1526 |
| 327 | Ga0207709_10069197 | 3300025935 | Bacteria | 2233 |
| 328 | Ga0207670_10002019 | 3300025936 | Bacteria | 10648 |
| 329 | Ga0207670_10059474 | 3300025936 | Bacteria | 2599 |
| 330 | Ga0207670_10059722 | 3300025936 | Bacteria | 2594 |
| 331 | Ga0207704_10001365 | 3300025938 | Bacteria | 10908 |
| 332 | Ga0207691_10011498 | 3300025940 | Bacteria | 8494 |
| 333 | Ga0207691_10028165 | 3300025940 | Bacteria | 5262 |
| 334 | Ga0207711_10051181 | 3300025941 | Bacteria | 3537 |
| 335 | Ga0207711_10095643 | 3300025941 | Bacteria | 2620 |
| 336 | Ga0207689_10001285 | 3300025942 | Bacteria | 24212 |
| 337 | Ga0207689_10002332 | 3300025942 | Bacteria | 17776 |
| 338 | Ga0207689_10082728 | 3300025942 | Bacteria | 2639 |
| 339 | Ga0207661_10001249 | 3300025944 | Bacteria | 16984 |
| 340 | Ga0207661_10265592 | 3300025944 | Bacteria | 1530 |
| 341 | Ga0207679_10002148 | 3300025945 | Bacteria | 12202 |
| 342 | Ga0207679_10130250 | 3300025945 | Bacteria | 2017 |
| 343 | Ga0207667_10000053 | 3300025949 | Bacteria | 226712 |
| 344 | Ga0207667_10010379 | 3300025949 | Bacteria | 10885 |
| 345 | Ga0207667_10012404 | 3300025949 | Bacteria | 9823 |
| 346 | Ga0207667_10024176 | 3300025949 | Bacteria | 6675 |
| 347 | Ga0207667_10038157 | 3300025949 | Bacteria | 5132 |
| 348 | Ga0207667_10169730 | 3300025949 | Bacteria | 2242 |
| 349 | Ga0207712_10031274 | 3300025961 | Bacteria | 3583 |
| 350 | Ga0207668_10019908 | 3300025972 | Bacteria | 4253 |
| 351 | Ga0207640_10004866 | 3300025981 | Bacteria | 7295 |
| 352 | Ga0207677_10014417 | 3300026023 | Bacteria | 4615 |
| 353 | Ga0207677_10108350 | 3300026023 | Bacteria | 2063 |
| 354 | Ga0207677_10131423 | 3300026023 | Bacteria | 1901 |
| 355 | Ga0207703_10013747 | 3300026035 | Bacteria | 6310 |
| 356 | Ga0207703_10040395 | 3300026035 | Bacteria | 3733 |
| 357 | Ga0207639_10036345 | 3300026041 | Bacteria | 3650 |
| 358 | Ga0207678_10001325 | 3300026067 | Bacteria | 22864 |
| 359 | Ga0207678_10212027 | 3300026067 | Bacteria | 1657 |
| 360 | Ga0207708_10000156 | 3300026075 | Bacteria | 54425 |
| 361 | Ga0207708_10030948 | 3300026075 | Bacteria | 4061 |
| 362 | Ga0207702_10045740 | 3300026078 | Bacteria | 3682 |
| 363 | Ga0207702_10085554 | 3300026078 | Bacteria | 2748 |
| 364 | Ga0207702_10124137 | 3300026078 | Bacteria | 2315 |
| 365 | Ga0207641_10012080 | 3300026088 | Bacteria | 7081 |
| 366 | Ga0207648_10005383 | 3300026089 | Bacteria | 12907 |
| 367 | Ga0207676_10001137 | 3300026095 | Bacteria | 20095 |
| 368 | Ga0207674_10023254 | 3300026116 | Bacteria | 6639 |
| 369 | Ga0207675_100001059 | 3300026118 | Bacteria | 27297 |
| 370 | Ga0207683_10000565 | 3300026121 | Bacteria | 34282 |
| 371 | Ga0207683_10085260 | 3300026121 | Bacteria | 2808 |
| 372 | Ga0207698_10002155 | 3300026142 | Bacteria | 11626 |
| 373 | Ga0207698_10005052 | 3300026142 | Bacteria | 8094 |
| 374 | Ga0209971_1003987 | 3300027682 | Bacteria | 3491 |
| 375 | Ga0207428_10003457 | 3300027907 | Bacteria | 15332 |
| 376 | Ga0207428_10012488 | 3300027907 | Bacteria | 7460 |
| 377 | Ga0268264_10022554 | 3300028381 | Bacteria | 5138 |
| 378 | Ga0316177_1194028 | 3300030731 | Bacteria | 9231 |
| 379 | Ga0265331_10010555 | 3300031250 | Bacteria | 5103 |
| 380 | Ga0265327_10000639 | 3300031251 | Bacteria | 56852 |
| 381 | Ga0307408_100000140 | 3300031548 | Bacteria | 80709 |
| 382 | Ga0307408_100020196 | 3300031548 | Bacteria | 4492 |
| 383 | Ga0307408_100101106 | 3300031548 | Bacteria | 2197 |
| 384 | Ga0307408_100109124 | 3300031548 | Bacteria | 2122 |
| 385 | Ga0307408_100175360 | 3300031548 | Bacteria | 1715 |
| 386 | Ga0316579_10000043 | 3300031691 | Bacteria | 29246 |
| 387 | Ga0265314_10032195 | 3300031711 | Bacteria | 3859 |
| 388 | Ga0316578_10002920 | 3300031728 | Bacteria | 7666 |
| 389 | Ga0316578_10052727 | 3300031728 | Bacteria | 2384 |
| 390 | Ga0316577_10001045 | 3300031733 | Bacteria | 12508 |
| 391 | Ga0307416_100007520 | 3300032002 | Bacteria | 6939 |
| 392 | Ga0307416_100205343 | 3300032002 | Bacteria | 1874 |
| 393 | Ga0307414_10093485 | 3300032004 | Bacteria | 2242 |
| 394 | Ga0316585_10000368 | 3300032137 | Bacteria | 10376 |
| 395 | Ga0316580_10000200 | 3300032139 | Bacteria | 12217 |
| 396 | Ga0316593_10000016 | 3300032168 | Bacteria | 16636 |
| 397 | Ga0316588_1000731 | 3300033528 | Bacteria | 4851 |
| 398 | Ga0373944_0033084 | 3300035089 | Bacteria | 1565 |
| 399 | Ga0373923_0002011 | 3300035111 | Bacteria | 6119 |
| 400 | Ga0373936_0002769 | 3300035113 | Bacteria | 6534 |
| 401 | Ga0373953_0000495 | 3300035117 | Bacteria | 10925 |
| 402 | Ga0373954_0005296 | 3300035118 | Bacteria | 5572 |
| 403 | Ga0373954_0009358 | 3300035118 | Bacteria | 4310 |
| 404 | Ga0373956_0003206 | 3300035119 | Bacteria | 6608 |
| 405 | Ga0373956_0011273 | 3300035119 | Bacteria | 3681 |
| 406 | Ga0373943_0005190 | 3300035170 | Bacteria | 5862 |
| 407 | Ga0373946_0069834 | 3300035171 | Bacteria | 1514 |
| 408 | Ga0373955_0008004 | 3300035172 | Bacteria | 4887 |
| 409 | Ga0373955_0039940 | 3300035172 | Bacteria | 2507 |
| 410 | Ga0373955_0149637 | 3300035172 | Bacteria | 1373 |
| 411 | Ga0316574_0000879 | 3300035398 | Bacteria | 13274 |
| 412 | Ga0316574_0003444 | 3300035398 | Bacteria | 8153 |
| 413 | Ga0373924_0011263 | 3300035410 | Bacteria | 3318 |
| 414 | Ga0373931_0055874 | 3300035691 | Bacteria | 2114 |
| 415 | Ga0373935_0001464 | 3300035692 | Bacteria | 13100 |
| 416 | Ga0373927_0061227 | 3300035695 | Bacteria | 2435 |
| 417 | Ga0373933_0005221 | 3300035724 | Bacteria | 7086 |
| 418 | Ga0373947_0017109 | 3300035725 | Bacteria | 4169 |
| 419 | Ga0373937_0001406 | 3300036401 | Bacteria | 20084 |
| 420 | Ga0373937_0108327 | 3300036401 | Bacteria | 2583 |
| 421 | Ga0373937_0189820 | 3300036401 | Bacteria | 1930 |
| 422 | Ga0316582_0002490 | 3300036647 | Bacteria | 8674 |
| 423 | Ga0316582_0090944 | 3300036647 | Bacteria | 2008 |
| 424 | Ga0373925_0080980 | 3300037068 | Bacteria | 2468 |
| 425 | Ga0395899_0000183 | 3300037312 | Bacteria | 91818 |
| 426 | Ga0395899_0001628 | 3300037312 | Bacteria | 18785 |
| 427 | Ga0395899_0011441 | 3300037312 | Bacteria | 6792 |
| 428 | Ga0395899_0012998 | 3300037312 | Bacteria | 6369 |
| 429 | Ga0395899_0045159 | 3300037312 | Bacteria | 3282 |
| 430 | Ga0395900_0000331 | 3300037418 | Bacteria | 69780 |
| 431 | Ga0395900_0001669 | 3300037418 | Bacteria | 25883 |
| 432 | Ga0395900_0005509 | 3300037418 | Bacteria | 13249 |
| 433 | Ga0395900_0011725 | 3300037418 | Bacteria | 8961 |
| 434 | Ga0395900_0034481 | 3300037418 | Bacteria | 5212 |
| 435 | Ga0395900_0039342 | 3300037418 | Bacteria | 4872 |
| 436 | Ga0395900_0039766 | 3300037418 | Bacteria | 4846 |
| 437 | Ga0395900_0057317 | 3300037418 | Bacteria | 4010 |
| 438 | Ga0395900_0073550 | 3300037418 | Bacteria | 3514 |
| 439 | Ga0395900_0082870 | 3300037418 | Bacteria | 3295 |
| 440 | Ga0395900_0088453 | 3300037418 | Bacteria | 3184 |
| 441 | Ga0395900_0177584 | 3300037418 | Bacteria | 2165 |
| 442 | Ga0395898_0048223 | 3300037466 | Bacteria | 4178 |
| 443 | Ga0395898_0081519 | 3300037466 | Bacteria | 3119 |
| 444 | Ga0395898_0085096 | 3300037466 | Bacteria | 3048 |
| 445 | Ga0395898_0350191 | 3300037466 | Bacteria | 1408 |
| 446 | Ga0395905_0004758 | 3300037471 | Bacteria | 14030 |
| 447 | Ga0395905_0069234 | 3300037471 | Bacteria | 3305 |
| 448 | Ga0395905_0072426 | 3300037471 | Bacteria | 3230 |
| 449 | Ga0395905_0090323 | 3300037471 | Bacteria | 2871 |
| 450 | Ga0395905_0107847 | 3300037471 | Bacteria | 2614 |
| 451 | Ga0395905_0208272 | 3300037471 | Bacteria | 1832 |
| 452 | Ga0395901_0000097 | 3300038443 | Bacteria | 118528 |
| 453 | Ga0395901_0002053 | 3300038443 | Bacteria | 20648 |
| 454 | Ga0395901_0002114 | 3300038443 | Bacteria | 20373 |
| 455 | Ga0395901_0028671 | 3300038443 | Bacteria | 5726 |
| 456 | Ga0395901_0098268 | 3300038443 | Bacteria | 3069 |
| 457 | Ga0395901_0147689 | 3300038443 | Bacteria | 2471 |
| 458 | Ga0400484_39392 | 3300038725 | Bacteria | 10100 |
| 459 | Ga0400490_44514 | 3300038726 | Bacteria | 11139 |
| 460 | Ga0400490_47396 | 3300038726 | Bacteria | 26208 |
| 461 | Ga0400490_50054 | 3300038726 | Bacteria | 3415 |
| 462 | Ga0400485_05209 | 3300038735 | Bacteria | 3685 |
| 463 | Ga0400488_06787 | 3300038741 | Bacteria | 6328 |
| 464 | Ga0400486_31155 | 3300038742 | Bacteria | 2918 |
| 465 | Ga0400483_014751 | 3300039062 | Bacteria | 5758 |
| 466 | Ga0400483_117873 | 3300039062 | Bacteria | 2251 |
| 467 | Ga0400483_118802 | 3300039062 | Bacteria | 1971 |
| 468 | Ga0400483_161191 | 3300039062 | Bacteria | 11695 |
| 469 | Ga0400483_239730 | 3300039062 | Bacteria | 3646 |
| 470 | Ga0400483_263105 | 3300039062 | Bacteria | 3824 |
| 471 | Ga0400483_279956 | 3300039062 | Bacteria | 11884 |
| 472 | Ga0400489_49372 | 3300039093 | Bacteria | 3852 |
| 473 | Ga0400487_57745 | 3300039110 | Bacteria | 5068 |
| 474 | Ga0436361_0204853 | 3300039447 | Bacteria | 15869 |
| 475 | Ga0436361_0594223 | 3300039447 | Bacteria | 49801 |
| 476 | Ga0436361_0901422 | 3300039447 | Bacteria | 18634 |
| 477 | Ga0436361_0922237 | 3300039447 | Bacteria | 22454 |
| 478 | Ga0436361_0954113 | 3300039447 | Bacteria | 4461 |
| 479 | Ga0439441_001907 | 3300042001 | Bacteria | 2851 |
| 480 | Ga0439448_0005556 | 3300042005 | Bacteria | 3597 |
| 481 | Ga0439448_0010451 | 3300042005 | Bacteria | 2755 |
| 482 | Ga0450911_000539 | 3300042115 | Bacteria | 11803 |
| 483 | Ga0450904_000213 | 3300042139 | Bacteria | 12602 |
| 484 | Ga0439446_0002039 | 3300042156 | Bacteria | 4786 |
| 485 | Ga0439459_0006044 | 3300042438 | Bacteria | 2007 |
| 486 | Ga0439460_0015679 | 3300042461 | Bacteria | 2009 |
| 487 | Ga0451577_0010210 | 3300042876 | Bacteria | 8993 |
| 488 | Ga0451577_0047164 | 3300042876 | Bacteria | 3853 |
| 489 | Ga0466972_0000275 | 3300044658 | Bacteria | 32437 |
| 490 | Ga0466972_0027692 | 3300044658 | Bacteria | 2803 |
| 491 | Ga0466965_0052353 | 3300044683 | Bacteria | 2027 |
| 492 | Ga0466965_0071145 | 3300044683 | Bacteria | 1749 |
| 493 | Ga0466966_0006240 | 3300044684 | Bacteria | 7882 |
| 494 | Ga0466966_0026496 | 3300044684 | Bacteria | 3784 |
| 495 | Ga0466966_0039322 | 3300044684 | Bacteria | 3046 |
| 496 | Ga0466961_0066942 | 3300044693 | Bacteria | 2281 |
| 497 | Ga0466964_0002459 | 3300044706 | Bacteria | 6590 |
| 498 | Ga0466964_0056952 | 3300044706 | Bacteria | 1617 |
| 499 | Ga0466970_0014159 | 3300044765 | Bacteria | 4090 |
| 500 | Ga0466957_0003310 | 3300044842 | Bacteria | 8824 |
| 501 | Ga0466957_0023223 | 3300044842 | Bacteria | 3665 |
| 502 | Ga0466957_0037108 | 3300044842 | Bacteria | 2933 |
| 503 | Ga0466957_0107941 | 3300044842 | Bacteria | 1762 |
| 504 | Ga0466957_0192967 | 3300044842 | Bacteria | 1335 |
| 505 | Ga0466960_0019925 | 3300044901 | Bacteria | 2963 |
| 506 | Ga0466959_0015602 | 3300045049 | Bacteria | 5538 |
| 507 | Ga0466959_0114682 | 3300045049 | Bacteria | 1920 |
| 508 | Ga0451576_0009713 | 3300045051 | Bacteria | 11126 |
| 509 | Ga0451576_0146409 | 3300045051 | Bacteria | 2463 |
| 510 | Ga0466958_0019882 | 3300045836 | Bacteria | 3912 |
| 511 | Ga0466958_0095612 | 3300045836 | Bacteria | 1842 |
| 512 | Ga0466967_0026135 | 3300045976 | Bacteria | 4830 |
| 513 | Ga0466967_0049377 | 3300045976 | Bacteria | 3679 |
| 514 | Ga0495617_000004 | 3300046452 | Bacteria | 511274 |
| 515 | Ga0495617_000009 | 3300046452 | Bacteria | 312936 |
| 516 | Ga0495617_000407 | 3300046452 | Bacteria | 23876 |
| 517 | Ga0495617_009926 | 3300046452 | Bacteria | 3264 |
| 518 | Ga0495617_021504 | 3300046452 | Bacteria | 2178 |
| 519 | Ga0495627_000008 | 3300046453 | Bacteria | 572150 |
| 520 | Ga0495627_000255 | 3300046453 | Bacteria | 54602 |
| 521 | Ga0495627_001629 | 3300046453 | Bacteria | 12537 |
| 522 | Ga0495592_0015317 | 3300046454 | Bacteria | 5819 |
| 523 | Ga0495592_0042407 | 3300046454 | Bacteria | 3407 |
| 524 | Ga0495603_0017245 | 3300046455 | Bacteria | 4371 |
| 525 | Ga0495590_0000010 | 3300046457 | Bacteria | 317890 |
| 526 | Ga0495590_0000669 | 3300046457 | Bacteria | 15860 |
| 527 | Ga0495590_0002180 | 3300046457 | Bacteria | 8199 |
| 528 | Ga0495591_001902 | 3300046458 | Bacteria | 12252 |
| 529 | Ga0495629_0065510 | 3300046459 | Bacteria | 2536 |
| 530 | Ga0495638_0000042 | 3300046460 | Bacteria | 232752 |
| 531 | Ga0495641_0005536 | 3300046461 | Bacteria | 8484 |
| 532 | Ga0495651_0003157 | 3300046462 | Bacteria | 12694 |
| 533 | Ga0495653_0000010 | 3300046463 | Bacteria | 274131 |
| 534 | Ga0495653_0031870 | 3300046463 | Bacteria | 4188 |
| 535 | Ga0495653_0078741 | 3300046463 | Bacteria | 2443 |
| 536 | Ga0495650_0000011 | 3300046471 | Bacteria | 615329 |
| 537 | Ga0495650_0000165 | 3300046471 | Bacteria | 146945 |
| 538 | Ga0495650_0000429 | 3300046471 | Bacteria | 68004 |
| 539 | Ga0495650_0000494 | 3300046471 | Bacteria | 59876 |
| 540 | Ga0495650_0000500 | 3300046471 | Bacteria | 59272 |
| 541 | Ga0495650_0000593 | 3300046471 | Bacteria | 50088 |
| 542 | Ga0495650_0015190 | 3300046471 | Bacteria | 3960 |
| 543 | Ga0495650_0017535 | 3300046471 | Bacteria | 3588 |
| 544 | Ga0495650_0017859 | 3300046471 | Bacteria | 3543 |
| 545 | Ga0495650_0025561 | 3300046471 | Bacteria | 2765 |
| 546 | Ga0495650_0052606 | 3300046471 | Bacteria | 1671 |
| 547 | Ga0495580_0004251 | 3300046472 | Bacteria | 12046 |
| 548 | Ga0495605_0000022 | 3300046474 | Bacteria | 248321 |
| 549 | Ga0495605_0000024 | 3300046474 | Bacteria | 236016 |
| 550 | Ga0495605_0000236 | 3300046474 | Bacteria | 67212 |
| 551 | Ga0495605_0002652 | 3300046474 | Bacteria | 10953 |
| 552 | Ga0495605_0012754 | 3300046474 | Bacteria | 4652 |
| 553 | Ga0495605_0022425 | 3300046474 | Bacteria | 3335 |
| 554 | Ga0495605_0045363 | 3300046474 | Bacteria | 2166 |
| 555 | Ga0495639_0008995 | 3300046475 | Bacteria | 4282 |
| 556 | Ga0495639_0019621 | 3300046475 | Bacteria | 2951 |
| 557 | Ga0495662_0016721 | 3300046476 | Bacteria | 3553 |
| 558 | Ga0495584_0000003 | 3300046491 | Bacteria | 323768 |
| 559 | Ga0495584_0000145 | 3300046491 | Bacteria | 49520 |
| 560 | Ga0495584_0001720 | 3300046491 | Bacteria | 12796 |
| 561 | Ga0495584_0002824 | 3300046491 | Bacteria | 9693 |
| 562 | Ga0495584_0025456 | 3300046491 | Bacteria | 3000 |
| 563 | Ga0495584_0041540 | 3300046491 | Bacteria | 2321 |
| 564 | Ga0495584_0041841 | 3300046491 | Bacteria | 2312 |
| 565 | Ga0495585_0000130 | 3300046492 | Bacteria | 81689 |
| 566 | Ga0495585_0000996 | 3300046492 | Bacteria | 23676 |
| 567 | Ga0495585_0001018 | 3300046492 | Bacteria | 23309 |
| 568 | Ga0495585_0002381 | 3300046492 | Bacteria | 13490 |
| 569 | Ga0495585_0002914 | 3300046492 | Bacteria | 11849 |
| 570 | Ga0495585_0028439 | 3300046492 | Bacteria | 3188 |
| 571 | Ga0495585_0035009 | 3300046492 | Bacteria | 2839 |
| 572 | Ga0495585_0050119 | 3300046492 | Bacteria | 2316 |
| 573 | Ga0495585_0098533 | 3300046492 | Bacteria | 1566 |
| 574 | Ga0495594_0022348 | 3300046499 | Bacteria | 3383 |
| 575 | Ga0495596_0001402 | 3300046500 | Bacteria | 13827 |
| 576 | Ga0495596_0003382 | 3300046500 | Bacteria | 8103 |
| 577 | Ga0495596_0004245 | 3300046500 | Bacteria | 7027 |
| 578 | Ga0495596_0004507 | 3300046500 | Bacteria | 6772 |
| 579 | Ga0495596_0006613 | 3300046500 | Bacteria | 5318 |
| 580 | Ga0495596_0017410 | 3300046500 | Bacteria | 2975 |
| 581 | Ga0495607_0000615 | 3300046501 | Bacteria | 34548 |
| 582 | Ga0495607_0003741 | 3300046501 | Bacteria | 11513 |
| 583 | Ga0495607_0009001 | 3300046501 | Bacteria | 6791 |
| 584 | Ga0495607_0016447 | 3300046501 | Bacteria | 4773 |
| 585 | Ga0495607_0017184 | 3300046501 | Bacteria | 4652 |
| 586 | Ga0495607_0021131 | 3300046501 | Bacteria | 4098 |
| 587 | Ga0495607_0031141 | 3300046501 | Bacteria | 3267 |
| 588 | Ga0495607_0036706 | 3300046501 | Bacteria | 2950 |
| 589 | Ga0495607_0080074 | 3300046501 | Bacteria | 1797 |
| 590 | Ga0495583_0000006 | 3300046506 | Bacteria | 436893 |
| 591 | Ga0495583_0000235 | 3300046506 | Bacteria | 91939 |
| 592 | Ga0495583_0000560 | 3300046506 | Bacteria | 51454 |
| 593 | Ga0495583_0000654 | 3300046506 | Bacteria | 45704 |
| 594 | Ga0495583_0004372 | 3300046506 | Bacteria | 10176 |
| 595 | Ga0495583_0028477 | 3300046506 | Bacteria | 2745 |
| 596 | Ga0495606_0000014 | 3300046507 | Bacteria | 289347 |
| 597 | Ga0495606_0000111 | 3300046507 | Bacteria | 138144 |
| 598 | Ga0495606_0000580 | 3300046507 | Bacteria | 58150 |
| 599 | Ga0495606_0000927 | 3300046507 | Bacteria | 43195 |
| 600 | Ga0495606_0001555 | 3300046507 | Bacteria | 30156 |
| 601 | Ga0495606_0006256 | 3300046507 | Bacteria | 11051 |
| 602 | Ga0495606_0006476 | 3300046507 | Bacteria | 10776 |
| 603 | Ga0495606_0015030 | 3300046507 | Bacteria | 5996 |
| 604 | Ga0495606_0029563 | 3300046507 | Bacteria | 3843 |
| 605 | Ga0495606_0051056 | 3300046507 | Bacteria | 2700 |
| 606 | Ga0495606_0059306 | 3300046507 | Bacteria | 2455 |
| 607 | Ga0495608_0011071 | 3300046511 | Bacteria | 6283 |
| 608 | Ga0495608_0026379 | 3300046511 | Bacteria | 3961 |
| 609 | Ga0495610_0000010 | 3300046512 | Bacteria | 538821 |
| 610 | Ga0495610_0001639 | 3300046512 | Bacteria | 19681 |
| 611 | Ga0495610_0006477 | 3300046512 | Bacteria | 8048 |
| 612 | Ga0495616_0000542 | 3300046513 | Bacteria | 28451 |
| 613 | Ga0495616_0000648 | 3300046513 | Bacteria | 25880 |
| 614 | Ga0495616_0000816 | 3300046513 | Bacteria | 22705 |
| 615 | Ga0495616_0002434 | 3300046513 | Bacteria | 12372 |
| 616 | Ga0495616_0007257 | 3300046513 | Bacteria | 6637 |
| 617 | Ga0495616_0020804 | 3300046513 | Bacteria | 3564 |
| 618 | Ga0495616_0080572 | 3300046513 | Bacteria | 1559 |
| 619 | Ga0495618_0015550 | 3300046514 | Bacteria | 4645 |
| 620 | Ga0495628_0077781 | 3300046516 | Bacteria | 2580 |
| 621 | Ga0495630_0006438 | 3300046517 | Bacteria | 8352 |
| 622 | Ga0495630_0054277 | 3300046517 | Bacteria | 3002 |
| 623 | Ga0495631_0001791 | 3300046518 | Bacteria | 12743 |
| 624 | Ga0495631_0002889 | 3300046518 | Bacteria | 9518 |
| 625 | Ga0495631_0003258 | 3300046518 | Bacteria | 8922 |
| 626 | Ga0495631_0029473 | 3300046518 | Bacteria | 2495 |
| 627 | Ga0495632_0000073 | 3300046519 | Bacteria | 104293 |
| 628 | Ga0495632_0000203 | 3300046519 | Bacteria | 60607 |
| 629 | Ga0495632_0000225 | 3300046519 | Bacteria | 57394 |
| 630 | Ga0495632_0001091 | 3300046519 | Bacteria | 23243 |
| 631 | Ga0495632_0022132 | 3300046519 | Bacteria | 3412 |
| 632 | Ga0495632_0040635 | 3300046519 | Bacteria | 2341 |
| 633 | Ga0495637_0000069 | 3300046520 | Bacteria | 84826 |
| 634 | Ga0495643_0001442 | 3300046522 | Bacteria | 21926 |
| 635 | Ga0495643_0007966 | 3300046522 | Bacteria | 6756 |
| 636 | Ga0495643_0037200 | 3300046522 | Bacteria | 2671 |
| 637 | Ga0495644_0024587 | 3300046523 | Bacteria | 2291 |
| 638 | Ga0495648_0000003 | 3300046524 | Bacteria | 386817 |
| 639 | Ga0495648_0000290 | 3300046524 | Bacteria | 57025 |
| 640 | Ga0495648_0001863 | 3300046524 | Bacteria | 20176 |
| 641 | Ga0495648_0006527 | 3300046524 | Bacteria | 9495 |
| 642 | Ga0495648_0017919 | 3300046524 | Bacteria | 5041 |
| 643 | Ga0495663_0042045 | 3300046525 | Bacteria | 1392 |
| 644 | Ga0495642_0000065 | 3300046528 | Bacteria | 63401 |
| 645 | Ga0495642_0003872 | 3300046528 | Bacteria | 5869 |
| 646 | Ga0495642_0010459 | 3300046528 | Bacteria | 3555 |
| 647 | Ga0495642_0023058 | 3300046528 | Bacteria | 2456 |
| 648 | Ga0495642_0033354 | 3300046528 | Bacteria | 2070 |
| 649 | Ga0495652_0037529 | 3300046529 | Bacteria | 4202 |
| 650 | Ga0495652_0044005 | 3300046529 | Bacteria | 3846 |
| 651 | Ga0495652_0138551 | 3300046529 | Bacteria | 1916 |
| 652 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 653 | Ga0495654_0011052 | 3300046530 | Bacteria | 4902 |
| 654 | Ga0495654_0017135 | 3300046530 | Bacteria | 3814 |
| 655 | Ga0495665_0035295 | 3300046531 | Bacteria | 2671 |
| 656 | Ga0495640_0008997 | 3300046533 | Bacteria | 7797 |
| 657 | Ga0495586_0038260 | 3300046535 | Bacteria | 2575 |
| 658 | Ga0495587_0003065 | 3300046536 | Bacteria | 11165 |
| 659 | Ga0495609_0000030 | 3300046538 | Bacteria | 215885 |
| 660 | Ga0495609_0000072 | 3300046538 | Bacteria | 125273 |
| 661 | Ga0495609_0000542 | 3300046538 | Bacteria | 29919 |
| 662 | Ga0495609_0003180 | 3300046538 | Bacteria | 9549 |
| 663 | Ga0495609_0006964 | 3300046538 | Bacteria | 5703 |
| 664 | Ga0495609_0010364 | 3300046538 | Bacteria | 4473 |
| 665 | Ga0495609_0018313 | 3300046538 | Bacteria | 3245 |
| 666 | Ga0495609_0026724 | 3300046538 | Bacteria | 2641 |
| 667 | Ga0495597_0000111 | 3300046542 | Bacteria | 72653 |
| 668 | Ga0495597_0000219 | 3300046542 | Bacteria | 52473 |
| 669 | Ga0495597_0001941 | 3300046542 | Bacteria | 13942 |
| 670 | Ga0495597_0006433 | 3300046542 | Bacteria | 6078 |
| 671 | Ga0495597_0019384 | 3300046542 | Bacteria | 3184 |
| 672 | Ga0495597_0022494 | 3300046542 | Bacteria | 2923 |
| 673 | Ga0495645_0001557 | 3300046543 | Bacteria | 15525 |
| 674 | Ga0495645_0018519 | 3300046543 | Bacteria | 5003 |
| 675 | Ga0495645_0045214 | 3300046543 | Bacteria | 3212 |
| 676 | Ga0495645_0115655 | 3300046543 | Bacteria | 1894 |
| 677 | Ga0495622_0000116 | 3300046557 | Bacteria | 69072 |
| 678 | Ga0495633_0000124 | 3300046558 | Bacteria | 104617 |
| 679 | Ga0495633_0000553 | 3300046558 | Bacteria | 36816 |
| 680 | Ga0495633_0002706 | 3300046558 | Bacteria | 12291 |
| 681 | Ga0495633_0007242 | 3300046558 | Bacteria | 6420 |
| 682 | Ga0495633_0010500 | 3300046558 | Bacteria | 5047 |
| 683 | Ga0495633_0014935 | 3300046558 | Bacteria | 4038 |
| 684 | Ga0495667_0013108 | 3300046559 | Bacteria | 5615 |
| 685 | Ga0495656_0121263 | 3300046615 | Bacteria | 1234 |
| 686 | Ga0495668_0000038 | 3300046616 | Bacteria | 232122 |
| 687 | Ga0495668_0000071 | 3300046616 | Bacteria | 168801 |
| 688 | Ga0495668_0000366 | 3300046616 | Bacteria | 59612 |
| 689 | Ga0495668_0000843 | 3300046616 | Bacteria | 34761 |
| 690 | Ga0495668_0001445 | 3300046616 | Bacteria | 22973 |
| 691 | Ga0495668_0006030 | 3300046616 | Bacteria | 8036 |
| 692 | Ga0495668_0016824 | 3300046616 | Bacteria | 4248 |
| 693 | Ga0495668_0020642 | 3300046616 | Bacteria | 3786 |
| 694 | Ga0495668_0031335 | 3300046616 | Bacteria | 2997 |
| 695 | Ga0495668_0038717 | 3300046616 | Bacteria | 2663 |
| 696 | Ga0495634_0004770 | 3300046642 | Bacteria | 10539 |
| 697 | Ga0495634_0012880 | 3300046642 | Bacteria | 6054 |
| 698 | Ga0495611_0000944 | 3300046648 | Bacteria | 15586 |
| 699 | Ga0495611_0008302 | 3300046648 | Bacteria | 4398 |
| 700 | Ga0495625_0000218 | 3300046660 | Bacteria | 90741 |
| 701 | Ga0495625_0002241 | 3300046660 | Bacteria | 21344 |
| 702 | Ga0495625_0002638 | 3300046660 | Bacteria | 19153 |
| 703 | Ga0495625_0026750 | 3300046660 | Bacteria | 4352 |
| 704 | Ga0495625_0038134 | 3300046660 | Bacteria | 3519 |
| 705 | Ga0495625_0038762 | 3300046660 | Bacteria | 3485 |
| 706 | Ga0495625_0049337 | 3300046660 | Bacteria | 3026 |
| 707 | Ga0495625_0050334 | 3300046660 | Bacteria | 2990 |
| 708 | Ga0495635_0025139 | 3300046663 | Bacteria | 4149 |
| 709 | Ga0495659_0000240 | 3300046664 | Bacteria | 23009 |
| 710 | Ga0495659_0003268 | 3300046664 | Bacteria | 5197 |
| 711 | Ga0495659_0014299 | 3300046664 | Bacteria | 2597 |
| 712 | Ga0495661_0000209 | 3300046665 | Bacteria | 67580 |
| 713 | Ga0495661_0003296 | 3300046665 | Bacteria | 11978 |
| 714 | Ga0495661_0005018 | 3300046665 | Bacteria | 9450 |
| 715 | Ga0495661_0009420 | 3300046665 | Bacteria | 6703 |
| 716 | Ga0495661_0016457 | 3300046665 | Bacteria | 4901 |
| 717 | Ga0495661_0018929 | 3300046665 | Bacteria | 4518 |
| 718 | Ga0495661_0023930 | 3300046665 | Bacteria | 3957 |
| 719 | Ga0495661_0024398 | 3300046665 | Bacteria | 3914 |
| 720 | Ga0495661_0029152 | 3300046665 | Bacteria | 3525 |
| 721 | Ga0495661_0034208 | 3300046665 | Bacteria | 3198 |
| 722 | Ga0495661_0034544 | 3300046665 | Bacteria | 3180 |
| 723 | Ga0495661_0034622 | 3300046665 | Bacteria | 3177 |
| 724 | Ga0495661_0058618 | 3300046665 | Bacteria | 2294 |
| 725 | Ga0495588_0000078 | 3300046674 | Bacteria | 214254 |
| 726 | Ga0495588_0030499 | 3300046674 | Bacteria | 2710 |
| 727 | Ga0495657_0022230 | 3300046675 | Bacteria | 4546 |
| 728 | Ga0495599_0010681 | 3300046678 | Bacteria | 5621 |
| 729 | Ga0495599_0013096 | 3300046678 | Bacteria | 5123 |
| 730 | Ga0495623_0008017 | 3300046679 | Bacteria | 6864 |
| 731 | Ga0495623_0033389 | 3300046679 | Bacteria | 3302 |
| 732 | Ga0495646_0010240 | 3300046680 | Bacteria | 5964 |
| 733 | Ga0495646_0013711 | 3300046680 | Bacteria | 5152 |
| 734 | Ga0495646_0035421 | 3300046680 | Bacteria | 3096 |
| 735 | Ga0495658_0117709 | 3300046683 | Bacteria | 1604 |
| 736 | Ga0495669_0001554 | 3300046684 | Bacteria | 9437 |
| 737 | Ga0495669_0014220 | 3300046684 | Bacteria | 3403 |
| 738 | Ga0495669_0024677 | 3300046684 | Bacteria | 2618 |
| 739 | Ga0495670_0000223 | 3300046691 | Bacteria | 25806 |
| 740 | Ga0495670_0018262 | 3300046691 | Bacteria | 3453 |
| 741 | Ga0495670_0046089 | 3300046691 | Bacteria | 2177 |
| 742 | Ga0495670_0141502 | 3300046691 | Bacteria | 1258 |
| 743 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 744 | Ga0495671_0000382 | 3300046692 | Bacteria | 36493 |
| 745 | Ga0495671_0000812 | 3300046692 | Bacteria | 22323 |
| 746 | Ga0495671_0004041 | 3300046692 | Bacteria | 8861 |
| 747 | Ga0495649_0000363 | 3300046694 | Bacteria | 39271 |
| 748 | Ga0495649_0002963 | 3300046694 | Bacteria | 11694 |
| 749 | Ga0495649_0018097 | 3300046694 | Bacteria | 3970 |
| 750 | Ga0495589_0000021 | 3300046794 | Bacteria | 197941 |
| 751 | Ga0495589_0000193 | 3300046794 | Bacteria | 53197 |
| 752 | Ga0495589_0007813 | 3300046794 | Bacteria | 5599 |
| 753 | Ga0495600_0001052 | 3300046809 | Bacteria | 14949 |
| 754 | Ga0495600_0003954 | 3300046809 | Bacteria | 8806 |
| 755 | Ga0495600_0043602 | 3300046809 | Bacteria | 2926 |
| 756 | Ga0495600_0134184 | 3300046809 | Bacteria | 1608 |
| 757 | Ga0495660_0000173 | 3300046810 | Bacteria | 69912 |
| 758 | Ga0495660_0001379 | 3300046810 | Bacteria | 16695 |
| 759 | Ga0495660_0003764 | 3300046810 | Bacteria | 9306 |
| 760 | Ga0495660_0009880 | 3300046810 | Bacteria | 5552 |
| 761 | Ga0495660_0012363 | 3300046810 | Bacteria | 4954 |
| 762 | Ga0495660_0034184 | 3300046810 | Bacteria | 2846 |
| 763 | Ga0495660_0105555 | 3300046810 | Bacteria | 1444 |
| 764 | Ga0495604_0001639 | 3300047317 | Bacteria | 18388 |
| 765 | Ga0495604_0019580 | 3300047317 | Bacteria | 5417 |
| 766 | Ga0495636_0009917 | 3300047318 | Bacteria | 3750 |
| 767 | Ga0495672_0000178 | 3300047320 | Bacteria | 91834 |
| 768 | Ga0495672_0001371 | 3300047320 | Bacteria | 24097 |
| 769 | Ga0495672_0002544 | 3300047320 | Bacteria | 16635 |
| 770 | Ga0495672_0002881 | 3300047320 | Bacteria | 15233 |
| 771 | Ga0495672_0008348 | 3300047320 | Bacteria | 7660 |
| 772 | Ga0495672_0020474 | 3300047320 | Bacteria | 4335 |
| 773 | Ga0495676_0159698 | 3300047321 | Bacteria | 1596 |
| 774 | Ga0495680_0019175 | 3300047322 | Bacteria | 5785 |
| 775 | Ga0495680_0080171 | 3300047322 | Bacteria | 2467 |
| 776 | Ga0495683_0000660 | 3300047323 | Bacteria | 25526 |
| 777 | Ga0495683_0001145 | 3300047323 | Bacteria | 18245 |
| 778 | Ga0495683_0006365 | 3300047323 | Bacteria | 6452 |
| 779 | Ga0495683_0006608 | 3300047323 | Bacteria | 6323 |
| 780 | Ga0495683_0008983 | 3300047323 | Bacteria | 5333 |
| 781 | Ga0495683_0011073 | 3300047323 | Bacteria | 4755 |
| 782 | Ga0495683_0017116 | 3300047323 | Bacteria | 3760 |
| 783 | Ga0495683_0032082 | 3300047323 | Bacteria | 2676 |
| 784 | Ga0495683_0077191 | 3300047323 | Bacteria | 1628 |
| 785 | Ga0495687_000012 | 3300047443 | Bacteria | 391586 |
| 786 | Ga0495687_000276 | 3300047443 | Bacteria | 67876 |
| 787 | Ga0495687_000279 | 3300047443 | Bacteria | 67230 |
| 788 | Ga0495687_000319 | 3300047443 | Bacteria | 62530 |
| 789 | Ga0495687_000545 | 3300047443 | Bacteria | 45047 |
| 790 | Ga0495687_000965 | 3300047443 | Bacteria | 29302 |
| 791 | Ga0495687_000991 | 3300047443 | Bacteria | 28486 |
| 792 | Ga0495687_013143 | 3300047443 | Bacteria | 4334 |
| 793 | Ga0495687_036245 | 3300047443 | Bacteria | 2209 |
| 794 | Ga0495675_0032064 | 3300047444 | Bacteria | 3355 |
| 795 | Ga0495675_0051543 | 3300047444 | Bacteria | 2613 |
| 796 | Ga0495677_0000050 | 3300047445 | Bacteria | 67980 |
| 797 | Ga0495677_0000934 | 3300047445 | Bacteria | 11759 |
| 798 | Ga0495677_0004733 | 3300047445 | Bacteria | 5185 |
| 799 | Ga0495677_0005481 | 3300047445 | Bacteria | 4811 |
| 800 | Ga0495677_0027690 | 3300047445 | Bacteria | 2056 |
| 801 | Ga0495679_006510 | 3300047446 | Bacteria | 5007 |
| 802 | Ga0495679_012045 | 3300047446 | Bacteria | 3312 |
| 803 | Ga0495679_022962 | 3300047446 | Bacteria | 2124 |
| 804 | Ga0495685_002889 | 3300047447 | Bacteria | 5429 |
| 805 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 806 | Ga0495673_0000026 | 3300047469 | Bacteria | 476378 |
| 807 | Ga0495673_0000028 | 3300047469 | Bacteria | 473418 |
| 808 | Ga0495681_0000744 | 3300047470 | Bacteria | 25082 |
| 809 | Ga0495681_0000807 | 3300047470 | Bacteria | 24161 |
| 810 | Ga0495681_0017085 | 3300047470 | Bacteria | 4041 |
| 811 | Ga0495681_0023498 | 3300047470 | Bacteria | 3273 |
| 812 | Ga0495681_0034729 | 3300047470 | Bacteria | 2509 |
| 813 | Ga0495684_0022699 | 3300047471 | Bacteria | 4826 |
| 814 | Ga0495684_0145098 | 3300047471 | Bacteria | 1778 |
| 815 | Ga0495686_0000495 | 3300047472 | Bacteria | 57870 |
| 816 | Ga0495686_0001546 | 3300047472 | Bacteria | 24576 |
| 817 | Ga0495686_0002818 | 3300047472 | Bacteria | 15756 |
| 818 | Ga0495686_0053915 | 3300047472 | Bacteria | 2519 |
| 819 | Ga0495615_0004504 | 3300048090 | Bacteria | 2438 |
| 820 | Ga0495626_0000017 | 3300048091 | Bacteria | 231648 |
| 821 | Ga0495626_0000386 | 3300048091 | Bacteria | 45608 |
| 822 | Ga0495626_0000425 | 3300048091 | Bacteria | 43228 |
| 823 | Ga0495626_0005936 | 3300048091 | Bacteria | 7027 |
| 824 | Ga0495626_0035411 | 3300048091 | Bacteria | 2382 |
| 825 | Ga0496101_0059228 | 3300048904 | Bacteria | 2775 |
| 826 | Ga0496101_0239903 | 3300048904 | Bacteria | 1410 |
| 827 | Ga0496102_0000829 | 3300048905 | Bacteria | 29800 |
| 828 | Ga0496102_0016019 | 3300048905 | Bacteria | 6544 |
| 829 | Ga0496102_0029433 | 3300048905 | Bacteria | 4914 |
| 830 | Ga0496102_0045157 | 3300048905 | Bacteria | 3999 |
| 831 | Ga0496103_0018656 | 3300048906 | Bacteria | 4162 |
| 832 | Ga0496103_0037110 | 3300048906 | Bacteria | 2986 |
| 833 | Ga0496103_0037452 | 3300048906 | Bacteria | 2972 |
| 834 | Ga0496104_0051486 | 3300048907 | Bacteria | 3886 |
| 835 | Ga0496104_0120702 | 3300048907 | Bacteria | 2517 |
| 836 | Ga0496104_0209741 | 3300048907 | Bacteria | 1860 |
| 837 | Ga0496105_0036700 | 3300048908 | Bacteria | 4038 |
| 838 | Ga0496105_0099411 | 3300048908 | Bacteria | 2403 |
| 839 | Ga0496105_0118365 | 3300048908 | Bacteria | 2185 |
| 840 | Ga0496106_0064727 | 3300048909 | Bacteria | 2782 |
| 841 | Ga0496107_0027620 | 3300048910 | Bacteria | 4030 |
| 842 | Ga0496108_0200177 | 3300048911 | Bacteria | 1733 |
| 843 | Ga0496109_0057844 | 3300048912 | Bacteria | 3540 |
| 844 | Ga0496109_0060710 | 3300048912 | Bacteria | 3455 |
| 845 | Ga0496109_0063033 | 3300048912 | Bacteria | 3390 |
| 846 | Ga0496110_0000070 | 3300048913 | Bacteria | 51596 |
| 847 | Ga0496110_0040532 | 3300048913 | Bacteria | 4058 |
| 848 | Ga0496110_0226540 | 3300048913 | Bacteria | 1700 |
| 849 | Ga0496111_0018763 | 3300048914 | Bacteria | 4794 |
| 850 | Ga0496112_0077032 | 3300048915 | Bacteria | 3298 |
| 851 | Ga0496112_0091673 | 3300048915 | Bacteria | 3008 |
| 852 | Ga0496113_0038171 | 3300048916 | Bacteria | 3530 |
| 853 | Ga0496113_0067247 | 3300048916 | Bacteria | 2716 |
| 854 | Ga0496113_0136051 | 3300048916 | Bacteria | 1931 |
| 855 | Ga0496115_0203182 | 3300048918 | Bacteria | 1637 |
| 856 | Ga0496116_0025999 | 3300048919 | Bacteria | 4290 |
| 857 | Ga0496116_0050726 | 3300048919 | Bacteria | 2762 |
| 858 | Ga0496117_0085225 | 3300048920 | Bacteria | 2058 |
| 859 | Ga0496118_0009602 | 3300048921 | Bacteria | 9740 |
| 860 | Ga0496121_0002960 | 3300048924 | Bacteria | 24756 |
| 861 | Ga0496121_0012291 | 3300048924 | Bacteria | 9369 |
| 862 | Ga0496121_0067635 | 3300048924 | Bacteria | 2894 |
| 863 | Ga0496121_0101059 | 3300048924 | Bacteria | 2225 |
| 864 | Ga0496122_0000452 | 3300048925 | Bacteria | 85514 |
| 865 | Ga0496122_0003862 | 3300048925 | Bacteria | 19222 |
| 866 | Ga0496122_0049890 | 3300048925 | Bacteria | 3197 |
| 867 | Ga0496122_0055182 | 3300048925 | Bacteria | 2976 |
| 868 | Ga0496122_0127976 | 3300048925 | Bacteria | 1621 |
| 869 | Ga0496123_0000514 | 3300048926 | Bacteria | 67374 |
| 870 | Ga0496123_0003055 | 3300048926 | Bacteria | 19252 |
| 871 | Ga0496123_0091043 | 3300048926 | Bacteria | 1810 |
| 872 | Ga0496124_0057706 | 3300048927 | Bacteria | 3270 |
| 873 | Ga0496124_0063627 | 3300048927 | Bacteria | 3081 |
| 874 | Ga0496124_0083110 | 3300048927 | Bacteria | 2628 |
| 875 | Ga0496124_0119203 | 3300048927 | Bacteria | 2111 |
| 876 | Ga0496125_0000572 | 3300048928 | Bacteria | 63057 |
| 877 | Ga0496125_0001421 | 3300048928 | Bacteria | 34916 |
| 878 | Ga0496125_0001986 | 3300048928 | Bacteria | 27786 |
| 879 | Ga0496126_0049386 | 3300048929 | Bacteria | 3841 |
| 880 | Ga0495678_000006 | 3300049459 | Bacteria | 463690 |
| 881 | Ga0495678_000293 | 3300049459 | Bacteria | 54963 |
| 882 | Ga0495678_000671 | 3300049459 | Bacteria | 31406 |
| 883 | Ga0495678_000936 | 3300049459 | Bacteria | 25387 |
| 884 | Ga0495678_001164 | 3300049459 | Bacteria | 21704 |
| 885 | Ga0495678_001549 | 3300049459 | Bacteria | 17735 |
| 886 | Ga0495678_002684 | 3300049459 | Bacteria | 11749 |
| 887 | Ga0495678_006615 | 3300049459 | Bacteria | 6142 |
| 888 | Ga0495678_016210 | 3300049459 | Bacteria | 3413 |
| 889 | Ga0501032_0007810 | 3300049569 | Bacteria | 7798 |
| 890 | Ga0501032_0106611 | 3300049569 | Bacteria | 1856 |
| 891 | Ga0501034_0000468 | 3300049571 | Bacteria | 66573 |
| 892 | Ga0501034_0000781 | 3300049571 | Bacteria | 47646 |
| 893 | Ga0501036_0018715 | 3300049572 | Bacteria | 5808 |
| 894 | Ga0501037_0009794 | 3300049573 | Bacteria | 7035 |
| 895 | Ga0501037_0022546 | 3300049573 | Bacteria | 4657 |
| 896 | Ga0501037_0102118 | 3300049573 | Bacteria | 2069 |
| 897 | Ga0501038_0002776 | 3300049574 | Bacteria | 16288 |
| 898 | Ga0501038_0080830 | 3300049574 | Bacteria | 2739 |
| 899 | Ga0501039_0039391 | 3300049575 | Bacteria | 3650 |
| 900 | Ga0501039_0089498 | 3300049575 | Bacteria | 2399 |
| 901 | Ga0501046_0006098 | 3300049580 | Bacteria | 10716 |
| 902 | Ga0501047_0019305 | 3300049581 | Bacteria | 6539 |
| 903 | Ga0501048_0088728 | 3300049582 | Bacteria | 2181 |
| 904 | Ga0501067_0076997 | 3300049583 | Bacteria | 1848 |
| 905 | Ga0501069_0001751 | 3300049585 | Bacteria | 10826 |
| 906 | Ga0501070_0003149 | 3300049586 | Bacteria | 14367 |
| 907 | Ga0501070_0013289 | 3300049586 | Bacteria | 6942 |
| 908 | Ga0501070_0015596 | 3300049586 | Bacteria | 6389 |
| 909 | Ga0501070_0020637 | 3300049586 | Bacteria | 5526 |
| 910 | Ga0501070_0031671 | 3300049586 | Bacteria | 4430 |
| 911 | Ga0501071_0009404 | 3300049587 | Bacteria | 6511 |
| 912 | Ga0501072_0033189 | 3300049588 | Bacteria | 4045 |
| 913 | Ga0501072_0036798 | 3300049588 | Bacteria | 3838 |
| 914 | Ga0501073_0000278 | 3300049589 | Bacteria | 33962 |
| 915 | Ga0501073_0033039 | 3300049589 | Bacteria | 3687 |
| 916 | Ga0501074_0002070 | 3300049590 | Bacteria | 13861 |
| 917 | Ga0501074_0013897 | 3300049590 | Bacteria | 5851 |
| 918 | Ga0501075_0001807 | 3300049591 | Bacteria | 14085 |
| 919 | Ga0501076_0000702 | 3300049592 | Bacteria | 21561 |
| 920 | Ga0501076_0044313 | 3300049592 | Bacteria | 3508 |
| 921 | Ga0501079_0050326 | 3300049741 | Bacteria | 3216 |
| 922 | Ga0501079_0210185 | 3300049741 | Bacteria | 1520 |
| 923 | Ga0501080_0007743 | 3300049742 | Bacteria | 9711 |
| 924 | Ga0501080_0014652 | 3300049742 | Bacteria | 7221 |
| 925 | Ga0501080_0042531 | 3300049742 | Bacteria | 4230 |
| 926 | Ga0501081_0010281 | 3300049743 | Bacteria | 6109 |
| 927 | Ga0501083_0007253 | 3300049744 | Bacteria | 7872 |
| 928 | Ga0501279_004229 | 3300049775 | Bacteria | 1883 |
| 929 | Ga0501035_0011898 | 3300049822 | Bacteria | 8053 |
| 930 | Ga0501044_0097554 | 3300049823 | Bacteria | 2960 |
| 931 | Ga0501045_0002691 | 3300049824 | Bacteria | 12125 |
| 932 | nmdc:mga00v17_22542_c1 | 3300050491 | Bacteria | 3634 |
| 933 | nmdc:mga0k408_1373_c1 | 3300050493 | Bacteria | 13133 |
| 934 | nmdc:mga09592_18475_c1 | 3300050508 | Bacteria | 5718 |
| 935 | nmdc:mga09592_237415_c1 | 3300050508 | Bacteria | 1579 |
| 936 | nmdc:mga09592_24967_c1 | 3300050508 | Bacteria | 4943 |
| 937 | nmdc:mga06r32_118952_c1 | 3300050510 | Bacteria | 2605 |
| 938 | nmdc:mga08y16_785_c1 | 3300050511 | Bacteria | 30306 |
| 939 | nmdc:mga0n895_10431_c1 | 3300050512 | Bacteria | 8206 |
| 940 | nmdc:mga0n895_51391_c1 | 3300050512 | Bacteria | 4044 |
| 941 | nmdc:mga0rr50_13135_c1 | 3300050513 | Bacteria | 5379 |
| 942 | nmdc:mga0rr50_75146_c1 | 3300050513 | Bacteria | 2589 |
| 943 | nmdc:mga08x19_745_c1 | 3300050514 | Bacteria | 20774 |
| 944 | nmdc:mga08x19_9110_c1 | 3300050514 | Bacteria | 5926 |
| 945 | nmdc:mga0a205_60904_c1 | 3300050515 | Bacteria | 3645 |
| 946 | nmdc:mga0a205_8626_c1 | 3300050515 | Bacteria | 9275 |
| 947 | Ga0495601_0007578 | 3300053077 | Bacteria | 6373 |
| 948 | Ga0495619_0038154 | 3300053085 | Bacteria | 3133 |
| 949 | Ga0500594_0001376 | 3300053118 | Bacteria | 5273 |
| 950 | Ga0500595_002472 | 3300053119 | Bacteria | 9144 |
| 951 | Ga0500618_001366 | 3300053125 | Bacteria | 11094 |
| 952 | Ga0500618_002052 | 3300053125 | Bacteria | 8118 |
| 953 | Ga0500619_000135 | 3300053154 | Bacteria | 19002 |
| 954 | Ga0501084_0015416 | 3300054114 | Bacteria | 6337 |
| 955 | Ga0501082_0017408 | 3300060353 | Bacteria | 6191 |
| 956 | Ga0501082_0025637 | 3300060353 | Bacteria | 5080 |
| 957 | Ga0530510_0010709 | 3300061734 | Bacteria | 6432 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044842 | Ga0466957_0192967 | Ga0466957_0192967_265_1317 | 341 |
| 2 | 3300045051 | Ga0451576_0146409 | Ga0451576_0146409_1308_2447 | 374 |
| 3 | 3300046615 | Ga0495656_0121263 | Ga0495656_0121263_14_1174 | 386 |
| 4 | 3300046691 | Ga0495670_0141502 | Ga0495670_0141502_79_1239 | 386 |
| 5 | 3300046809 | Ga0495600_0134184 | Ga0495600_0134184_431_1591 | 386 |
| 6 | 3300046525 | Ga0495663_0042045 | Ga0495663_0042045_163_1359 | 398 |
| 7 | 3300046794 | Ga0495589_0007813 | Ga0495589_0007813_4387_5583 | 398 |
| 8 | 3300047323 | Ga0495683_0077191 | Ga0495683_0077191_11_1207 | 398 |
| 9 | 3300025907 | Ga0207645_10101655 | Ga0207645_101016551 | 401 |
| 10 | 3300044693 | Ga0466961_0066942 | Ga0466961_0066942_43_1386 | 404 |
| 11 | 3300044684 | Ga0466966_0026496 | Ga0466966_0026496_226_1569 | 405 |
| 12 | 3300045049 | Ga0466959_0114682 | Ga0466959_0114682_448_1791 | 405 |
| 13 | 3300045836 | Ga0466958_0095612 | Ga0466958_0095612_277_1620 | 405 |
| 14 | iso_pu_bacteria | 2921643360 | 2921647972 | 409 |
| 15 | 3300038742 | Ga0400486_31155 | Ga0400486_31155_598_1941 | 412 |
| 16 | 3300039093 | Ga0400489_49372 | Ga0400489_49372_529_1872 | 414 |
| 17 | 3300038735 | Ga0400485_05209 | Ga0400485_05209_629_1972 | 415 |
| 18 | 3300048921 | Ga0496118_0009602 | Ga0496118_0009602_17_1279 | 416 |
| 19 | 3300037312 | Ga0395899_0001628 | Ga0395899_0001628_14745_16034 | 417 |
| 20 | 3300046810 | Ga0495660_0009880 | Ga0495660_0009880_2482_3840 | 417 |
| 21 | 3300005614 | Ga0068856_100024700 | Ga0068856_1000247002 | 419 |
| 22 | 3300026078 | Ga0207702_10045740 | Ga0207702_100457401 | 419 |
| 23 | 3300046471 | Ga0495650_0000011 | Ga0495650_0000011_254_1591 | 419 |
| 24 | 3300038725 | Ga0400484_39392 | Ga0400484_39392_743_2086 | 420 |
| 25 | 3300037466 | Ga0395898_0350191 | Ga0395898_0350191_39_1304 | 421 |
| 26 | 3300046471 | Ga0495650_0015190 | Ga0495650_0015190_1474_2811 | 421 |
| 27 | 3300005434 | Ga0070709_10013484 | Ga0070709_100134843 | 422 |
| 28 | 3300005435 | Ga0070714_100154152 | Ga0070714_1001541522 | 422 |
| 29 | 3300005436 | Ga0070713_100001388 | Ga0070713_1000013889 | 422 |
| 30 | 3300006028 | Ga0070717_10074695 | Ga0070717_100746951 | 422 |
| 31 | 3300025915 | Ga0207693_10026392 | Ga0207693_100263922 | 422 |
| 32 | 3300025928 | Ga0207700_10145112 | Ga0207700_101451121 | 422 |
| 33 | 3300025929 | Ga0207664_10068997 | Ga0207664_100689974 | 422 |
| 34 | 3300005434 | Ga0070709_10050553 | Ga0070709_100505532 | 423 |
| 35 | 3300025906 | Ga0207699_10041965 | Ga0207699_100419652 | 423 |
| 36 | 3300035089 | Ga0373944_0033084 | Ga0373944_0033084_275_1549 | 423 |
| 37 | 3300035171 | Ga0373946_0069834 | Ga0373946_0069834_44_1318 | 423 |
| 38 | 3300039062 | Ga0400483_014751 | Ga0400483_014751_619_1962 | 425 |
| 39 | 3300039062 | Ga0400483_263105 | Ga0400483_263105_1529_2872 | 425 |
| 40 | 3300042139 | Ga0450904_000213 | Ga0450904_000213_2017_3354 | 425 |
| 41 | 3300031691 | Ga0316579_10000043 | Ga0316579_1000004320 | 426 |
| 42 | 3300031728 | Ga0316578_10002920 | Ga0316578_100029206 | 426 |
| 43 | 3300031733 | Ga0316577_10001045 | Ga0316577_100010459 | 426 |
| 44 | 3300032137 | Ga0316585_10000368 | Ga0316585_100003687 | 426 |
| 45 | 3300032139 | Ga0316580_10000200 | Ga0316580_100002002 | 426 |
| 46 | 3300033528 | Ga0316588_1000731 | Ga0316588_10007312 | 426 |
| 47 | 3300035398 | Ga0316574_0000879 | Ga0316574_0000879_3900_5240 | 426 |
| 48 | 3300036647 | Ga0316582_0002490 | Ga0316582_0002490_3435_4775 | 426 |
| 49 | 3300048919 | Ga0496116_0050726 | Ga0496116_0050726_207_1550 | 426 |
| 50 | 3300025303 | Ga0209051_1020910 | Ga0209051_10209102 | 430 |
| 51 | 3300031548 | Ga0307408_100101106 | Ga0307408_1001011062 | 430 |
| 52 | 3300037418 | Ga0395900_0073550 | Ga0395900_0073550_232_1572 | 430 |
| 53 | 3300046810 | Ga0495660_0105555 | Ga0495660_0105555_10_1308 | 432 |
| 54 | 3300050515 | nmdc:mga0a205_60904_c1 | nmdc:mga0a205_60904_c1_988_2343 | 432 |
| 55 | 3300037418 | Ga0395900_0088453 | Ga0395900_0088453_1252_2589 | 433 |
| 56 | 3300049586 | Ga0501070_0015596 | Ga0501070_0015596_1354_2706 | 433 |
| 57 | 3300049741 | Ga0501079_0210185 | Ga0501079_0210185_61_1422 | 434 |
| 58 | 3300006847 | Ga0075431_100051695 | Ga0075431_1000516952 | 436 |
| 59 | 3300027682 | Ga0209971_1003987 | Ga0209971_10039872 | 436 |
| 60 | 3300037312 | Ga0395899_0011441 | Ga0395899_0011441_2493_3830 | 436 |
| 61 | 3300037466 | Ga0395898_0048223 | Ga0395898_0048223_1426_2763 | 436 |
| 62 | 3300038726 | Ga0400490_50054 | Ga0400490_50054_1614_2960 | 436 |
| 63 | 3300039062 | Ga0400483_117873 | Ga0400483_117873_431_1774 | 436 |
| 64 | 3300039062 | Ga0400483_161191 | Ga0400483_161191_815_2158 | 436 |
| 65 | 3300039062 | Ga0400483_239730 | Ga0400483_239730_574_1920 | 436 |
| 66 | 3300042001 | Ga0439441_001907 | Ga0439441_001907_555_1907 | 436 |
| 67 | 3300042461 | Ga0439460_0015679 | Ga0439460_0015679_597_1949 | 436 |
| 68 | 3300046528 | Ga0495642_0010459 | Ga0495642_0010459_883_2223 | 436 |
| 69 | 3300046542 | Ga0495597_0019384 | Ga0495597_0019384_1539_2879 | 436 |
| 70 | 3300046665 | Ga0495661_0003296 | Ga0495661_0003296_884_2224 | 436 |
| 71 | 3300047443 | Ga0495687_013143 | Ga0495687_013143_185_1525 | 436 |
| 72 | 3300048913 | Ga0496110_0226540 | Ga0496110_0226540_325_1665 | 436 |
| 73 | 3300050508 | nmdc:mga09592_18475_c1 | nmdc:mga09592_18475_c1_1382_2734 | 436 |
| 74 | 3300002459 | JGI24751J29686_10008669 | JGI24751J29686_100086692 | 437 |
| 75 | 3300005327 | Ga0070658_10098905 | Ga0070658_100989052 | 437 |
| 76 | 3300005328 | Ga0070676_10068657 | Ga0070676_100686572 | 437 |
| 77 | 3300005331 | Ga0070670_100023041 | Ga0070670_1000230413 | 437 |
| 78 | 3300005336 | Ga0070680_100009999 | Ga0070680_1000099996 | 437 |
| 79 | 3300005337 | Ga0070682_100034778 | Ga0070682_1000347781 | 437 |
| 80 | 3300005340 | Ga0070689_100170526 | Ga0070689_1001705262 | 437 |
| 81 | 3300005341 | Ga0070691_10043259 | Ga0070691_100432592 | 437 |
| 82 | 3300005345 | Ga0070692_10004046 | Ga0070692_100040462 | 437 |
| 83 | 3300005354 | Ga0070675_100024312 | Ga0070675_1000243122 | 437 |
| 84 | 3300005355 | Ga0070671_100001411 | Ga0070671_1000014113 | 437 |
| 85 | 3300005366 | Ga0070659_100033847 | Ga0070659_1000338474 | 437 |
| 86 | 3300005435 | Ga0070714_100037629 | Ga0070714_1000376295 | 437 |
| 87 | 3300005455 | Ga0070663_100005913 | Ga0070663_1000059136 | 437 |
| 88 | 3300005456 | Ga0070678_100034928 | Ga0070678_1000349284 | 437 |
| 89 | 3300005458 | Ga0070681_10026817 | Ga0070681_100268174 | 437 |
| 90 | 3300005530 | Ga0070679_100030112 | Ga0070679_1000301123 | 437 |
| 91 | 3300005543 | Ga0070672_100040575 | Ga0070672_1000405755 | 437 |
| 92 | 3300005547 | Ga0070693_100000782 | Ga0070693_1000007822 | 437 |
| 93 | 3300005548 | Ga0070665_100018219 | Ga0070665_1000182193 | 437 |
| 94 | 3300005563 | Ga0068855_100056268 | Ga0068855_1000562682 | 437 |
| 95 | 3300005563 | Ga0068855_100120706 | Ga0068855_1001207063 | 437 |
| 96 | 3300005615 | Ga0070702_100000492 | Ga0070702_1000004926 | 437 |
| 97 | 3300005616 | Ga0068852_100046693 | Ga0068852_1000466934 | 437 |
| 98 | 3300005617 | Ga0068859_100076106 | Ga0068859_1000761063 | 437 |
| 99 | 3300005840 | Ga0068870_10000308 | Ga0068870_100003081 | 437 |
| 100 | 3300005841 | Ga0068863_100010004 | Ga0068863_1000100046 | 437 |
| 101 | 3300006028 | Ga0070717_10061684 | Ga0070717_100616842 | 437 |
| 102 | 3300006358 | Ga0068871_100024724 | Ga0068871_1000247243 | 437 |
| 103 | 3300006844 | Ga0075428_100069025 | Ga0075428_1000690253 | 437 |
| 104 | 3300006871 | Ga0075434_100197302 | Ga0075434_1001973022 | 437 |
| 105 | 3300006880 | Ga0075429_100067974 | Ga0075429_1000679741 | 437 |
| 106 | 3300006914 | Ga0075436_100001288 | Ga0075436_1000012886 | 437 |
| 107 | 3300006931 | Ga0097620_100076112 | Ga0097620_1000761123 | 437 |
| 108 | 3300007076 | Ga0075435_100091052 | Ga0075435_1000910523 | 437 |
| 109 | 3300009093 | Ga0105240_10039974 | Ga0105240_100399745 | 437 |
| 110 | 3300009093 | Ga0105240_10057195 | Ga0105240_100571955 | 437 |
| 111 | 3300009094 | Ga0111539_10089558 | Ga0111539_100895581 | 437 |
| 112 | 3300009098 | Ga0105245_10090782 | Ga0105245_100907823 | 437 |
| 113 | 3300009101 | Ga0105247_10005715 | Ga0105247_100057153 | 437 |
| 114 | 3300009147 | Ga0114129_10100461 | Ga0114129_101004614 | 437 |
| 115 | 3300009174 | Ga0105241_10007546 | Ga0105241_100075466 | 437 |
| 116 | 3300009177 | Ga0105248_10047726 | Ga0105248_100477265 | 437 |
| 117 | 3300009551 | Ga0105238_10032802 | Ga0105238_100328025 | 437 |
| 118 | 3300011119 | Ga0105246_10002707 | Ga0105246_100027076 | 437 |
| 119 | 3300014326 | Ga0157380_10050206 | Ga0157380_100502063 | 437 |
| 120 | 3300014497 | Ga0182008_10063228 | Ga0182008_100632282 | 437 |
| 121 | 3300014745 | Ga0157377_10027254 | Ga0157377_100272543 | 437 |
| 122 | 3300020070 | Ga0206356_10349654 | Ga0206356_103496541 | 437 |
| 123 | 3300020081 | Ga0206354_10556897 | Ga0206354_105568974 | 437 |
| 124 | 3300022467 | Ga0224712_10007566 | Ga0224712_100075664 | 437 |
| 125 | 3300025900 | Ga0207710_10017733 | Ga0207710_100177334 | 437 |
| 126 | 3300025908 | Ga0207643_10000100 | Ga0207643_1000010029 | 437 |
| 127 | 3300025909 | Ga0207705_10011250 | Ga0207705_100112505 | 437 |
| 128 | 3300025912 | Ga0207707_10043300 | Ga0207707_100433003 | 437 |
| 129 | 3300025913 | Ga0207695_10042043 | Ga0207695_100420433 | 437 |
| 130 | 3300025918 | Ga0207662_10042222 | Ga0207662_100422221 | 437 |
| 131 | 3300025929 | Ga0207664_10044984 | Ga0207664_100449842 | 437 |
| 132 | 3300025932 | Ga0207690_10009825 | Ga0207690_100098254 | 437 |
| 133 | 3300025933 | Ga0207706_10088654 | Ga0207706_100886542 | 437 |
| 134 | 3300025936 | Ga0207670_10059474 | Ga0207670_100594743 | 437 |
| 135 | 3300025940 | Ga0207691_10028165 | Ga0207691_100281651 | 437 |
| 136 | 3300025942 | Ga0207689_10001285 | Ga0207689_100012857 | 437 |
| 137 | 3300025944 | Ga0207661_10001249 | Ga0207661_100012495 | 437 |
| 138 | 3300025945 | Ga0207679_10002148 | Ga0207679_1000214812 | 437 |
| 139 | 3300025981 | Ga0207640_10004866 | Ga0207640_100048663 | 437 |
| 140 | 3300026023 | Ga0207677_10014417 | Ga0207677_100144175 | 437 |
| 141 | 3300026067 | Ga0207678_10001325 | Ga0207678_1000132521 | 437 |
| 142 | 3300026088 | Ga0207641_10012080 | Ga0207641_100120804 | 437 |
| 143 | 3300026095 | Ga0207676_10001137 | Ga0207676_100011374 | 437 |
| 144 | 3300026116 | Ga0207674_10023254 | Ga0207674_100232547 | 437 |
| 145 | 3300026121 | Ga0207683_10000565 | Ga0207683_1000056518 | 437 |
| 146 | 3300026142 | Ga0207698_10005052 | Ga0207698_100050526 | 437 |
| 147 | 3300027907 | Ga0207428_10012488 | Ga0207428_100124883 | 437 |
| 148 | 3300037418 | Ga0395900_0039342 | Ga0395900_0039342_880_2217 | 437 |
| 149 | 3300038443 | Ga0395901_0028671 | Ga0395901_0028671_550_1887 | 437 |
| 150 | 3300038443 | Ga0395901_0147689 | Ga0395901_0147689_809_2140 | 437 |
| 151 | 3300038726 | Ga0400490_44514 | Ga0400490_44514_6830_8173 | 437 |
| 152 | 3300042005 | Ga0439448_0010451 | Ga0439448_0010451_919_2250 | 437 |
| 153 | 3300044658 | Ga0466972_0000275 | Ga0466972_0000275_25199_26566 | 437 |
| 154 | 3300048904 | Ga0496101_0059228 | Ga0496101_0059228_1105_2436 | 437 |
| 155 | 3300048905 | Ga0496102_0016019 | Ga0496102_0016019_2235_3566 | 437 |
| 156 | 3300048908 | Ga0496105_0036700 | Ga0496105_0036700_730_2061 | 437 |
| 157 | 3300048909 | Ga0496106_0064727 | Ga0496106_0064727_974_2305 | 437 |
| 158 | 3300048910 | Ga0496107_0027620 | Ga0496107_0027620_1179_2510 | 437 |
| 159 | 3300048912 | Ga0496109_0057844 | Ga0496109_0057844_506_1837 | 437 |
| 160 | 3300048916 | Ga0496113_0038171 | Ga0496113_0038171_671_2002 | 437 |
| 161 | 3300050508 | nmdc:mga09592_237415_c1 | nmdc:mga09592_237415_c1_97_1428 | 437 |
| 162 | 3300050510 | nmdc:mga06r32_118952_c1 | nmdc:mga06r32_118952_c1_999_2330 | 437 |
| 163 | 3300050512 | nmdc:mga0n895_51391_c1 | nmdc:mga0n895_51391_c1_1011_2342 | 437 |
| 164 | 3300050514 | nmdc:mga08x19_9110_c1 | nmdc:mga08x19_9110_c1_2028_3359 | 437 |
| 165 | 3300050515 | nmdc:mga0a205_8626_c1 | nmdc:mga0a205_8626_c1_3813_5144 | 437 |
| 166 | 3300035172 | Ga0373955_0149637 | Ga0373955_0149637_27_1346 | 438 |
| 167 | 3300036401 | Ga0373937_0108327 | Ga0373937_0108327_27_1346 | 438 |
| 168 | 3300036401 | Ga0373937_0189820 | Ga0373937_0189820_585_1904 | 438 |
| 169 | 3300037418 | Ga0395900_0039766 | Ga0395900_0039766_2771_4108 | 438 |
| 170 | 3300046535 | Ga0495586_0038260 | Ga0495586_0038260_27_1346 | 438 |
| 171 | 3300046543 | Ga0495645_0115655 | Ga0495645_0115655_308_1645 | 438 |
| 172 | 3300046680 | Ga0495646_0013711 | Ga0495646_0013711_1372_2709 | 438 |
| 173 | iso_pu_bacteria | 2547132103 | 2547372050 | 439 |
| 174 | iso_pu_bacteria | 2808606373 | 2808906792 | 439 |
| 175 | iso_pu_bacteria | 2843690924 | 2843694804 | 439 |
| 176 | iso_pu_bacteria | 2846037992 | 2846040252 | 439 |
| 177 | iso_pu_bacteria | 8057160832 | 8057163418 | 439 |
| 178 | 3300007265 | Ga0099794_10078515 | Ga0099794_100785151 | 440 |
| 179 | iso_pu_bacteria | 2511231026 | 2511387745 | 440 |
| 180 | iso_pu_bacteria | 2521172590 | 2521557304 | 440 |
| 181 | iso_pu_bacteria | 2551306416 | 2553005345 | 440 |
| 182 | iso_pu_bacteria | 2765235838 | 2765568431 | 440 |
| 183 | iso_pu_bacteria | 2808606386 | 2808981186 | 440 |
| 184 | iso_pu_bacteria | 2808606415 | 2809131761 | 440 |
| 185 | iso_pu_bacteria | 2808606419 | 2809151427 | 440 |
| 186 | iso_pu_bacteria | 2818991449 | 2819617701 | 440 |
| 187 | iso_pu_bacteria | 2839094727 | 2839095331 | 440 |
| 188 | iso_pu_bacteria | 2846033681 | 2846033726 | 440 |
| 189 | iso_pu_bacteria | 2852618963 | 2852620909 | 440 |
| 190 | iso_pu_bacteria | 2904439833 | 2904439961 | 440 |
| 191 | iso_pu_bacteria | 2904530477 | 2904531094 | 440 |
| 192 | iso_pu_bacteria | 2904584206 | 2904587261 | 440 |
| 193 | iso_pu_bacteria | 2904589729 | 2904592704 | 440 |
| 194 | iso_pu_bacteria | 2904601388 | 2904604513 | 440 |
| 195 | iso_pu_bacteria | 2919046199 | 2919050283 | 440 |
| 196 | iso_pu_bacteria | 2919079590 | 2919082335 | 440 |
| 197 | iso_pu_bacteria | 2928130867 | 2928133273 | 440 |
| 198 | 3300046492 | Ga0495585_0050119 | Ga0495585_0050119_591_1931 | 441 |
| 199 | 3300046691 | Ga0495670_0018262 | Ga0495670_0018262_1523_2863 | 441 |
| 200 | 3300047318 | Ga0495636_0009917 | Ga0495636_0009917_1911_3251 | 441 |
| 201 | 3300048920 | Ga0496117_0085225 | Ga0496117_0085225_366_1703 | 441 |
| 202 | 3300048924 | Ga0496121_0002960 | Ga0496121_0002960_20617_22026 | 441 |
| 203 | iso_pu_bacteria | 2511231003 | 2511250002 | 441 |
| 204 | iso_pu_bacteria | 2548876994 | 2550695285 | 441 |
| 205 | iso_pu_bacteria | 2738541297 | 2738828840 | 441 |
| 206 | iso_pu_bacteria | 2738541357 | 2739152636 | 441 |
| 207 | iso_pu_bacteria | 2738543003 | 2739194556 | 441 |
| 208 | iso_pu_bacteria | 2738543026 | 2739321032 | 441 |
| 209 | iso_pu_bacteria | 2738543029 | 2739339273 | 441 |
| 210 | iso_pu_bacteria | 2818991436 | 2819541227 | 441 |
| 211 | iso_pu_bacteria | 2818991445 | 2819591986 | 441 |
| 212 | iso_pu_bacteria | 2884811622 | 2884813759 | 441 |
| 213 | iso_pu_bacteria | 2884836552 | 2884840601 | 441 |
| 214 | iso_pu_bacteria | 2884852848 | 2884855858 | 441 |
| 215 | iso_pu_bacteria | 2885080285 | 2885085797 | 441 |
| 216 | iso_pu_bacteria | 2896154374 | 2896157217 | 441 |
| 217 | 3300021361 | Ga0213872_10001428 | Ga0213872_100014284 | 442 |
| 218 | 3300032004 | Ga0307414_10093485 | Ga0307414_100934853 | 442 |
| 219 | 3300039447 | Ga0436361_0922237 | Ga0436361_0922237_9265_10596 | 442 |
| 220 | 3300047323 | Ga0495683_0017116 | Ga0495683_0017116_1269_2597 | 442 |
| 221 | iso_pu_bacteria | 2643221556 | 2643802804 | 442 |
| 222 | iso_pu_bacteria | 2643221684 | 2644472309 | 442 |
| 223 | iso_pu_bacteria | 2808606418 | 2809142740 | 442 |
| 224 | iso_pu_bacteria | 8047673197 | 8047678596 | 442 |
| 225 | 3300032168 | Ga0316593_10000016 | Ga0316593_1000001618 | 443 |
| 226 | 3300037418 | Ga0395900_0034481 | Ga0395900_0034481_628_1986 | 443 |
| 227 | 3300038726 | Ga0400490_47396 | Ga0400490_47396_7124_8467 | 443 |
| 228 | 3300038741 | Ga0400488_06787 | Ga0400488_06787_2385_3728 | 443 |
| 229 | 3300039062 | Ga0400483_118802 | Ga0400483_118802_393_1736 | 443 |
| 230 | 3300039062 | Ga0400483_279956 | Ga0400483_279956_6983_8347 | 443 |
| 231 | 3300039110 | Ga0400487_57745 | Ga0400487_57745_2396_3739 | 443 |
| 232 | 3300039447 | Ga0436361_0954113 | Ga0436361_0954113_2583_3917 | 443 |
| 233 | 3300042115 | Ga0450911_000539 | Ga0450911_000539_3531_4868 | 443 |
| 234 | 3300042156 | Ga0439446_0002039 | Ga0439446_0002039_1370_2707 | 443 |
| 235 | 3300042438 | Ga0439459_0006044 | Ga0439459_0006044_121_1458 | 443 |
| 236 | 3300049569 | Ga0501032_0106611 | Ga0501032_0106611_251_1594 | 443 |
| 237 | 3300049573 | Ga0501037_0009794 | Ga0501037_0009794_2642_3988 | 443 |
| 238 | 3300049573 | Ga0501037_0022546 | Ga0501037_0022546_577_1920 | 443 |
| 239 | 3300049573 | Ga0501037_0102118 | Ga0501037_0102118_345_1688 | 443 |
| 240 | 3300049574 | Ga0501038_0002776 | Ga0501038_0002776_5970_7316 | 443 |
| 241 | 3300049575 | Ga0501039_0039391 | Ga0501039_0039391_865_2208 | 443 |
| 242 | 3300049580 | Ga0501046_0006098 | Ga0501046_0006098_3440_4783 | 443 |
| 243 | 3300049586 | Ga0501070_0003149 | Ga0501070_0003149_7094_8437 | 443 |
| 244 | 3300049586 | Ga0501070_0020637 | Ga0501070_0020637_1135_2478 | 443 |
| 245 | 3300049586 | Ga0501070_0031671 | Ga0501070_0031671_792_2138 | 443 |
| 246 | 3300049588 | Ga0501072_0033189 | Ga0501072_0033189_2613_3959 | 443 |
| 247 | 3300049589 | Ga0501073_0033039 | Ga0501073_0033039_1082_2425 | 443 |
| 248 | 3300049590 | Ga0501074_0013897 | Ga0501074_0013897_3232_4578 | 443 |
| 249 | 3300049742 | Ga0501080_0007743 | Ga0501080_0007743_3577_4923 | 443 |
| 250 | iso_pu_bacteria | 2513237150 | 2513956411 | 443 |
| 251 | iso_pu_bacteria | 2513237165 | 2514041511 | 443 |
| 252 | iso_pu_bacteria | 2687453129 | 2687580699 | 443 |
| 253 | iso_pu_bacteria | 2834641062 | 2834645031 | 443 |
| 254 | iso_pu_bacteria | 2842711865 | 2842714761 | 443 |
| 255 | iso_pu_bacteria | 2857558681 | 2857563326 | 443 |
| 256 | iso_pu_bacteria | 2858688981 | 2858695231 | 443 |
| 257 | iso_pu_bacteria | 644736347 | 644748291 | 443 |
| 258 | iso_pu_bacteria | 8003400568 | 8003401417 | 443 |
| 259 | 3300003751 | Ga0055538_1000013 | Ga0055538_1000013113 | 444 |
| 260 | 3300003752 | Ga0055539_1000018 | Ga0055539_1000018113 | 444 |
| 261 | 3300003756 | Ga0055533_1000022 | Ga0055533_1000022113 | 444 |
| 262 | 3300003759 | Ga0055525_1000024 | Ga0055525_1000024113 | 444 |
| 263 | 3300003841 | Ga0055541_1000013 | Ga0055541_1000013113 | 444 |
| 264 | 3300005563 | Ga0068855_100000037 | Ga0068855_10000003721 | 444 |
| 265 | 3300005578 | Ga0068854_100004957 | Ga0068854_1000049578 | 444 |
| 266 | 3300009093 | Ga0105240_10074646 | Ga0105240_100746463 | 444 |
| 267 | 3300009545 | Ga0105237_10015031 | Ga0105237_100150316 | 444 |
| 268 | 3300009551 | Ga0105238_10006983 | Ga0105238_100069833 | 444 |
| 269 | 3300010375 | Ga0105239_10013663 | Ga0105239_100136637 | 444 |
| 270 | 3300015261 | Ga0182006_1006807 | Ga0182006_10068073 | 444 |
| 271 | 3300021361 | Ga0213872_10030827 | Ga0213872_100308272 | 444 |
| 272 | 3300025224 | Ga0209784_100005 | Ga0209784_100005610 | 444 |
| 273 | 3300025225 | Ga0209566_100005 | Ga0209566_100005610 | 444 |
| 274 | 3300025226 | Ga0209674_100009 | Ga0209674_100009610 | 444 |
| 275 | 3300025230 | Ga0209563_100012 | Ga0209563_100012610 | 444 |
| 276 | 3300025253 | Ga0209677_100006 | Ga0209677_100006610 | 444 |
| 277 | 3300025913 | Ga0207695_10001485 | Ga0207695_100014856 | 444 |
| 278 | 3300025924 | Ga0207694_10001079 | Ga0207694_1000107918 | 444 |
| 279 | 3300025949 | Ga0207667_10000053 | Ga0207667_10000053165 | 444 |
| 280 | 3300025949 | Ga0207667_10010379 | Ga0207667_100103795 | 444 |
| 281 | 3300039447 | Ga0436361_0204853 | Ga0436361_0204853_13165_14499 | 444 |
| 282 | 3300047472 | Ga0495686_0000495 | Ga0495686_0000495_1529_2863 | 444 |
| 283 | 3300048906 | Ga0496103_0037110 | Ga0496103_0037110_135_1469 | 444 |
| 284 | 3300053125 | Ga0500618_002052 | Ga0500618_002052_1736_3070 | 444 |
| 285 | iso_pu_bacteria | 2643221645 | 2644251905 | 444 |
| 286 | iso_pu_bacteria | 2643221664 | 2644360555 | 444 |
| 287 | iso_pu_bacteria | 2721755763 | 2723876863 | 444 |
| 288 | iso_pu_bacteria | 2738541280 | 2738740390 | 444 |
| 289 | iso_pu_bacteria | 2738541300 | 2738843359 | 444 |
| 290 | iso_pu_bacteria | 2738543018 | 2739275568 | 444 |
| 291 | iso_pu_bacteria | 2738543030 | 2739344612 | 444 |
| 292 | iso_pu_bacteria | 2821131069 | 2821133074 | 444 |
| 293 | iso_pu_bacteria | 2857564685 | 2857567271 | 444 |
| 294 | 3300002704 | JGI25155J39150_1000275 | JGI25155J39150_10002759 | 445 |
| 295 | 3300002704 | JGI25155J39150_1000300 | JGI25155J39150_10003004 | 445 |
| 296 | 3300002705 | JGI25156J39149_1000654 | JGI25156J39149_10006547 | 445 |
| 297 | 3300002738 | JGI25154J39366_1001008 | JGI25154J39366_10010087 | 445 |
| 298 | 3300002738 | JGI25154J39366_1001607 | JGI25154J39366_10016077 | 445 |
| 299 | 3300002741 | JGI25157J39369_1000620 | JGI25157J39369_10006207 | 445 |
| 300 | 3300003214 | JGI25165J46597_1000172 | JGI25165J46597_10001726 | 445 |
| 301 | 3300003544 | Ga0007417J51691_1020175 | Ga0007417J51691_10201754 | 445 |
| 302 | 3300003574 | Ga0007410J51695_1027423 | Ga0007410J51695_10274234 | 445 |
| 303 | 3300003575 | Ga0007409J51694_1021755 | Ga0007409J51694_10217552 | 445 |
| 304 | 3300003577 | Ga0007416J51690_1014475 | Ga0007416J51690_10144758 | 445 |
| 305 | 3300003693 | Ga0032354_1020813 | Ga0032354_10208134 | 445 |
| 306 | 3300003751 | Ga0055538_1000063 | Ga0055538_100006386 | 445 |
| 307 | 3300003752 | Ga0055539_1000096 | Ga0055539_100009686 | 445 |
| 308 | 3300003756 | Ga0055533_1000107 | Ga0055533_100010786 | 445 |
| 309 | 3300003758 | Ga0055532_1000017 | Ga0055532_100001781 | 445 |
| 310 | 3300003759 | Ga0055525_1000047 | Ga0055525_100004718 | 445 |
| 311 | 3300003759 | Ga0055525_1000140 | Ga0055525_100014086 | 445 |
| 312 | 3300003761 | Ga0055535_1006068 | Ga0055535_10060682 | 445 |
| 313 | 3300003841 | Ga0055541_1000064 | Ga0055541_100006486 | 445 |
| 314 | 3300005327 | Ga0070658_10094454 | Ga0070658_100944542 | 445 |
| 315 | 3300005331 | Ga0070670_100069835 | Ga0070670_1000698354 | 445 |
| 316 | 3300005339 | Ga0070660_100156513 | Ga0070660_1001565132 | 445 |
| 317 | 3300005365 | Ga0070688_100163434 | Ga0070688_1001634341 | 445 |
| 318 | 3300005530 | Ga0070679_100096088 | Ga0070679_1000960884 | 445 |
| 319 | 3300005563 | Ga0068855_100057771 | Ga0068855_1000577712 | 445 |
| 320 | 3300005614 | Ga0068856_100107915 | Ga0068856_1001079153 | 445 |
| 321 | 3300005616 | Ga0068852_100024959 | Ga0068852_1000249594 | 445 |
| 322 | 3300005985 | Ga0081539_10000178 | Ga0081539_1000017820 | 445 |
| 323 | 3300009093 | Ga0105240_10056621 | Ga0105240_100566213 | 445 |
| 324 | 3300015265 | Ga0182005_1001875 | Ga0182005_10018753 | 445 |
| 325 | 3300017792 | Ga0163161_10046295 | Ga0163161_100462953 | 445 |
| 326 | 3300025206 | Ga0209435_100015 | Ga0209435_10001595 | 445 |
| 327 | 3300025206 | Ga0209435_100309 | Ga0209435_1003092 | 445 |
| 328 | 3300025207 | Ga0209760_101815 | Ga0209760_1018151 | 445 |
| 329 | 3300025224 | Ga0209784_100079 | Ga0209784_100079138 | 445 |
| 330 | 3300025225 | Ga0209566_100093 | Ga0209566_100093138 | 445 |
| 331 | 3300025226 | Ga0209674_100115 | Ga0209674_100115138 | 445 |
| 332 | 3300025229 | Ga0209147_100004 | Ga0209147_1000041131 | 445 |
| 333 | 3300025230 | Ga0209563_100003 | Ga0209563_100003548 | 445 |
| 334 | 3300025230 | Ga0209563_100113 | Ga0209563_100113138 | 445 |
| 335 | 3300025231 | Ga0207427_100262 | Ga0207427_10026232 | 445 |
| 336 | 3300025233 | Ga0209437_100176 | Ga0209437_100176138 | 445 |
| 337 | 3300025233 | Ga0209437_100329 | Ga0209437_10032927 | 445 |
| 338 | 3300025242 | Ga0209258_100523 | Ga0209258_1005238 | 445 |
| 339 | 3300025246 | Ga0209646_1000020 | Ga0209646_100002076 | 445 |
| 340 | 3300025246 | Ga0209646_1000040 | Ga0209646_1000040125 | 445 |
| 341 | 3300025250 | Ga0209026_1000034 | Ga0209026_1000034194 | 445 |
| 342 | 3300025250 | Ga0209026_1001477 | Ga0209026_10014774 | 445 |
| 343 | 3300025253 | Ga0209677_100072 | Ga0209677_100072138 | 445 |
| 344 | 3300025256 | Ga0209759_1000049 | Ga0209759_10000499 | 445 |
| 345 | 3300025256 | Ga0209759_1000656 | Ga0209759_10006567 | 445 |
| 346 | 3300025261 | Ga0209233_1000183 | Ga0209233_1000183138 | 445 |
| 347 | 3300025272 | Ga0209455_1001230 | Ga0209455_10012307 | 445 |
| 348 | 3300025912 | Ga0207707_10015157 | Ga0207707_100151573 | 445 |
| 349 | 3300025913 | Ga0207695_10041793 | Ga0207695_100417933 | 445 |
| 350 | 3300025919 | Ga0207657_10051371 | Ga0207657_100513713 | 445 |
| 351 | 3300025921 | Ga0207652_10241492 | Ga0207652_102414922 | 445 |
| 352 | 3300025932 | Ga0207690_10057472 | Ga0207690_100574723 | 445 |
| 353 | 3300025933 | Ga0207706_10174827 | Ga0207706_101748272 | 445 |
| 354 | 3300025949 | Ga0207667_10024176 | Ga0207667_100241763 | 445 |
| 355 | 3300026078 | Ga0207702_10085554 | Ga0207702_100855543 | 445 |
| 356 | 3300037312 | Ga0395899_0000183 | Ga0395899_0000183_88957_90294 | 445 |
| 357 | 3300037312 | Ga0395899_0012998 | Ga0395899_0012998_2143_3480 | 445 |
| 358 | 3300037418 | Ga0395900_0005509 | Ga0395900_0005509_6376_7713 | 445 |
| 359 | 3300037418 | Ga0395900_0011725 | Ga0395900_0011725_872_2209 | 445 |
| 360 | 3300037418 | Ga0395900_0177584 | Ga0395900_0177584_23_1360 | 445 |
| 361 | 3300037466 | Ga0395898_0085096 | Ga0395898_0085096_1696_3033 | 445 |
| 362 | 3300037471 | Ga0395905_0004758 | Ga0395905_0004758_9023_10360 | 445 |
| 363 | 3300038443 | Ga0395901_0002114 | Ga0395901_0002114_3494_4831 | 445 |
| 364 | 3300042876 | Ga0451577_0047164 | Ga0451577_0047164_1461_2843 | 445 |
| 365 | 3300044765 | Ga0466970_0014159 | Ga0466970_0014159_385_1722 | 445 |
| 366 | 3300045049 | Ga0466959_0015602 | Ga0466959_0015602_402_1739 | 445 |
| 367 | 3300046452 | Ga0495617_000004 | Ga0495617_000004_56440_57777 | 445 |
| 368 | 3300046463 | Ga0495653_0000010 | Ga0495653_0000010_268526_269863 | 445 |
| 369 | 3300046471 | Ga0495650_0000494 | Ga0495650_0000494_16952_18289 | 445 |
| 370 | 3300046471 | Ga0495650_0052606 | Ga0495650_0052606_251_1588 | 445 |
| 371 | 3300046492 | Ga0495585_0002914 | Ga0495585_0002914_1734_3071 | 445 |
| 372 | 3300046507 | Ga0495606_0000014 | Ga0495606_0000014_165047_166384 | 445 |
| 373 | 3300046507 | Ga0495606_0000111 | Ga0495606_0000111_98884_100221 | 445 |
| 374 | 3300046507 | Ga0495606_0000580 | Ga0495606_0000580_2121_3458 | 445 |
| 375 | 3300046511 | Ga0495608_0011071 | Ga0495608_0011071_455_1792 | 445 |
| 376 | 3300046512 | Ga0495610_0000010 | Ga0495610_0000010_414825_416162 | 445 |
| 377 | 3300046512 | Ga0495610_0006477 | Ga0495610_0006477_3343_4680 | 445 |
| 378 | 3300046514 | Ga0495618_0015550 | Ga0495618_0015550_1752_3089 | 445 |
| 379 | 3300046524 | Ga0495648_0001863 | Ga0495648_0001863_1000_2337 | 445 |
| 380 | 3300046529 | Ga0495652_0037529 | Ga0495652_0037529_1268_2605 | 445 |
| 381 | 3300046542 | Ga0495597_0001941 | Ga0495597_0001941_1625_2962 | 445 |
| 382 | 3300046543 | Ga0495645_0018519 | Ga0495645_0018519_2369_3706 | 445 |
| 383 | 3300046558 | Ga0495633_0007242 | Ga0495633_0007242_58_1395 | 445 |
| 384 | 3300046616 | Ga0495668_0000038 | Ga0495668_0000038_42344_43681 | 445 |
| 385 | 3300046660 | Ga0495625_0002638 | Ga0495625_0002638_16097_17434 | 445 |
| 386 | 3300046664 | Ga0495659_0014299 | Ga0495659_0014299_1227_2567 | 445 |
| 387 | 3300046678 | Ga0495599_0013096 | Ga0495599_0013096_3692_5029 | 445 |
| 388 | 3300046680 | Ga0495646_0035421 | Ga0495646_0035421_479_1816 | 445 |
| 389 | 3300046692 | Ga0495671_0000002 | Ga0495671_0000002_467809_469146 | 445 |
| 390 | 3300046809 | Ga0495600_0001052 | Ga0495600_0001052_12498_13835 | 445 |
| 391 | 3300047317 | Ga0495604_0001639 | Ga0495604_0001639_2828_4165 | 445 |
| 392 | 3300047323 | Ga0495683_0006608 | Ga0495683_0006608_1695_3032 | 445 |
| 393 | 3300047443 | Ga0495687_036245 | Ga0495687_036245_564_1901 | 445 |
| 394 | 3300047446 | Ga0495679_022962 | Ga0495679_022962_516_1853 | 445 |
| 395 | 3300047469 | Ga0495673_0000026 | Ga0495673_0000026_355311_356648 | 445 |
| 396 | 3300047472 | Ga0495686_0053915 | Ga0495686_0053915_1169_2506 | 445 |
| 397 | 3300048090 | Ga0495615_0004504 | Ga0495615_0004504_246_1583 | 445 |
| 398 | 3300048091 | Ga0495626_0005936 | Ga0495626_0005936_4198_5535 | 445 |
| 399 | 3300048905 | Ga0496102_0000829 | Ga0496102_0000829_26668_28005 | 445 |
| 400 | 3300048905 | Ga0496102_0029433 | Ga0496102_0029433_1855_3192 | 445 |
| 401 | 3300048905 | Ga0496102_0045157 | Ga0496102_0045157_62_1399 | 445 |
| 402 | 3300048906 | Ga0496103_0018656 | Ga0496103_0018656_1926_3263 | 445 |
| 403 | 3300048907 | Ga0496104_0120702 | Ga0496104_0120702_161_1498 | 445 |
| 404 | 3300048908 | Ga0496105_0099411 | Ga0496105_0099411_649_1986 | 445 |
| 405 | 3300048912 | Ga0496109_0060710 | Ga0496109_0060710_1948_3285 | 445 |
| 406 | 3300048913 | Ga0496110_0040532 | Ga0496110_0040532_2195_3532 | 445 |
| 407 | 3300048914 | Ga0496111_0018763 | Ga0496111_0018763_2614_3951 | 445 |
| 408 | 3300048915 | Ga0496112_0091673 | Ga0496112_0091673_686_2023 | 445 |
| 409 | 3300048919 | Ga0496116_0025999 | Ga0496116_0025999_2543_3880 | 445 |
| 410 | 3300048924 | Ga0496121_0012291 | Ga0496121_0012291_1808_3145 | 445 |
| 411 | 3300048924 | Ga0496121_0101059 | Ga0496121_0101059_624_1961 | 445 |
| 412 | 3300048925 | Ga0496122_0003862 | Ga0496122_0003862_16013_17350 | 445 |
| 413 | 3300048925 | Ga0496122_0055182 | Ga0496122_0055182_1283_2620 | 445 |
| 414 | 3300048926 | Ga0496123_0003055 | Ga0496123_0003055_1924_3261 | 445 |
| 415 | 3300048926 | Ga0496123_0091043 | Ga0496123_0091043_199_1536 | 445 |
| 416 | 3300048927 | Ga0496124_0083110 | Ga0496124_0083110_1036_2373 | 445 |
| 417 | 3300048928 | Ga0496125_0001421 | Ga0496125_0001421_29110_30447 | 445 |
| 418 | 3300048928 | Ga0496125_0001986 | Ga0496125_0001986_1923_3260 | 445 |
| 419 | 3300049459 | Ga0495678_002684 | Ga0495678_002684_7491_8828 | 445 |
| 420 | 3300049588 | Ga0501072_0036798 | Ga0501072_0036798_1223_2563 | 445 |
| 421 | 3300050512 | nmdc:mga0n895_10431_c1 | nmdc:mga0n895_10431_c1_1427_2767 | 445 |
| 422 | 3300050513 | nmdc:mga0rr50_13135_c1 | nmdc:mga0rr50_13135_c1_1763_3103 | 445 |
| 423 | 3300053119 | Ga0500595_002472 | Ga0500595_002472_1743_3080 | 445 |
| 424 | 3300053154 | Ga0500619_000135 | Ga0500619_000135_16108_17445 | 445 |
| 425 | iso_pu_bacteria | 2643221638 | 2644211847 | 445 |
| 426 | 3300003575 | Ga0007409J51694_1027849 | Ga0007409J51694_10278492 | 446 |
| 427 | 3300005327 | Ga0070658_10086252 | Ga0070658_100862521 | 446 |
| 428 | 3300005563 | Ga0068855_100020817 | Ga0068855_1000208171 | 446 |
| 429 | 3300013100 | Ga0157373_10089301 | Ga0157373_100893013 | 446 |
| 430 | 3300013297 | Ga0157378_10057431 | Ga0157378_100574313 | 446 |
| 431 | 3300025254 | Ga0209148_1001634 | Ga0209148_10016348 | 446 |
| 432 | 3300025909 | Ga0207705_10059148 | Ga0207705_100591482 | 446 |
| 433 | 3300025911 | Ga0207654_10000706 | Ga0207654_1000070613 | 446 |
| 434 | 3300025919 | Ga0207657_10076687 | Ga0207657_100766873 | 446 |
| 435 | 3300025949 | Ga0207667_10012404 | Ga0207667_100124048 | 446 |
| 436 | 3300025949 | Ga0207667_10169730 | Ga0207667_101697302 | 446 |
| 437 | 3300030731 | Ga0316177_1194028 | Ga0316177_119402812 | 446 |
| 438 | 3300037312 | Ga0395899_0045159 | Ga0395899_0045159_160_1500 | 446 |
| 439 | 3300037418 | Ga0395900_0000331 | Ga0395900_0000331_5401_6741 | 446 |
| 440 | 3300037418 | Ga0395900_0001669 | Ga0395900_0001669_3801_5141 | 446 |
| 441 | 3300037418 | Ga0395900_0057317 | Ga0395900_0057317_1761_3101 | 446 |
| 442 | 3300037466 | Ga0395898_0081519 | Ga0395898_0081519_449_1789 | 446 |
| 443 | 3300037471 | Ga0395905_0072426 | Ga0395905_0072426_1730_3070 | 446 |
| 444 | 3300037471 | Ga0395905_0090323 | Ga0395905_0090323_396_1736 | 446 |
| 445 | 3300037471 | Ga0395905_0107847 | Ga0395905_0107847_713_2053 | 446 |
| 446 | 3300037471 | Ga0395905_0208272 | Ga0395905_0208272_83_1423 | 446 |
| 447 | 3300038443 | Ga0395901_0000097 | Ga0395901_0000097_39029_40369 | 446 |
| 448 | 3300038443 | Ga0395901_0002053 | Ga0395901_0002053_1083_2423 | 446 |
| 449 | 3300042005 | Ga0439448_0005556 | Ga0439448_0005556_338_1678 | 446 |
| 450 | 3300044658 | Ga0466972_0027692 | Ga0466972_0027692_698_2038 | 446 |
| 451 | 3300044683 | Ga0466965_0052353 | Ga0466965_0052353_522_1862 | 446 |
| 452 | 3300044684 | Ga0466966_0006240 | Ga0466966_0006240_6273_7613 | 446 |
| 453 | 3300044684 | Ga0466966_0039322 | Ga0466966_0039322_981_2321 | 446 |
| 454 | 3300044706 | Ga0466964_0002459 | Ga0466964_0002459_3584_4924 | 446 |
| 455 | 3300044706 | Ga0466964_0056952 | Ga0466964_0056952_165_1505 | 446 |
| 456 | 3300044842 | Ga0466957_0003310 | Ga0466957_0003310_4757_6097 | 446 |
| 457 | 3300044842 | Ga0466957_0023223 | Ga0466957_0023223_747_2087 | 446 |
| 458 | 3300044842 | Ga0466957_0037108 | Ga0466957_0037108_1454_2794 | 446 |
| 459 | 3300044842 | Ga0466957_0107941 | Ga0466957_0107941_19_1359 | 446 |
| 460 | 3300044901 | Ga0466960_0019925 | Ga0466960_0019925_875_2215 | 446 |
| 461 | 3300045976 | Ga0466967_0026135 | Ga0466967_0026135_1375_2715 | 446 |
| 462 | 3300045976 | Ga0466967_0049377 | Ga0466967_0049377_832_2172 | 446 |
| 463 | 3300046452 | Ga0495617_000009 | Ga0495617_000009_154786_156126 | 446 |
| 464 | 3300046452 | Ga0495617_000407 | Ga0495617_000407_3861_5201 | 446 |
| 465 | 3300046452 | Ga0495617_021504 | Ga0495617_021504_677_2017 | 446 |
| 466 | 3300046453 | Ga0495627_000255 | Ga0495627_000255_1836_3176 | 446 |
| 467 | 3300046453 | Ga0495627_001629 | Ga0495627_001629_819_2159 | 446 |
| 468 | 3300046455 | Ga0495603_0017245 | Ga0495603_0017245_1759_3099 | 446 |
| 469 | 3300046457 | Ga0495590_0000669 | Ga0495590_0000669_9645_10985 | 446 |
| 470 | 3300046457 | Ga0495590_0002180 | Ga0495590_0002180_5474_6814 | 446 |
| 471 | 3300046458 | Ga0495591_001902 | Ga0495591_001902_1869_3209 | 446 |
| 472 | 3300046463 | Ga0495653_0031870 | Ga0495653_0031870_1574_2914 | 446 |
| 473 | 3300046463 | Ga0495653_0078741 | Ga0495653_0078741_124_1464 | 446 |
| 474 | 3300046471 | Ga0495650_0000593 | Ga0495650_0000593_6317_7657 | 446 |
| 475 | 3300046471 | Ga0495650_0025561 | Ga0495650_0025561_946_2286 | 446 |
| 476 | 3300046474 | Ga0495605_0000024 | Ga0495605_0000024_77636_78976 | 446 |
| 477 | 3300046474 | Ga0495605_0000236 | Ga0495605_0000236_1798_3138 | 446 |
| 478 | 3300046474 | Ga0495605_0002652 | Ga0495605_0002652_7899_9239 | 446 |
| 479 | 3300046474 | Ga0495605_0012754 | Ga0495605_0012754_1989_3329 | 446 |
| 480 | 3300046474 | Ga0495605_0022425 | Ga0495605_0022425_1034_2374 | 446 |
| 481 | 3300046474 | Ga0495605_0045363 | Ga0495605_0045363_424_1764 | 446 |
| 482 | 3300046491 | Ga0495584_0000003 | Ga0495584_0000003_256497_257837 | 446 |
| 483 | 3300046491 | Ga0495584_0000145 | Ga0495584_0000145_46598_47938 | 446 |
| 484 | 3300046491 | Ga0495584_0001720 | Ga0495584_0001720_2910_4250 | 446 |
| 485 | 3300046491 | Ga0495584_0002824 | Ga0495584_0002824_8318_9658 | 446 |
| 486 | 3300046491 | Ga0495584_0025456 | Ga0495584_0025456_191_1531 | 446 |
| 487 | 3300046491 | Ga0495584_0041841 | Ga0495584_0041841_518_1858 | 446 |
| 488 | 3300046492 | Ga0495585_0000130 | Ga0495585_0000130_6492_7832 | 446 |
| 489 | 3300046492 | Ga0495585_0000996 | Ga0495585_0000996_1299_2639 | 446 |
| 490 | 3300046492 | Ga0495585_0001018 | Ga0495585_0001018_1335_2675 | 446 |
| 491 | 3300046492 | Ga0495585_0002381 | Ga0495585_0002381_3390_4730 | 446 |
| 492 | 3300046492 | Ga0495585_0028439 | Ga0495585_0028439_1565_2905 | 446 |
| 493 | 3300046492 | Ga0495585_0035009 | Ga0495585_0035009_313_1653 | 446 |
| 494 | 3300046492 | Ga0495585_0098533 | Ga0495585_0098533_118_1458 | 446 |
| 495 | 3300046500 | Ga0495596_0001402 | Ga0495596_0001402_627_1967 | 446 |
| 496 | 3300046500 | Ga0495596_0003382 | Ga0495596_0003382_1750_3090 | 446 |
| 497 | 3300046500 | Ga0495596_0004245 | Ga0495596_0004245_3917_5257 | 446 |
| 498 | 3300046500 | Ga0495596_0004507 | Ga0495596_0004507_3803_5143 | 446 |
| 499 | 3300046500 | Ga0495596_0006613 | Ga0495596_0006613_2642_3982 | 446 |
| 500 | 3300046500 | Ga0495596_0017410 | Ga0495596_0017410_1588_2928 | 446 |
| 501 | 3300046501 | Ga0495607_0003741 | Ga0495607_0003741_8285_9625 | 446 |
| 502 | 3300046501 | Ga0495607_0009001 | Ga0495607_0009001_1786_3126 | 446 |
| 503 | 3300046501 | Ga0495607_0016447 | Ga0495607_0016447_1849_3189 | 446 |
| 504 | 3300046501 | Ga0495607_0017184 | Ga0495607_0017184_1842_3182 | 446 |
| 505 | 3300046501 | Ga0495607_0021131 | Ga0495607_0021131_1805_3145 | 446 |
| 506 | 3300046506 | Ga0495583_0000235 | Ga0495583_0000235_62478_63818 | 446 |
| 507 | 3300046506 | Ga0495583_0000560 | Ga0495583_0000560_48364_49704 | 446 |
| 508 | 3300046506 | Ga0495583_0000654 | Ga0495583_0000654_1833_3173 | 446 |
| 509 | 3300046506 | Ga0495583_0004372 | Ga0495583_0004372_864_2204 | 446 |
| 510 | 3300046506 | Ga0495583_0028477 | Ga0495583_0028477_395_1735 | 446 |
| 511 | 3300046507 | Ga0495606_0006256 | Ga0495606_0006256_8225_9565 | 446 |
| 512 | 3300046507 | Ga0495606_0029563 | Ga0495606_0029563_2267_3607 | 446 |
| 513 | 3300046507 | Ga0495606_0051056 | Ga0495606_0051056_1076_2416 | 446 |
| 514 | 3300046507 | Ga0495606_0059306 | Ga0495606_0059306_79_1419 | 446 |
| 515 | 3300046512 | Ga0495610_0001639 | Ga0495610_0001639_6215_7555 | 446 |
| 516 | 3300046513 | Ga0495616_0000542 | Ga0495616_0000542_1771_3111 | 446 |
| 517 | 3300046513 | Ga0495616_0000648 | Ga0495616_0000648_21675_23015 | 446 |
| 518 | 3300046513 | Ga0495616_0000816 | Ga0495616_0000816_1759_3099 | 446 |
| 519 | 3300046513 | Ga0495616_0002434 | Ga0495616_0002434_9826_11166 | 446 |
| 520 | 3300046513 | Ga0495616_0007257 | Ga0495616_0007257_3625_4965 | 446 |
| 521 | 3300046513 | Ga0495616_0020804 | Ga0495616_0020804_1924_3264 | 446 |
| 522 | 3300046513 | Ga0495616_0080572 | Ga0495616_0080572_54_1394 | 446 |
| 523 | 3300046517 | Ga0495630_0054277 | Ga0495630_0054277_1186_2526 | 446 |
| 524 | 3300046518 | Ga0495631_0001791 | Ga0495631_0001791_2851_4191 | 446 |
| 525 | 3300046518 | Ga0495631_0002889 | Ga0495631_0002889_7797_9137 | 446 |
| 526 | 3300046518 | Ga0495631_0003258 | Ga0495631_0003258_1871_3211 | 446 |
| 527 | 3300046518 | Ga0495631_0029473 | Ga0495631_0029473_109_1449 | 446 |
| 528 | 3300046519 | Ga0495632_0000073 | Ga0495632_0000073_101141_102481 | 446 |
| 529 | 3300046519 | Ga0495632_0000203 | Ga0495632_0000203_57608_58948 | 446 |
| 530 | 3300046519 | Ga0495632_0000225 | Ga0495632_0000225_1602_2942 | 446 |
| 531 | 3300046519 | Ga0495632_0022132 | Ga0495632_0022132_1556_2896 | 446 |
| 532 | 3300046519 | Ga0495632_0040635 | Ga0495632_0040635_946_2286 | 446 |
| 533 | 3300046522 | Ga0495643_0007966 | Ga0495643_0007966_3813_5153 | 446 |
| 534 | 3300046522 | Ga0495643_0037200 | Ga0495643_0037200_1145_2485 | 446 |
| 535 | 3300046523 | Ga0495644_0024587 | Ga0495644_0024587_378_1718 | 446 |
| 536 | 3300046524 | Ga0495648_0000003 | Ga0495648_0000003_315328_316668 | 446 |
| 537 | 3300046524 | Ga0495648_0000290 | Ga0495648_0000290_51429_52769 | 446 |
| 538 | 3300046524 | Ga0495648_0017919 | Ga0495648_0017919_1731_3071 | 446 |
| 539 | 3300046528 | Ga0495642_0000065 | Ga0495642_0000065_59376_60716 | 446 |
| 540 | 3300046528 | Ga0495642_0003872 | Ga0495642_0003872_1614_2954 | 446 |
| 541 | 3300046528 | Ga0495642_0023058 | Ga0495642_0023058_228_1568 | 446 |
| 542 | 3300046530 | Ga0495654_0011052 | Ga0495654_0011052_1833_3173 | 446 |
| 543 | 3300046538 | Ga0495609_0000030 | Ga0495609_0000030_92943_94283 | 446 |
| 544 | 3300046538 | Ga0495609_0003180 | Ga0495609_0003180_1544_2884 | 446 |
| 545 | 3300046538 | Ga0495609_0006964 | Ga0495609_0006964_1722_3062 | 446 |
| 546 | 3300046538 | Ga0495609_0010364 | Ga0495609_0010364_1476_2816 | 446 |
| 547 | 3300046538 | Ga0495609_0018313 | Ga0495609_0018313_1747_3087 | 446 |
| 548 | 3300046538 | Ga0495609_0026724 | Ga0495609_0026724_652_1992 | 446 |
| 549 | 3300046542 | Ga0495597_0000219 | Ga0495597_0000219_49288_50628 | 446 |
| 550 | 3300046542 | Ga0495597_0022494 | Ga0495597_0022494_1278_2618 | 446 |
| 551 | 3300046543 | Ga0495645_0045214 | Ga0495645_0045214_681_2021 | 446 |
| 552 | 3300046558 | Ga0495633_0002706 | Ga0495633_0002706_9153_10493 | 446 |
| 553 | 3300046558 | Ga0495633_0010500 | Ga0495633_0010500_1394_2734 | 446 |
| 554 | 3300046558 | Ga0495633_0014935 | Ga0495633_0014935_1020_2360 | 446 |
| 555 | 3300046616 | Ga0495668_0000366 | Ga0495668_0000366_1719_3059 | 446 |
| 556 | 3300046616 | Ga0495668_0001445 | Ga0495668_0001445_20087_21427 | 446 |
| 557 | 3300046616 | Ga0495668_0006030 | Ga0495668_0006030_2097_3437 | 446 |
| 558 | 3300046616 | Ga0495668_0016824 | Ga0495668_0016824_1743_3083 | 446 |
| 559 | 3300046616 | Ga0495668_0020642 | Ga0495668_0020642_1722_3062 | 446 |
| 560 | 3300046616 | Ga0495668_0038717 | Ga0495668_0038717_155_1495 | 446 |
| 561 | 3300046642 | Ga0495634_0012880 | Ga0495634_0012880_3931_5271 | 446 |
| 562 | 3300046648 | Ga0495611_0000944 | Ga0495611_0000944_5700_7040 | 446 |
| 563 | 3300046648 | Ga0495611_0008302 | Ga0495611_0008302_1391_2731 | 446 |
| 564 | 3300046660 | Ga0495625_0038762 | Ga0495625_0038762_1871_3211 | 446 |
| 565 | 3300046660 | Ga0495625_0050334 | Ga0495625_0050334_1518_2858 | 446 |
| 566 | 3300046665 | Ga0495661_0000209 | Ga0495661_0000209_1804_3144 | 446 |
| 567 | 3300046665 | Ga0495661_0009420 | Ga0495661_0009420_1487_2827 | 446 |
| 568 | 3300046665 | Ga0495661_0016457 | Ga0495661_0016457_1683_3023 | 446 |
| 569 | 3300046665 | Ga0495661_0018929 | Ga0495661_0018929_892_2232 | 446 |
| 570 | 3300046665 | Ga0495661_0023930 | Ga0495661_0023930_1920_3260 | 446 |
| 571 | 3300046665 | Ga0495661_0024398 | Ga0495661_0024398_982_2322 | 446 |
| 572 | 3300046665 | Ga0495661_0029152 | Ga0495661_0029152_1775_3115 | 446 |
| 573 | 3300046665 | Ga0495661_0034208 | Ga0495661_0034208_625_1965 | 446 |
| 574 | 3300046665 | Ga0495661_0034544 | Ga0495661_0034544_215_1555 | 446 |
| 575 | 3300046665 | Ga0495661_0058618 | Ga0495661_0058618_711_2051 | 446 |
| 576 | 3300046674 | Ga0495588_0000078 | Ga0495588_0000078_21127_22467 | 446 |
| 577 | 3300046674 | Ga0495588_0030499 | Ga0495588_0030499_930_2270 | 446 |
| 578 | 3300046679 | Ga0495623_0033389 | Ga0495623_0033389_1413_2753 | 446 |
| 579 | 3300046684 | Ga0495669_0014220 | Ga0495669_0014220_1725_3065 | 446 |
| 580 | 3300046684 | Ga0495669_0024677 | Ga0495669_0024677_908_2248 | 446 |
| 581 | 3300046691 | Ga0495670_0000223 | Ga0495670_0000223_1384_2724 | 446 |
| 582 | 3300046691 | Ga0495670_0046089 | Ga0495670_0046089_543_1883 | 446 |
| 583 | 3300046692 | Ga0495671_0000812 | Ga0495671_0000812_1797_3137 | 446 |
| 584 | 3300046692 | Ga0495671_0004041 | Ga0495671_0004041_237_1577 | 446 |
| 585 | 3300046694 | Ga0495649_0000363 | Ga0495649_0000363_1884_3224 | 446 |
| 586 | 3300046694 | Ga0495649_0002963 | Ga0495649_0002963_1747_3087 | 446 |
| 587 | 3300046794 | Ga0495589_0000021 | Ga0495589_0000021_93243_94583 | 446 |
| 588 | 3300046794 | Ga0495589_0000193 | Ga0495589_0000193_36200_37540 | 446 |
| 589 | 3300046810 | Ga0495660_0000173 | Ga0495660_0000173_65692_67032 | 446 |
| 590 | 3300046810 | Ga0495660_0012363 | Ga0495660_0012363_1790_3130 | 446 |
| 591 | 3300046810 | Ga0495660_0034184 | Ga0495660_0034184_1062_2402 | 446 |
| 592 | 3300047320 | Ga0495672_0000178 | Ga0495672_0000178_80819_82159 | 446 |
| 593 | 3300047320 | Ga0495672_0001371 | Ga0495672_0001371_1650_2990 | 446 |
| 594 | 3300047320 | Ga0495672_0002544 | Ga0495672_0002544_13810_15150 | 446 |
| 595 | 3300047320 | Ga0495672_0008348 | Ga0495672_0008348_148_1488 | 446 |
| 596 | 3300047321 | Ga0495676_0159698 | Ga0495676_0159698_89_1429 | 446 |
| 597 | 3300047323 | Ga0495683_0000660 | Ga0495683_0000660_22171_23511 | 446 |
| 598 | 3300047323 | Ga0495683_0001145 | Ga0495683_0001145_8440_9780 | 446 |
| 599 | 3300047323 | Ga0495683_0006365 | Ga0495683_0006365_708_2048 | 446 |
| 600 | 3300047323 | Ga0495683_0008983 | Ga0495683_0008983_532_1872 | 446 |
| 601 | 3300047323 | Ga0495683_0011073 | Ga0495683_0011073_1841_3181 | 446 |
| 602 | 3300047323 | Ga0495683_0032082 | Ga0495683_0032082_905_2245 | 446 |
| 603 | 3300047443 | Ga0495687_000012 | Ga0495687_000012_320586_321926 | 446 |
| 604 | 3300047443 | Ga0495687_000276 | Ga0495687_000276_64649_65989 | 446 |
| 605 | 3300047443 | Ga0495687_000279 | Ga0495687_000279_64079_65419 | 446 |
| 606 | 3300047443 | Ga0495687_000319 | Ga0495687_000319_58289_59629 | 446 |
| 607 | 3300047443 | Ga0495687_000545 | Ga0495687_000545_1831_3171 | 446 |
| 608 | 3300047444 | Ga0495675_0032064 | Ga0495675_0032064_309_1649 | 446 |
| 609 | 3300047445 | Ga0495677_0000050 | Ga0495677_0000050_2195_3535 | 446 |
| 610 | 3300047445 | Ga0495677_0000934 | Ga0495677_0000934_1539_2879 | 446 |
| 611 | 3300047445 | Ga0495677_0004733 | Ga0495677_0004733_1977_3317 | 446 |
| 612 | 3300047445 | Ga0495677_0005481 | Ga0495677_0005481_1806_3146 | 446 |
| 613 | 3300047445 | Ga0495677_0027690 | Ga0495677_0027690_264_1604 | 446 |
| 614 | 3300047446 | Ga0495679_006510 | Ga0495679_006510_2172_3512 | 446 |
| 615 | 3300047446 | Ga0495679_012045 | Ga0495679_012045_1769_3109 | 446 |
| 616 | 3300047447 | Ga0495685_002889 | Ga0495685_002889_2321_3661 | 446 |
| 617 | 3300047470 | Ga0495681_0000744 | Ga0495681_0000744_1802_3142 | 446 |
| 618 | 3300047470 | Ga0495681_0000807 | Ga0495681_0000807_21003_22343 | 446 |
| 619 | 3300047470 | Ga0495681_0017085 | Ga0495681_0017085_1104_2444 | 446 |
| 620 | 3300047470 | Ga0495681_0034729 | Ga0495681_0034729_854_2194 | 446 |
| 621 | 3300047472 | Ga0495686_0002818 | Ga0495686_0002818_12589_13929 | 446 |
| 622 | 3300048091 | Ga0495626_0000017 | Ga0495626_0000017_224097_225437 | 446 |
| 623 | 3300048091 | Ga0495626_0000386 | Ga0495626_0000386_1661_3001 | 446 |
| 624 | 3300048091 | Ga0495626_0000425 | Ga0495626_0000425_1802_3142 | 446 |
| 625 | 3300048904 | Ga0496101_0239903 | Ga0496101_0239903_19_1359 | 446 |
| 626 | 3300048906 | Ga0496103_0037452 | Ga0496103_0037452_558_1898 | 446 |
| 627 | 3300048908 | Ga0496105_0118365 | Ga0496105_0118365_643_1983 | 446 |
| 628 | 3300048911 | Ga0496108_0200177 | Ga0496108_0200177_230_1570 | 446 |
| 629 | 3300048912 | Ga0496109_0063033 | Ga0496109_0063033_187_1527 | 446 |
| 630 | 3300048913 | Ga0496110_0000070 | Ga0496110_0000070_1790_3130 | 446 |
| 631 | 3300048915 | Ga0496112_0077032 | Ga0496112_0077032_631_1971 | 446 |
| 632 | 3300048916 | Ga0496113_0067247 | Ga0496113_0067247_454_1794 | 446 |
| 633 | 3300048918 | Ga0496115_0203182 | Ga0496115_0203182_266_1606 | 446 |
| 634 | 3300048925 | Ga0496122_0000452 | Ga0496122_0000452_82338_83678 | 446 |
| 635 | 3300048925 | Ga0496122_0049890 | Ga0496122_0049890_1572_2912 | 446 |
| 636 | 3300048925 | Ga0496122_0127976 | Ga0496122_0127976_205_1545 | 446 |
| 637 | 3300048926 | Ga0496123_0000514 | Ga0496123_0000514_1618_2958 | 446 |
| 638 | 3300048927 | Ga0496124_0057706 | Ga0496124_0057706_283_1623 | 446 |
| 639 | 3300048927 | Ga0496124_0063627 | Ga0496124_0063627_21_1361 | 446 |
| 640 | 3300048927 | Ga0496124_0119203 | Ga0496124_0119203_600_1940 | 446 |
| 641 | 3300048928 | Ga0496125_0000572 | Ga0496125_0000572_60093_61433 | 446 |
| 642 | 3300049459 | Ga0495678_000293 | Ga0495678_000293_1763_3103 | 446 |
| 643 | 3300049459 | Ga0495678_000671 | Ga0495678_000671_1748_3088 | 446 |
| 644 | 3300049459 | Ga0495678_001164 | Ga0495678_001164_18751_20091 | 446 |
| 645 | 3300049459 | Ga0495678_001549 | Ga0495678_001549_7527_8867 | 446 |
| 646 | 3300049459 | Ga0495678_016210 | Ga0495678_016210_419_1759 | 446 |
| 647 | 3300049822 | Ga0501035_0011898 | Ga0501035_0011898_4869_6209 | 446 |
| 648 | 3300049823 | Ga0501044_0097554 | Ga0501044_0097554_242_1582 | 446 |
| 649 | 3300053125 | Ga0500618_001366 | Ga0500618_001366_2639_3985 | 446 |
| 650 | iso_pu_bacteria | 2526164512 | 2526211196 | 446 |
| 651 | iso_pu_bacteria | 2857553236 | 2857558356 | 446 |
| 652 | iso_pu_bacteria | 2919476304 | 2919479858 | 446 |
| 653 | iso_pu_bacteria | 2952252522 | 2952254926 | 446 |
| 654 | 3300003775 | Ga0055524_1011067 | Ga0055524_10110671 | 447 |
| 655 | 3300005546 | Ga0070696_100031224 | Ga0070696_1000312242 | 447 |
| 656 | 3300025294 | Ga0209025_1001025 | Ga0209025_100102532 | 447 |
| 657 | 3300025922 | Ga0207646_10232375 | Ga0207646_102323751 | 447 |
| 658 | 3300042876 | Ga0451577_0010210 | Ga0451577_0010210_7549_8901 | 447 |
| 659 | 3300045051 | Ga0451576_0009713 | Ga0451576_0009713_5356_6708 | 447 |
| 660 | 3300046452 | Ga0495617_009926 | Ga0495617_009926_1652_2998 | 447 |
| 661 | 3300046507 | Ga0495606_0000927 | Ga0495606_0000927_6291_7637 | 447 |
| 662 | 3300046660 | Ga0495625_0026750 | Ga0495625_0026750_1437_2783 | 447 |
| 663 | 3300047469 | Ga0495673_0000028 | Ga0495673_0000028_57442_58788 | 447 |
| 664 | 3300048907 | Ga0496104_0209741 | Ga0496104_0209741_424_1767 | 447 |
| 665 | 3300049571 | Ga0501034_0000781 | Ga0501034_0000781_7938_9281 | 447 |
| 666 | 3300049572 | Ga0501036_0018715 | Ga0501036_0018715_951_2303 | 447 |
| 667 | 3300049574 | Ga0501038_0080830 | Ga0501038_0080830_644_1996 | 447 |
| 668 | 3300049575 | Ga0501039_0089498 | Ga0501039_0089498_822_2174 | 447 |
| 669 | 3300049582 | Ga0501048_0088728 | Ga0501048_0088728_131_1483 | 447 |
| 670 | 3300049587 | Ga0501071_0009404 | Ga0501071_0009404_2915_4267 | 447 |
| 671 | 3300049591 | Ga0501075_0001807 | Ga0501075_0001807_6835_8187 | 447 |
| 672 | 3300049592 | Ga0501076_0000702 | Ga0501076_0000702_15675_17027 | 447 |
| 673 | 3300049592 | Ga0501076_0044313 | Ga0501076_0044313_1258_2613 | 447 |
| 674 | 3300049741 | Ga0501079_0050326 | Ga0501079_0050326_622_1974 | 447 |
| 675 | 3300049742 | Ga0501080_0042531 | Ga0501080_0042531_1652_3004 | 447 |
| 676 | 3300049743 | Ga0501081_0010281 | Ga0501081_0010281_2975_4327 | 447 |
| 677 | 3300049824 | Ga0501045_0002691 | Ga0501045_0002691_663_2015 | 447 |
| 678 | 3300053118 | Ga0500594_0001376 | Ga0500594_0001376_3314_4660 | 447 |
| 679 | 3300060353 | Ga0501082_0017408 | Ga0501082_0017408_3148_4500 | 447 |
| 680 | 3300061734 | Ga0530510_0010709 | Ga0530510_0010709_3887_5239 | 447 |
| 681 | 3300002774 | JGI25150J39212_1002852 | JGI25150J39212_10028526 | 448 |
| 682 | 3300002774 | JGI25150J39212_1006946 | JGI25150J39212_10069462 | 448 |
| 683 | 3300005458 | Ga0070681_10006572 | Ga0070681_1000657216 | 448 |
| 684 | 3300005467 | Ga0070706_100017426 | Ga0070706_1000174268 | 448 |
| 685 | 3300005468 | Ga0070707_100214422 | Ga0070707_1002144222 | 448 |
| 686 | 3300005545 | Ga0070695_100060199 | Ga0070695_1000601993 | 448 |
| 687 | 3300021361 | Ga0213872_10000020 | Ga0213872_1000002064 | 448 |
| 688 | 3300025245 | Ga0207425_1000678 | Ga0207425_100067813 | 448 |
| 689 | 3300025294 | Ga0209025_1005080 | Ga0209025_10050809 | 448 |
| 690 | 3300025297 | Ga0209758_1000228 | Ga0209758_100022813 | 448 |
| 691 | 3300025935 | Ga0207709_10069197 | Ga0207709_100691972 | 448 |
| 692 | 3300031548 | Ga0307408_100020196 | Ga0307408_1000201961 | 448 |
| 693 | 3300031711 | Ga0265314_10032195 | Ga0265314_100321953 | 448 |
| 694 | 3300035111 | Ga0373923_0002011 | Ga0373923_0002011_3249_4598 | 448 |
| 695 | 3300035113 | Ga0373936_0002769 | Ga0373936_0002769_956_2305 | 448 |
| 696 | 3300035117 | Ga0373953_0000495 | Ga0373953_0000495_242_1591 | 448 |
| 697 | 3300035118 | Ga0373954_0005296 | Ga0373954_0005296_1129_2478 | 448 |
| 698 | 3300035118 | Ga0373954_0009358 | Ga0373954_0009358_1533_2882 | 448 |
| 699 | 3300035119 | Ga0373956_0003206 | Ga0373956_0003206_1949_3298 | 448 |
| 700 | 3300035119 | Ga0373956_0011273 | Ga0373956_0011273_1103_2452 | 448 |
| 701 | 3300035170 | Ga0373943_0005190 | Ga0373943_0005190_2438_3787 | 448 |
| 702 | 3300035172 | Ga0373955_0008004 | Ga0373955_0008004_2672_4021 | 448 |
| 703 | 3300035692 | Ga0373935_0001464 | Ga0373935_0001464_3977_5326 | 448 |
| 704 | 3300035724 | Ga0373933_0005221 | Ga0373933_0005221_2587_3936 | 448 |
| 705 | 3300035725 | Ga0373947_0017109 | Ga0373947_0017109_2314_3663 | 448 |
| 706 | 3300036401 | Ga0373937_0001406 | Ga0373937_0001406_6506_7855 | 448 |
| 707 | 3300037068 | Ga0373925_0080980 | Ga0373925_0080980_746_2095 | 448 |
| 708 | 3300039447 | Ga0436361_0594223 | Ga0436361_0594223_18310_19659 | 448 |
| 709 | 3300039447 | Ga0436361_0901422 | Ga0436361_0901422_14451_15800 | 448 |
| 710 | 3300044683 | Ga0466965_0071145 | Ga0466965_0071145_113_1462 | 448 |
| 711 | 3300046454 | Ga0495592_0042407 | Ga0495592_0042407_96_1445 | 448 |
| 712 | 3300046457 | Ga0495590_0000010 | Ga0495590_0000010_6968_8317 | 448 |
| 713 | 3300046459 | Ga0495629_0065510 | Ga0495629_0065510_563_1912 | 448 |
| 714 | 3300046460 | Ga0495638_0000042 | Ga0495638_0000042_182949_184298 | 448 |
| 715 | 3300046461 | Ga0495641_0005536 | Ga0495641_0005536_3169_4518 | 448 |
| 716 | 3300046462 | Ga0495651_0003157 | Ga0495651_0003157_3885_5234 | 448 |
| 717 | 3300046471 | Ga0495650_0000165 | Ga0495650_0000165_3888_5237 | 448 |
| 718 | 3300046471 | Ga0495650_0000429 | Ga0495650_0000429_65187_66536 | 448 |
| 719 | 3300046471 | Ga0495650_0000500 | Ga0495650_0000500_6479_7828 | 448 |
| 720 | 3300046471 | Ga0495650_0017535 | Ga0495650_0017535_2054_3403 | 448 |
| 721 | 3300046471 | Ga0495650_0017859 | Ga0495650_0017859_2009_3358 | 448 |
| 722 | 3300046472 | Ga0495580_0004251 | Ga0495580_0004251_1213_2562 | 448 |
| 723 | 3300046474 | Ga0495605_0000022 | Ga0495605_0000022_2554_3903 | 448 |
| 724 | 3300046475 | Ga0495639_0008995 | Ga0495639_0008995_479_1828 | 448 |
| 725 | 3300046475 | Ga0495639_0019621 | Ga0495639_0019621_1076_2425 | 448 |
| 726 | 3300046476 | Ga0495662_0016721 | Ga0495662_0016721_1640_2989 | 448 |
| 727 | 3300046499 | Ga0495594_0022348 | Ga0495594_0022348_974_2323 | 448 |
| 728 | 3300046501 | Ga0495607_0036706 | Ga0495607_0036706_172_1521 | 448 |
| 729 | 3300046501 | Ga0495607_0080074 | Ga0495607_0080074_324_1673 | 448 |
| 730 | 3300046506 | Ga0495583_0000006 | Ga0495583_0000006_1929_3278 | 448 |
| 731 | 3300046507 | Ga0495606_0001555 | Ga0495606_0001555_21090_22439 | 448 |
| 732 | 3300046507 | Ga0495606_0006476 | Ga0495606_0006476_1509_2858 | 448 |
| 733 | 3300046507 | Ga0495606_0015030 | Ga0495606_0015030_1509_2858 | 448 |
| 734 | 3300046511 | Ga0495608_0026379 | Ga0495608_0026379_1230_2579 | 448 |
| 735 | 3300046516 | Ga0495628_0077781 | Ga0495628_0077781_1136_2485 | 448 |
| 736 | 3300046517 | Ga0495630_0006438 | Ga0495630_0006438_5205_6554 | 448 |
| 737 | 3300046520 | Ga0495637_0000069 | Ga0495637_0000069_81794_83143 | 448 |
| 738 | 3300046522 | Ga0495643_0001442 | Ga0495643_0001442_18734_20083 | 448 |
| 739 | 3300046524 | Ga0495648_0006527 | Ga0495648_0006527_928_2277 | 448 |
| 740 | 3300046528 | Ga0495642_0033354 | Ga0495642_0033354_256_1605 | 448 |
| 741 | 3300046529 | Ga0495652_0138551 | Ga0495652_0138551_385_1734 | 448 |
| 742 | 3300046530 | Ga0495654_0000002 | Ga0495654_0000002_406100_407449 | 448 |
| 743 | 3300046530 | Ga0495654_0017135 | Ga0495654_0017135_2232_3581 | 448 |
| 744 | 3300046531 | Ga0495665_0035295 | Ga0495665_0035295_844_2193 | 448 |
| 745 | 3300046533 | Ga0495640_0008997 | Ga0495640_0008997_1116_2465 | 448 |
| 746 | 3300046536 | Ga0495587_0003065 | Ga0495587_0003065_2665_4014 | 448 |
| 747 | 3300046542 | Ga0495597_0000111 | Ga0495597_0000111_50660_52009 | 448 |
| 748 | 3300046542 | Ga0495597_0006433 | Ga0495597_0006433_700_2049 | 448 |
| 749 | 3300046557 | Ga0495622_0000116 | Ga0495622_0000116_1314_2663 | 448 |
| 750 | 3300046558 | Ga0495633_0000124 | Ga0495633_0000124_7214_8563 | 448 |
| 751 | 3300046558 | Ga0495633_0000553 | Ga0495633_0000553_33788_35137 | 448 |
| 752 | 3300046616 | Ga0495668_0000843 | Ga0495668_0000843_1994_3343 | 448 |
| 753 | 3300046616 | Ga0495668_0031335 | Ga0495668_0031335_1453_2802 | 448 |
| 754 | 3300046642 | Ga0495634_0004770 | Ga0495634_0004770_2836_4185 | 448 |
| 755 | 3300046660 | Ga0495625_0000218 | Ga0495625_0000218_87109_88458 | 448 |
| 756 | 3300046660 | Ga0495625_0002241 | Ga0495625_0002241_1508_2857 | 448 |
| 757 | 3300046660 | Ga0495625_0049337 | Ga0495625_0049337_162_1511 | 448 |
| 758 | 3300046663 | Ga0495635_0025139 | Ga0495635_0025139_1115_2464 | 448 |
| 759 | 3300046664 | Ga0495659_0000240 | Ga0495659_0000240_20028_21377 | 448 |
| 760 | 3300046675 | Ga0495657_0022230 | Ga0495657_0022230_1230_2579 | 448 |
| 761 | 3300046680 | Ga0495646_0010240 | Ga0495646_0010240_2732_4078 | 448 |
| 762 | 3300046692 | Ga0495671_0000382 | Ga0495671_0000382_33628_34977 | 448 |
| 763 | 3300046809 | Ga0495600_0003954 | Ga0495600_0003954_4253_5602 | 448 |
| 764 | 3300047317 | Ga0495604_0019580 | Ga0495604_0019580_1024_2373 | 448 |
| 765 | 3300047320 | Ga0495672_0002881 | Ga0495672_0002881_7041_8390 | 448 |
| 766 | 3300047320 | Ga0495672_0020474 | Ga0495672_0020474_1416_2765 | 448 |
| 767 | 3300047322 | Ga0495680_0019175 | Ga0495680_0019175_988_2337 | 448 |
| 768 | 3300047443 | Ga0495687_000965 | Ga0495687_000965_27672_29021 | 448 |
| 769 | 3300047443 | Ga0495687_000991 | Ga0495687_000991_26856_28205 | 448 |
| 770 | 3300047444 | Ga0495675_0051543 | Ga0495675_0051543_649_1998 | 448 |
| 771 | 3300047469 | Ga0495673_0000005 | Ga0495673_0000005_298922_300271 | 448 |
| 772 | 3300047471 | Ga0495684_0022699 | Ga0495684_0022699_2037_3386 | 448 |
| 773 | 3300048924 | Ga0496121_0067635 | Ga0496121_0067635_128_1477 | 448 |
| 774 | 3300048929 | Ga0496126_0049386 | Ga0496126_0049386_1495_2844 | 448 |
| 775 | 3300049459 | Ga0495678_000936 | Ga0495678_000936_1965_3314 | 448 |
| 776 | 3300049459 | Ga0495678_006615 | Ga0495678_006615_3639_4988 | 448 |
| 777 | 3300002739 | JGI25158J39367_1002873 | JGI25158J39367_10028731 | 449 |
| 778 | 3300002739 | JGI25158J39367_1003610 | JGI25158J39367_10036103 | 449 |
| 779 | 3300002773 | JGI25152J39213_1001570 | JGI25152J39213_10015702 | 449 |
| 780 | 3300002774 | JGI25150J39212_1002715 | JGI25150J39212_10027154 | 449 |
| 781 | 3300003215 | JGI25153J46596_10016740 | JGI25153J46596_100167404 | 449 |
| 782 | 3300003771 | Ga0055526_1016792 | Ga0055526_10167921 | 449 |
| 783 | 3300003773 | Ga0055537_1000330 | Ga0055537_100033021 | 449 |
| 784 | 3300003775 | Ga0055524_1001358 | Ga0055524_100135810 | 449 |
| 785 | 3300003775 | Ga0055524_1012021 | Ga0055524_10120213 | 449 |
| 786 | 3300003784 | Ga0055534_1000606 | Ga0055534_10006068 | 449 |
| 787 | 3300003790 | Ga0055528_1000364 | Ga0055528_100036424 | 449 |
| 788 | 3300003791 | Ga0055530_10013065 | Ga0055530_100130652 | 449 |
| 789 | 3300003791 | Ga0055530_10014339 | Ga0055530_100143393 | 449 |
| 790 | 3300003794 | Ga0055531_10004518 | Ga0055531_100045186 | 449 |
| 791 | 3300003794 | Ga0055531_10028903 | Ga0055531_100289032 | 449 |
| 792 | 3300004625 | Ga0055543_1003234 | Ga0055543_10032343 | 449 |
| 793 | 3300004625 | Ga0055543_1006226 | Ga0055543_10062262 | 449 |
| 794 | 3300005262 | Ga0065165_1000039 | Ga0065165_100003915 | 449 |
| 795 | 3300005262 | Ga0065165_1015571 | Ga0065165_10155711 | 449 |
| 796 | 3300005327 | Ga0070658_10023663 | Ga0070658_100236633 | 449 |
| 797 | 3300005535 | Ga0070684_100034767 | Ga0070684_1000347674 | 449 |
| 798 | 3300005535 | Ga0070684_100142665 | Ga0070684_1001426652 | 449 |
| 799 | 3300005616 | Ga0068852_100027944 | Ga0068852_1000279446 | 449 |
| 800 | 3300006880 | Ga0075429_100099229 | Ga0075429_1000992292 | 449 |
| 801 | 3300009094 | Ga0111539_10000505 | Ga0111539_100005053 | 449 |
| 802 | 3300009098 | Ga0105245_10053839 | Ga0105245_100538393 | 449 |
| 803 | 3300009551 | Ga0105238_10051992 | Ga0105238_100519925 | 449 |
| 804 | 3300009551 | Ga0105238_10100019 | Ga0105238_101000192 | 449 |
| 805 | 3300013104 | Ga0157370_10014186 | Ga0157370_100141863 | 449 |
| 806 | 3300013104 | Ga0157370_10081754 | Ga0157370_100817542 | 449 |
| 807 | 3300013105 | Ga0157369_10040213 | Ga0157369_100402133 | 449 |
| 808 | 3300013307 | Ga0157372_10013542 | Ga0157372_100135423 | 449 |
| 809 | 3300013307 | Ga0157372_10059774 | Ga0157372_100597742 | 449 |
| 810 | 3300025208 | Ga0209436_100728 | Ga0209436_10072820 | 449 |
| 811 | 3300025208 | Ga0209436_101841 | Ga0209436_1018418 | 449 |
| 812 | 3300025208 | Ga0209436_102839 | Ga0209436_1028392 | 449 |
| 813 | 3300025245 | Ga0207425_1000014 | Ga0207425_10000144 | 449 |
| 814 | 3300025245 | Ga0207425_1000109 | Ga0207425_10001098 | 449 |
| 815 | 3300025245 | Ga0207425_1000122 | Ga0207425_100012272 | 449 |
| 816 | 3300025258 | Ga0209129_1000017 | Ga0209129_1000017457 | 449 |
| 817 | 3300025263 | Ga0209565_1000003 | Ga0209565_10000038 | 449 |
| 818 | 3300025263 | Ga0209565_1004651 | Ga0209565_10046516 | 449 |
| 819 | 3300025263 | Ga0209565_1006069 | Ga0209565_10060692 | 449 |
| 820 | 3300025273 | Ga0209673_1000017 | Ga0209673_1000017379 | 449 |
| 821 | 3300025284 | Ga0209130_1000171 | Ga0209130_100017177 | 449 |
| 822 | 3300025284 | Ga0209130_1000177 | Ga0209130_100017788 | 449 |
| 823 | 3300025291 | Ga0209675_1000119 | Ga0209675_10001198 | 449 |
| 824 | 3300025291 | Ga0209675_1001621 | Ga0209675_10016218 | 449 |
| 825 | 3300025295 | Ga0209564_1000016 | Ga0209564_1000016107 | 449 |
| 826 | 3300025295 | Ga0209564_1005005 | Ga0209564_10050052 | 449 |
| 827 | 3300025297 | Ga0209758_1000038 | Ga0209758_10000384 | 449 |
| 828 | 3300025298 | Ga0209050_1000011 | Ga0209050_1000011540 | 449 |
| 829 | 3300025298 | Ga0209050_1003602 | Ga0209050_10036029 | 449 |
| 830 | 3300025299 | Ga0209256_1000210 | Ga0209256_10002108 | 449 |
| 831 | 3300025299 | Ga0209256_1000987 | Ga0209256_100098737 | 449 |
| 832 | 3300025299 | Ga0209256_1002009 | Ga0209256_10020093 | 449 |
| 833 | 3300025299 | Ga0209256_1009131 | Ga0209256_10091313 | 449 |
| 834 | 3300025302 | Ga0207426_1006741 | Ga0207426_10067412 | 449 |
| 835 | 3300025302 | Ga0207426_1023189 | Ga0207426_10231892 | 449 |
| 836 | 3300025304 | Ga0209257_1000003 | Ga0209257_10000031312 | 449 |
| 837 | 3300025304 | Ga0209257_1013499 | Ga0209257_10134993 | 449 |
| 838 | 3300025909 | Ga0207705_10017296 | Ga0207705_100172962 | 449 |
| 839 | 3300025909 | Ga0207705_10018257 | Ga0207705_100182573 | 449 |
| 840 | 3300025911 | Ga0207654_10019815 | Ga0207654_100198153 | 449 |
| 841 | 3300025921 | Ga0207652_10056420 | Ga0207652_100564202 | 449 |
| 842 | 3300025924 | Ga0207694_10040962 | Ga0207694_100409623 | 449 |
| 843 | 3300025945 | Ga0207679_10130250 | Ga0207679_101302502 | 449 |
| 844 | 3300025949 | Ga0207667_10038157 | Ga0207667_100381572 | 449 |
| 845 | 3300026041 | Ga0207639_10036345 | Ga0207639_100363453 | 449 |
| 846 | 3300026067 | Ga0207678_10212027 | Ga0207678_102120271 | 449 |
| 847 | 3300026078 | Ga0207702_10124137 | Ga0207702_101241372 | 449 |
| 848 | 3300027907 | Ga0207428_10003457 | Ga0207428_100034573 | 449 |
| 849 | 3300031548 | Ga0307408_100000140 | Ga0307408_10000014087 | 449 |
| 850 | 3300031548 | Ga0307408_100109124 | Ga0307408_1001091242 | 449 |
| 851 | 3300031548 | Ga0307408_100175360 | Ga0307408_1001753602 | 449 |
| 852 | 3300031728 | Ga0316578_10052727 | Ga0316578_100527272 | 449 |
| 853 | 3300032002 | Ga0307416_100007520 | Ga0307416_1000075204 | 449 |
| 854 | 3300035398 | Ga0316574_0003444 | Ga0316574_0003444_1001_2371 | 449 |
| 855 | 3300036647 | Ga0316582_0090944 | Ga0316582_0090944_304_1662 | 449 |
| 856 | 3300037418 | Ga0395900_0082870 | Ga0395900_0082870_552_1916 | 449 |
| 857 | 3300037471 | Ga0395905_0069234 | Ga0395905_0069234_149_1501 | 449 |
| 858 | 3300038443 | Ga0395901_0098268 | Ga0395901_0098268_509_1873 | 449 |
| 859 | 3300045836 | Ga0466958_0019882 | Ga0466958_0019882_2142_3506 | 449 |
| 860 | 3300046491 | Ga0495584_0041540 | Ga0495584_0041540_720_2072 | 449 |
| 861 | 3300046501 | Ga0495607_0000615 | Ga0495607_0000615_31375_32727 | 449 |
| 862 | 3300046501 | Ga0495607_0031141 | Ga0495607_0031141_384_1736 | 449 |
| 863 | 3300046519 | Ga0495632_0001091 | Ga0495632_0001091_1708_3060 | 449 |
| 864 | 3300046538 | Ga0495609_0000072 | Ga0495609_0000072_1996_3348 | 449 |
| 865 | 3300046616 | Ga0495668_0000071 | Ga0495668_0000071_7494_8846 | 449 |
| 866 | 3300046660 | Ga0495625_0038134 | Ga0495625_0038134_76_1428 | 449 |
| 867 | 3300046664 | Ga0495659_0003268 | Ga0495659_0003268_1002_2354 | 449 |
| 868 | 3300046665 | Ga0495661_0005018 | Ga0495661_0005018_6298_7650 | 449 |
| 869 | 3300046665 | Ga0495661_0034622 | Ga0495661_0034622_704_2056 | 449 |
| 870 | 3300046684 | Ga0495669_0001554 | Ga0495669_0001554_1907_3259 | 449 |
| 871 | 3300046694 | Ga0495649_0018097 | Ga0495649_0018097_638_1990 | 449 |
| 872 | 3300047470 | Ga0495681_0023498 | Ga0495681_0023498_178_1530 | 449 |
| 873 | 3300047472 | Ga0495686_0001546 | Ga0495686_0001546_1503_2855 | 449 |
| 874 | 3300048091 | Ga0495626_0035411 | Ga0495626_0035411_37_1389 | 449 |
| 875 | 3300048916 | Ga0496113_0136051 | Ga0496113_0136051_249_1601 | 449 |
| 876 | 3300049581 | Ga0501047_0019305 | Ga0501047_0019305_5071_6438 | 449 |
| 877 | 3300049583 | Ga0501067_0076997 | Ga0501067_0076997_65_1432 | 449 |
| 878 | 3300049585 | Ga0501069_0001751 | Ga0501069_0001751_3056_4423 | 449 |
| 879 | 3300049586 | Ga0501070_0013289 | Ga0501070_0013289_2455_3822 | 449 |
| 880 | 3300049589 | Ga0501073_0000278 | Ga0501073_0000278_17144_18511 | 449 |
| 881 | 3300049590 | Ga0501074_0002070 | Ga0501074_0002070_11539_12906 | 449 |
| 882 | 3300049742 | Ga0501080_0014652 | Ga0501080_0014652_1125_2492 | 449 |
| 883 | 3300049744 | Ga0501083_0007253 | Ga0501083_0007253_3229_4596 | 449 |
| 884 | 3300049775 | Ga0501279_004229 | Ga0501279_004229_355_1707 | 449 |
| 885 | 3300050491 | nmdc:mga00v17_22542_c1 | nmdc:mga00v17_22542_c1_360_1727 | 449 |
| 886 | 3300050508 | nmdc:mga09592_24967_c1 | nmdc:mga09592_24967_c1_1827_3191 | 449 |
| 887 | 3300050511 | nmdc:mga08y16_785_c1 | nmdc:mga08y16_785_c1_1005_2369 | 449 |
| 888 | 3300054114 | Ga0501084_0015416 | Ga0501084_0015416_1929_3296 | 449 |
| 889 | 3300060353 | Ga0501082_0025637 | Ga0501082_0025637_2408_3775 | 449 |
| 890 | 3300005330 | Ga0070690_100001150 | Ga0070690_10000115013 | 450 |
| 891 | 3300005334 | Ga0068869_100001768 | Ga0068869_10000176811 | 450 |
| 892 | 3300005338 | Ga0068868_100121854 | Ga0068868_1001218542 | 450 |
| 893 | 3300005338 | Ga0068868_100153756 | Ga0068868_1001537561 | 450 |
| 894 | 3300005340 | Ga0070689_100002574 | Ga0070689_10000257410 | 450 |
| 895 | 3300005340 | Ga0070689_100009280 | Ga0070689_1000092807 | 450 |
| 896 | 3300005340 | Ga0070689_100119308 | Ga0070689_1001193081 | 450 |
| 897 | 3300005341 | Ga0070691_10008035 | Ga0070691_100080354 | 450 |
| 898 | 3300005345 | Ga0070692_10003248 | Ga0070692_100032485 | 450 |
| 899 | 3300005354 | Ga0070675_100001897 | Ga0070675_10000189711 | 450 |
| 900 | 3300005356 | Ga0070674_100073081 | Ga0070674_1000730812 | 450 |
| 901 | 3300005356 | Ga0070674_100144524 | Ga0070674_1001445241 | 450 |
| 902 | 3300005364 | Ga0070673_100106735 | Ga0070673_1001067352 | 450 |
| 903 | 3300005365 | Ga0070688_100023396 | Ga0070688_1000233963 | 450 |
| 904 | 3300005439 | Ga0070711_100025581 | Ga0070711_1000255813 | 450 |
| 905 | 3300005440 | Ga0070705_100034973 | Ga0070705_1000349733 | 450 |
| 906 | 3300005441 | Ga0070700_100002896 | Ga0070700_1000028962 | 450 |
| 907 | 3300005444 | Ga0070694_100061363 | Ga0070694_1000613632 | 450 |
| 908 | 3300005459 | Ga0068867_100003190 | Ga0068867_1000031903 | 450 |
| 909 | 3300005466 | Ga0070685_10065099 | Ga0070685_100650991 | 450 |
| 910 | 3300005467 | Ga0070706_100040072 | Ga0070706_1000400722 | 450 |
| 911 | 3300005544 | Ga0070686_100001567 | Ga0070686_1000015676 | 450 |
| 912 | 3300005545 | Ga0070695_100016701 | Ga0070695_1000167013 | 450 |
| 913 | 3300005546 | Ga0070696_100009218 | Ga0070696_1000092185 | 450 |
| 914 | 3300005546 | Ga0070696_100031219 | Ga0070696_1000312192 | 450 |
| 915 | 3300005547 | Ga0070693_100000927 | Ga0070693_1000009273 | 450 |
| 916 | 3300005547 | Ga0070693_100011430 | Ga0070693_1000114304 | 450 |
| 917 | 3300005547 | Ga0070693_100020661 | Ga0070693_1000206611 | 450 |
| 918 | 3300005548 | Ga0070665_100153626 | Ga0070665_1001536262 | 450 |
| 919 | 3300005615 | Ga0070702_100003343 | Ga0070702_1000033436 | 450 |
| 920 | 3300005718 | Ga0068866_10004054 | Ga0068866_100040542 | 450 |
| 921 | 3300005719 | Ga0068861_100005425 | Ga0068861_1000054252 | 450 |
| 922 | 3300005842 | Ga0068858_100032854 | Ga0068858_1000328543 | 450 |
| 923 | 3300005842 | Ga0068858_100043474 | Ga0068858_1000434742 | 450 |
| 924 | 3300005843 | Ga0068860_100020008 | Ga0068860_1000200086 | 450 |
| 925 | 3300005844 | Ga0068862_100009752 | Ga0068862_1000097525 | 450 |
| 926 | 3300006195 | Ga0075366_10006563 | Ga0075366_100065637 | 450 |
| 927 | 3300006237 | Ga0097621_100023306 | Ga0097621_1000233064 | 450 |
| 928 | 3300006237 | Ga0097621_100221051 | Ga0097621_1002210512 | 450 |
| 929 | 3300006358 | Ga0068871_100087396 | Ga0068871_1000873962 | 450 |
| 930 | 3300006871 | Ga0075434_100121819 | Ga0075434_1001218193 | 450 |
| 931 | 3300006881 | Ga0068865_100000273 | Ga0068865_10000027315 | 450 |
| 932 | 3300009098 | Ga0105245_10000207 | Ga0105245_100002076 | 450 |
| 933 | 3300009098 | Ga0105245_10034497 | Ga0105245_100344974 | 450 |
| 934 | 3300009148 | Ga0105243_10027012 | Ga0105243_100270124 | 450 |
| 935 | 3300009176 | Ga0105242_10003135 | Ga0105242_1000313510 | 450 |
| 936 | 3300009176 | Ga0105242_10019320 | Ga0105242_100193202 | 450 |
| 937 | 3300009176 | Ga0105242_10022750 | Ga0105242_100227502 | 450 |
| 938 | 3300009177 | Ga0105248_10017721 | Ga0105248_100177212 | 450 |
| 939 | 3300009177 | Ga0105248_10377723 | Ga0105248_103777231 | 450 |
| 940 | 3300009551 | Ga0105238_10133784 | Ga0105238_101337843 | 450 |
| 941 | 3300009553 | Ga0105249_10016805 | Ga0105249_100168055 | 450 |
| 942 | 3300013296 | Ga0157374_10056395 | Ga0157374_100563955 | 450 |
| 943 | 3300013297 | Ga0157378_10004564 | Ga0157378_100045646 | 450 |
| 944 | 3300013308 | Ga0157375_10086055 | Ga0157375_100860553 | 450 |
| 945 | 3300014326 | Ga0157380_10005531 | Ga0157380_1000553110 | 450 |
| 946 | 3300014745 | Ga0157377_10034828 | Ga0157377_100348283 | 450 |
| 947 | 3300014968 | Ga0157379_10053926 | Ga0157379_100539264 | 450 |
| 948 | 3300014968 | Ga0157379_10140774 | Ga0157379_101407742 | 450 |
| 949 | 3300014969 | Ga0157376_10073516 | Ga0157376_100735163 | 450 |
| 950 | 3300015265 | Ga0182005_1000013 | Ga0182005_1000013316 | 450 |
| 951 | 3300025899 | Ga0207642_10002492 | Ga0207642_100024923 | 450 |
| 952 | 3300025908 | Ga0207643_10005317 | Ga0207643_100053173 | 450 |
| 953 | 3300025912 | Ga0207707_10117374 | Ga0207707_101173741 | 450 |
| 954 | 3300025924 | Ga0207694_10103237 | Ga0207694_101032372 | 450 |
| 955 | 3300025926 | Ga0207659_10091323 | Ga0207659_100913232 | 450 |
| 956 | 3300025926 | Ga0207659_10135247 | Ga0207659_101352472 | 450 |
| 957 | 3300025927 | Ga0207687_10005397 | Ga0207687_100053973 | 450 |
| 958 | 3300025933 | Ga0207706_10101869 | Ga0207706_101018692 | 450 |
| 959 | 3300025934 | Ga0207686_10012873 | Ga0207686_100128732 | 450 |
| 960 | 3300025934 | Ga0207686_10020448 | Ga0207686_100204484 | 450 |
| 961 | 3300025936 | Ga0207670_10002019 | Ga0207670_100020199 | 450 |
| 962 | 3300025936 | Ga0207670_10059722 | Ga0207670_100597223 | 450 |
| 963 | 3300025938 | Ga0207704_10001365 | Ga0207704_100013657 | 450 |
| 964 | 3300025940 | Ga0207691_10011498 | Ga0207691_1001149810 | 450 |
| 965 | 3300025941 | Ga0207711_10051181 | Ga0207711_100511815 | 450 |
| 966 | 3300025941 | Ga0207711_10095643 | Ga0207711_100956433 | 450 |
| 967 | 3300025942 | Ga0207689_10002332 | Ga0207689_1000233214 | 450 |
| 968 | 3300025944 | Ga0207661_10265592 | Ga0207661_102655922 | 450 |
| 969 | 3300025961 | Ga0207712_10031274 | Ga0207712_100312742 | 450 |
| 970 | 3300026023 | Ga0207677_10108350 | Ga0207677_101083502 | 450 |
| 971 | 3300026023 | Ga0207677_10131423 | Ga0207677_101314231 | 450 |
| 972 | 3300026035 | Ga0207703_10013747 | Ga0207703_100137472 | 450 |
| 973 | 3300026035 | Ga0207703_10040395 | Ga0207703_100403956 | 450 |
| 974 | 3300026075 | Ga0207708_10000156 | Ga0207708_1000015645 | 450 |
| 975 | 3300026075 | Ga0207708_10030948 | Ga0207708_100309482 | 450 |
| 976 | 3300026089 | Ga0207648_10005383 | Ga0207648_100053836 | 450 |
| 977 | 3300026118 | Ga0207675_100001059 | Ga0207675_10000105916 | 450 |
| 978 | 3300026121 | Ga0207683_10085260 | Ga0207683_100852603 | 450 |
| 979 | 3300026142 | Ga0207698_10002155 | Ga0207698_1000215512 | 450 |
| 980 | 3300028381 | Ga0268264_10022554 | Ga0268264_100225542 | 450 |
| 981 | 3300032002 | Ga0307416_100205343 | Ga0307416_1002053432 | 450 |
| 982 | 3300035172 | Ga0373955_0039940 | Ga0373955_0039940_1129_2496 | 450 |
| 983 | 3300035410 | Ga0373924_0011263 | Ga0373924_0011263_1355_2722 | 450 |
| 984 | 3300035691 | Ga0373931_0055874 | Ga0373931_0055874_641_2008 | 450 |
| 985 | 3300035695 | Ga0373927_0061227 | Ga0373927_0061227_287_1645 | 450 |
| 986 | 3300046453 | Ga0495627_000008 | Ga0495627_000008_376005_377360 | 450 |
| 987 | 3300046454 | Ga0495592_0015317 | Ga0495592_0015317_2087_3454 | 450 |
| 988 | 3300046529 | Ga0495652_0044005 | Ga0495652_0044005_1400_2767 | 450 |
| 989 | 3300046538 | Ga0495609_0000542 | Ga0495609_0000542_26429_27784 | 450 |
| 990 | 3300046543 | Ga0495645_0001557 | Ga0495645_0001557_8107_9474 | 450 |
| 991 | 3300046559 | Ga0495667_0013108 | Ga0495667_0013108_1221_2588 | 450 |
| 992 | 3300046678 | Ga0495599_0010681 | Ga0495599_0010681_1190_2557 | 450 |
| 993 | 3300046679 | Ga0495623_0008017 | Ga0495623_0008017_940_2307 | 450 |
| 994 | 3300046809 | Ga0495600_0043602 | Ga0495600_0043602_442_1809 | 450 |
| 995 | 3300046810 | Ga0495660_0001379 | Ga0495660_0001379_1554_2909 | 450 |
| 996 | 3300046810 | Ga0495660_0003764 | Ga0495660_0003764_2852_4207 | 450 |
| 997 | 3300047322 | Ga0495680_0080171 | Ga0495680_0080171_868_2235 | 450 |
| 998 | 3300047471 | Ga0495684_0145098 | Ga0495684_0145098_365_1732 | 450 |
| 999 | 3300048907 | Ga0496104_0051486 | Ga0496104_0051486_217_1617 | 450 |
| 1000 | 3300049459 | Ga0495678_000006 | Ga0495678_000006_391786_393141 | 450 |
| 1001 | 3300049571 | Ga0501034_0000468 | Ga0501034_0000468_61325_62695 | 450 |
| 1002 | 3300050493 | nmdc:mga0k408_1373_c1 | nmdc:mga0k408_1373_c1_4884_6251 | 450 |
| 1003 | 3300050513 | nmdc:mga0rr50_75146_c1 | nmdc:mga0rr50_75146_c1_328_1695 | 450 |
| 1004 | 3300050514 | nmdc:mga08x19_745_c1 | nmdc:mga08x19_745_c1_3170_4537 | 450 |
| 1005 | 3300053077 | Ga0495601_0007578 | Ga0495601_0007578_2644_4011 | 450 |
| 1006 | 3300053085 | Ga0495619_0038154 | Ga0495619_0038154_1150_2517 | 450 |
| 1007 | 3300005347 | Ga0070668_100010282 | Ga0070668_1000102824 | 451 |
| 1008 | 3300005549 | Ga0070704_100015546 | Ga0070704_1000155464 | 451 |
| 1009 | 3300005617 | Ga0068859_100061203 | Ga0068859_1000612032 | 451 |
| 1010 | 3300005842 | Ga0068858_100031576 | Ga0068858_1000315763 | 451 |
| 1011 | 3300005844 | Ga0068862_100028139 | Ga0068862_1000281394 | 451 |
| 1012 | 3300006931 | Ga0097620_100061206 | Ga0097620_1000612062 | 451 |
| 1013 | 3300013297 | Ga0157378_10078856 | Ga0157378_100788562 | 451 |
| 1014 | 3300013308 | Ga0157375_10148969 | Ga0157375_101489691 | 451 |
| 1015 | 3300014326 | Ga0157380_10020047 | Ga0157380_100200473 | 451 |
| 1016 | 3300025934 | Ga0207686_10172580 | Ga0207686_101725801 | 451 |
| 1017 | 3300025942 | Ga0207689_10082728 | Ga0207689_100827282 | 451 |
| 1018 | 3300025972 | Ga0207668_10019908 | Ga0207668_100199084 | 451 |
| 1019 | 3300031250 | Ga0265331_10010555 | Ga0265331_100105552 | 451 |
| 1020 | 3300031251 | Ga0265327_10000639 | Ga0265327_1000063937 | 451 |
| 1021 | 3300046683 | Ga0495658_0117709 | Ga0495658_0117709_67_1458 | 451 |
| 1022 | 3300049569 | Ga0501032_0007810 | Ga0501032_0007810_5067_6428 | 451 |
| 1023 | 3300001979 | JGI24740J21852_10001895 | JGI24740J21852_100018959 | 453 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gyz-assembly1.cif.gz_B | crystal structure of glmm from staphylococcus aureus | 0.9494 | 4 | 451 |
| 7olh-assembly3.cif.gz_E | bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) | 0.9447 | 4 | 375 |
| 7olh-assembly3.cif.gz_E | bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) | 0.9422 | 4 | 375 |
| 6gyz-assembly1.cif.gz_B | crystal structure of glmm from staphylococcus aureus | 0.9411 | 4 | 451 |
| 3i3w-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9319 | 4 | 449 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6gyzB02 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9828 | 162 | 262 | 3.40.120.10 |
| af_P31120_370_445_3.30.310.50 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain | 0.9713 | 376 | 449 | 3.30.310.50 |
| af_P9WN41_373_447_3.30.310.50 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain | 0.9596 | 376 | 450 | 3.30.310.50 |
| af_P31120_3_154_3.40.120.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 | 0.9551 | 3 | 159 | 3.40.120.10 |
| af_P9WN41_373_447_3.30.310.50 | Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain | 0.9473 | 376 | 450 | 3.30.310.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A381EZZ9-F1-model_v4 | deleted | 0.9858 | 80 | 234 |
|
| AF-A4MZY5-F1-model_v4 | deleted | 0.9855 | 51 | 449 |
|
| AF-A0A1G0KTN6-F1-model_v4 | Phosphoglucosamine mutase (EC 5.4.2.10) | 0.985 | 1 | 451 |
GO:0000287
GO:0004615 GO:0005829 GO:0005975 GO:0006048 GO:0008966 GO:0009252 |
| AF-A0A1F8U9G8-F1-model_v4 | Phosphoglucosamine mutase (EC 5.4.2.10) | 0.9846 | 101 | 450 |
GO:0000287
GO:0004615 GO:0005829 GO:0005975 GO:0006048 GO:0008966 GO:0009252 |
| AF-A0A382VFH7-F1-model_v4 | Alpha-D-phosphohexomutase alpha/beta/alpha domain-containing protein | 0.9839 | 103 | 269 |
GO:0004615
GO:0005829 GO:0005975 GO:0006048 GO:0008966 GO:0009252 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar