F488443
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1023 | 306 | 1023 | 108 |
Family's Representative Sequence
| Representative Sequence | 3300025929|Ga0207664_10207285|Ga0207664_102072853 |
| Length | 116 |
| Sequence | MDEDELDVPEPDSDERRLNIQMPAELIGGTYANFANVSFSQYEFTLTFARIEHEVEEGDVPGAVVARVNASPRFIPELIAALQDSYSKYVTREGIRNLPEAQGHSDADDTSASPGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 75 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 81 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 82 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 83 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 124 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 125 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 126 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 127 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 134 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 137 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 138 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 139 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 149 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 150 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 151 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 157 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 160 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 179 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 180 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 181 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 182 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 183 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 184 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 185 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 186 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 187 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 188 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 189 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 196 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 274 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 277 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 278 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 279 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 304 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 305 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.02 |
| Metatranscriptomes | 0.98 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 8.02 |
| Rhizosphere | 91.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10009734 | 3300005327 | Bacteria | 7719 |
| 2 | Ga0070658_10085504 | 3300005327 | Bacteria | 2594 |
| 3 | Ga0070658_10374225 | 3300005327 | Bacteria | 1221 |
| 4 | Ga0070658_10566130 | 3300005327 | Bacteria | 984 |
| 5 | Ga0070658_11277009 | 3300005327 | Unclassified | 638 |
| 6 | Ga0070683_100000682 | 3300005329 | Bacteria | 24589 |
| 7 | Ga0070683_100046995 | 3300005329 | Bacteria | 3988 |
| 8 | Ga0070683_100106628 | 3300005329 | Bacteria | 2642 |
| 9 | Ga0070683_100629443 | 3300005329 | Bacteria | 1027 |
| 10 | Ga0070680_100014283 | 3300005336 | Bacteria | 6202 |
| 11 | Ga0070680_100105611 | 3300005336 | Bacteria | 2341 |
| 12 | Ga0070680_100210240 | 3300005336 | Bacteria | 1641 |
| 13 | Ga0070680_100445605 | 3300005336 | Bacteria | 1106 |
| 14 | Ga0070680_100564676 | 3300005336 | Unclassified | 976 |
| 15 | Ga0070682_100015147 | 3300005337 | Bacteria | 4464 |
| 16 | Ga0070682_101354349 | 3300005337 | Unclassified | 607 |
| 17 | Ga0070682_101787717 | 3300005337 | Bacteria | 536 |
| 18 | Ga0068868_101450820 | 3300005338 | Bacteria | 641 |
| 19 | Ga0070660_100001782 | 3300005339 | Bacteria | 14790 |
| 20 | Ga0070660_100003328 | 3300005339 | Bacteria | 11044 |
| 21 | Ga0070660_100031738 | 3300005339 | Bacteria | 3969 |
| 22 | Ga0070660_100031952 | 3300005339 | Bacteria | 3958 |
| 23 | Ga0070691_10056155 | 3300005341 | Bacteria | 1886 |
| 24 | Ga0070691_10253315 | 3300005341 | Bacteria | 945 |
| 25 | Ga0070687_101231344 | 3300005343 | Unclassified | 553 |
| 26 | Ga0070661_100086770 | 3300005344 | Bacteria | 2314 |
| 27 | Ga0070661_100259758 | 3300005344 | Unclassified | 1342 |
| 28 | Ga0070661_100952102 | 3300005344 | Bacteria | 710 |
| 29 | Ga0070671_100034613 | 3300005355 | Bacteria | 4182 |
| 30 | Ga0070659_100846421 | 3300005366 | Unclassified | 797 |
| 31 | Ga0070659_100857674 | 3300005366 | Unclassified | 792 |
| 32 | Ga0070709_10008335 | 3300005434 | Bacteria | 5691 |
| 33 | Ga0070709_10067769 | 3300005434 | Bacteria | 2293 |
| 34 | Ga0070709_10078187 | 3300005434 | Bacteria | 2152 |
| 35 | Ga0070709_10090319 | 3300005434 | Bacteria | 2019 |
| 36 | Ga0070709_10463584 | 3300005434 | Unclassified | 956 |
| 37 | Ga0070709_11766686 | 3300005434 | Unclassified | 506 |
| 38 | Ga0070714_100002904 | 3300005435 | Bacteria | 12681 |
| 39 | Ga0070714_100049516 | 3300005435 | Bacteria | 3576 |
| 40 | Ga0070714_100071577 | 3300005435 | Bacteria | 2999 |
| 41 | Ga0070714_100092539 | 3300005435 | Bacteria | 2650 |
| 42 | Ga0070714_100094496 | 3300005435 | Bacteria | 2624 |
| 43 | Ga0070714_100112726 | 3300005435 | Bacteria | 2410 |
| 44 | Ga0070714_100215384 | 3300005435 | Bacteria | 1763 |
| 45 | Ga0070714_100218997 | 3300005435 | Unclassified | 1749 |
| 46 | Ga0070714_100431830 | 3300005435 | Bacteria | 1249 |
| 47 | Ga0070714_100471587 | 3300005435 | Bacteria | 1194 |
| 48 | Ga0070714_101529976 | 3300005435 | Bacteria | 652 |
| 49 | Ga0070714_101842380 | 3300005435 | Unclassified | 591 |
| 50 | Ga0070713_100000801 | 3300005436 | Bacteria | 20125 |
| 51 | Ga0070713_100024783 | 3300005436 | Bacteria | 4680 |
| 52 | Ga0070713_100518532 | 3300005436 | Unclassified | 1126 |
| 53 | Ga0070710_10009224 | 3300005437 | Bacteria | 4822 |
| 54 | Ga0070710_10025527 | 3300005437 | Bacteria | 3130 |
| 55 | Ga0070710_10448744 | 3300005437 | Unclassified | 874 |
| 56 | Ga0070710_10512121 | 3300005437 | Bacteria | 823 |
| 57 | Ga0070710_10890300 | 3300005437 | Bacteria | 642 |
| 58 | Ga0070711_100002572 | 3300005439 | Bacteria | 10383 |
| 59 | Ga0070711_100053954 | 3300005439 | Bacteria | 2772 |
| 60 | Ga0070711_100060945 | 3300005439 | Bacteria | 2625 |
| 61 | Ga0070711_100926352 | 3300005439 | Bacteria | 745 |
| 62 | Ga0070711_101064732 | 3300005439 | Bacteria | 696 |
| 63 | Ga0070694_100247988 | 3300005444 | Bacteria | 1346 |
| 64 | Ga0070694_100266842 | 3300005444 | Bacteria | 1300 |
| 65 | Ga0070708_100635391 | 3300005445 | Bacteria | 1006 |
| 66 | Ga0070663_101443352 | 3300005455 | Bacteria | 610 |
| 67 | Ga0070681_10046923 | 3300005458 | Bacteria | 4319 |
| 68 | Ga0070681_10071171 | 3300005458 | Bacteria | 3442 |
| 69 | Ga0070681_10082518 | 3300005458 | Bacteria | 3170 |
| 70 | Ga0070681_10152629 | 3300005458 | Bacteria | 2236 |
| 71 | Ga0070681_10190835 | 3300005458 | Bacteria | 1968 |
| 72 | Ga0070681_10211448 | 3300005458 | Bacteria | 1856 |
| 73 | Ga0070681_10226054 | 3300005458 | Bacteria | 1786 |
| 74 | Ga0070681_10227477 | 3300005458 | Bacteria | 1780 |
| 75 | Ga0070681_10243805 | 3300005458 | Bacteria | 1710 |
| 76 | Ga0070706_100718497 | 3300005467 | Unclassified | 926 |
| 77 | Ga0070706_101700403 | 3300005467 | Bacteria | 575 |
| 78 | Ga0070707_100022323 | 3300005468 | Bacteria | 5982 |
| 79 | Ga0070707_100035404 | 3300005468 | Bacteria | 4762 |
| 80 | Ga0070707_100243368 | 3300005468 | Bacteria | 1751 |
| 81 | Ga0070707_100880331 | 3300005468 | Unclassified | 860 |
| 82 | Ga0070698_100041252 | 3300005471 | Bacteria | 4738 |
| 83 | Ga0070698_100049309 | 3300005471 | Bacteria | 4298 |
| 84 | Ga0070698_100133400 | 3300005471 | Bacteria | 2438 |
| 85 | Ga0070698_100366155 | 3300005471 | Bacteria | 1373 |
| 86 | Ga0070699_100218255 | 3300005518 | Bacteria | 1699 |
| 87 | Ga0070699_100274647 | 3300005518 | Bacteria | 1509 |
| 88 | Ga0070699_100437513 | 3300005518 | Bacteria | 1185 |
| 89 | Ga0070679_100012002 | 3300005530 | Bacteria | 8268 |
| 90 | Ga0070679_100031188 | 3300005530 | Bacteria | 5265 |
| 91 | Ga0070679_100091661 | 3300005530 | Bacteria | 3027 |
| 92 | Ga0070679_100179570 | 3300005530 | Bacteria | 2089 |
| 93 | Ga0070679_100230258 | 3300005530 | Bacteria | 1813 |
| 94 | Ga0070679_100332401 | 3300005530 | Bacteria | 1468 |
| 95 | Ga0070679_100399888 | 3300005530 | Bacteria | 1320 |
| 96 | Ga0070684_100008210 | 3300005535 | Bacteria | 8157 |
| 97 | Ga0070684_100071994 | 3300005535 | Bacteria | 3042 |
| 98 | Ga0070684_101479769 | 3300005535 | Bacteria | 640 |
| 99 | Ga0070695_100000265 | 3300005545 | Bacteria | 26294 |
| 100 | Ga0070696_100815919 | 3300005546 | Unclassified | 769 |
| 101 | Ga0070693_100409806 | 3300005547 | Bacteria | 942 |
| 102 | Ga0070704_100109343 | 3300005549 | Unclassified | 2100 |
| 103 | Ga0068855_100006484 | 3300005563 | Bacteria | 14232 |
| 104 | Ga0068855_100409946 | 3300005563 | Bacteria | 1484 |
| 105 | Ga0068855_100818834 | 3300005563 | Bacteria | 988 |
| 106 | Ga0068855_100947419 | 3300005563 | Unclassified | 907 |
| 107 | Ga0070664_101171552 | 3300005564 | Bacteria | 725 |
| 108 | Ga0068857_100199718 | 3300005577 | Bacteria | 1823 |
| 109 | Ga0068857_101844116 | 3300005577 | Bacteria | 592 |
| 110 | Ga0068856_100098406 | 3300005614 | Bacteria | 2915 |
| 111 | Ga0068856_100115279 | 3300005614 | Bacteria | 2686 |
| 112 | Ga0068856_100427551 | 3300005614 | Unclassified | 1344 |
| 113 | Ga0068856_100497399 | 3300005614 | Bacteria | 1240 |
| 114 | Ga0068856_101493298 | 3300005614 | Bacteria | 690 |
| 115 | Ga0070702_100050938 | 3300005615 | Bacteria | 2368 |
| 116 | Ga0068852_100242824 | 3300005616 | Unclassified | 1722 |
| 117 | Ga0068852_101119958 | 3300005616 | Bacteria | 807 |
| 118 | Ga0068852_101257571 | 3300005616 | Bacteria | 762 |
| 119 | Ga0068858_100683461 | 3300005842 | Bacteria | 998 |
| 120 | Ga0068860_101767756 | 3300005843 | Bacteria | 640 |
| 121 | Ga0070717_10007082 | 3300006028 | Bacteria | 8307 |
| 122 | Ga0070717_10013600 | 3300006028 | Bacteria | 6243 |
| 123 | Ga0070717_10031923 | 3300006028 | Bacteria | 4240 |
| 124 | Ga0070717_10049217 | 3300006028 | Bacteria | 3459 |
| 125 | Ga0070717_10176291 | 3300006028 | Bacteria | 1861 |
| 126 | Ga0070717_10426752 | 3300006028 | Bacteria | 1193 |
| 127 | Ga0070717_10477044 | 3300006028 | Bacteria | 1126 |
| 128 | Ga0070717_10680881 | 3300006028 | Bacteria | 934 |
| 129 | Ga0070717_10919315 | 3300006028 | Unclassified | 797 |
| 130 | Ga0075365_10849160 | 3300006038 | Unclassified | 644 |
| 131 | Ga0070715_10005269 | 3300006163 | Bacteria | 4300 |
| 132 | Ga0070716_100003859 | 3300006173 | Bacteria | 7114 |
| 133 | Ga0070716_100018111 | 3300006173 | Bacteria | 3664 |
| 134 | Ga0070716_100020120 | 3300006173 | Bacteria | 3500 |
| 135 | Ga0070716_100210958 | 3300006173 | Bacteria | 1298 |
| 136 | Ga0070716_100436688 | 3300006173 | Bacteria | 951 |
| 137 | Ga0070716_101581982 | 3300006173 | Unclassified | 538 |
| 138 | Ga0070712_100028000 | 3300006175 | Bacteria | 3766 |
| 139 | Ga0070712_100058473 | 3300006175 | Bacteria | 2712 |
| 140 | Ga0070712_100253298 | 3300006175 | Unclassified | 1408 |
| 141 | Ga0070712_100445355 | 3300006175 | Bacteria | 1077 |
| 142 | Ga0070712_100837485 | 3300006175 | Bacteria | 791 |
| 143 | Ga0070712_101081141 | 3300006175 | Bacteria | 696 |
| 144 | Ga0075433_10324794 | 3300006852 | Unclassified | 1361 |
| 145 | Ga0075433_10430070 | 3300006852 | Bacteria | 1164 |
| 146 | Ga0075433_10493077 | 3300006852 | Bacteria | 1079 |
| 147 | Ga0075434_100013210 | 3300006871 | Bacteria | 7847 |
| 148 | Ga0068865_100417737 | 3300006881 | Bacteria | 1102 |
| 149 | Ga0075436_100167210 | 3300006914 | Bacteria | 1552 |
| 150 | Ga0075436_101282923 | 3300006914 | Bacteria | 554 |
| 151 | Ga0075435_100725352 | 3300007076 | Unclassified | 864 |
| 152 | Ga0075435_101357572 | 3300007076 | Archaea | 623 |
| 153 | Ga0099795_10454618 | 3300007788 | Unclassified | 590 |
| 154 | Ga0105240_10037102 | 3300009093 | Bacteria | 6265 |
| 155 | Ga0105240_10058261 | 3300009093 | Bacteria | 4822 |
| 156 | Ga0105240_10640569 | 3300009093 | Unclassified | 1166 |
| 157 | Ga0105240_10808587 | 3300009093 | Unclassified | 1015 |
| 158 | Ga0105240_11669978 | 3300009093 | Bacteria | 665 |
| 159 | Ga0111539_11408433 | 3300009094 | Unclassified | 809 |
| 160 | Ga0105245_10173604 | 3300009098 | Bacteria | 2054 |
| 161 | Ga0105245_10496423 | 3300009098 | Bacteria | 1236 |
| 162 | Ga0105245_11460550 | 3300009098 | Bacteria | 734 |
| 163 | Ga0105247_10055600 | 3300009101 | Bacteria | 2442 |
| 164 | Ga0114129_11629417 | 3300009147 | Unclassified | 789 |
| 165 | Ga0105242_10433116 | 3300009176 | Bacteria | 1235 |
| 166 | Ga0105242_10525862 | 3300009176 | Bacteria | 1129 |
| 167 | Ga0105242_11776964 | 3300009176 | Bacteria | 654 |
| 168 | Ga0105248_10493375 | 3300009177 | Bacteria | 1380 |
| 169 | Ga0105248_10780279 | 3300009177 | Bacteria | 1078 |
| 170 | Ga0105248_10806199 | 3300009177 | Bacteria | 1060 |
| 171 | Ga0105237_10039879 | 3300009545 | Bacteria | 4738 |
| 172 | Ga0105237_12118390 | 3300009545 | Unclassified | 571 |
| 173 | Ga0105237_12284450 | 3300009545 | Unclassified | 551 |
| 174 | Ga0105238_10035269 | 3300009551 | Bacteria | 5086 |
| 175 | Ga0105238_11299361 | 3300009551 | Unclassified | 753 |
| 176 | Ga0105238_11756639 | 3300009551 | Bacteria | 652 |
| 177 | Ga0099796_10360770 | 3300010159 | Bacteria | 629 |
| 178 | Ga0105239_10125430 | 3300010375 | Bacteria | 2853 |
| 179 | Ga0105239_10606228 | 3300010375 | Unclassified | 1249 |
| 180 | Ga0157373_10141834 | 3300013100 | Bacteria | 1690 |
| 181 | Ga0157373_10208399 | 3300013100 | Bacteria | 1378 |
| 182 | Ga0157373_10608029 | 3300013100 | Bacteria | 796 |
| 183 | Ga0157371_10144028 | 3300013102 | Bacteria | 1698 |
| 184 | Ga0157371_10569547 | 3300013102 | Bacteria | 841 |
| 185 | Ga0157370_10009353 | 3300013104 | Bacteria | 10485 |
| 186 | Ga0157370_10017077 | 3300013104 | Bacteria | 7331 |
| 187 | Ga0157370_10141323 | 3300013104 | Bacteria | 2243 |
| 188 | Ga0157370_10530462 | 3300013104 | Unclassified | 1080 |
| 189 | Ga0157370_10605538 | 3300013104 | Unclassified | 1003 |
| 190 | Ga0157370_11335105 | 3300013104 | Unclassified | 646 |
| 191 | Ga0157370_11389367 | 3300013104 | Bacteria | 632 |
| 192 | Ga0157370_11804151 | 3300013104 | Unclassified | 549 |
| 193 | Ga0157370_11812284 | 3300013104 | Unclassified | 548 |
| 194 | Ga0157369_10001145 | 3300013105 | Bacteria | 33059 |
| 195 | Ga0157369_10019029 | 3300013105 | Bacteria | 7689 |
| 196 | Ga0157369_10040236 | 3300013105 | Bacteria | 5104 |
| 197 | Ga0157369_10416301 | 3300013105 | Bacteria | 1393 |
| 198 | Ga0157369_10586687 | 3300013105 | Bacteria | 1151 |
| 199 | Ga0157369_11171477 | 3300013105 | Bacteria | 785 |
| 200 | Ga0157369_11246815 | 3300013105 | Bacteria | 758 |
| 201 | Ga0157374_10120956 | 3300013296 | Bacteria | 2527 |
| 202 | Ga0157374_10139452 | 3300013296 | Bacteria | 2353 |
| 203 | Ga0157374_10882096 | 3300013296 | Bacteria | 912 |
| 204 | Ga0157378_11129856 | 3300013297 | Bacteria | 821 |
| 205 | Ga0163162_10245382 | 3300013306 | Bacteria | 1923 |
| 206 | Ga0157372_10095372 | 3300013307 | Bacteria | 3389 |
| 207 | Ga0157372_10219081 | 3300013307 | Bacteria | 2206 |
| 208 | Ga0157372_10458840 | 3300013307 | Bacteria | 1485 |
| 209 | Ga0157372_10560087 | 3300013307 | Bacteria | 1332 |
| 210 | Ga0157372_10917960 | 3300013307 | Bacteria | 1015 |
| 211 | Ga0157372_10990852 | 3300013307 | Bacteria | 973 |
| 212 | Ga0157372_11772468 | 3300013307 | Unclassified | 710 |
| 213 | Ga0157372_12066558 | 3300013307 | Unclassified | 655 |
| 214 | Ga0157372_13230627 | 3300013307 | Bacteria | 520 |
| 215 | Ga0157375_10327714 | 3300013308 | Bacteria | 1696 |
| 216 | Ga0163163_12825034 | 3300014325 | Unclassified | 542 |
| 217 | Ga0182008_10016723 | 3300014497 | Bacteria | 3806 |
| 218 | Ga0182008_10099413 | 3300014497 | Bacteria | 1437 |
| 219 | Ga0182008_10246628 | 3300014497 | Bacteria | 920 |
| 220 | Ga0182008_10523615 | 3300014497 | Bacteria | 655 |
| 221 | Ga0182008_10584864 | 3300014497 | Bacteria | 624 |
| 222 | Ga0182008_10882034 | 3300014497 | Bacteria | 525 |
| 223 | Ga0157379_10191763 | 3300014968 | Unclassified | 1847 |
| 224 | Ga0157376_10017404 | 3300014969 | Bacteria | 5482 |
| 225 | Ga0157376_11582992 | 3300014969 | Unclassified | 689 |
| 226 | Ga0157376_12130055 | 3300014969 | Unclassified | 599 |
| 227 | Ga0182006_1016295 | 3300015261 | Bacteria | 3171 |
| 228 | Ga0182007_10018540 | 3300015262 | Bacteria | 2519 |
| 229 | Ga0206356_10582850 | 3300020070 | Bacteria | 641 |
| 230 | Ga0206356_11584572 | 3300020070 | Bacteria | 1564 |
| 231 | Ga0206349_1467851 | 3300020075 | Unclassified | 666 |
| 232 | Ga0206354_10451936 | 3300020081 | Bacteria | 3526 |
| 233 | Ga0206354_10531976 | 3300020081 | Unclassified | 1148 |
| 234 | Ga0206354_11239232 | 3300020081 | Bacteria | 879 |
| 235 | Ga0206353_10289596 | 3300020082 | Bacteria | 1256 |
| 236 | Ga0206353_11314291 | 3300020082 | Bacteria | 763 |
| 237 | Ga0206353_12040664 | 3300020082 | Bacteria | 5700 |
| 238 | Ga0213874_10046469 | 3300021377 | Bacteria | 1318 |
| 239 | Ga0213876_10487114 | 3300021384 | Bacteria | 656 |
| 240 | Ga0213871_10030518 | 3300021441 | Bacteria | 1403 |
| 241 | Ga0224712_10655245 | 3300022467 | Bacteria | 515 |
| 242 | Ga0207692_10023816 | 3300025898 | Bacteria | 2837 |
| 243 | Ga0207692_10037256 | 3300025898 | Bacteria | 2378 |
| 244 | Ga0207692_10330626 | 3300025898 | Unclassified | 935 |
| 245 | Ga0207692_11084736 | 3300025898 | Bacteria | 530 |
| 246 | Ga0207710_10062626 | 3300025900 | Unclassified | 1691 |
| 247 | Ga0207647_10590702 | 3300025904 | Bacteria | 613 |
| 248 | Ga0207685_10001113 | 3300025905 | Bacteria | 5343 |
| 249 | Ga0207699_10026168 | 3300025906 | Bacteria | 3212 |
| 250 | Ga0207699_10045831 | 3300025906 | Bacteria | 2554 |
| 251 | Ga0207699_10046097 | 3300025906 | Bacteria | 2548 |
| 252 | Ga0207699_10057762 | 3300025906 | Bacteria | 2318 |
| 253 | Ga0207699_10068842 | 3300025906 | Bacteria | 2156 |
| 254 | Ga0207699_10069126 | 3300025906 | Bacteria | 2152 |
| 255 | Ga0207705_10017947 | 3300025909 | Bacteria | 5061 |
| 256 | Ga0207705_10065177 | 3300025909 | Bacteria | 2633 |
| 257 | Ga0207705_10067247 | 3300025909 | Bacteria | 2593 |
| 258 | Ga0207705_10203568 | 3300025909 | Bacteria | 1500 |
| 259 | Ga0207705_10238310 | 3300025909 | Bacteria | 1385 |
| 260 | Ga0207684_10828969 | 3300025910 | Unclassified | 781 |
| 261 | Ga0207707_10024218 | 3300025912 | Bacteria | 5311 |
| 262 | Ga0207707_10025872 | 3300025912 | Bacteria | 5132 |
| 263 | Ga0207707_10095478 | 3300025912 | Bacteria | 2598 |
| 264 | Ga0207707_10112571 | 3300025912 | Bacteria | 2379 |
| 265 | Ga0207707_10190270 | 3300025912 | Bacteria | 1790 |
| 266 | Ga0207707_10231095 | 3300025912 | Bacteria | 1609 |
| 267 | Ga0207707_10290210 | 3300025912 | Bacteria | 1415 |
| 268 | Ga0207695_10225920 | 3300025913 | Bacteria | 1778 |
| 269 | Ga0207695_10277597 | 3300025913 | Bacteria | 1570 |
| 270 | Ga0207695_10667101 | 3300025913 | Bacteria | 921 |
| 271 | Ga0207671_10190994 | 3300025914 | Bacteria | 1597 |
| 272 | Ga0207693_10000814 | 3300025915 | Bacteria | 27803 |
| 273 | Ga0207693_10000920 | 3300025915 | Bacteria | 26422 |
| 274 | Ga0207693_10065202 | 3300025915 | Bacteria | 2853 |
| 275 | Ga0207693_10259586 | 3300025915 | Bacteria | 1363 |
| 276 | Ga0207693_10283420 | 3300025915 | Bacteria | 1298 |
| 277 | Ga0207693_10395283 | 3300025915 | Bacteria | 1081 |
| 278 | Ga0207693_10770359 | 3300025915 | Bacteria | 743 |
| 279 | Ga0207663_10015847 | 3300025916 | Bacteria | 4168 |
| 280 | Ga0207663_10096802 | 3300025916 | Unclassified | 1972 |
| 281 | Ga0207663_10699025 | 3300025916 | Bacteria | 803 |
| 282 | Ga0207663_10772227 | 3300025916 | Bacteria | 764 |
| 283 | Ga0207663_11134982 | 3300025916 | Bacteria | 629 |
| 284 | Ga0207660_10019550 | 3300025917 | Bacteria | 4528 |
| 285 | Ga0207660_10083143 | 3300025917 | Bacteria | 2357 |
| 286 | Ga0207660_10309987 | 3300025917 | Bacteria | 1258 |
| 287 | Ga0207660_10527571 | 3300025917 | Bacteria | 959 |
| 288 | Ga0207662_10435502 | 3300025918 | Bacteria | 894 |
| 289 | Ga0207657_10003170 | 3300025919 | Bacteria | 17601 |
| 290 | Ga0207657_10008838 | 3300025919 | Bacteria | 10190 |
| 291 | Ga0207657_10014486 | 3300025919 | Bacteria | 7695 |
| 292 | Ga0207657_10026169 | 3300025919 | Bacteria | 5367 |
| 293 | Ga0207649_10030184 | 3300025920 | Bacteria | 3208 |
| 294 | Ga0207649_10030419 | 3300025920 | Unclassified | 3198 |
| 295 | Ga0207649_10142378 | 3300025920 | Unclassified | 1642 |
| 296 | Ga0207649_10205547 | 3300025920 | Unclassified | 1394 |
| 297 | Ga0207649_10547393 | 3300025920 | Unclassified | 885 |
| 298 | Ga0207652_10011197 | 3300025921 | Bacteria | 7226 |
| 299 | Ga0207652_10071202 | 3300025921 | Bacteria | 3021 |
| 300 | Ga0207652_10109179 | 3300025921 | Bacteria | 2452 |
| 301 | Ga0207652_10176255 | 3300025921 | Unclassified | 1920 |
| 302 | Ga0207652_10183542 | 3300025921 | Bacteria | 1881 |
| 303 | Ga0207652_10213223 | 3300025921 | Bacteria | 1739 |
| 304 | Ga0207652_10418300 | 3300025921 | Bacteria | 1209 |
| 305 | Ga0207652_10571169 | 3300025921 | Bacteria | 1015 |
| 306 | Ga0207652_10844137 | 3300025921 | Bacteria | 811 |
| 307 | Ga0207652_11576738 | 3300025921 | Unclassified | 561 |
| 308 | Ga0207646_10001386 | 3300025922 | Bacteria | 30019 |
| 309 | Ga0207646_10035040 | 3300025922 | Bacteria | 4536 |
| 310 | Ga0207646_10617919 | 3300025922 | Bacteria | 972 |
| 311 | Ga0207646_10783520 | 3300025922 | Unclassified | 850 |
| 312 | Ga0207687_10241320 | 3300025927 | Bacteria | 1432 |
| 313 | Ga0207700_10000006 | 3300025928 | Bacteria | 348187 |
| 314 | Ga0207700_10026419 | 3300025928 | Bacteria | 4047 |
| 315 | Ga0207700_10194226 | 3300025928 | Bacteria | 1707 |
| 316 | Ga0207700_10560598 | 3300025928 | Unclassified | 1015 |
| 317 | Ga0207700_11184650 | 3300025928 | Bacteria | 682 |
| 318 | Ga0207664_10001397 | 3300025929 | Bacteria | 15865 |
| 319 | Ga0207664_10003898 | 3300025929 | Bacteria | 10020 |
| 320 | Ga0207664_10017802 | 3300025929 | Bacteria | 5220 |
| 321 | Ga0207664_10018691 | 3300025929 | Bacteria | 5109 |
| 322 | Ga0207664_10032295 | 3300025929 | Bacteria | 4011 |
| 323 | Ga0207664_10035157 | 3300025929 | Bacteria | 3864 |
| 324 | Ga0207664_10054343 | 3300025929 | Bacteria | 3173 |
| 325 | Ga0207664_10190644 | 3300025929 | Bacteria | 1764 |
| 326 | Ga0207664_10200363 | 3300025929 | Bacteria | 1723 |
| 327 | Ga0207664_10207285 | 3300025929 | Bacteria | 1695 |
| 328 | Ga0207664_10233746 | 3300025929 | Unclassified | 1598 |
| 329 | Ga0207664_10458001 | 3300025929 | Bacteria | 1139 |
| 330 | Ga0207664_10707705 | 3300025929 | Bacteria | 906 |
| 331 | Ga0207664_11021426 | 3300025929 | Bacteria | 741 |
| 332 | Ga0207664_11366455 | 3300025929 | Bacteria | 629 |
| 333 | Ga0207664_11422224 | 3300025929 | Bacteria | 614 |
| 334 | Ga0207664_11479422 | 3300025929 | Bacteria | 601 |
| 335 | Ga0207644_10083224 | 3300025931 | Bacteria | 2369 |
| 336 | Ga0207644_10386778 | 3300025931 | Unclassified | 1142 |
| 337 | Ga0207690_10251900 | 3300025932 | Unclassified | 1364 |
| 338 | Ga0207690_11346899 | 3300025932 | Bacteria | 597 |
| 339 | Ga0207690_11811886 | 3300025932 | Bacteria | 510 |
| 340 | Ga0207690_11837553 | 3300025932 | Unclassified | 506 |
| 341 | Ga0207686_10536237 | 3300025934 | Bacteria | 913 |
| 342 | Ga0207686_11233929 | 3300025934 | Bacteria | 613 |
| 343 | Ga0207704_10421870 | 3300025938 | Bacteria | 1058 |
| 344 | Ga0207665_10000247 | 3300025939 | Bacteria | 37247 |
| 345 | Ga0207665_10005520 | 3300025939 | Bacteria | 8434 |
| 346 | Ga0207665_10075321 | 3300025939 | Bacteria | 2311 |
| 347 | Ga0207665_10360193 | 3300025939 | Bacteria | 1100 |
| 348 | Ga0207665_10551896 | 3300025939 | Bacteria | 895 |
| 349 | Ga0207665_11381714 | 3300025939 | Unclassified | 561 |
| 350 | Ga0207711_10280780 | 3300025941 | Bacteria | 1534 |
| 351 | Ga0207711_10429780 | 3300025941 | Unclassified | 1229 |
| 352 | Ga0207711_10464403 | 3300025941 | Bacteria | 1179 |
| 353 | Ga0207711_10964423 | 3300025941 | Bacteria | 792 |
| 354 | Ga0207661_10025875 | 3300025944 | Bacteria | 4465 |
| 355 | Ga0207661_10033486 | 3300025944 | Bacteria | 3989 |
| 356 | Ga0207661_10266862 | 3300025944 | Bacteria | 1526 |
| 357 | Ga0207679_10479241 | 3300025945 | Unclassified | 1107 |
| 358 | Ga0207667_10182073 | 3300025949 | Bacteria | 2157 |
| 359 | Ga0207667_10460936 | 3300025949 | Bacteria | 1291 |
| 360 | Ga0207667_10700870 | 3300025949 | Bacteria | 1015 |
| 361 | Ga0207640_10090763 | 3300025981 | Bacteria | 2115 |
| 362 | Ga0207677_11062385 | 3300026023 | Bacteria | 736 |
| 363 | Ga0207639_12297231 | 3300026041 | Unclassified | 501 |
| 364 | Ga0207678_11260407 | 3300026067 | Bacteria | 654 |
| 365 | Ga0207678_11271975 | 3300026067 | Bacteria | 651 |
| 366 | Ga0207702_10088815 | 3300026078 | Bacteria | 2701 |
| 367 | Ga0207702_10189089 | 3300026078 | Bacteria | 1901 |
| 368 | Ga0207702_10669249 | 3300026078 | Bacteria | 1022 |
| 369 | Ga0207702_11085766 | 3300026078 | Unclassified | 794 |
| 370 | Ga0207702_11244060 | 3300026078 | Bacteria | 739 |
| 371 | Ga0207641_10290913 | 3300026088 | Bacteria | 1540 |
| 372 | Ga0207674_10124716 | 3300026116 | Bacteria | 2541 |
| 373 | Ga0207683_10147298 | 3300026121 | Bacteria | 2124 |
| 374 | Ga0207698_10248799 | 3300026142 | Unclassified | 1625 |
| 375 | Ga0207698_10503608 | 3300026142 | Bacteria | 1179 |
| 376 | Ga0265337_1016990 | 3300028556 | Bacteria | 2342 |
| 377 | Ga0265326_10049203 | 3300028558 | Bacteria | 1194 |
| 378 | Ga0265319_1007813 | 3300028563 | Bacteria | 4757 |
| 379 | Ga0265319_1022703 | 3300028563 | Bacteria | 2281 |
| 380 | Ga0265319_1025818 | 3300028563 | Bacteria | 2099 |
| 381 | Ga0265319_1187408 | 3300028563 | Bacteria | 636 |
| 382 | Ga0265334_10009412 | 3300028573 | Bacteria | 4132 |
| 383 | Ga0265334_10059590 | 3300028573 | Bacteria | 1442 |
| 384 | Ga0265334_10075215 | 3300028573 | Bacteria | 1252 |
| 385 | Ga0265334_10248913 | 3300028573 | Unclassified | 612 |
| 386 | Ga0265318_10000788 | 3300028577 | Bacteria | 21011 |
| 387 | Ga0265318_10029227 | 3300028577 | Bacteria | 2150 |
| 388 | Ga0265318_10038532 | 3300028577 | Bacteria | 1827 |
| 389 | Ga0265318_10077287 | 3300028577 | Bacteria | 1231 |
| 390 | Ga0265322_10012790 | 3300028654 | Bacteria | 2430 |
| 391 | Ga0265322_10044206 | 3300028654 | Bacteria | 1268 |
| 392 | Ga0265322_10048347 | 3300028654 | Bacteria | 1209 |
| 393 | Ga0265336_10001699 | 3300028666 | Bacteria | 9698 |
| 394 | Ga0265336_10037811 | 3300028666 | Bacteria | 1483 |
| 395 | Ga0265336_10054715 | 3300028666 | Bacteria | 1201 |
| 396 | Ga0265336_10101403 | 3300028666 | Bacteria | 858 |
| 397 | Ga0265338_10002456 | 3300028800 | Bacteria | 27727 |
| 398 | Ga0265338_10003688 | 3300028800 | Bacteria | 21332 |
| 399 | Ga0265338_10011083 | 3300028800 | Bacteria | 10457 |
| 400 | Ga0265338_10027009 | 3300028800 | Bacteria | 5772 |
| 401 | Ga0265338_10042058 | 3300028800 | Bacteria | 4262 |
| 402 | Ga0265338_10072190 | 3300028800 | Bacteria | 2948 |
| 403 | Ga0265338_10083009 | 3300028800 | Bacteria | 2681 |
| 404 | Ga0265338_10113409 | 3300028800 | Bacteria | 2177 |
| 405 | Ga0265338_10195867 | 3300028800 | Unclassified | 1527 |
| 406 | Ga0265324_10083740 | 3300029957 | Bacteria | 1085 |
| 407 | Ga0265330_10000672 | 3300031235 | Bacteria | 21962 |
| 408 | Ga0265330_10004373 | 3300031235 | Bacteria | 7174 |
| 409 | Ga0265330_10094669 | 3300031235 | Unclassified | 1281 |
| 410 | Ga0265332_10018992 | 3300031238 | Bacteria | 3034 |
| 411 | Ga0265332_10057099 | 3300031238 | Bacteria | 1673 |
| 412 | Ga0265332_10374389 | 3300031238 | Bacteria | 588 |
| 413 | Ga0265332_10383295 | 3300031238 | Bacteria | 581 |
| 414 | Ga0265328_10012489 | 3300031239 | Bacteria | 3379 |
| 415 | Ga0265328_10068228 | 3300031239 | Bacteria | 1306 |
| 416 | Ga0265320_10014307 | 3300031240 | Bacteria | 4522 |
| 417 | Ga0265320_10099056 | 3300031240 | Bacteria | 1343 |
| 418 | Ga0265320_10169979 | 3300031240 | Unclassified | 979 |
| 419 | Ga0265325_10020864 | 3300031241 | Bacteria | 3606 |
| 420 | Ga0265325_10045429 | 3300031241 | Bacteria | 2282 |
| 421 | Ga0265325_10060819 | 3300031241 | Bacteria | 1917 |
| 422 | Ga0265325_10079377 | 3300031241 | Bacteria | 1633 |
| 423 | Ga0265329_10016823 | 3300031242 | Bacteria | 2528 |
| 424 | Ga0265329_10050423 | 3300031242 | Bacteria | 1326 |
| 425 | Ga0265340_10006639 | 3300031247 | Bacteria | 6346 |
| 426 | Ga0265340_10211349 | 3300031247 | Bacteria | 871 |
| 427 | Ga0265339_10014310 | 3300031249 | Bacteria | 4784 |
| 428 | Ga0265339_10175665 | 3300031249 | Bacteria | 1069 |
| 429 | Ga0265331_10008097 | 3300031250 | Bacteria | 6002 |
| 430 | Ga0265331_10030596 | 3300031250 | Bacteria | 2680 |
| 431 | Ga0265327_10006666 | 3300031251 | Bacteria | 9160 |
| 432 | Ga0265327_10063059 | 3300031251 | Bacteria | 1883 |
| 433 | Ga0265327_10081029 | 3300031251 | Bacteria | 1603 |
| 434 | Ga0265316_10025347 | 3300031344 | Bacteria | 4950 |
| 435 | Ga0265316_10068014 | 3300031344 | Bacteria | 2753 |
| 436 | Ga0265313_10010563 | 3300031595 | Bacteria | 5823 |
| 437 | Ga0265313_10028666 | 3300031595 | Bacteria | 2890 |
| 438 | Ga0265313_10030697 | 3300031595 | Bacteria | 2762 |
| 439 | Ga0265314_10007395 | 3300031711 | Bacteria | 9526 |
| 440 | Ga0265314_10093079 | 3300031711 | Bacteria | 1957 |
| 441 | Ga0265314_10098822 | 3300031711 | Bacteria | 1881 |
| 442 | Ga0265314_10104317 | 3300031711 | Unclassified | 1816 |
| 443 | Ga0265342_10011777 | 3300031712 | Bacteria | 5963 |
| 444 | Ga0265342_10019089 | 3300031712 | Bacteria | 4424 |
| 445 | Ga0265342_10210518 | 3300031712 | Bacteria | 1051 |
| 446 | Ga0265342_10240671 | 3300031712 | Unclassified | 969 |
| 447 | Ga0265342_10528442 | 3300031712 | Unclassified | 600 |
| 448 | Ga0307405_10093478 | 3300031731 | Bacteria | 1998 |
| 449 | Ga0307416_100246297 | 3300032002 | Bacteria | 1736 |
| 450 | Ga0307415_100305825 | 3300032126 | Bacteria | 1319 |
| 451 | Ga0373926_0012170 | 3300035083 | Bacteria | 2906 |
| 452 | Ga0373929_0198666 | 3300035085 | Bacteria | 561 |
| 453 | Ga0373934_0192213 | 3300035086 | Unclassified | 840 |
| 454 | Ga0373944_0136839 | 3300035089 | Bacteria | 855 |
| 455 | Ga0373949_0013045 | 3300035090 | Bacteria | 1842 |
| 456 | Ga0373951_0139555 | 3300035091 | Bacteria | 672 |
| 457 | Ga0373923_0601161 | 3300035111 | Bacteria | 542 |
| 458 | Ga0373936_0125929 | 3300035113 | Bacteria | 1098 |
| 459 | Ga0373945_0581142 | 3300035116 | Unclassified | 505 |
| 460 | Ga0373956_0463976 | 3300035119 | Bacteria | 604 |
| 461 | Ga0373957_0313898 | 3300035120 | Unclassified | 666 |
| 462 | Ga0373960_0292337 | 3300035121 | Unclassified | 604 |
| 463 | Ga0373943_0001012 | 3300035170 | Bacteria | 12501 |
| 464 | Ga0373943_0503745 | 3300035170 | Unclassified | 708 |
| 465 | Ga0373946_0063315 | 3300035171 | Bacteria | 1579 |
| 466 | Ga0373955_0035019 | 3300035172 | Unclassified | 2656 |
| 467 | Ga0373955_1019257 | 3300035172 | Bacteria | 510 |
| 468 | Ga0373961_0243972 | 3300035241 | Unclassified | 648 |
| 469 | Ga0373931_0010780 | 3300035691 | Bacteria | 4401 |
| 470 | Ga0373935_0047048 | 3300035692 | Bacteria | 2726 |
| 471 | Ga0373927_0049245 | 3300035695 | Bacteria | 2725 |
| 472 | Ga0373933_0048671 | 3300035724 | Bacteria | 2525 |
| 473 | Ga0373947_0001552 | 3300035725 | Bacteria | 14072 |
| 474 | Ga0373937_0000355 | 3300036401 | Bacteria | 42585 |
| 475 | Ga0373937_0317727 | 3300036401 | Bacteria | 1473 |
| 476 | Ga0373937_0379173 | 3300036401 | Bacteria | 1341 |
| 477 | Ga0373937_1483170 | 3300036401 | Unclassified | 626 |
| 478 | Ga0373937_1902801 | 3300036401 | Bacteria | 541 |
| 479 | Ga0373925_0007406 | 3300037068 | Bacteria | 8008 |
| 480 | Ga0395899_0080577 | 3300037312 | Bacteria | 2369 |
| 481 | Ga0395899_0102523 | 3300037312 | Bacteria | 2065 |
| 482 | Ga0395899_0143077 | 3300037312 | Bacteria | 1700 |
| 483 | Ga0395899_0573369 | 3300037312 | Bacteria | 722 |
| 484 | Ga0395900_0128055 | 3300037418 | Bacteria | 2603 |
| 485 | Ga0395900_0140283 | 3300037418 | Bacteria | 2475 |
| 486 | Ga0395900_0221277 | 3300037418 | Archaea | 1908 |
| 487 | Ga0395900_0388044 | 3300037418 | Bacteria | 1363 |
| 488 | Ga0395900_0658226 | 3300037418 | Bacteria | 983 |
| 489 | Ga0395900_0709558 | 3300037418 | Bacteria | 939 |
| 490 | Ga0395900_1448153 | 3300037418 | Bacteria | 599 |
| 491 | Ga0395898_0095120 | 3300037466 | Bacteria | 2862 |
| 492 | Ga0395898_0207769 | 3300037466 | Bacteria | 1868 |
| 493 | Ga0395898_0796814 | 3300037466 | Bacteria | 885 |
| 494 | Ga0395898_0904405 | 3300037466 | Bacteria | 821 |
| 495 | Ga0395898_0917966 | 3300037466 | Archaea | 813 |
| 496 | Ga0395898_0924804 | 3300037466 | Bacteria | 810 |
| 497 | Ga0395898_1457309 | 3300037466 | Unclassified | 611 |
| 498 | Ga0395905_0248304 | 3300037471 | Bacteria | 1662 |
| 499 | Ga0395905_1042955 | 3300037471 | Bacteria | 721 |
| 500 | Ga0395905_1048441 | 3300037471 | Bacteria | 718 |
| 501 | Ga0395905_1146403 | 3300037471 | Unclassified | 681 |
| 502 | Ga0395905_1557016 | 3300037471 | Unclassified | 566 |
| 503 | Ga0395901_0089797 | 3300038443 | Bacteria | 3215 |
| 504 | Ga0395901_0629307 | 3300038443 | Bacteria | 1079 |
| 505 | Ga0395901_0789678 | 3300038443 | Bacteria | 939 |
| 506 | Ga0395901_1088901 | 3300038443 | Bacteria | 770 |
| 507 | Ga0395901_1129757 | 3300038443 | Unclassified | 753 |
| 508 | Ga0395901_1273572 | 3300038443 | Bacteria | 698 |
| 509 | Ga0395901_1289827 | 3300038443 | Bacteria | 692 |
| 510 | Ga0436365_1260527 | 3300039437 | Bacteria | 708 |
| 511 | Ga0436360_0134583 | 3300039438 | Unclassified | 704 |
| 512 | Ga0436360_0249670 | 3300039438 | Bacteria | 2736 |
| 513 | Ga0436363_0296049 | 3300039450 | Bacteria | 1572 |
| 514 | Ga0439453_0002236 | 3300041408 | Bacteria | 2640 |
| 515 | Ga0439461_0033180 | 3300041410 | Bacteria | 1085 |
| 516 | Ga0451849_1048234 | 3300041505 | Unclassified | 1553 |
| 517 | Ga0451853_1958868 | 3300041512 | Unclassified | 640 |
| 518 | Ga0439445_0243414 | 3300042004 | Bacteria | 536 |
| 519 | Ga0439448_0047072 | 3300042005 | Bacteria | 1406 |
| 520 | Ga0439451_021447 | 3300042009 | Bacteria | 1303 |
| 521 | Ga0466969_0003223 | 3300044656 | Bacteria | 8681 |
| 522 | Ga0466969_0083616 | 3300044656 | Bacteria | 1520 |
| 523 | Ga0466969_0128896 | 3300044656 | Bacteria | 1174 |
| 524 | Ga0466969_0274891 | 3300044656 | Bacteria | 763 |
| 525 | Ga0466972_0569304 | 3300044658 | Unclassified | 535 |
| 526 | Ga0466965_0050616 | 3300044683 | Unclassified | 2060 |
| 527 | Ga0466965_0052097 | 3300044683 | Bacteria | 2032 |
| 528 | Ga0466965_0074998 | 3300044683 | Bacteria | 1705 |
| 529 | Ga0466965_0075882 | 3300044683 | Bacteria | 1696 |
| 530 | Ga0466965_0080484 | 3300044683 | Unclassified | 1646 |
| 531 | Ga0466965_0515727 | 3300044683 | Unclassified | 672 |
| 532 | Ga0466966_0017398 | 3300044684 | Bacteria | 4751 |
| 533 | Ga0466966_0085063 | 3300044684 | Bacteria | 1966 |
| 534 | Ga0466966_0086218 | 3300044684 | Bacteria | 1952 |
| 535 | Ga0466966_0090799 | 3300044684 | Bacteria | 1896 |
| 536 | Ga0466966_0254890 | 3300044684 | Bacteria | 1057 |
| 537 | Ga0466966_0319246 | 3300044684 | Bacteria | 933 |
| 538 | Ga0466966_0745912 | 3300044684 | Bacteria | 590 |
| 539 | Ga0466961_0005282 | 3300044693 | Bacteria | 8128 |
| 540 | Ga0466961_0008879 | 3300044693 | Bacteria | 6410 |
| 541 | Ga0466961_0027130 | 3300044693 | Bacteria | 3682 |
| 542 | Ga0466961_0079263 | 3300044693 | Bacteria | 2080 |
| 543 | Ga0466961_0106343 | 3300044693 | Unclassified | 1766 |
| 544 | Ga0466961_0133855 | 3300044693 | Bacteria | 1553 |
| 545 | Ga0466961_0418829 | 3300044693 | Bacteria | 812 |
| 546 | Ga0466963_0000010 | 3300044694 | Bacteria | 68690 |
| 547 | Ga0466963_0000649 | 3300044694 | Bacteria | 16741 |
| 548 | Ga0466963_0001770 | 3300044694 | Bacteria | 11779 |
| 549 | Ga0466963_0002000 | 3300044694 | Bacteria | 11192 |
| 550 | Ga0466963_0004407 | 3300044694 | Bacteria | 8176 |
| 551 | Ga0466963_0004464 | 3300044694 | Bacteria | 8139 |
| 552 | Ga0466963_0007182 | 3300044694 | Bacteria | 6641 |
| 553 | Ga0466963_0010186 | 3300044694 | Bacteria | 5684 |
| 554 | Ga0466963_0013797 | 3300044694 | Bacteria | 4973 |
| 555 | Ga0466963_0023343 | 3300044694 | Bacteria | 3926 |
| 556 | Ga0466963_0034779 | 3300044694 | Bacteria | 3280 |
| 557 | Ga0466963_0061633 | 3300044694 | Bacteria | 2508 |
| 558 | Ga0466963_0111563 | 3300044694 | Bacteria | 1877 |
| 559 | Ga0466963_0165855 | 3300044694 | Bacteria | 1538 |
| 560 | Ga0466963_0171253 | 3300044694 | Bacteria | 1514 |
| 561 | Ga0466963_0284073 | 3300044694 | Bacteria | 1163 |
| 562 | Ga0466963_0299326 | 3300044694 | Bacteria | 1131 |
| 563 | Ga0466963_0374982 | 3300044694 | Bacteria | 1003 |
| 564 | Ga0466963_0499035 | 3300044694 | Unclassified | 859 |
| 565 | Ga0466963_0808330 | 3300044694 | Bacteria | 661 |
| 566 | Ga0466963_0888203 | 3300044694 | Unclassified | 628 |
| 567 | Ga0466964_0000213 | 3300044706 | Bacteria | 16442 |
| 568 | Ga0466964_0008591 | 3300044706 | Bacteria | 3838 |
| 569 | Ga0466964_0023691 | 3300044706 | Bacteria | 2387 |
| 570 | Ga0466964_0031496 | 3300044706 | Unclassified | 2104 |
| 571 | Ga0466964_0031869 | 3300044706 | Bacteria | 2092 |
| 572 | Ga0466964_0039198 | 3300044706 | Bacteria | 1908 |
| 573 | Ga0466964_0051369 | 3300044706 | Bacteria | 1693 |
| 574 | Ga0466964_0100868 | 3300044706 | Bacteria | 1272 |
| 575 | Ga0466964_0132499 | 3300044706 | Bacteria | 1137 |
| 576 | Ga0466964_0167304 | 3300044706 | Bacteria | 1032 |
| 577 | Ga0466964_0207540 | 3300044706 | Bacteria | 944 |
| 578 | Ga0466964_0252216 | 3300044706 | Bacteria | 870 |
| 579 | Ga0466964_0348546 | 3300044706 | Unclassified | 760 |
| 580 | Ga0466964_0434408 | 3300044706 | Bacteria | 693 |
| 581 | Ga0466964_0438146 | 3300044706 | Unclassified | 690 |
| 582 | Ga0466964_0581351 | 3300044706 | Unclassified | 612 |
| 583 | Ga0466971_0004429 | 3300044719 | Bacteria | 6060 |
| 584 | Ga0466971_0006123 | 3300044719 | Bacteria | 5229 |
| 585 | Ga0466971_0010450 | 3300044719 | Bacteria | 4057 |
| 586 | Ga0466971_0034738 | 3300044719 | Bacteria | 2259 |
| 587 | Ga0466971_0094401 | 3300044719 | Bacteria | 1371 |
| 588 | Ga0466971_0295719 | 3300044719 | Bacteria | 777 |
| 589 | Ga0466968_0001937 | 3300044735 | Bacteria | 7503 |
| 590 | Ga0466968_0003137 | 3300044735 | Bacteria | 6099 |
| 591 | Ga0466968_0005017 | 3300044735 | Bacteria | 4960 |
| 592 | Ga0466968_0011205 | 3300044735 | Bacteria | 3494 |
| 593 | Ga0466968_0018981 | 3300044735 | Bacteria | 2762 |
| 594 | Ga0466968_0093842 | 3300044735 | Bacteria | 1333 |
| 595 | Ga0466968_0138895 | 3300044735 | Bacteria | 1110 |
| 596 | Ga0466970_0004127 | 3300044765 | Bacteria | 7141 |
| 597 | Ga0466970_0137134 | 3300044765 | Bacteria | 1346 |
| 598 | Ga0466970_0178128 | 3300044765 | Bacteria | 1179 |
| 599 | Ga0466970_0283130 | 3300044765 | Bacteria | 933 |
| 600 | Ga0466970_0724194 | 3300044765 | Bacteria | 581 |
| 601 | Ga0466957_0009295 | 3300044842 | Bacteria | 5608 |
| 602 | Ga0466957_0021958 | 3300044842 | Bacteria | 3764 |
| 603 | Ga0466957_0025441 | 3300044842 | Bacteria | 3508 |
| 604 | Ga0466957_0033272 | 3300044842 | Bacteria | 3092 |
| 605 | Ga0466957_0094799 | 3300044842 | Bacteria | 1874 |
| 606 | Ga0466957_0234214 | 3300044842 | Bacteria | 1216 |
| 607 | Ga0466957_0289971 | 3300044842 | Bacteria | 1097 |
| 608 | Ga0466957_0317661 | 3300044842 | Bacteria | 1050 |
| 609 | Ga0466957_0408286 | 3300044842 | Bacteria | 930 |
| 610 | Ga0466957_0459239 | 3300044842 | Bacteria | 878 |
| 611 | Ga0466957_1067989 | 3300044842 | Bacteria | 581 |
| 612 | Ga0466957_1135314 | 3300044842 | Bacteria | 564 |
| 613 | Ga0466957_1298025 | 3300044842 | Unclassified | 528 |
| 614 | Ga0466957_1433304 | 3300044842 | Bacteria | 503 |
| 615 | Ga0466960_0005761 | 3300044901 | Bacteria | 4931 |
| 616 | Ga0466960_0011815 | 3300044901 | Bacteria | 3668 |
| 617 | Ga0466960_0039338 | 3300044901 | Bacteria | 2230 |
| 618 | Ga0466960_0055310 | 3300044901 | Bacteria | 1930 |
| 619 | Ga0466960_0097033 | 3300044901 | Unclassified | 1512 |
| 620 | Ga0466960_0458479 | 3300044901 | Bacteria | 742 |
| 621 | Ga0466960_0471454 | 3300044901 | Unclassified | 732 |
| 622 | Ga0466960_0481040 | 3300044901 | Bacteria | 725 |
| 623 | Ga0466959_0003840 | 3300045049 | Bacteria | 9964 |
| 624 | Ga0466959_0009312 | 3300045049 | Bacteria | 6979 |
| 625 | Ga0466959_0032586 | 3300045049 | Bacteria | 3857 |
| 626 | Ga0466959_0050692 | 3300045049 | Bacteria | 3046 |
| 627 | Ga0466959_0068110 | 3300045049 | Bacteria | 2580 |
| 628 | Ga0466959_0596101 | 3300045049 | Bacteria | 743 |
| 629 | Ga0466959_0874037 | 3300045049 | Bacteria | 600 |
| 630 | Ga0451576_2700887 | 3300045051 | Unclassified | 505 |
| 631 | Ga0466958_0000431 | 3300045836 | Bacteria | 17350 |
| 632 | Ga0466958_0001425 | 3300045836 | Bacteria | 11326 |
| 633 | Ga0466958_0002150 | 3300045836 | Bacteria | 9809 |
| 634 | Ga0466958_0025195 | 3300045836 | Bacteria | 3505 |
| 635 | Ga0466958_0066615 | 3300045836 | Bacteria | 2199 |
| 636 | Ga0466958_0079309 | 3300045836 | Bacteria | 2019 |
| 637 | Ga0466958_0115347 | 3300045836 | Unclassified | 1678 |
| 638 | Ga0466958_0116169 | 3300045836 | Bacteria | 1672 |
| 639 | Ga0466958_0399438 | 3300045836 | Bacteria | 887 |
| 640 | Ga0466958_0409828 | 3300045836 | Bacteria | 875 |
| 641 | Ga0466958_0551108 | 3300045836 | Bacteria | 749 |
| 642 | Ga0466958_0642807 | 3300045836 | Bacteria | 690 |
| 643 | Ga0466958_0783635 | 3300045836 | Unclassified | 621 |
| 644 | Ga0466958_1069720 | 3300045836 | Unclassified | 526 |
| 645 | Ga0466967_0000332 | 3300045976 | Bacteria | 21635 |
| 646 | Ga0466967_0001331 | 3300045976 | Bacteria | 14150 |
| 647 | Ga0466967_0002063 | 3300045976 | Bacteria | 12278 |
| 648 | Ga0466967_0002354 | 3300045976 | Bacteria | 11698 |
| 649 | Ga0466967_0010334 | 3300045976 | Bacteria | 6995 |
| 650 | Ga0466967_0015409 | 3300045976 | Bacteria | 5990 |
| 651 | Ga0466967_0016719 | 3300045976 | Bacteria | 5796 |
| 652 | Ga0466967_0022864 | 3300045976 | Bacteria | 5111 |
| 653 | Ga0466967_0023774 | 3300045976 | Bacteria | 5027 |
| 654 | Ga0466967_0024167 | 3300045976 | Bacteria | 4992 |
| 655 | Ga0466967_0038072 | 3300045976 | Bacteria | 4122 |
| 656 | Ga0466967_0042311 | 3300045976 | Bacteria | 3935 |
| 657 | Ga0466967_0062915 | 3300045976 | Bacteria | 3295 |
| 658 | Ga0466967_0066290 | 3300045976 | Bacteria | 3216 |
| 659 | Ga0466967_0077443 | 3300045976 | Bacteria | 2993 |
| 660 | Ga0466967_0079621 | 3300045976 | Bacteria | 2954 |
| 661 | Ga0466967_0099263 | 3300045976 | Bacteria | 2659 |
| 662 | Ga0466967_0113945 | 3300045976 | Bacteria | 2488 |
| 663 | Ga0466967_0127686 | 3300045976 | Bacteria | 2357 |
| 664 | Ga0466967_0158743 | 3300045976 | Bacteria | 2121 |
| 665 | Ga0466967_0169342 | 3300045976 | Bacteria | 2054 |
| 666 | Ga0466967_0199979 | 3300045976 | Bacteria | 1892 |
| 667 | Ga0466967_0202306 | 3300045976 | Bacteria | 1881 |
| 668 | Ga0466967_0232813 | 3300045976 | Bacteria | 1754 |
| 669 | Ga0466967_0245079 | 3300045976 | Bacteria | 1710 |
| 670 | Ga0466967_0264260 | 3300045976 | Unclassified | 1647 |
| 671 | Ga0466967_0421752 | 3300045976 | Bacteria | 1301 |
| 672 | Ga0466967_0439108 | 3300045976 | Bacteria | 1274 |
| 673 | Ga0466967_0451495 | 3300045976 | Bacteria | 1256 |
| 674 | Ga0466967_0545234 | 3300045976 | Unclassified | 1141 |
| 675 | Ga0466967_0709865 | 3300045976 | Bacteria | 996 |
| 676 | Ga0466967_0718067 | 3300045976 | Bacteria | 990 |
| 677 | Ga0466967_1210509 | 3300045976 | Bacteria | 752 |
| 678 | Ga0495592_0000732 | 3300046454 | Bacteria | 22931 |
| 679 | Ga0495592_0004058 | 3300046454 | Bacteria | 10646 |
| 680 | Ga0495592_0080194 | 3300046454 | Bacteria | 2362 |
| 681 | Ga0495592_0158825 | 3300046454 | Bacteria | 1557 |
| 682 | Ga0495592_0387691 | 3300046454 | Bacteria | 888 |
| 683 | Ga0495592_0461163 | 3300046454 | Bacteria | 794 |
| 684 | Ga0495592_0769422 | 3300046454 | Bacteria | 574 |
| 685 | Ga0495603_0046829 | 3300046455 | Bacteria | 2576 |
| 686 | Ga0495629_0017747 | 3300046459 | Bacteria | 5100 |
| 687 | Ga0495629_0131264 | 3300046459 | Bacteria | 1745 |
| 688 | Ga0495629_0235242 | 3300046459 | Bacteria | 1262 |
| 689 | Ga0495629_0252307 | 3300046459 | Bacteria | 1214 |
| 690 | Ga0495629_0439069 | 3300046459 | Bacteria | 885 |
| 691 | Ga0495641_0016066 | 3300046461 | Bacteria | 3958 |
| 692 | Ga0495641_0026195 | 3300046461 | Bacteria | 2849 |
| 693 | Ga0495641_0079331 | 3300046461 | Bacteria | 1471 |
| 694 | Ga0495641_0086874 | 3300046461 | Bacteria | 1399 |
| 695 | Ga0495641_0114459 | 3300046461 | Bacteria | 1203 |
| 696 | Ga0495641_0204830 | 3300046461 | Bacteria | 884 |
| 697 | Ga0495651_0000029 | 3300046462 | Bacteria | 105042 |
| 698 | Ga0495651_0037777 | 3300046462 | Bacteria | 3760 |
| 699 | Ga0495651_0139797 | 3300046462 | Bacteria | 1757 |
| 700 | Ga0495651_0161878 | 3300046462 | Bacteria | 1602 |
| 701 | Ga0495651_0342042 | 3300046462 | Bacteria | 991 |
| 702 | Ga0495651_0454263 | 3300046462 | Unclassified | 827 |
| 703 | Ga0495653_0001363 | 3300046463 | Bacteria | 18977 |
| 704 | Ga0495653_0008307 | 3300046463 | Bacteria | 8509 |
| 705 | Ga0495653_0072654 | 3300046463 | Bacteria | 2568 |
| 706 | Ga0495653_0091261 | 3300046463 | Bacteria | 2227 |
| 707 | Ga0495653_0115764 | 3300046463 | Unclassified | 1918 |
| 708 | Ga0495653_0135178 | 3300046463 | Bacteria | 1740 |
| 709 | Ga0495653_0151920 | 3300046463 | Bacteria | 1617 |
| 710 | Ga0495653_0227844 | 3300046463 | Bacteria | 1249 |
| 711 | Ga0495653_0374914 | 3300046463 | Bacteria | 910 |
| 712 | Ga0495653_0575937 | 3300046463 | Unclassified | 694 |
| 713 | Ga0495653_0861213 | 3300046463 | Unclassified | 542 |
| 714 | Ga0495580_0024113 | 3300046472 | Bacteria | 4459 |
| 715 | Ga0495582_0004164 | 3300046473 | Bacteria | 8134 |
| 716 | Ga0495582_0150648 | 3300046473 | Bacteria | 1320 |
| 717 | Ga0495639_0006273 | 3300046475 | Bacteria | 5106 |
| 718 | Ga0495639_0340620 | 3300046475 | Bacteria | 752 |
| 719 | Ga0495662_0001522 | 3300046476 | Bacteria | 11502 |
| 720 | Ga0495662_0023497 | 3300046476 | Bacteria | 2977 |
| 721 | Ga0495664_0042590 | 3300046477 | Bacteria | 2689 |
| 722 | Ga0495664_0201632 | 3300046477 | Bacteria | 1205 |
| 723 | Ga0495664_0267472 | 3300046477 | Bacteria | 1033 |
| 724 | Ga0495584_0007847 | 3300046491 | Bacteria | 5550 |
| 725 | Ga0495585_0025444 | 3300046492 | Bacteria | 3390 |
| 726 | Ga0495594_0145070 | 3300046499 | Bacteria | 1347 |
| 727 | Ga0495594_0319906 | 3300046499 | Bacteria | 884 |
| 728 | Ga0495594_0639243 | 3300046499 | Unclassified | 603 |
| 729 | Ga0495596_0062955 | 3300046500 | Bacteria | 1443 |
| 730 | Ga0495607_0040771 | 3300046501 | Bacteria | 2762 |
| 731 | Ga0495608_0014722 | 3300046511 | Bacteria | 5429 |
| 732 | Ga0495608_0023778 | 3300046511 | Bacteria | 4194 |
| 733 | Ga0495608_0032053 | 3300046511 | Bacteria | 3552 |
| 734 | Ga0495608_0115571 | 3300046511 | Bacteria | 1722 |
| 735 | Ga0495608_0312755 | 3300046511 | Archaea | 971 |
| 736 | Ga0495608_0355764 | 3300046511 | Unclassified | 901 |
| 737 | Ga0495608_0418423 | 3300046511 | Bacteria | 818 |
| 738 | Ga0495618_0009479 | 3300046514 | Bacteria | 5882 |
| 739 | Ga0495618_0034082 | 3300046514 | Bacteria | 3191 |
| 740 | Ga0495618_0067575 | 3300046514 | Bacteria | 2273 |
| 741 | Ga0495618_0104752 | 3300046514 | Bacteria | 1811 |
| 742 | Ga0495618_0736342 | 3300046514 | Unclassified | 578 |
| 743 | Ga0495628_0000016 | 3300046516 | Bacteria | 170260 |
| 744 | Ga0495628_0014430 | 3300046516 | Bacteria | 6622 |
| 745 | Ga0495628_0028205 | 3300046516 | Bacteria | 4563 |
| 746 | Ga0495630_0000505 | 3300046517 | Bacteria | 28893 |
| 747 | Ga0495630_0298166 | 3300046517 | Bacteria | 1232 |
| 748 | Ga0495630_0681174 | 3300046517 | Bacteria | 787 |
| 749 | Ga0495630_0770971 | 3300046517 | Unclassified | 735 |
| 750 | Ga0495630_1362339 | 3300046517 | Unclassified | 534 |
| 751 | Ga0495644_0020878 | 3300046523 | Bacteria | 2498 |
| 752 | Ga0495663_0375953 | 3300046525 | Bacteria | 520 |
| 753 | Ga0495666_0186505 | 3300046526 | Bacteria | 957 |
| 754 | Ga0495652_0000045 | 3300046529 | Bacteria | 122469 |
| 755 | Ga0495652_0006417 | 3300046529 | Bacteria | 10948 |
| 756 | Ga0495652_0042714 | 3300046529 | Bacteria | 3908 |
| 757 | Ga0495652_0081521 | 3300046529 | Bacteria | 2668 |
| 758 | Ga0495652_0083596 | 3300046529 | Bacteria | 2627 |
| 759 | Ga0495652_0118634 | 3300046529 | Unclassified | 2114 |
| 760 | Ga0495652_0232474 | 3300046529 | Unclassified | 1378 |
| 761 | Ga0495665_0029813 | 3300046531 | Bacteria | 2921 |
| 762 | Ga0495640_0007391 | 3300046533 | Bacteria | 8645 |
| 763 | Ga0495640_0014315 | 3300046533 | Bacteria | 6006 |
| 764 | Ga0495640_0125500 | 3300046533 | Bacteria | 1665 |
| 765 | Ga0495640_0954284 | 3300046533 | Unclassified | 506 |
| 766 | Ga0495586_0034130 | 3300046535 | Bacteria | 2731 |
| 767 | Ga0495586_0088546 | 3300046535 | Bacteria | 1708 |
| 768 | Ga0495587_0000083 | 3300046536 | Bacteria | 73166 |
| 769 | Ga0495587_0114475 | 3300046536 | Bacteria | 1547 |
| 770 | Ga0495587_0655845 | 3300046536 | Bacteria | 576 |
| 771 | Ga0495587_0674079 | 3300046536 | Bacteria | 568 |
| 772 | Ga0495645_0001902 | 3300046543 | Bacteria | 14187 |
| 773 | Ga0495645_0021257 | 3300046543 | Bacteria | 4689 |
| 774 | Ga0495645_0028921 | 3300046543 | Bacteria | 4027 |
| 775 | Ga0495645_0306506 | 3300046543 | Bacteria | 1035 |
| 776 | Ga0495667_0025440 | 3300046559 | Bacteria | 3989 |
| 777 | Ga0495667_0069376 | 3300046559 | Bacteria | 2300 |
| 778 | Ga0495667_0111199 | 3300046559 | Unclassified | 1770 |
| 779 | Ga0495667_0120029 | 3300046559 | Bacteria | 1698 |
| 780 | Ga0495667_0193124 | 3300046559 | Bacteria | 1304 |
| 781 | Ga0495667_0223154 | 3300046559 | Archaea | 1202 |
| 782 | Ga0495667_0540690 | 3300046559 | Bacteria | 728 |
| 783 | Ga0495656_0001481 | 3300046615 | Bacteria | 7683 |
| 784 | Ga0495668_0245643 | 3300046616 | Bacteria | 980 |
| 785 | Ga0495634_0003355 | 3300046642 | Bacteria | 12860 |
| 786 | Ga0495634_0038164 | 3300046642 | Bacteria | 3276 |
| 787 | Ga0495634_0091496 | 3300046642 | Bacteria | 1975 |
| 788 | Ga0495634_0200725 | 3300046642 | Bacteria | 1239 |
| 789 | Ga0495611_0124287 | 3300046648 | Bacteria | 1203 |
| 790 | Ga0495635_0004708 | 3300046663 | Bacteria | 9481 |
| 791 | Ga0495635_0044339 | 3300046663 | Bacteria | 3069 |
| 792 | Ga0495635_0159815 | 3300046663 | Unclassified | 1533 |
| 793 | Ga0495635_0275879 | 3300046663 | Unclassified | 1130 |
| 794 | Ga0495635_0402960 | 3300046663 | Bacteria | 908 |
| 795 | Ga0495635_0409722 | 3300046663 | Unclassified | 900 |
| 796 | Ga0495635_0561639 | 3300046663 | Bacteria | 747 |
| 797 | Ga0495635_0816601 | 3300046663 | Bacteria | 600 |
| 798 | Ga0495661_0159110 | 3300046665 | Bacteria | 1214 |
| 799 | Ga0495588_0088482 | 3300046674 | Unclassified | 1621 |
| 800 | Ga0495657_0011595 | 3300046675 | Bacteria | 6586 |
| 801 | Ga0495657_0037285 | 3300046675 | Bacteria | 3352 |
| 802 | Ga0495657_0187772 | 3300046675 | Bacteria | 1264 |
| 803 | Ga0495657_0241416 | 3300046675 | Bacteria | 1090 |
| 804 | Ga0495657_0345525 | 3300046675 | Bacteria | 881 |
| 805 | Ga0495657_0346145 | 3300046675 | Bacteria | 880 |
| 806 | Ga0495657_0399648 | 3300046675 | Bacteria | 809 |
| 807 | Ga0495657_0469575 | 3300046675 | Bacteria | 735 |
| 808 | Ga0495657_0706024 | 3300046675 | Bacteria | 579 |
| 809 | Ga0495599_0000187 | 3300046678 | Bacteria | 40807 |
| 810 | Ga0495599_0000610 | 3300046678 | Bacteria | 20335 |
| 811 | Ga0495599_0200702 | 3300046678 | Bacteria | 1225 |
| 812 | Ga0495599_0235184 | 3300046678 | Unclassified | 1118 |
| 813 | Ga0495599_0463928 | 3300046678 | Unclassified | 749 |
| 814 | Ga0495623_0000121 | 3300046679 | Bacteria | 47882 |
| 815 | Ga0495623_0005723 | 3300046679 | Bacteria | 8117 |
| 816 | Ga0495623_0194689 | 3300046679 | Bacteria | 1169 |
| 817 | Ga0495646_0001537 | 3300046680 | Bacteria | 13770 |
| 818 | Ga0495646_0062692 | 3300046680 | Bacteria | 2210 |
| 819 | Ga0495647_0000468 | 3300046681 | Bacteria | 11697 |
| 820 | Ga0495647_0049997 | 3300046681 | Bacteria | 1621 |
| 821 | Ga0495658_0011253 | 3300046683 | Bacteria | 4495 |
| 822 | Ga0495658_0203263 | 3300046683 | Bacteria | 1235 |
| 823 | Ga0495669_0276031 | 3300046684 | Bacteria | 808 |
| 824 | Ga0495613_0062116 | 3300046689 | Bacteria | 2735 |
| 825 | Ga0495613_0081268 | 3300046689 | Bacteria | 2355 |
| 826 | Ga0495613_0456135 | 3300046689 | Bacteria | 865 |
| 827 | Ga0495624_0005932 | 3300046690 | Bacteria | 8730 |
| 828 | Ga0495624_0022126 | 3300046690 | Bacteria | 4208 |
| 829 | Ga0495624_0408691 | 3300046690 | Bacteria | 815 |
| 830 | Ga0495624_0633771 | 3300046690 | Bacteria | 636 |
| 831 | Ga0495670_0072448 | 3300046691 | Bacteria | 1745 |
| 832 | Ga0495589_0200021 | 3300046794 | Bacteria | 943 |
| 833 | Ga0495600_0041000 | 3300046809 | Bacteria | 3017 |
| 834 | Ga0495600_0228921 | 3300046809 | Bacteria | 1187 |
| 835 | Ga0495600_0268406 | 3300046809 | Bacteria | 1083 |
| 836 | Ga0495600_0473465 | 3300046809 | Unclassified | 772 |
| 837 | Ga0495660_0280624 | 3300046810 | Bacteria | 762 |
| 838 | Ga0495581_0002035 | 3300047315 | Bacteria | 11369 |
| 839 | Ga0495581_0047064 | 3300047315 | Bacteria | 2493 |
| 840 | Ga0495581_0263017 | 3300047315 | Bacteria | 1009 |
| 841 | Ga0495604_0000072 | 3300047317 | Bacteria | 88631 |
| 842 | Ga0495604_0087853 | 3300047317 | Bacteria | 2314 |
| 843 | Ga0495604_0375810 | 3300047317 | Bacteria | 940 |
| 844 | Ga0495604_0601678 | 3300047317 | Bacteria | 705 |
| 845 | Ga0495674_0012591 | 3300047319 | Bacteria | 7969 |
| 846 | Ga0495674_0073771 | 3300047319 | Bacteria | 2940 |
| 847 | Ga0495674_0493489 | 3300047319 | Bacteria | 980 |
| 848 | Ga0495674_0582007 | 3300047319 | Unclassified | 888 |
| 849 | Ga0495676_0071355 | 3300047321 | Bacteria | 2670 |
| 850 | Ga0495676_0155177 | 3300047321 | Bacteria | 1625 |
| 851 | Ga0495676_0160103 | 3300047321 | Bacteria | 1593 |
| 852 | Ga0495676_0429865 | 3300047321 | Bacteria | 873 |
| 853 | Ga0495680_0004810 | 3300047322 | Bacteria | 12812 |
| 854 | Ga0495680_0007057 | 3300047322 | Bacteria | 10354 |
| 855 | Ga0495680_0016342 | 3300047322 | Bacteria | 6379 |
| 856 | Ga0495680_0037008 | 3300047322 | Bacteria | 3911 |
| 857 | Ga0495680_0108643 | 3300047322 | Bacteria | 2058 |
| 858 | Ga0495680_0181638 | 3300047322 | Archaea | 1518 |
| 859 | Ga0495680_0611430 | 3300047322 | Unclassified | 728 |
| 860 | Ga0495680_0929519 | 3300047322 | Bacteria | 560 |
| 861 | Ga0495683_0226532 | 3300047323 | Bacteria | 831 |
| 862 | Ga0495675_0000031 | 3300047444 | Bacteria | 99240 |
| 863 | Ga0495675_0355316 | 3300047444 | Bacteria | 861 |
| 864 | Ga0495675_0563240 | 3300047444 | Bacteria | 649 |
| 865 | Ga0495677_0028578 | 3300047445 | Bacteria | 2026 |
| 866 | Ga0495679_055719 | 3300047446 | Bacteria | 1173 |
| 867 | Ga0495684_0008099 | 3300047471 | Bacteria | 8125 |
| 868 | Ga0495684_0019924 | 3300047471 | Bacteria | 5168 |
| 869 | Ga0495684_0027689 | 3300047471 | Bacteria | 4352 |
| 870 | Ga0495684_0297074 | 3300047471 | Unclassified | 1161 |
| 871 | Ga0495684_0516700 | 3300047471 | Unclassified | 818 |
| 872 | Ga0495684_0674395 | 3300047471 | Unclassified | 688 |
| 873 | Ga0495593_0000333 | 3300047673 | Bacteria | 26121 |
| 874 | Ga0495593_0119571 | 3300047673 | Bacteria | 1341 |
| 875 | Ga0495602_0000133 | 3300048088 | Bacteria | 69392 |
| 876 | Ga0495602_0024934 | 3300048088 | Bacteria | 5795 |
| 877 | Ga0495602_0095157 | 3300048088 | Bacteria | 2460 |
| 878 | Ga0495602_0678536 | 3300048088 | Bacteria | 701 |
| 879 | Ga0495602_0723161 | 3300048088 | Bacteria | 674 |
| 880 | Ga0495614_0001325 | 3300048089 | Bacteria | 10682 |
| 881 | Ga0496100_0034269 | 3300048903 | Bacteria | 3184 |
| 882 | Ga0496100_0049310 | 3300048903 | Bacteria | 2722 |
| 883 | Ga0496100_0144881 | 3300048903 | Bacteria | 1688 |
| 884 | Ga0496100_0974278 | 3300048903 | Unclassified | 667 |
| 885 | Ga0496101_0002509 | 3300048904 | Bacteria | 11277 |
| 886 | Ga0496101_0044485 | 3300048904 | Bacteria | 3178 |
| 887 | Ga0496101_0110389 | 3300048904 | Bacteria | 2069 |
| 888 | Ga0496101_0260787 | 3300048904 | Bacteria | 1352 |
| 889 | Ga0496101_0952560 | 3300048904 | Bacteria | 675 |
| 890 | Ga0496101_1067501 | 3300048904 | Bacteria | 634 |
| 891 | Ga0496102_0005815 | 3300048905 | Bacteria | 10487 |
| 892 | Ga0496102_0055705 | 3300048905 | Bacteria | 3605 |
| 893 | Ga0496102_0100308 | 3300048905 | Bacteria | 2689 |
| 894 | Ga0496102_0185761 | 3300048905 | Bacteria | 1959 |
| 895 | Ga0496102_0352481 | 3300048905 | Bacteria | 1386 |
| 896 | Ga0496102_0849525 | 3300048905 | Bacteria | 835 |
| 897 | Ga0496103_0016363 | 3300048906 | Bacteria | 4426 |
| 898 | Ga0496103_0023625 | 3300048906 | Bacteria | 3709 |
| 899 | Ga0496104_0034254 | 3300048907 | Bacteria | 4733 |
| 900 | Ga0496104_0039390 | 3300048907 | Bacteria | 4425 |
| 901 | Ga0496104_0864155 | 3300048907 | Bacteria | 810 |
| 902 | Ga0496104_0988404 | 3300048907 | Unclassified | 746 |
| 903 | Ga0496105_0010632 | 3300048908 | Bacteria | 7240 |
| 904 | Ga0496105_0017937 | 3300048908 | Bacteria | 5680 |
| 905 | Ga0496105_0104099 | 3300048908 | Unclassified | 2344 |
| 906 | Ga0496105_0845583 | 3300048908 | Bacteria | 693 |
| 907 | Ga0496105_1212534 | 3300048908 | Bacteria | 555 |
| 908 | Ga0496106_0030068 | 3300048909 | Bacteria | 4050 |
| 909 | Ga0496106_0041047 | 3300048909 | Bacteria | 3466 |
| 910 | Ga0496106_0103195 | 3300048909 | Bacteria | 2213 |
| 911 | Ga0496106_0741584 | 3300048909 | Bacteria | 781 |
| 912 | Ga0496107_0010435 | 3300048910 | Bacteria | 6453 |
| 913 | Ga0496107_0093099 | 3300048910 | Bacteria | 2204 |
| 914 | Ga0496107_0154752 | 3300048910 | Bacteria | 1697 |
| 915 | Ga0496107_0155954 | 3300048910 | Bacteria | 1690 |
| 916 | Ga0496107_1045708 | 3300048910 | Unclassified | 591 |
| 917 | Ga0496108_0011946 | 3300048911 | Bacteria | 7065 |
| 918 | Ga0496108_0036442 | 3300048911 | Bacteria | 4092 |
| 919 | Ga0496108_0482952 | 3300048911 | Bacteria | 1082 |
| 920 | Ga0496108_0631030 | 3300048911 | Bacteria | 932 |
| 921 | Ga0496109_0009062 | 3300048912 | Bacteria | 8475 |
| 922 | Ga0496109_0056369 | 3300048912 | Bacteria | 3586 |
| 923 | Ga0496109_0344092 | 3300048912 | Bacteria | 1408 |
| 924 | Ga0496109_0609685 | 3300048912 | Bacteria | 1028 |
| 925 | Ga0496109_0620230 | 3300048912 | Bacteria | 1018 |
| 926 | Ga0496110_0006093 | 3300048913 | Bacteria | 9501 |
| 927 | Ga0496110_0237736 | 3300048913 | Unclassified | 1657 |
| 928 | Ga0496110_0279650 | 3300048913 | Bacteria | 1520 |
| 929 | Ga0496110_0733996 | 3300048913 | Bacteria | 890 |
| 930 | Ga0496111_0016935 | 3300048914 | Bacteria | 5030 |
| 931 | Ga0496111_0022289 | 3300048914 | Bacteria | 4432 |
| 932 | Ga0496111_0271384 | 3300048914 | Unclassified | 1258 |
| 933 | Ga0496111_0293454 | 3300048914 | Bacteria | 1206 |
| 934 | Ga0496111_1136859 | 3300048914 | Bacteria | 555 |
| 935 | Ga0496112_0056461 | 3300048915 | Bacteria | 3864 |
| 936 | Ga0496112_0071929 | 3300048915 | Bacteria | 3418 |
| 937 | Ga0496112_0082148 | 3300048915 | Bacteria | 3187 |
| 938 | Ga0496112_0087667 | 3300048915 | Bacteria | 3079 |
| 939 | Ga0496112_0089402 | 3300048915 | Bacteria | 3048 |
| 940 | Ga0496112_0186249 | 3300048915 | Bacteria | 2039 |
| 941 | Ga0496112_0289113 | 3300048915 | Bacteria | 1585 |
| 942 | Ga0496112_0434252 | 3300048915 | Unclassified | 1251 |
| 943 | Ga0496112_1036068 | 3300048915 | Archaea | 740 |
| 944 | Ga0496112_1216066 | 3300048915 | Bacteria | 670 |
| 945 | Ga0496112_1233356 | 3300048915 | Unclassified | 664 |
| 946 | Ga0496113_0041344 | 3300048916 | Bacteria | 3402 |
| 947 | Ga0496113_0166052 | 3300048916 | Bacteria | 1746 |
| 948 | Ga0496113_0181263 | 3300048916 | Bacteria | 1670 |
| 949 | Ga0496113_0234272 | 3300048916 | Unclassified | 1464 |
| 950 | Ga0496113_0300215 | 3300048916 | Bacteria | 1286 |
| 951 | Ga0496113_0555840 | 3300048916 | Bacteria | 920 |
| 952 | Ga0496113_0738305 | 3300048916 | Bacteria | 784 |
| 953 | Ga0496114_0011562 | 3300048917 | Bacteria | 7053 |
| 954 | Ga0496114_0096721 | 3300048917 | Bacteria | 2514 |
| 955 | Ga0496114_0176094 | 3300048917 | Bacteria | 1866 |
| 956 | Ga0496115_0026093 | 3300048918 | Bacteria | 4556 |
| 957 | Ga0496115_0043589 | 3300048918 | Bacteria | 3579 |
| 958 | Ga0496115_0080724 | 3300048918 | Bacteria | 2648 |
| 959 | Ga0496115_0082447 | 3300048918 | Bacteria | 2620 |
| 960 | Ga0496115_0100595 | 3300048918 | Bacteria | 2370 |
| 961 | Ga0496115_0199138 | 3300048918 | Bacteria | 1654 |
| 962 | Ga0496115_0641835 | 3300048918 | Bacteria | 840 |
| 963 | Ga0501034_0004589 | 3300049571 | Bacteria | 15299 |
| 964 | Ga0501038_0655408 | 3300049574 | Bacteria | 790 |
| 965 | Ga0501048_0291163 | 3300049582 | Bacteria | 1161 |
| 966 | Ga0501067_0027300 | 3300049583 | Bacteria | 3163 |
| 967 | Ga0501067_0057526 | 3300049583 | Unclassified | 2153 |
| 968 | Ga0501067_0238382 | 3300049583 | Bacteria | 1012 |
| 969 | Ga0501067_0274228 | 3300049583 | Bacteria | 939 |
| 970 | Ga0501069_0019863 | 3300049585 | Bacteria | 3635 |
| 971 | Ga0501069_0033705 | 3300049585 | Bacteria | 2821 |
| 972 | Ga0501070_0025291 | 3300049586 | Bacteria | 4978 |
| 973 | Ga0501070_0051543 | 3300049586 | Bacteria | 3416 |
| 974 | Ga0501070_0846256 | 3300049586 | Unclassified | 716 |
| 975 | Ga0501072_0015894 | 3300049588 | Bacteria | 5769 |
| 976 | Ga0501073_0052133 | 3300049589 | Bacteria | 2865 |
| 977 | Ga0501074_0017998 | 3300049590 | Bacteria | 5133 |
| 978 | Ga0501079_0036453 | 3300049741 | Bacteria | 3789 |
| 979 | Ga0501080_0000535 | 3300049742 | Bacteria | 29918 |
| 980 | Ga0501080_0007055 | 3300049742 | Bacteria | 10146 |
| 981 | Ga0501083_0011627 | 3300049744 | Bacteria | 6176 |
| 982 | nmdc:mga05p37_1052152_c1 | 3300050507 | Unclassified | 858 |
| 983 | nmdc:mga0n895_180850_c1 | 3300050512 | Bacteria | 2140 |
| 984 | nmdc:mga0n895_5478_c1 | 3300050512 | Bacteria | 10620 |
| 985 | nmdc:mga0rr50_1006024_c1 | 3300050513 | Archaea | 710 |
| 986 | nmdc:mga0rr50_544609_c1 | 3300050513 | Unclassified | 988 |
| 987 | nmdc:mga08x19_381534_c1 | 3300050514 | Unclassified | 987 |
| 988 | nmdc:mga08x19_737301_c1 | 3300050514 | Bacteria | 699 |
| 989 | nmdc:mga0a205_299821_c1 | 3300050515 | Bacteria | 1480 |
| 990 | nmdc:mga0a205_488426_c1 | 3300050515 | Bacteria | 1089 |
| 991 | Ga0495601_0000304 | 3300053077 | Bacteria | 26118 |
| 992 | Ga0495601_0026164 | 3300053077 | Bacteria | 3600 |
| 993 | Ga0495601_0033652 | 3300053077 | Bacteria | 3193 |
| 994 | Ga0495601_0111956 | 3300053077 | Unclassified | 1768 |
| 995 | Ga0495601_0167849 | 3300053077 | Unclassified | 1434 |
| 996 | Ga0495601_0525157 | 3300053077 | Unclassified | 763 |
| 997 | Ga0495601_0670365 | 3300053077 | Unclassified | 663 |
| 998 | Ga0495612_0005159 | 3300053078 | Bacteria | 5399 |
| 999 | Ga0495612_0011693 | 3300053078 | Bacteria | 3538 |
| 1000 | Ga0495612_0424336 | 3300053078 | Unclassified | 606 |
| 1001 | Ga0495612_0601550 | 3300053078 | Bacteria | 508 |
| 1002 | Ga0495595_0004259 | 3300053084 | Bacteria | 5752 |
| 1003 | Ga0495595_0010303 | 3300053084 | Bacteria | 3884 |
| 1004 | Ga0495595_0015196 | 3300053084 | Bacteria | 3280 |
| 1005 | Ga0495595_0104732 | 3300053084 | Bacteria | 1367 |
| 1006 | Ga0495595_0617963 | 3300053084 | Unclassified | 554 |
| 1007 | Ga0495595_0738570 | 3300053084 | Bacteria | 505 |
| 1008 | Ga0495619_0000836 | 3300053085 | Bacteria | 20199 |
| 1009 | Ga0495619_0001937 | 3300053085 | Bacteria | 13798 |
| 1010 | Ga0495619_0109203 | 3300053085 | Bacteria | 1889 |
| 1011 | Ga0495619_0109497 | 3300053085 | Bacteria | 1886 |
| 1012 | Ga0495619_0296165 | 3300053085 | Bacteria | 1121 |
| 1013 | Ga0495619_0568792 | 3300053085 | Bacteria | 777 |
| 1014 | Ga0500566_0008196 | 3300053094 | Bacteria | 6182 |
| 1015 | Ga0500614_224465 | 3300053123 | Unclassified | 583 |
| 1016 | Ga0501082_0804749 | 3300060353 | Bacteria | 822 |
| 1017 | Ga0466962_0002608 | 3300061719 | Bacteria | 8568 |
| 1018 | Ga0466962_0005598 | 3300061719 | Bacteria | 6033 |
| 1019 | Ga0466962_0012201 | 3300061719 | Bacteria | 4131 |
| 1020 | Ga0466962_0028295 | 3300061719 | Bacteria | 2685 |
| 1021 | Ga0466962_0029341 | 3300061719 | Bacteria | 2633 |
| 1022 | Ga0466962_0041976 | 3300061719 | Unclassified | 2189 |
| 1023 | Ga0466962_0382425 | 3300061719 | Unclassified | 703 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044656 | Ga0466969_0128896 | Ga0466969_0128896_831_1121 | 94 |
| 2 | 3300005436 | Ga0070713_100024783 | Ga0070713_1000247836 | 95 |
| 3 | 3300005439 | Ga0070711_100926352 | Ga0070711_1009263522 | 95 |
| 4 | 3300006028 | Ga0070717_10680881 | Ga0070717_106808812 | 95 |
| 5 | 3300006173 | Ga0070716_100003859 | Ga0070716_1000038592 | 95 |
| 6 | 3300006175 | Ga0070712_101081141 | Ga0070712_1010811412 | 95 |
| 7 | 3300006852 | Ga0075433_10493077 | Ga0075433_104930771 | 95 |
| 8 | 3300021384 | Ga0213876_10487114 | Ga0213876_104871141 | 95 |
| 9 | 3300025906 | Ga0207699_10046097 | Ga0207699_100460973 | 95 |
| 10 | 3300025915 | Ga0207693_10395283 | Ga0207693_103952832 | 95 |
| 11 | 3300025916 | Ga0207663_10699025 | Ga0207663_106990251 | 95 |
| 12 | 3300025928 | Ga0207700_10000006 | Ga0207700_10000006301 | 95 |
| 13 | 3300025929 | Ga0207664_10233746 | Ga0207664_102337462 | 95 |
| 14 | 3300025939 | Ga0207665_10005520 | Ga0207665_1000552010 | 95 |
| 15 | 3300031731 | Ga0307405_10093478 | Ga0307405_100934782 | 95 |
| 16 | 3300032002 | Ga0307416_100246297 | Ga0307416_1002462973 | 95 |
| 17 | 3300032126 | Ga0307415_100305825 | Ga0307415_1003058251 | 95 |
| 18 | 3300038443 | Ga0395901_0629307 | Ga0395901_0629307_351_638 | 95 |
| 19 | 3300039437 | Ga0436365_1260527 | Ga0436365_1260527_355_645 | 95 |
| 20 | 3300041410 | Ga0439461_0033180 | Ga0439461_0033180_214_516 | 95 |
| 21 | 3300042004 | Ga0439445_0243414 | Ga0439445_0243414_87_383 | 95 |
| 22 | 3300044684 | Ga0466966_0017398 | Ga0466966_0017398_2483_2824 | 95 |
| 23 | 3300045049 | Ga0466959_0009312 | Ga0466959_0009312_2984_3325 | 95 |
| 24 | 3300045976 | Ga0466967_0709865 | Ga0466967_0709865_532_819 | 95 |
| 25 | 3300048908 | Ga0496105_0104099 | Ga0496105_0104099_1202_1504 | 95 |
| 26 | 3300048913 | Ga0496110_0237736 | Ga0496110_0237736_1092_1394 | 95 |
| 27 | 3300048914 | Ga0496111_0271384 | Ga0496111_0271384_32_334 | 95 |
| 28 | 3300048916 | Ga0496113_0555840 | Ga0496113_0555840_191_493 | 95 |
| 29 | 3300050515 | nmdc:mga0a205_488426_c1 | nmdc:mga0a205_488426_c1_726_1028 | 95 |
| 30 | 3300005341 | Ga0070691_10253315 | Ga0070691_102533151 | 96 |
| 31 | 3300005444 | Ga0070694_100266842 | Ga0070694_1002668421 | 96 |
| 32 | 3300005458 | Ga0070681_10211448 | Ga0070681_102114482 | 96 |
| 33 | 3300005530 | Ga0070679_100399888 | Ga0070679_1003998882 | 96 |
| 34 | 3300005545 | Ga0070695_100000265 | Ga0070695_1000002653 | 96 |
| 35 | 3300005577 | Ga0068857_101844116 | Ga0068857_1018441162 | 96 |
| 36 | 3300009093 | Ga0105240_10058261 | Ga0105240_100582616 | 96 |
| 37 | 3300009098 | Ga0105245_11460550 | Ga0105245_114605502 | 96 |
| 38 | 3300009545 | Ga0105237_10039879 | Ga0105237_100398794 | 96 |
| 39 | 3300013307 | Ga0157372_13230627 | Ga0157372_132306271 | 96 |
| 40 | 3300025912 | Ga0207707_10290210 | Ga0207707_102902103 | 96 |
| 41 | 3300025913 | Ga0207695_10277597 | Ga0207695_102775971 | 96 |
| 42 | 3300025914 | Ga0207671_10190994 | Ga0207671_101909942 | 96 |
| 43 | 3300025921 | Ga0207652_10844137 | Ga0207652_108441372 | 96 |
| 44 | 3300041408 | Ga0439453_0002236 | Ga0439453_0002236_2058_2351 | 96 |
| 45 | 3300042009 | Ga0439451_021447 | Ga0439451_021447_323_616 | 96 |
| 46 | 3300044683 | Ga0466965_0075882 | Ga0466965_0075882_119_424 | 96 |
| 47 | 3300044706 | Ga0466964_0252216 | Ga0466964_0252216_497_802 | 96 |
| 48 | 3300044735 | Ga0466968_0093842 | Ga0466968_0093842_257_562 | 96 |
| 49 | 3300044842 | Ga0466957_1433304 | Ga0466957_1433304_152_457 | 96 |
| 50 | 3300044901 | Ga0466960_0011815 | Ga0466960_0011815_1035_1340 | 96 |
| 51 | 3300045976 | Ga0466967_0002354 | Ga0466967_0002354_2265_2570 | 96 |
| 52 | 3300048905 | Ga0496102_0005815 | Ga0496102_0005815_6110_6454 | 96 |
| 53 | 3300048906 | Ga0496103_0023625 | Ga0496103_0023625_279_623 | 96 |
| 54 | 3300006028 | Ga0070717_10426752 | Ga0070717_104267522 | 97 |
| 55 | 3300044706 | Ga0466964_0581351 | Ga0466964_0581351_308_601 | 97 |
| 56 | 3300005327 | Ga0070658_11277009 | Ga0070658_112770092 | 98 |
| 57 | 3300005329 | Ga0070683_100106628 | Ga0070683_1001066284 | 98 |
| 58 | 3300005336 | Ga0070680_100014283 | Ga0070680_1000142832 | 98 |
| 59 | 3300005339 | Ga0070660_100001782 | Ga0070660_1000017829 | 98 |
| 60 | 3300005344 | Ga0070661_100086770 | Ga0070661_1000867703 | 98 |
| 61 | 3300005455 | Ga0070663_101443352 | Ga0070663_1014433521 | 98 |
| 62 | 3300005458 | Ga0070681_10227477 | Ga0070681_102274772 | 98 |
| 63 | 3300005458 | Ga0070681_10243805 | Ga0070681_102438053 | 98 |
| 64 | 3300005530 | Ga0070679_100012002 | Ga0070679_1000120024 | 98 |
| 65 | 3300005616 | Ga0068852_100242824 | Ga0068852_1002428242 | 98 |
| 66 | 3300020081 | Ga0206354_11239232 | Ga0206354_112392322 | 98 |
| 67 | 3300025912 | Ga0207707_10025872 | Ga0207707_100258724 | 98 |
| 68 | 3300025917 | Ga0207660_10019550 | Ga0207660_100195504 | 98 |
| 69 | 3300025919 | Ga0207657_10026169 | Ga0207657_100261695 | 98 |
| 70 | 3300025920 | Ga0207649_10030184 | Ga0207649_100301843 | 98 |
| 71 | 3300025921 | Ga0207652_10213223 | Ga0207652_102132232 | 98 |
| 72 | 3300025921 | Ga0207652_11576738 | Ga0207652_115767382 | 98 |
| 73 | 3300026067 | Ga0207678_11271975 | Ga0207678_112719752 | 98 |
| 74 | 3300026142 | Ga0207698_10248799 | Ga0207698_102487992 | 98 |
| 75 | 3300044683 | Ga0466965_0074998 | Ga0466965_0074998_288_623 | 99 |
| 76 | 3300044684 | Ga0466966_0086218 | Ga0466966_0086218_1512_1847 | 99 |
| 77 | 3300044693 | Ga0466961_0027130 | Ga0466961_0027130_3182_3517 | 99 |
| 78 | 3300044694 | Ga0466963_0111563 | Ga0466963_0111563_1122_1457 | 99 |
| 79 | 3300044706 | Ga0466964_0438146 | Ga0466964_0438146_75_410 | 99 |
| 80 | 3300044719 | Ga0466971_0004429 | Ga0466971_0004429_1391_1726 | 99 |
| 81 | 3300044735 | Ga0466968_0001937 | Ga0466968_0001937_1801_2136 | 99 |
| 82 | 3300044735 | Ga0466968_0011205 | Ga0466968_0011205_1498_1833 | 99 |
| 83 | 3300044765 | Ga0466970_0178128 | Ga0466970_0178128_680_1015 | 99 |
| 84 | 3300045049 | Ga0466959_0003840 | Ga0466959_0003840_552_887 | 99 |
| 85 | 3300045836 | Ga0466958_0116169 | Ga0466958_0116169_1278_1613 | 99 |
| 86 | 3300061719 | Ga0466962_0028295 | Ga0466962_0028295_2144_2479 | 99 |
| 87 | 3300005435 | Ga0070714_100471587 | Ga0070714_1004715872 | 100 |
| 88 | 3300005437 | Ga0070710_10890300 | Ga0070710_108903002 | 100 |
| 89 | 3300006173 | Ga0070716_100020120 | Ga0070716_1000201204 | 100 |
| 90 | 3300006175 | Ga0070712_100837485 | Ga0070712_1008374851 | 100 |
| 91 | 3300025898 | Ga0207692_10330626 | Ga0207692_103306262 | 100 |
| 92 | 3300025915 | Ga0207693_10259586 | Ga0207693_102595862 | 100 |
| 93 | 3300025929 | Ga0207664_10018691 | Ga0207664_100186915 | 100 |
| 94 | 3300045049 | Ga0466959_0032586 | Ga0466959_0032586_3216_3545 | 100 |
| 95 | 3300045976 | Ga0466967_0421752 | Ga0466967_0421752_909_1211 | 100 |
| 96 | 3300005471 | Ga0070698_100366155 | Ga0070698_1003661552 | 101 |
| 97 | 3300006028 | Ga0070717_10013600 | Ga0070717_100136007 | 101 |
| 98 | 3300006028 | Ga0070717_10477044 | Ga0070717_104770442 | 101 |
| 99 | 3300006038 | Ga0075365_10849160 | Ga0075365_108491602 | 101 |
| 100 | 3300007076 | Ga0075435_101357572 | Ga0075435_1013575722 | 101 |
| 101 | 3300009176 | Ga0105242_11776964 | Ga0105242_117769642 | 101 |
| 102 | 3300025922 | Ga0207646_10617919 | Ga0207646_106179192 | 101 |
| 103 | 3300025928 | Ga0207700_11184650 | Ga0207700_111846501 | 101 |
| 104 | 3300025929 | Ga0207664_10035157 | Ga0207664_100351572 | 101 |
| 105 | 3300025934 | Ga0207686_11233929 | Ga0207686_112339292 | 101 |
| 106 | 3300039438 | Ga0436360_0134583 | Ga0436360_0134583_386_691 | 101 |
| 107 | 3300046679 | Ga0495623_0005723 | Ga0495623_0005723_5161_5493 | 101 |
| 108 | 3300048903 | Ga0496100_0974278 | Ga0496100_0974278_28_366 | 101 |
| 109 | 3300048911 | Ga0496108_0631030 | Ga0496108_0631030_520_858 | 101 |
| 110 | 3300048912 | Ga0496109_0344092 | Ga0496109_0344092_237_575 | 101 |
| 111 | 3300049582 | Ga0501048_0291163 | Ga0501048_0291163_752_1063 | 101 |
| 112 | 3300050513 | nmdc:mga0rr50_1006024_c1 | nmdc:mga0rr50_1006024_c1_101_439 | 101 |
| 113 | 3300050514 | nmdc:mga08x19_737301_c1 | nmdc:mga08x19_737301_c1_259_567 | 101 |
| 114 | 3300005327 | Ga0070658_10085504 | Ga0070658_100855044 | 102 |
| 115 | 3300005327 | Ga0070658_10566130 | Ga0070658_105661302 | 102 |
| 116 | 3300005336 | Ga0070680_100105611 | Ga0070680_1001056113 | 102 |
| 117 | 3300005434 | Ga0070709_10078187 | Ga0070709_100781872 | 102 |
| 118 | 3300005434 | Ga0070709_10463584 | Ga0070709_104635842 | 102 |
| 119 | 3300005434 | Ga0070709_11766686 | Ga0070709_117666861 | 102 |
| 120 | 3300005435 | Ga0070714_100002904 | Ga0070714_1000029048 | 102 |
| 121 | 3300005435 | Ga0070714_100112726 | Ga0070714_1001127263 | 102 |
| 122 | 3300005435 | Ga0070714_100431830 | Ga0070714_1004318302 | 102 |
| 123 | 3300005458 | Ga0070681_10226054 | Ga0070681_102260541 | 102 |
| 124 | 3300005471 | Ga0070698_100041252 | Ga0070698_1000412524 | 102 |
| 125 | 3300005530 | Ga0070679_100332401 | Ga0070679_1003324012 | 102 |
| 126 | 3300005535 | Ga0070684_101479769 | Ga0070684_1014797691 | 102 |
| 127 | 3300005563 | Ga0068855_100409946 | Ga0068855_1004099462 | 102 |
| 128 | 3300005614 | Ga0068856_100497399 | Ga0068856_1004973992 | 102 |
| 129 | 3300006173 | Ga0070716_101581982 | Ga0070716_1015819822 | 102 |
| 130 | 3300006175 | Ga0070712_100445355 | Ga0070712_1004453552 | 102 |
| 131 | 3300006914 | Ga0075436_100167210 | Ga0075436_1001672101 | 102 |
| 132 | 3300009545 | Ga0105237_12284450 | Ga0105237_122844501 | 102 |
| 133 | 3300013104 | Ga0157370_10141323 | Ga0157370_101413233 | 102 |
| 134 | 3300013104 | Ga0157370_11804151 | Ga0157370_118041511 | 102 |
| 135 | 3300013105 | Ga0157369_11246815 | Ga0157369_112468152 | 102 |
| 136 | 3300014497 | Ga0182008_10246628 | Ga0182008_102466282 | 102 |
| 137 | 3300015261 | Ga0182006_1016295 | Ga0182006_10162953 | 102 |
| 138 | 3300015262 | Ga0182007_10018540 | Ga0182007_100185402 | 102 |
| 139 | 3300021441 | Ga0213871_10030518 | Ga0213871_100305182 | 102 |
| 140 | 3300025906 | Ga0207699_10057762 | Ga0207699_100577623 | 102 |
| 141 | 3300025909 | Ga0207705_10067247 | Ga0207705_100672474 | 102 |
| 142 | 3300025909 | Ga0207705_10203568 | Ga0207705_102035681 | 102 |
| 143 | 3300025912 | Ga0207707_10190270 | Ga0207707_101902702 | 102 |
| 144 | 3300025915 | Ga0207693_10283420 | Ga0207693_102834202 | 102 |
| 145 | 3300025917 | Ga0207660_10083143 | Ga0207660_100831432 | 102 |
| 146 | 3300025921 | Ga0207652_10183542 | Ga0207652_101835423 | 102 |
| 147 | 3300025929 | Ga0207664_11021426 | Ga0207664_110214261 | 102 |
| 148 | 3300025929 | Ga0207664_11422224 | Ga0207664_114222241 | 102 |
| 149 | 3300025939 | Ga0207665_11381714 | Ga0207665_113817141 | 102 |
| 150 | 3300025944 | Ga0207661_10033486 | Ga0207661_100334866 | 102 |
| 151 | 3300025949 | Ga0207667_10460936 | Ga0207667_104609362 | 102 |
| 152 | 3300026041 | Ga0207639_12297231 | Ga0207639_122972311 | 102 |
| 153 | 3300026078 | Ga0207702_10189089 | Ga0207702_101890892 | 102 |
| 154 | 3300028563 | Ga0265319_1007813 | Ga0265319_10078132 | 102 |
| 155 | 3300028573 | Ga0265334_10075215 | Ga0265334_100752151 | 102 |
| 156 | 3300028577 | Ga0265318_10029227 | Ga0265318_100292273 | 102 |
| 157 | 3300028577 | Ga0265318_10038532 | Ga0265318_100385322 | 102 |
| 158 | 3300028654 | Ga0265322_10012790 | Ga0265322_100127902 | 102 |
| 159 | 3300028800 | Ga0265338_10042058 | Ga0265338_100420584 | 102 |
| 160 | 3300028800 | Ga0265338_10083009 | Ga0265338_100830093 | 102 |
| 161 | 3300029957 | Ga0265324_10083740 | Ga0265324_100837402 | 102 |
| 162 | 3300031235 | Ga0265330_10004373 | Ga0265330_100043736 | 102 |
| 163 | 3300031238 | Ga0265332_10374389 | Ga0265332_103743892 | 102 |
| 164 | 3300031238 | Ga0265332_10383295 | Ga0265332_103832951 | 102 |
| 165 | 3300031239 | Ga0265328_10068228 | Ga0265328_100682282 | 102 |
| 166 | 3300031240 | Ga0265320_10014307 | Ga0265320_100143072 | 102 |
| 167 | 3300031241 | Ga0265325_10045429 | Ga0265325_100454293 | 102 |
| 168 | 3300031242 | Ga0265329_10050423 | Ga0265329_100504232 | 102 |
| 169 | 3300031251 | Ga0265327_10063059 | Ga0265327_100630592 | 102 |
| 170 | 3300031251 | Ga0265327_10081029 | Ga0265327_100810292 | 102 |
| 171 | 3300031711 | Ga0265314_10093079 | Ga0265314_100930793 | 102 |
| 172 | 3300031712 | Ga0265342_10019089 | Ga0265342_100190892 | 102 |
| 173 | 3300035172 | Ga0373955_0035019 | Ga0373955_0035019_1328_1636 | 102 |
| 174 | 3300035724 | Ga0373933_0048671 | Ga0373933_0048671_1307_1615 | 102 |
| 175 | 3300036401 | Ga0373937_0317727 | Ga0373937_0317727_238_546 | 102 |
| 176 | 3300036401 | Ga0373937_1902801 | Ga0373937_1902801_59_367 | 102 |
| 177 | 3300037418 | Ga0395900_0388044 | Ga0395900_0388044_354_668 | 102 |
| 178 | 3300037466 | Ga0395898_0904405 | Ga0395898_0904405_24_332 | 102 |
| 179 | 3300037471 | Ga0395905_1042955 | Ga0395905_1042955_155_469 | 102 |
| 180 | 3300038443 | Ga0395901_1273572 | Ga0395901_1273572_284_595 | 102 |
| 181 | 3300039438 | Ga0436360_0249670 | Ga0436360_0249670_1943_2257 | 102 |
| 182 | 3300044683 | Ga0466965_0515727 | Ga0466965_0515727_133_441 | 102 |
| 183 | 3300044684 | Ga0466966_0085063 | Ga0466966_0085063_319_627 | 102 |
| 184 | 3300044693 | Ga0466961_0079263 | Ga0466961_0079263_174_482 | 102 |
| 185 | 3300044693 | Ga0466961_0418829 | Ga0466961_0418829_474_782 | 102 |
| 186 | 3300044694 | Ga0466963_0007182 | Ga0466963_0007182_5155_5463 | 102 |
| 187 | 3300044694 | Ga0466963_0499035 | Ga0466963_0499035_288_596 | 102 |
| 188 | 3300044694 | Ga0466963_0888203 | Ga0466963_0888203_11_319 | 102 |
| 189 | 3300044706 | Ga0466964_0207540 | Ga0466964_0207540_379_690 | 102 |
| 190 | 3300044706 | Ga0466964_0434408 | Ga0466964_0434408_332_640 | 102 |
| 191 | 3300044719 | Ga0466971_0295719 | Ga0466971_0295719_264_572 | 102 |
| 192 | 3300044765 | Ga0466970_0724194 | Ga0466970_0724194_263_571 | 102 |
| 193 | 3300044842 | Ga0466957_0317661 | Ga0466957_0317661_675_983 | 102 |
| 194 | 3300044842 | Ga0466957_0408286 | Ga0466957_0408286_489_797 | 102 |
| 195 | 3300044901 | Ga0466960_0471454 | Ga0466960_0471454_328_636 | 102 |
| 196 | 3300045049 | Ga0466959_0596101 | Ga0466959_0596101_420_728 | 102 |
| 197 | 3300045049 | Ga0466959_0874037 | Ga0466959_0874037_181_489 | 102 |
| 198 | 3300045051 | Ga0451576_2700887 | Ga0451576_2700887_161_472 | 102 |
| 199 | 3300045836 | Ga0466958_0000431 | Ga0466958_0000431_11052_11360 | 102 |
| 200 | 3300045836 | Ga0466958_0399438 | Ga0466958_0399438_513_821 | 102 |
| 201 | 3300045836 | Ga0466958_0551108 | Ga0466958_0551108_413_721 | 102 |
| 202 | 3300045976 | Ga0466967_0002063 | Ga0466967_0002063_4026_4334 | 102 |
| 203 | 3300045976 | Ga0466967_0099263 | Ga0466967_0099263_2207_2518 | 102 |
| 204 | 3300045976 | Ga0466967_0169342 | Ga0466967_0169342_141_452 | 102 |
| 205 | 3300045976 | Ga0466967_0199979 | Ga0466967_0199979_1570_1878 | 102 |
| 206 | 3300045976 | Ga0466967_0202306 | Ga0466967_0202306_1423_1740 | 102 |
| 207 | 3300045976 | Ga0466967_0718067 | Ga0466967_0718067_394_702 | 102 |
| 208 | 3300046459 | Ga0495629_0252307 | Ga0495629_0252307_61_369 | 102 |
| 209 | 3300046461 | Ga0495641_0114459 | Ga0495641_0114459_55_372 | 102 |
| 210 | 3300046461 | Ga0495641_0204830 | Ga0495641_0204830_91_408 | 102 |
| 211 | 3300046462 | Ga0495651_0161878 | Ga0495651_0161878_315_623 | 102 |
| 212 | 3300046463 | Ga0495653_0151920 | Ga0495653_0151920_233_541 | 102 |
| 213 | 3300046463 | Ga0495653_0861213 | Ga0495653_0861213_93_401 | 102 |
| 214 | 3300046475 | Ga0495639_0340620 | Ga0495639_0340620_78_395 | 102 |
| 215 | 3300046511 | Ga0495608_0014722 | Ga0495608_0014722_4658_4966 | 102 |
| 216 | 3300046514 | Ga0495618_0067575 | Ga0495618_0067575_562_870 | 102 |
| 217 | 3300046517 | Ga0495630_1362339 | Ga0495630_1362339_104_421 | 102 |
| 218 | 3300046529 | Ga0495652_0232474 | Ga0495652_0232474_921_1229 | 102 |
| 219 | 3300046533 | Ga0495640_0125500 | Ga0495640_0125500_158_466 | 102 |
| 220 | 3300046559 | Ga0495667_0193124 | Ga0495667_0193124_384_692 | 102 |
| 221 | 3300046642 | Ga0495634_0200725 | Ga0495634_0200725_809_1117 | 102 |
| 222 | 3300046663 | Ga0495635_0159815 | Ga0495635_0159815_1001_1309 | 102 |
| 223 | 3300046663 | Ga0495635_0816601 | Ga0495635_0816601_158_475 | 102 |
| 224 | 3300046675 | Ga0495657_0037285 | Ga0495657_0037285_1734_2042 | 102 |
| 225 | 3300046678 | Ga0495599_0463928 | Ga0495599_0463928_13_321 | 102 |
| 226 | 3300047317 | Ga0495604_0601678 | Ga0495604_0601678_294_602 | 102 |
| 227 | 3300047319 | Ga0495674_0493489 | Ga0495674_0493489_29_346 | 102 |
| 228 | 3300047322 | Ga0495680_0037008 | Ga0495680_0037008_2374_2682 | 102 |
| 229 | 3300047444 | Ga0495675_0355316 | Ga0495675_0355316_396_704 | 102 |
| 230 | 3300047471 | Ga0495684_0027689 | Ga0495684_0027689_1507_1815 | 102 |
| 231 | 3300047471 | Ga0495684_0516700 | Ga0495684_0516700_481_789 | 102 |
| 232 | 3300048088 | Ga0495602_0678536 | Ga0495602_0678536_86_394 | 102 |
| 233 | 3300048904 | Ga0496101_0952560 | Ga0496101_0952560_294_605 | 102 |
| 234 | 3300048905 | Ga0496102_0100308 | Ga0496102_0100308_55_366 | 102 |
| 235 | 3300048908 | Ga0496105_0845583 | Ga0496105_0845583_260_577 | 102 |
| 236 | 3300048909 | Ga0496106_0030068 | Ga0496106_0030068_2358_2669 | 102 |
| 237 | 3300048910 | Ga0496107_0155954 | Ga0496107_0155954_1184_1495 | 102 |
| 238 | 3300048915 | Ga0496112_0289113 | Ga0496112_0289113_390_707 | 102 |
| 239 | 3300048916 | Ga0496113_0181263 | Ga0496113_0181263_1313_1624 | 102 |
| 240 | 3300048918 | Ga0496115_0043589 | Ga0496115_0043589_1211_1528 | 102 |
| 241 | 3300049571 | Ga0501034_0004589 | Ga0501034_0004589_6383_6694 | 102 |
| 242 | 3300049574 | Ga0501038_0655408 | Ga0501038_0655408_202_513 | 102 |
| 243 | 3300049583 | Ga0501067_0027300 | Ga0501067_0027300_1172_1480 | 102 |
| 244 | 3300049583 | Ga0501067_0238382 | Ga0501067_0238382_42_353 | 102 |
| 245 | 3300049585 | Ga0501069_0019863 | Ga0501069_0019863_285_593 | 102 |
| 246 | 3300049586 | Ga0501070_0025291 | Ga0501070_0025291_1914_2225 | 102 |
| 247 | 3300049586 | Ga0501070_0051543 | Ga0501070_0051543_3062_3373 | 102 |
| 248 | 3300049588 | Ga0501072_0015894 | Ga0501072_0015894_2844_3155 | 102 |
| 249 | 3300049589 | Ga0501073_0052133 | Ga0501073_0052133_1905_2216 | 102 |
| 250 | 3300049590 | Ga0501074_0017998 | Ga0501074_0017998_2470_2781 | 102 |
| 251 | 3300049741 | Ga0501079_0036453 | Ga0501079_0036453_1673_1984 | 102 |
| 252 | 3300049742 | Ga0501080_0000535 | Ga0501080_0000535_3132_3443 | 102 |
| 253 | 3300049742 | Ga0501080_0007055 | Ga0501080_0007055_775_1086 | 102 |
| 254 | 3300049744 | Ga0501083_0011627 | Ga0501083_0011627_79_390 | 102 |
| 255 | 3300053077 | Ga0495601_0167849 | Ga0495601_0167849_51_368 | 102 |
| 256 | 3300053077 | Ga0495601_0525157 | Ga0495601_0525157_296_613 | 102 |
| 257 | 3300053077 | Ga0495601_0670365 | Ga0495601_0670365_47_355 | 102 |
| 258 | 3300053084 | Ga0495595_0010303 | Ga0495595_0010303_3369_3677 | 102 |
| 259 | 3300053085 | Ga0495619_0296165 | Ga0495619_0296165_720_1037 | 102 |
| 260 | 3300060353 | Ga0501082_0804749 | Ga0501082_0804749_442_753 | 102 |
| 261 | 3300061719 | Ga0466962_0382425 | Ga0466962_0382425_96_404 | 102 |
| 262 | 3300005329 | Ga0070683_100000682 | Ga0070683_10000068216 | 103 |
| 263 | 3300005329 | Ga0070683_100046995 | Ga0070683_1000469953 | 103 |
| 264 | 3300005336 | Ga0070680_100210240 | Ga0070680_1002102402 | 103 |
| 265 | 3300005336 | Ga0070680_100445605 | Ga0070680_1004456052 | 103 |
| 266 | 3300005336 | Ga0070680_100564676 | Ga0070680_1005646762 | 103 |
| 267 | 3300005337 | Ga0070682_100015147 | Ga0070682_1000151472 | 103 |
| 268 | 3300005337 | Ga0070682_101354349 | Ga0070682_1013543491 | 103 |
| 269 | 3300005338 | Ga0068868_101450820 | Ga0068868_1014508201 | 103 |
| 270 | 3300005339 | Ga0070660_100031738 | Ga0070660_1000317383 | 103 |
| 271 | 3300005341 | Ga0070691_10056155 | Ga0070691_100561553 | 103 |
| 272 | 3300005343 | Ga0070687_101231344 | Ga0070687_1012313441 | 103 |
| 273 | 3300005344 | Ga0070661_100952102 | Ga0070661_1009521021 | 103 |
| 274 | 3300005355 | Ga0070671_100034613 | Ga0070671_1000346133 | 103 |
| 275 | 3300005366 | Ga0070659_100846421 | Ga0070659_1008464212 | 103 |
| 276 | 3300005366 | Ga0070659_100857674 | Ga0070659_1008576741 | 103 |
| 277 | 3300005434 | Ga0070709_10008335 | Ga0070709_100083355 | 103 |
| 278 | 3300005434 | Ga0070709_10090319 | Ga0070709_100903192 | 103 |
| 279 | 3300005435 | Ga0070714_100049516 | Ga0070714_1000495163 | 103 |
| 280 | 3300005435 | Ga0070714_100092539 | Ga0070714_1000925394 | 103 |
| 281 | 3300005435 | Ga0070714_100094496 | Ga0070714_1000944962 | 103 |
| 282 | 3300005435 | Ga0070714_100215384 | Ga0070714_1002153842 | 103 |
| 283 | 3300005435 | Ga0070714_100218997 | Ga0070714_1002189972 | 103 |
| 284 | 3300005436 | Ga0070713_100000801 | Ga0070713_1000008018 | 103 |
| 285 | 3300005437 | Ga0070710_10009224 | Ga0070710_100092242 | 103 |
| 286 | 3300005437 | Ga0070710_10025527 | Ga0070710_100255272 | 103 |
| 287 | 3300005437 | Ga0070710_10512121 | Ga0070710_105121212 | 103 |
| 288 | 3300005439 | Ga0070711_100002572 | Ga0070711_1000025726 | 103 |
| 289 | 3300005439 | Ga0070711_100053954 | Ga0070711_1000539542 | 103 |
| 290 | 3300005439 | Ga0070711_101064732 | Ga0070711_1010647322 | 103 |
| 291 | 3300005444 | Ga0070694_100247988 | Ga0070694_1002479882 | 103 |
| 292 | 3300005445 | Ga0070708_100635391 | Ga0070708_1006353912 | 103 |
| 293 | 3300005458 | Ga0070681_10046923 | Ga0070681_100469233 | 103 |
| 294 | 3300005458 | Ga0070681_10071171 | Ga0070681_100711713 | 103 |
| 295 | 3300005458 | Ga0070681_10082518 | Ga0070681_100825185 | 103 |
| 296 | 3300005458 | Ga0070681_10190835 | Ga0070681_101908353 | 103 |
| 297 | 3300005467 | Ga0070706_100718497 | Ga0070706_1007184972 | 103 |
| 298 | 3300005467 | Ga0070706_101700403 | Ga0070706_1017004031 | 103 |
| 299 | 3300005468 | Ga0070707_100022323 | Ga0070707_1000223234 | 103 |
| 300 | 3300005468 | Ga0070707_100035404 | Ga0070707_1000354044 | 103 |
| 301 | 3300005468 | Ga0070707_100243368 | Ga0070707_1002433682 | 103 |
| 302 | 3300005468 | Ga0070707_100880331 | Ga0070707_1008803312 | 103 |
| 303 | 3300005471 | Ga0070698_100049309 | Ga0070698_1000493093 | 103 |
| 304 | 3300005471 | Ga0070698_100133400 | Ga0070698_1001334003 | 103 |
| 305 | 3300005518 | Ga0070699_100274647 | Ga0070699_1002746473 | 103 |
| 306 | 3300005518 | Ga0070699_100437513 | Ga0070699_1004375132 | 103 |
| 307 | 3300005530 | Ga0070679_100031188 | Ga0070679_1000311882 | 103 |
| 308 | 3300005530 | Ga0070679_100091661 | Ga0070679_1000916613 | 103 |
| 309 | 3300005530 | Ga0070679_100179570 | Ga0070679_1001795702 | 103 |
| 310 | 3300005535 | Ga0070684_100008210 | Ga0070684_1000082103 | 103 |
| 311 | 3300005535 | Ga0070684_100071994 | Ga0070684_1000719943 | 103 |
| 312 | 3300005546 | Ga0070696_100815919 | Ga0070696_1008159192 | 103 |
| 313 | 3300005547 | Ga0070693_100409806 | Ga0070693_1004098062 | 103 |
| 314 | 3300005549 | Ga0070704_100109343 | Ga0070704_1001093432 | 103 |
| 315 | 3300005563 | Ga0068855_100818834 | Ga0068855_1008188342 | 103 |
| 316 | 3300005564 | Ga0070664_101171552 | Ga0070664_1011715522 | 103 |
| 317 | 3300005577 | Ga0068857_100199718 | Ga0068857_1001997183 | 103 |
| 318 | 3300005614 | Ga0068856_100098406 | Ga0068856_1000984065 | 103 |
| 319 | 3300005614 | Ga0068856_100115279 | Ga0068856_1001152793 | 103 |
| 320 | 3300005614 | Ga0068856_100427551 | Ga0068856_1004275512 | 103 |
| 321 | 3300005615 | Ga0070702_100050938 | Ga0070702_1000509383 | 103 |
| 322 | 3300005616 | Ga0068852_101257571 | Ga0068852_1012575711 | 103 |
| 323 | 3300005842 | Ga0068858_100683461 | Ga0068858_1006834612 | 103 |
| 324 | 3300005843 | Ga0068860_101767756 | Ga0068860_1017677562 | 103 |
| 325 | 3300006028 | Ga0070717_10007082 | Ga0070717_100070823 | 103 |
| 326 | 3300006028 | Ga0070717_10031923 | Ga0070717_100319233 | 103 |
| 327 | 3300006028 | Ga0070717_10049217 | Ga0070717_100492173 | 103 |
| 328 | 3300006028 | Ga0070717_10919315 | Ga0070717_109193151 | 103 |
| 329 | 3300006163 | Ga0070715_10005269 | Ga0070715_100052694 | 103 |
| 330 | 3300006173 | Ga0070716_100018111 | Ga0070716_1000181112 | 103 |
| 331 | 3300006173 | Ga0070716_100210958 | Ga0070716_1002109582 | 103 |
| 332 | 3300006173 | Ga0070716_100436688 | Ga0070716_1004366882 | 103 |
| 333 | 3300006175 | Ga0070712_100028000 | Ga0070712_1000280001 | 103 |
| 334 | 3300006175 | Ga0070712_100058473 | Ga0070712_1000584733 | 103 |
| 335 | 3300006852 | Ga0075433_10324794 | Ga0075433_103247942 | 103 |
| 336 | 3300006852 | Ga0075433_10430070 | Ga0075433_104300702 | 103 |
| 337 | 3300006871 | Ga0075434_100013210 | Ga0075434_1000132109 | 103 |
| 338 | 3300006881 | Ga0068865_100417737 | Ga0068865_1004177372 | 103 |
| 339 | 3300006914 | Ga0075436_101282923 | Ga0075436_1012829231 | 103 |
| 340 | 3300007076 | Ga0075435_100725352 | Ga0075435_1007253522 | 103 |
| 341 | 3300007788 | Ga0099795_10454618 | Ga0099795_104546181 | 103 |
| 342 | 3300009093 | Ga0105240_10037102 | Ga0105240_100371025 | 103 |
| 343 | 3300009093 | Ga0105240_10640569 | Ga0105240_106405692 | 103 |
| 344 | 3300009093 | Ga0105240_10808587 | Ga0105240_108085872 | 103 |
| 345 | 3300009093 | Ga0105240_11669978 | Ga0105240_116699781 | 103 |
| 346 | 3300009094 | Ga0111539_11408433 | Ga0111539_114084332 | 103 |
| 347 | 3300009098 | Ga0105245_10173604 | Ga0105245_101736042 | 103 |
| 348 | 3300009098 | Ga0105245_10496423 | Ga0105245_104964231 | 103 |
| 349 | 3300009101 | Ga0105247_10055600 | Ga0105247_100556002 | 103 |
| 350 | 3300009147 | Ga0114129_11629417 | Ga0114129_116294172 | 103 |
| 351 | 3300009176 | Ga0105242_10433116 | Ga0105242_104331162 | 103 |
| 352 | 3300009176 | Ga0105242_10525862 | Ga0105242_105258622 | 103 |
| 353 | 3300009177 | Ga0105248_10493375 | Ga0105248_104933752 | 103 |
| 354 | 3300009177 | Ga0105248_10780279 | Ga0105248_107802792 | 103 |
| 355 | 3300009177 | Ga0105248_10806199 | Ga0105248_108061992 | 103 |
| 356 | 3300009545 | Ga0105237_12118390 | Ga0105237_121183902 | 103 |
| 357 | 3300009551 | Ga0105238_10035269 | Ga0105238_100352692 | 103 |
| 358 | 3300009551 | Ga0105238_11299361 | Ga0105238_112993612 | 103 |
| 359 | 3300010159 | Ga0099796_10360770 | Ga0099796_103607701 | 103 |
| 360 | 3300010375 | Ga0105239_10125430 | Ga0105239_101254302 | 103 |
| 361 | 3300010375 | Ga0105239_10606228 | Ga0105239_106062282 | 103 |
| 362 | 3300013100 | Ga0157373_10608029 | Ga0157373_106080292 | 103 |
| 363 | 3300013104 | Ga0157370_10530462 | Ga0157370_105304622 | 103 |
| 364 | 3300013104 | Ga0157370_10605538 | Ga0157370_106055382 | 103 |
| 365 | 3300013104 | Ga0157370_11335105 | Ga0157370_113351052 | 103 |
| 366 | 3300013105 | Ga0157369_10019029 | Ga0157369_100190298 | 103 |
| 367 | 3300013105 | Ga0157369_10416301 | Ga0157369_104163012 | 103 |
| 368 | 3300013105 | Ga0157369_10586687 | Ga0157369_105866872 | 103 |
| 369 | 3300013296 | Ga0157374_10120956 | Ga0157374_101209562 | 103 |
| 370 | 3300013296 | Ga0157374_10139452 | Ga0157374_101394522 | 103 |
| 371 | 3300013296 | Ga0157374_10882096 | Ga0157374_108820961 | 103 |
| 372 | 3300013297 | Ga0157378_11129856 | Ga0157378_111298562 | 103 |
| 373 | 3300013306 | Ga0163162_10245382 | Ga0163162_102453823 | 103 |
| 374 | 3300013307 | Ga0157372_10095372 | Ga0157372_100953725 | 103 |
| 375 | 3300013307 | Ga0157372_10458840 | Ga0157372_104588402 | 103 |
| 376 | 3300013307 | Ga0157372_10560087 | Ga0157372_105600872 | 103 |
| 377 | 3300013307 | Ga0157372_10990852 | Ga0157372_109908522 | 103 |
| 378 | 3300013307 | Ga0157372_11772468 | Ga0157372_117724681 | 103 |
| 379 | 3300013307 | Ga0157372_12066558 | Ga0157372_120665582 | 103 |
| 380 | 3300013308 | Ga0157375_10327714 | Ga0157375_103277142 | 103 |
| 381 | 3300014325 | Ga0163163_12825034 | Ga0163163_128250341 | 103 |
| 382 | 3300014497 | Ga0182008_10016723 | Ga0182008_100167233 | 103 |
| 383 | 3300014497 | Ga0182008_10099413 | Ga0182008_100994132 | 103 |
| 384 | 3300014497 | Ga0182008_10523615 | Ga0182008_105236152 | 103 |
| 385 | 3300014497 | Ga0182008_10584864 | Ga0182008_105848642 | 103 |
| 386 | 3300014497 | Ga0182008_10882034 | Ga0182008_108820341 | 103 |
| 387 | 3300014968 | Ga0157379_10191763 | Ga0157379_101917632 | 103 |
| 388 | 3300014969 | Ga0157376_10017404 | Ga0157376_100174043 | 103 |
| 389 | 3300014969 | Ga0157376_11582992 | Ga0157376_115829922 | 103 |
| 390 | 3300014969 | Ga0157376_12130055 | Ga0157376_121300551 | 103 |
| 391 | 3300020081 | Ga0206354_10531976 | Ga0206354_105319762 | 103 |
| 392 | 3300020082 | Ga0206353_10289596 | Ga0206353_102895962 | 103 |
| 393 | 3300020082 | Ga0206353_11314291 | Ga0206353_113142912 | 103 |
| 394 | 3300021377 | Ga0213874_10046469 | Ga0213874_100464692 | 103 |
| 395 | 3300022467 | Ga0224712_10655245 | Ga0224712_106552451 | 103 |
| 396 | 3300025898 | Ga0207692_10023816 | Ga0207692_100238163 | 103 |
| 397 | 3300025898 | Ga0207692_10037256 | Ga0207692_100372563 | 103 |
| 398 | 3300025900 | Ga0207710_10062626 | Ga0207710_100626262 | 103 |
| 399 | 3300025904 | Ga0207647_10590702 | Ga0207647_105907022 | 103 |
| 400 | 3300025905 | Ga0207685_10001113 | Ga0207685_100011132 | 103 |
| 401 | 3300025906 | Ga0207699_10026168 | Ga0207699_100261682 | 103 |
| 402 | 3300025906 | Ga0207699_10068842 | Ga0207699_100688423 | 103 |
| 403 | 3300025906 | Ga0207699_10069126 | Ga0207699_100691262 | 103 |
| 404 | 3300025909 | Ga0207705_10065177 | Ga0207705_100651773 | 103 |
| 405 | 3300025910 | Ga0207684_10828969 | Ga0207684_108289692 | 103 |
| 406 | 3300025912 | Ga0207707_10095478 | Ga0207707_100954782 | 103 |
| 407 | 3300025912 | Ga0207707_10112571 | Ga0207707_101125713 | 103 |
| 408 | 3300025912 | Ga0207707_10231095 | Ga0207707_102310951 | 103 |
| 409 | 3300025913 | Ga0207695_10225920 | Ga0207695_102259203 | 103 |
| 410 | 3300025915 | Ga0207693_10000814 | Ga0207693_100008148 | 103 |
| 411 | 3300025915 | Ga0207693_10000920 | Ga0207693_100009203 | 103 |
| 412 | 3300025915 | Ga0207693_10065202 | Ga0207693_100652022 | 103 |
| 413 | 3300025916 | Ga0207663_10015847 | Ga0207663_100158475 | 103 |
| 414 | 3300025916 | Ga0207663_10096802 | Ga0207663_100968022 | 103 |
| 415 | 3300025916 | Ga0207663_11134982 | Ga0207663_111349822 | 103 |
| 416 | 3300025917 | Ga0207660_10309987 | Ga0207660_103099873 | 103 |
| 417 | 3300025917 | Ga0207660_10527571 | Ga0207660_105275712 | 103 |
| 418 | 3300025918 | Ga0207662_10435502 | Ga0207662_104355022 | 103 |
| 419 | 3300025919 | Ga0207657_10008838 | Ga0207657_100088386 | 103 |
| 420 | 3300025920 | Ga0207649_10142378 | Ga0207649_101423782 | 103 |
| 421 | 3300025921 | Ga0207652_10011197 | Ga0207652_100111974 | 103 |
| 422 | 3300025921 | Ga0207652_10071202 | Ga0207652_100712023 | 103 |
| 423 | 3300025921 | Ga0207652_10109179 | Ga0207652_101091793 | 103 |
| 424 | 3300025921 | Ga0207652_10176255 | Ga0207652_101762552 | 103 |
| 425 | 3300025921 | Ga0207652_10418300 | Ga0207652_104183002 | 103 |
| 426 | 3300025922 | Ga0207646_10001386 | Ga0207646_1000138612 | 103 |
| 427 | 3300025922 | Ga0207646_10035040 | Ga0207646_100350404 | 103 |
| 428 | 3300025927 | Ga0207687_10241320 | Ga0207687_102413202 | 103 |
| 429 | 3300025928 | Ga0207700_10026419 | Ga0207700_100264192 | 103 |
| 430 | 3300025928 | Ga0207700_10194226 | Ga0207700_101942261 | 103 |
| 431 | 3300025928 | Ga0207700_10560598 | Ga0207700_105605982 | 103 |
| 432 | 3300025929 | Ga0207664_10001397 | Ga0207664_100013979 | 103 |
| 433 | 3300025929 | Ga0207664_10017802 | Ga0207664_100178026 | 103 |
| 434 | 3300025929 | Ga0207664_10032295 | Ga0207664_100322953 | 103 |
| 435 | 3300025929 | Ga0207664_10190644 | Ga0207664_101906442 | 103 |
| 436 | 3300025929 | Ga0207664_10200363 | Ga0207664_102003632 | 103 |
| 437 | 3300025929 | Ga0207664_10207285 | Ga0207664_102072853 | 103 |
| 438 | 3300025929 | Ga0207664_10707705 | Ga0207664_107077052 | 103 |
| 439 | 3300025929 | Ga0207664_11479422 | Ga0207664_114794221 | 103 |
| 440 | 3300025931 | Ga0207644_10083224 | Ga0207644_100832242 | 103 |
| 441 | 3300025931 | Ga0207644_10386778 | Ga0207644_103867781 | 103 |
| 442 | 3300025932 | Ga0207690_10251900 | Ga0207690_102519002 | 103 |
| 443 | 3300025932 | Ga0207690_11346899 | Ga0207690_113468991 | 103 |
| 444 | 3300025932 | Ga0207690_11811886 | Ga0207690_118118861 | 103 |
| 445 | 3300025934 | Ga0207686_10536237 | Ga0207686_105362372 | 103 |
| 446 | 3300025938 | Ga0207704_10421870 | Ga0207704_104218702 | 103 |
| 447 | 3300025939 | Ga0207665_10000247 | Ga0207665_100002478 | 103 |
| 448 | 3300025939 | Ga0207665_10075321 | Ga0207665_100753213 | 103 |
| 449 | 3300025939 | Ga0207665_10360193 | Ga0207665_103601932 | 103 |
| 450 | 3300025939 | Ga0207665_10551896 | Ga0207665_105518962 | 103 |
| 451 | 3300025941 | Ga0207711_10280780 | Ga0207711_102807802 | 103 |
| 452 | 3300025941 | Ga0207711_10429780 | Ga0207711_104297802 | 103 |
| 453 | 3300025941 | Ga0207711_10464403 | Ga0207711_104644032 | 103 |
| 454 | 3300025941 | Ga0207711_10964423 | Ga0207711_109644231 | 103 |
| 455 | 3300025944 | Ga0207661_10025875 | Ga0207661_100258753 | 103 |
| 456 | 3300025944 | Ga0207661_10266862 | Ga0207661_102668622 | 103 |
| 457 | 3300025945 | Ga0207679_10479241 | Ga0207679_104792412 | 103 |
| 458 | 3300025949 | Ga0207667_10700870 | Ga0207667_107008702 | 103 |
| 459 | 3300026023 | Ga0207677_11062385 | Ga0207677_110623851 | 103 |
| 460 | 3300026067 | Ga0207678_11260407 | Ga0207678_112604071 | 103 |
| 461 | 3300026078 | Ga0207702_10088815 | Ga0207702_100888151 | 103 |
| 462 | 3300026078 | Ga0207702_11085766 | Ga0207702_110857662 | 103 |
| 463 | 3300026088 | Ga0207641_10290913 | Ga0207641_102909132 | 103 |
| 464 | 3300026116 | Ga0207674_10124716 | Ga0207674_101247163 | 103 |
| 465 | 3300026121 | Ga0207683_10147298 | Ga0207683_101472983 | 103 |
| 466 | 3300028563 | Ga0265319_1025818 | Ga0265319_10258182 | 103 |
| 467 | 3300028563 | Ga0265319_1187408 | Ga0265319_11874082 | 103 |
| 468 | 3300028573 | Ga0265334_10059590 | Ga0265334_100595902 | 103 |
| 469 | 3300028573 | Ga0265334_10248913 | Ga0265334_102489132 | 103 |
| 470 | 3300028577 | Ga0265318_10077287 | Ga0265318_100772872 | 103 |
| 471 | 3300028654 | Ga0265322_10048347 | Ga0265322_100483471 | 103 |
| 472 | 3300028666 | Ga0265336_10001699 | Ga0265336_1000169910 | 103 |
| 473 | 3300028666 | Ga0265336_10037811 | Ga0265336_100378112 | 103 |
| 474 | 3300028800 | Ga0265338_10002456 | Ga0265338_100024567 | 103 |
| 475 | 3300028800 | Ga0265338_10011083 | Ga0265338_100110832 | 103 |
| 476 | 3300028800 | Ga0265338_10072190 | Ga0265338_100721903 | 103 |
| 477 | 3300028800 | Ga0265338_10113409 | Ga0265338_101134092 | 103 |
| 478 | 3300028800 | Ga0265338_10195867 | Ga0265338_101958671 | 103 |
| 479 | 3300031235 | Ga0265330_10094669 | Ga0265330_100946691 | 103 |
| 480 | 3300031240 | Ga0265320_10169979 | Ga0265320_101699792 | 103 |
| 481 | 3300031241 | Ga0265325_10079377 | Ga0265325_100793771 | 103 |
| 482 | 3300031250 | Ga0265331_10030596 | Ga0265331_100305962 | 103 |
| 483 | 3300031595 | Ga0265313_10028666 | Ga0265313_100286664 | 103 |
| 484 | 3300031711 | Ga0265314_10104317 | Ga0265314_101043173 | 103 |
| 485 | 3300031712 | Ga0265342_10240671 | Ga0265342_102406712 | 103 |
| 486 | 3300031712 | Ga0265342_10528442 | Ga0265342_105284422 | 103 |
| 487 | 3300035083 | Ga0373926_0012170 | Ga0373926_0012170_2336_2677 | 103 |
| 488 | 3300035085 | Ga0373929_0198666 | Ga0373929_0198666_94_432 | 103 |
| 489 | 3300035086 | Ga0373934_0192213 | Ga0373934_0192213_300_638 | 103 |
| 490 | 3300035089 | Ga0373944_0136839 | Ga0373944_0136839_195_536 | 103 |
| 491 | 3300035090 | Ga0373949_0013045 | Ga0373949_0013045_219_563 | 103 |
| 492 | 3300035091 | Ga0373951_0139555 | Ga0373951_0139555_10_354 | 103 |
| 493 | 3300035111 | Ga0373923_0601161 | Ga0373923_0601161_55_369 | 103 |
| 494 | 3300035113 | Ga0373936_0125929 | Ga0373936_0125929_18_359 | 103 |
| 495 | 3300035116 | Ga0373945_0581142 | Ga0373945_0581142_29_367 | 103 |
| 496 | 3300035119 | Ga0373956_0463976 | Ga0373956_0463976_93_428 | 103 |
| 497 | 3300035120 | Ga0373957_0313898 | Ga0373957_0313898_134_472 | 103 |
| 498 | 3300035121 | Ga0373960_0292337 | Ga0373960_0292337_61_399 | 103 |
| 499 | 3300035170 | Ga0373943_0001012 | Ga0373943_0001012_10514_10855 | 103 |
| 500 | 3300035170 | Ga0373943_0503745 | Ga0373943_0503745_219_563 | 103 |
| 501 | 3300035171 | Ga0373946_0063315 | Ga0373946_0063315_858_1199 | 103 |
| 502 | 3300035172 | Ga0373955_1019257 | Ga0373955_1019257_47_385 | 103 |
| 503 | 3300035241 | Ga0373961_0243972 | Ga0373961_0243972_60_398 | 103 |
| 504 | 3300035691 | Ga0373931_0010780 | Ga0373931_0010780_3263_3607 | 103 |
| 505 | 3300035692 | Ga0373935_0047048 | Ga0373935_0047048_946_1287 | 103 |
| 506 | 3300035695 | Ga0373927_0049245 | Ga0373927_0049245_549_890 | 103 |
| 507 | 3300035725 | Ga0373947_0001552 | Ga0373947_0001552_8847_9188 | 103 |
| 508 | 3300036401 | Ga0373937_0000355 | Ga0373937_0000355_8876_9211 | 103 |
| 509 | 3300036401 | Ga0373937_0379173 | Ga0373937_0379173_328_666 | 103 |
| 510 | 3300037068 | Ga0373925_0007406 | Ga0373925_0007406_3722_4063 | 103 |
| 511 | 3300037312 | Ga0395899_0102523 | Ga0395899_0102523_217_555 | 103 |
| 512 | 3300037312 | Ga0395899_0143077 | Ga0395899_0143077_1029_1343 | 103 |
| 513 | 3300037418 | Ga0395900_0140283 | Ga0395900_0140283_1847_2161 | 103 |
| 514 | 3300037418 | Ga0395900_0221277 | Ga0395900_0221277_762_1100 | 103 |
| 515 | 3300037418 | Ga0395900_0709558 | Ga0395900_0709558_175_513 | 103 |
| 516 | 3300037466 | Ga0395898_0796814 | Ga0395898_0796814_154_465 | 103 |
| 517 | 3300037466 | Ga0395898_0917966 | Ga0395898_0917966_287_625 | 103 |
| 518 | 3300037466 | Ga0395898_0924804 | Ga0395898_0924804_109_447 | 103 |
| 519 | 3300037466 | Ga0395898_1457309 | Ga0395898_1457309_175_486 | 103 |
| 520 | 3300037471 | Ga0395905_0248304 | Ga0395905_0248304_676_990 | 103 |
| 521 | 3300037471 | Ga0395905_1146403 | Ga0395905_1146403_145_486 | 103 |
| 522 | 3300037471 | Ga0395905_1557016 | Ga0395905_1557016_200_511 | 103 |
| 523 | 3300038443 | Ga0395901_0789678 | Ga0395901_0789678_561_899 | 103 |
| 524 | 3300038443 | Ga0395901_1129757 | Ga0395901_1129757_364_702 | 103 |
| 525 | 3300038443 | Ga0395901_1289827 | Ga0395901_1289827_315_629 | 103 |
| 526 | 3300039450 | Ga0436363_0296049 | Ga0436363_0296049_651_986 | 103 |
| 527 | 3300041505 | Ga0451849_1048234 | Ga0451849_1048234_1129_1467 | 103 |
| 528 | 3300041512 | Ga0451853_1958868 | Ga0451853_1958868_184_522 | 103 |
| 529 | 3300042005 | Ga0439448_0047072 | Ga0439448_0047072_900_1211 | 103 |
| 530 | 3300044656 | Ga0466969_0003223 | Ga0466969_0003223_6515_6853 | 103 |
| 531 | 3300044656 | Ga0466969_0083616 | Ga0466969_0083616_537_872 | 103 |
| 532 | 3300044656 | Ga0466969_0274891 | Ga0466969_0274891_11_346 | 103 |
| 533 | 3300044658 | Ga0466972_0569304 | Ga0466972_0569304_156_494 | 103 |
| 534 | 3300044683 | Ga0466965_0050616 | Ga0466965_0050616_333_677 | 103 |
| 535 | 3300044683 | Ga0466965_0052097 | Ga0466965_0052097_225_569 | 103 |
| 536 | 3300044683 | Ga0466965_0080484 | Ga0466965_0080484_1143_1481 | 103 |
| 537 | 3300044684 | Ga0466966_0090799 | Ga0466966_0090799_419_754 | 103 |
| 538 | 3300044684 | Ga0466966_0254890 | Ga0466966_0254890_446_781 | 103 |
| 539 | 3300044684 | Ga0466966_0319246 | Ga0466966_0319246_216_554 | 103 |
| 540 | 3300044684 | Ga0466966_0745912 | Ga0466966_0745912_192_503 | 103 |
| 541 | 3300044693 | Ga0466961_0005282 | Ga0466961_0005282_2338_2679 | 103 |
| 542 | 3300044693 | Ga0466961_0008879 | Ga0466961_0008879_2407_2742 | 103 |
| 543 | 3300044693 | Ga0466961_0106343 | Ga0466961_0106343_1049_1387 | 103 |
| 544 | 3300044693 | Ga0466961_0133855 | Ga0466961_0133855_904_1248 | 103 |
| 545 | 3300044694 | Ga0466963_0000010 | Ga0466963_0000010_57384_57725 | 103 |
| 546 | 3300044694 | Ga0466963_0000649 | Ga0466963_0000649_2984_3328 | 103 |
| 547 | 3300044694 | Ga0466963_0001770 | Ga0466963_0001770_3386_3718 | 103 |
| 548 | 3300044694 | Ga0466963_0002000 | Ga0466963_0002000_6204_6548 | 103 |
| 549 | 3300044694 | Ga0466963_0004407 | Ga0466963_0004407_4329_4664 | 103 |
| 550 | 3300044694 | Ga0466963_0004464 | Ga0466963_0004464_1292_1627 | 103 |
| 551 | 3300044694 | Ga0466963_0010186 | Ga0466963_0010186_2406_2744 | 103 |
| 552 | 3300044694 | Ga0466963_0013797 | Ga0466963_0013797_1439_1780 | 103 |
| 553 | 3300044694 | Ga0466963_0023343 | Ga0466963_0023343_2659_2997 | 103 |
| 554 | 3300044694 | Ga0466963_0034779 | Ga0466963_0034779_1104_1439 | 103 |
| 555 | 3300044694 | Ga0466963_0061633 | Ga0466963_0061633_581_916 | 103 |
| 556 | 3300044694 | Ga0466963_0165855 | Ga0466963_0165855_664_1008 | 103 |
| 557 | 3300044694 | Ga0466963_0171253 | Ga0466963_0171253_13_324 | 103 |
| 558 | 3300044694 | Ga0466963_0284073 | Ga0466963_0284073_416_760 | 103 |
| 559 | 3300044694 | Ga0466963_0299326 | Ga0466963_0299326_658_969 | 103 |
| 560 | 3300044694 | Ga0466963_0808330 | Ga0466963_0808330_236_574 | 103 |
| 561 | 3300044706 | Ga0466964_0000213 | Ga0466964_0000213_2559_2903 | 103 |
| 562 | 3300044706 | Ga0466964_0008591 | Ga0466964_0008591_1935_2273 | 103 |
| 563 | 3300044706 | Ga0466964_0023691 | Ga0466964_0023691_2029_2373 | 103 |
| 564 | 3300044706 | Ga0466964_0031496 | Ga0466964_0031496_471_815 | 103 |
| 565 | 3300044706 | Ga0466964_0031869 | Ga0466964_0031869_1465_1803 | 103 |
| 566 | 3300044706 | Ga0466964_0039198 | Ga0466964_0039198_606_941 | 103 |
| 567 | 3300044706 | Ga0466964_0051369 | Ga0466964_0051369_162_497 | 103 |
| 568 | 3300044706 | Ga0466964_0100868 | Ga0466964_0100868_304_642 | 103 |
| 569 | 3300044706 | Ga0466964_0132499 | Ga0466964_0132499_214_525 | 103 |
| 570 | 3300044706 | Ga0466964_0167304 | Ga0466964_0167304_390_725 | 103 |
| 571 | 3300044706 | Ga0466964_0348546 | Ga0466964_0348546_25_360 | 103 |
| 572 | 3300044719 | Ga0466971_0006123 | Ga0466971_0006123_1669_1998 | 103 |
| 573 | 3300044719 | Ga0466971_0010450 | Ga0466971_0010450_2056_2400 | 103 |
| 574 | 3300044719 | Ga0466971_0034738 | Ga0466971_0034738_1035_1370 | 103 |
| 575 | 3300044719 | Ga0466971_0094401 | Ga0466971_0094401_908_1249 | 103 |
| 576 | 3300044735 | Ga0466968_0003137 | Ga0466968_0003137_417_755 | 103 |
| 577 | 3300044735 | Ga0466968_0005017 | Ga0466968_0005017_1359_1694 | 103 |
| 578 | 3300044735 | Ga0466968_0018981 | Ga0466968_0018981_1152_1463 | 103 |
| 579 | 3300044735 | Ga0466968_0138895 | Ga0466968_0138895_30_368 | 103 |
| 580 | 3300044765 | Ga0466970_0004127 | Ga0466970_0004127_3988_4326 | 103 |
| 581 | 3300044765 | Ga0466970_0137134 | Ga0466970_0137134_636_980 | 103 |
| 582 | 3300044765 | Ga0466970_0283130 | Ga0466970_0283130_471_782 | 103 |
| 583 | 3300044842 | Ga0466957_0009295 | Ga0466957_0009295_2035_2373 | 103 |
| 584 | 3300044842 | Ga0466957_0021958 | Ga0466957_0021958_2720_3055 | 103 |
| 585 | 3300044842 | Ga0466957_0025441 | Ga0466957_0025441_713_1042 | 103 |
| 586 | 3300044842 | Ga0466957_0033272 | Ga0466957_0033272_892_1233 | 103 |
| 587 | 3300044842 | Ga0466957_0094799 | Ga0466957_0094799_1490_1828 | 103 |
| 588 | 3300044842 | Ga0466957_0234214 | Ga0466957_0234214_282_626 | 103 |
| 589 | 3300044842 | Ga0466957_0289971 | Ga0466957_0289971_392_703 | 103 |
| 590 | 3300044842 | Ga0466957_0459239 | Ga0466957_0459239_120_464 | 103 |
| 591 | 3300044842 | Ga0466957_1067989 | Ga0466957_1067989_182_520 | 103 |
| 592 | 3300044842 | Ga0466957_1135314 | Ga0466957_1135314_79_414 | 103 |
| 593 | 3300044901 | Ga0466960_0005761 | Ga0466960_0005761_1109_1444 | 103 |
| 594 | 3300044901 | Ga0466960_0039338 | Ga0466960_0039338_1339_1677 | 103 |
| 595 | 3300044901 | Ga0466960_0055310 | Ga0466960_0055310_376_720 | 103 |
| 596 | 3300044901 | Ga0466960_0097033 | Ga0466960_0097033_357_695 | 103 |
| 597 | 3300044901 | Ga0466960_0458479 | Ga0466960_0458479_290_628 | 103 |
| 598 | 3300044901 | Ga0466960_0481040 | Ga0466960_0481040_168_503 | 103 |
| 599 | 3300045049 | Ga0466959_0050692 | Ga0466959_0050692_1694_2029 | 103 |
| 600 | 3300045049 | Ga0466959_0068110 | Ga0466959_0068110_1861_2202 | 103 |
| 601 | 3300045836 | Ga0466958_0001425 | Ga0466958_0001425_10910_11239 | 103 |
| 602 | 3300045836 | Ga0466958_0002150 | Ga0466958_0002150_5601_5945 | 103 |
| 603 | 3300045836 | Ga0466958_0025195 | Ga0466958_0025195_609_950 | 103 |
| 604 | 3300045836 | Ga0466958_0066615 | Ga0466958_0066615_519_854 | 103 |
| 605 | 3300045836 | Ga0466958_0079309 | Ga0466958_0079309_369_707 | 103 |
| 606 | 3300045836 | Ga0466958_0115347 | Ga0466958_0115347_84_422 | 103 |
| 607 | 3300045836 | Ga0466958_0409828 | Ga0466958_0409828_331_666 | 103 |
| 608 | 3300045836 | Ga0466958_0642807 | Ga0466958_0642807_208_519 | 103 |
| 609 | 3300045836 | Ga0466958_0783635 | Ga0466958_0783635_57_395 | 103 |
| 610 | 3300045836 | Ga0466958_1069720 | Ga0466958_1069720_30_362 | 103 |
| 611 | 3300045976 | Ga0466967_0000332 | Ga0466967_0000332_3620_3931 | 103 |
| 612 | 3300045976 | Ga0466967_0001331 | Ga0466967_0001331_6918_7259 | 103 |
| 613 | 3300045976 | Ga0466967_0010334 | Ga0466967_0010334_534_872 | 103 |
| 614 | 3300045976 | Ga0466967_0015409 | Ga0466967_0015409_310_645 | 103 |
| 615 | 3300045976 | Ga0466967_0016719 | Ga0466967_0016719_1161_1496 | 103 |
| 616 | 3300045976 | Ga0466967_0022864 | Ga0466967_0022864_3371_3709 | 103 |
| 617 | 3300045976 | Ga0466967_0023774 | Ga0466967_0023774_3667_4005 | 103 |
| 618 | 3300045976 | Ga0466967_0024167 | Ga0466967_0024167_2353_2688 | 103 |
| 619 | 3300045976 | Ga0466967_0038072 | Ga0466967_0038072_1882_2214 | 103 |
| 620 | 3300045976 | Ga0466967_0042311 | Ga0466967_0042311_624_935 | 103 |
| 621 | 3300045976 | Ga0466967_0062915 | Ga0466967_0062915_1142_1480 | 103 |
| 622 | 3300045976 | Ga0466967_0066290 | Ga0466967_0066290_475_810 | 103 |
| 623 | 3300045976 | Ga0466967_0077443 | Ga0466967_0077443_1458_1802 | 103 |
| 624 | 3300045976 | Ga0466967_0079621 | Ga0466967_0079621_792_1103 | 103 |
| 625 | 3300045976 | Ga0466967_0113945 | Ga0466967_0113945_1073_1417 | 103 |
| 626 | 3300045976 | Ga0466967_0158743 | Ga0466967_0158743_1202_1543 | 103 |
| 627 | 3300045976 | Ga0466967_0232813 | Ga0466967_0232813_1049_1387 | 103 |
| 628 | 3300045976 | Ga0466967_0245079 | Ga0466967_0245079_282_617 | 103 |
| 629 | 3300045976 | Ga0466967_0264260 | Ga0466967_0264260_955_1293 | 103 |
| 630 | 3300045976 | Ga0466967_0439108 | Ga0466967_0439108_552_887 | 103 |
| 631 | 3300045976 | Ga0466967_0451495 | Ga0466967_0451495_365_706 | 103 |
| 632 | 3300045976 | Ga0466967_0545234 | Ga0466967_0545234_596_937 | 103 |
| 633 | 3300045976 | Ga0466967_1210509 | Ga0466967_1210509_35_379 | 103 |
| 634 | 3300046454 | Ga0495592_0000732 | Ga0495592_0000732_5323_5658 | 103 |
| 635 | 3300046454 | Ga0495592_0004058 | Ga0495592_0004058_5579_5917 | 103 |
| 636 | 3300046454 | Ga0495592_0080194 | Ga0495592_0080194_452_790 | 103 |
| 637 | 3300046454 | Ga0495592_0158825 | Ga0495592_0158825_985_1326 | 103 |
| 638 | 3300046454 | Ga0495592_0387691 | Ga0495592_0387691_39_380 | 103 |
| 639 | 3300046454 | Ga0495592_0461163 | Ga0495592_0461163_219_557 | 103 |
| 640 | 3300046454 | Ga0495592_0769422 | Ga0495592_0769422_10_345 | 103 |
| 641 | 3300046455 | Ga0495603_0046829 | Ga0495603_0046829_999_1328 | 103 |
| 642 | 3300046459 | Ga0495629_0017747 | Ga0495629_0017747_1063_1404 | 103 |
| 643 | 3300046459 | Ga0495629_0131264 | Ga0495629_0131264_356_682 | 103 |
| 644 | 3300046459 | Ga0495629_0235242 | Ga0495629_0235242_665_1003 | 103 |
| 645 | 3300046459 | Ga0495629_0439069 | Ga0495629_0439069_183_518 | 103 |
| 646 | 3300046461 | Ga0495641_0016066 | Ga0495641_0016066_1494_1835 | 103 |
| 647 | 3300046461 | Ga0495641_0026195 | Ga0495641_0026195_1495_1833 | 103 |
| 648 | 3300046461 | Ga0495641_0079331 | Ga0495641_0079331_471_815 | 103 |
| 649 | 3300046461 | Ga0495641_0086874 | Ga0495641_0086874_423_761 | 103 |
| 650 | 3300046462 | Ga0495651_0000029 | Ga0495651_0000029_39434_39769 | 103 |
| 651 | 3300046462 | Ga0495651_0037777 | Ga0495651_0037777_3392_3733 | 103 |
| 652 | 3300046462 | Ga0495651_0139797 | Ga0495651_0139797_346_684 | 103 |
| 653 | 3300046462 | Ga0495651_0342042 | Ga0495651_0342042_210_548 | 103 |
| 654 | 3300046462 | Ga0495651_0454263 | Ga0495651_0454263_87_425 | 103 |
| 655 | 3300046463 | Ga0495653_0001363 | Ga0495653_0001363_8253_8588 | 103 |
| 656 | 3300046463 | Ga0495653_0008307 | Ga0495653_0008307_2821_3162 | 103 |
| 657 | 3300046463 | Ga0495653_0072654 | Ga0495653_0072654_1474_1812 | 103 |
| 658 | 3300046463 | Ga0495653_0091261 | Ga0495653_0091261_457_783 | 103 |
| 659 | 3300046463 | Ga0495653_0115764 | Ga0495653_0115764_1548_1886 | 103 |
| 660 | 3300046463 | Ga0495653_0135178 | Ga0495653_0135178_482_820 | 103 |
| 661 | 3300046463 | Ga0495653_0227844 | Ga0495653_0227844_271_609 | 103 |
| 662 | 3300046463 | Ga0495653_0374914 | Ga0495653_0374914_426_764 | 103 |
| 663 | 3300046463 | Ga0495653_0575937 | Ga0495653_0575937_145_483 | 103 |
| 664 | 3300046472 | Ga0495580_0024113 | Ga0495580_0024113_3497_3838 | 103 |
| 665 | 3300046473 | Ga0495582_0004164 | Ga0495582_0004164_7337_7678 | 103 |
| 666 | 3300046473 | Ga0495582_0150648 | Ga0495582_0150648_172_510 | 103 |
| 667 | 3300046475 | Ga0495639_0006273 | Ga0495639_0006273_948_1289 | 103 |
| 668 | 3300046476 | Ga0495662_0001522 | Ga0495662_0001522_7337_7678 | 103 |
| 669 | 3300046476 | Ga0495662_0023497 | Ga0495662_0023497_1589_1927 | 103 |
| 670 | 3300046477 | Ga0495664_0042590 | Ga0495664_0042590_1892_2233 | 103 |
| 671 | 3300046477 | Ga0495664_0201632 | Ga0495664_0201632_535_873 | 103 |
| 672 | 3300046477 | Ga0495664_0267472 | Ga0495664_0267472_123_461 | 103 |
| 673 | 3300046491 | Ga0495584_0007847 | Ga0495584_0007847_5143_5481 | 103 |
| 674 | 3300046492 | Ga0495585_0025444 | Ga0495585_0025444_1155_1493 | 103 |
| 675 | 3300046499 | Ga0495594_0145070 | Ga0495594_0145070_171_500 | 103 |
| 676 | 3300046499 | Ga0495594_0319906 | Ga0495594_0319906_339_683 | 103 |
| 677 | 3300046499 | Ga0495594_0639243 | Ga0495594_0639243_38_382 | 103 |
| 678 | 3300046500 | Ga0495596_0062955 | Ga0495596_0062955_977_1315 | 103 |
| 679 | 3300046501 | Ga0495607_0040771 | Ga0495607_0040771_713_1051 | 103 |
| 680 | 3300046511 | Ga0495608_0023778 | Ga0495608_0023778_721_1056 | 103 |
| 681 | 3300046511 | Ga0495608_0032053 | Ga0495608_0032053_2403_2741 | 103 |
| 682 | 3300046511 | Ga0495608_0115571 | Ga0495608_0115571_772_1110 | 103 |
| 683 | 3300046511 | Ga0495608_0312755 | Ga0495608_0312755_522_860 | 103 |
| 684 | 3300046511 | Ga0495608_0355764 | Ga0495608_0355764_31_369 | 103 |
| 685 | 3300046511 | Ga0495608_0418423 | Ga0495608_0418423_280_606 | 103 |
| 686 | 3300046514 | Ga0495618_0009479 | Ga0495618_0009479_1878_2213 | 103 |
| 687 | 3300046514 | Ga0495618_0034082 | Ga0495618_0034082_685_1026 | 103 |
| 688 | 3300046514 | Ga0495618_0104752 | Ga0495618_0104752_153_488 | 103 |
| 689 | 3300046514 | Ga0495618_0736342 | Ga0495618_0736342_206_544 | 103 |
| 690 | 3300046516 | Ga0495628_0000016 | Ga0495628_0000016_39407_39742 | 103 |
| 691 | 3300046516 | Ga0495628_0014430 | Ga0495628_0014430_277_615 | 103 |
| 692 | 3300046516 | Ga0495628_0028205 | Ga0495628_0028205_1530_1871 | 103 |
| 693 | 3300046517 | Ga0495630_0000505 | Ga0495630_0000505_18065_18406 | 103 |
| 694 | 3300046517 | Ga0495630_0298166 | Ga0495630_0298166_197_523 | 103 |
| 695 | 3300046517 | Ga0495630_0681174 | Ga0495630_0681174_273_602 | 103 |
| 696 | 3300046517 | Ga0495630_0770971 | Ga0495630_0770971_65_403 | 103 |
| 697 | 3300046523 | Ga0495644_0020878 | Ga0495644_0020878_603_941 | 103 |
| 698 | 3300046525 | Ga0495663_0375953 | Ga0495663_0375953_112_450 | 103 |
| 699 | 3300046526 | Ga0495666_0186505 | Ga0495666_0186505_399_737 | 103 |
| 700 | 3300046529 | Ga0495652_0000045 | Ga0495652_0000045_111302_111637 | 103 |
| 701 | 3300046529 | Ga0495652_0006417 | Ga0495652_0006417_8929_9267 | 103 |
| 702 | 3300046529 | Ga0495652_0042714 | Ga0495652_0042714_1701_2042 | 103 |
| 703 | 3300046529 | Ga0495652_0081521 | Ga0495652_0081521_1512_1850 | 103 |
| 704 | 3300046529 | Ga0495652_0083596 | Ga0495652_0083596_1634_1972 | 103 |
| 705 | 3300046529 | Ga0495652_0118634 | Ga0495652_0118634_971_1309 | 103 |
| 706 | 3300046531 | Ga0495665_0029813 | Ga0495665_0029813_2124_2465 | 103 |
| 707 | 3300046533 | Ga0495640_0007391 | Ga0495640_0007391_6388_6726 | 103 |
| 708 | 3300046533 | Ga0495640_0014315 | Ga0495640_0014315_4850_5191 | 103 |
| 709 | 3300046533 | Ga0495640_0954284 | Ga0495640_0954284_20_355 | 103 |
| 710 | 3300046535 | Ga0495586_0034130 | Ga0495586_0034130_948_1289 | 103 |
| 711 | 3300046535 | Ga0495586_0088546 | Ga0495586_0088546_507_845 | 103 |
| 712 | 3300046536 | Ga0495587_0000083 | Ga0495587_0000083_10209_10544 | 103 |
| 713 | 3300046536 | Ga0495587_0114475 | Ga0495587_0114475_43_381 | 103 |
| 714 | 3300046536 | Ga0495587_0655845 | Ga0495587_0655845_146_481 | 103 |
| 715 | 3300046536 | Ga0495587_0674079 | Ga0495587_0674079_162_500 | 103 |
| 716 | 3300046543 | Ga0495645_0001902 | Ga0495645_0001902_8192_8527 | 103 |
| 717 | 3300046543 | Ga0495645_0021257 | Ga0495645_0021257_1075_1416 | 103 |
| 718 | 3300046543 | Ga0495645_0028921 | Ga0495645_0028921_2935_3273 | 103 |
| 719 | 3300046543 | Ga0495645_0306506 | Ga0495645_0306506_98_436 | 103 |
| 720 | 3300046559 | Ga0495667_0025440 | Ga0495667_0025440_599_940 | 103 |
| 721 | 3300046559 | Ga0495667_0069376 | Ga0495667_0069376_1230_1565 | 103 |
| 722 | 3300046559 | Ga0495667_0111199 | Ga0495667_0111199_498_836 | 103 |
| 723 | 3300046559 | Ga0495667_0120029 | Ga0495667_0120029_857_1195 | 103 |
| 724 | 3300046559 | Ga0495667_0223154 | Ga0495667_0223154_542_880 | 103 |
| 725 | 3300046559 | Ga0495667_0540690 | Ga0495667_0540690_341_667 | 103 |
| 726 | 3300046615 | Ga0495656_0001481 | Ga0495656_0001481_5821_6159 | 103 |
| 727 | 3300046616 | Ga0495668_0245643 | Ga0495668_0245643_143_481 | 103 |
| 728 | 3300046642 | Ga0495634_0003355 | Ga0495634_0003355_7690_8031 | 103 |
| 729 | 3300046642 | Ga0495634_0038164 | Ga0495634_0038164_384_722 | 103 |
| 730 | 3300046642 | Ga0495634_0091496 | Ga0495634_0091496_752_1087 | 103 |
| 731 | 3300046648 | Ga0495611_0124287 | Ga0495611_0124287_586_924 | 103 |
| 732 | 3300046663 | Ga0495635_0004708 | Ga0495635_0004708_2174_2500 | 103 |
| 733 | 3300046663 | Ga0495635_0044339 | Ga0495635_0044339_120_458 | 103 |
| 734 | 3300046663 | Ga0495635_0275879 | Ga0495635_0275879_23_361 | 103 |
| 735 | 3300046663 | Ga0495635_0402960 | Ga0495635_0402960_509_850 | 103 |
| 736 | 3300046663 | Ga0495635_0409722 | Ga0495635_0409722_311_649 | 103 |
| 737 | 3300046663 | Ga0495635_0561639 | Ga0495635_0561639_187_525 | 103 |
| 738 | 3300046665 | Ga0495661_0159110 | Ga0495661_0159110_124_462 | 103 |
| 739 | 3300046674 | Ga0495588_0088482 | Ga0495588_0088482_221_550 | 103 |
| 740 | 3300046675 | Ga0495657_0011595 | Ga0495657_0011595_1384_1719 | 103 |
| 741 | 3300046675 | Ga0495657_0187772 | Ga0495657_0187772_415_753 | 103 |
| 742 | 3300046675 | Ga0495657_0241416 | Ga0495657_0241416_534_872 | 103 |
| 743 | 3300046675 | Ga0495657_0345525 | Ga0495657_0345525_211_549 | 103 |
| 744 | 3300046675 | Ga0495657_0346145 | Ga0495657_0346145_138_464 | 103 |
| 745 | 3300046675 | Ga0495657_0399648 | Ga0495657_0399648_458_799 | 103 |
| 746 | 3300046675 | Ga0495657_0469575 | Ga0495657_0469575_285_623 | 103 |
| 747 | 3300046675 | Ga0495657_0706024 | Ga0495657_0706024_50_388 | 103 |
| 748 | 3300046678 | Ga0495599_0000187 | Ga0495599_0000187_3624_3959 | 103 |
| 749 | 3300046678 | Ga0495599_0000610 | Ga0495599_0000610_5216_5554 | 103 |
| 750 | 3300046678 | Ga0495599_0200702 | Ga0495599_0200702_282_620 | 103 |
| 751 | 3300046678 | Ga0495599_0235184 | Ga0495599_0235184_184_522 | 103 |
| 752 | 3300046679 | Ga0495623_0000121 | Ga0495623_0000121_39426_39761 | 103 |
| 753 | 3300046679 | Ga0495623_0194689 | Ga0495623_0194689_341_679 | 103 |
| 754 | 3300046680 | Ga0495646_0001537 | Ga0495646_0001537_5423_5758 | 103 |
| 755 | 3300046680 | Ga0495646_0062692 | Ga0495646_0062692_921_1259 | 103 |
| 756 | 3300046681 | Ga0495647_0000468 | Ga0495647_0000468_7076_7417 | 103 |
| 757 | 3300046681 | Ga0495647_0049997 | Ga0495647_0049997_445_783 | 103 |
| 758 | 3300046683 | Ga0495658_0011253 | Ga0495658_0011253_84_425 | 103 |
| 759 | 3300046683 | Ga0495658_0203263 | Ga0495658_0203263_273_611 | 103 |
| 760 | 3300046684 | Ga0495669_0276031 | Ga0495669_0276031_221_559 | 103 |
| 761 | 3300046689 | Ga0495613_0062116 | Ga0495613_0062116_1317_1661 | 103 |
| 762 | 3300046689 | Ga0495613_0081268 | Ga0495613_0081268_1717_2055 | 103 |
| 763 | 3300046689 | Ga0495613_0456135 | Ga0495613_0456135_196_537 | 103 |
| 764 | 3300046690 | Ga0495624_0005932 | Ga0495624_0005932_4444_4785 | 103 |
| 765 | 3300046690 | Ga0495624_0022126 | Ga0495624_0022126_1389_1733 | 103 |
| 766 | 3300046690 | Ga0495624_0408691 | Ga0495624_0408691_411_749 | 103 |
| 767 | 3300046690 | Ga0495624_0633771 | Ga0495624_0633771_29_358 | 103 |
| 768 | 3300046691 | Ga0495670_0072448 | Ga0495670_0072448_772_1110 | 103 |
| 769 | 3300046794 | Ga0495589_0200021 | Ga0495589_0200021_507_845 | 103 |
| 770 | 3300046809 | Ga0495600_0041000 | Ga0495600_0041000_2306_2641 | 103 |
| 771 | 3300046809 | Ga0495600_0228921 | Ga0495600_0228921_379_717 | 103 |
| 772 | 3300046809 | Ga0495600_0268406 | Ga0495600_0268406_384_722 | 103 |
| 773 | 3300046809 | Ga0495600_0473465 | Ga0495600_0473465_311_637 | 103 |
| 774 | 3300046810 | Ga0495660_0280624 | Ga0495660_0280624_57_395 | 103 |
| 775 | 3300047315 | Ga0495581_0002035 | Ga0495581_0002035_7204_7545 | 103 |
| 776 | 3300047315 | Ga0495581_0047064 | Ga0495581_0047064_26_364 | 103 |
| 777 | 3300047315 | Ga0495581_0263017 | Ga0495581_0263017_132_470 | 103 |
| 778 | 3300047317 | Ga0495604_0000072 | Ga0495604_0000072_79129_79464 | 103 |
| 779 | 3300047317 | Ga0495604_0087853 | Ga0495604_0087853_1333_1671 | 103 |
| 780 | 3300047317 | Ga0495604_0375810 | Ga0495604_0375810_58_393 | 103 |
| 781 | 3300047319 | Ga0495674_0012591 | Ga0495674_0012591_4967_5308 | 103 |
| 782 | 3300047319 | Ga0495674_0073771 | Ga0495674_0073771_1306_1644 | 103 |
| 783 | 3300047319 | Ga0495674_0582007 | Ga0495674_0582007_354_692 | 103 |
| 784 | 3300047321 | Ga0495676_0071355 | Ga0495676_0071355_441_785 | 103 |
| 785 | 3300047321 | Ga0495676_0155177 | Ga0495676_0155177_412_750 | 103 |
| 786 | 3300047321 | Ga0495676_0160103 | Ga0495676_0160103_68_409 | 103 |
| 787 | 3300047321 | Ga0495676_0429865 | Ga0495676_0429865_297_626 | 103 |
| 788 | 3300047322 | Ga0495680_0004810 | Ga0495680_0004810_6665_7006 | 103 |
| 789 | 3300047322 | Ga0495680_0007057 | Ga0495680_0007057_7560_7895 | 103 |
| 790 | 3300047322 | Ga0495680_0016342 | Ga0495680_0016342_5404_5742 | 103 |
| 791 | 3300047322 | Ga0495680_0108643 | Ga0495680_0108643_1242_1568 | 103 |
| 792 | 3300047322 | Ga0495680_0181638 | Ga0495680_0181638_843_1181 | 103 |
| 793 | 3300047322 | Ga0495680_0611430 | Ga0495680_0611430_142_477 | 103 |
| 794 | 3300047322 | Ga0495680_0929519 | Ga0495680_0929519_35_373 | 103 |
| 795 | 3300047323 | Ga0495683_0226532 | Ga0495683_0226532_202_540 | 103 |
| 796 | 3300047444 | Ga0495675_0000031 | Ga0495675_0000031_64087_64422 | 103 |
| 797 | 3300047444 | Ga0495675_0563240 | Ga0495675_0563240_158_496 | 103 |
| 798 | 3300047445 | Ga0495677_0028578 | Ga0495677_0028578_80_418 | 103 |
| 799 | 3300047446 | Ga0495679_055719 | Ga0495679_055719_608_946 | 103 |
| 800 | 3300047471 | Ga0495684_0008099 | Ga0495684_0008099_1019_1357 | 103 |
| 801 | 3300047471 | Ga0495684_0019924 | Ga0495684_0019924_2166_2507 | 103 |
| 802 | 3300047471 | Ga0495684_0297074 | Ga0495684_0297074_314_652 | 103 |
| 803 | 3300047471 | Ga0495684_0674395 | Ga0495684_0674395_68_409 | 103 |
| 804 | 3300047673 | Ga0495593_0000333 | Ga0495593_0000333_11657_11998 | 103 |
| 805 | 3300047673 | Ga0495593_0119571 | Ga0495593_0119571_405_731 | 103 |
| 806 | 3300048088 | Ga0495602_0000133 | Ga0495602_0000133_39434_39769 | 103 |
| 807 | 3300048088 | Ga0495602_0024934 | Ga0495602_0024934_3104_3442 | 103 |
| 808 | 3300048088 | Ga0495602_0095157 | Ga0495602_0095157_72_410 | 103 |
| 809 | 3300048088 | Ga0495602_0723161 | Ga0495602_0723161_288_626 | 103 |
| 810 | 3300048089 | Ga0495614_0001325 | Ga0495614_0001325_8719_9060 | 103 |
| 811 | 3300048903 | Ga0496100_0034269 | Ga0496100_0034269_1430_1774 | 103 |
| 812 | 3300048903 | Ga0496100_0049310 | Ga0496100_0049310_1821_2159 | 103 |
| 813 | 3300048903 | Ga0496100_0144881 | Ga0496100_0144881_673_1011 | 103 |
| 814 | 3300048904 | Ga0496101_0002509 | Ga0496101_0002509_8203_8547 | 103 |
| 815 | 3300048904 | Ga0496101_0044485 | Ga0496101_0044485_2761_3099 | 103 |
| 816 | 3300048904 | Ga0496101_0110389 | Ga0496101_0110389_472_810 | 103 |
| 817 | 3300048904 | Ga0496101_0260787 | Ga0496101_0260787_284_628 | 103 |
| 818 | 3300048904 | Ga0496101_1067501 | Ga0496101_1067501_132_470 | 103 |
| 819 | 3300048905 | Ga0496102_0055705 | Ga0496102_0055705_1468_1812 | 103 |
| 820 | 3300048905 | Ga0496102_0185761 | Ga0496102_0185761_786_1124 | 103 |
| 821 | 3300048905 | Ga0496102_0352481 | Ga0496102_0352481_87_425 | 103 |
| 822 | 3300048905 | Ga0496102_0849525 | Ga0496102_0849525_319_657 | 103 |
| 823 | 3300048906 | Ga0496103_0016363 | Ga0496103_0016363_1222_1566 | 103 |
| 824 | 3300048907 | Ga0496104_0034254 | Ga0496104_0034254_2012_2350 | 103 |
| 825 | 3300048907 | Ga0496104_0039390 | Ga0496104_0039390_3641_3979 | 103 |
| 826 | 3300048907 | Ga0496104_0864155 | Ga0496104_0864155_62_400 | 103 |
| 827 | 3300048908 | Ga0496105_0010632 | Ga0496105_0010632_5207_5545 | 103 |
| 828 | 3300048908 | Ga0496105_0017937 | Ga0496105_0017937_2607_2945 | 103 |
| 829 | 3300048908 | Ga0496105_1212534 | Ga0496105_1212534_159_497 | 103 |
| 830 | 3300048909 | Ga0496106_0041047 | Ga0496106_0041047_2404_2748 | 103 |
| 831 | 3300048909 | Ga0496106_0103195 | Ga0496106_0103195_808_1146 | 103 |
| 832 | 3300048909 | Ga0496106_0741584 | Ga0496106_0741584_323_661 | 103 |
| 833 | 3300048910 | Ga0496107_0010435 | Ga0496107_0010435_1235_1579 | 103 |
| 834 | 3300048910 | Ga0496107_0093099 | Ga0496107_0093099_541_879 | 103 |
| 835 | 3300048910 | Ga0496107_0154752 | Ga0496107_0154752_162_500 | 103 |
| 836 | 3300048910 | Ga0496107_1045708 | Ga0496107_1045708_78_389 | 103 |
| 837 | 3300048911 | Ga0496108_0011946 | Ga0496108_0011946_4351_4695 | 103 |
| 838 | 3300048911 | Ga0496108_0036442 | Ga0496108_0036442_3608_3946 | 103 |
| 839 | 3300048911 | Ga0496108_0482952 | Ga0496108_0482952_648_986 | 103 |
| 840 | 3300048912 | Ga0496109_0009062 | Ga0496109_0009062_1775_2113 | 103 |
| 841 | 3300048912 | Ga0496109_0056369 | Ga0496109_0056369_2093_2431 | 103 |
| 842 | 3300048912 | Ga0496109_0609685 | Ga0496109_0609685_92_403 | 103 |
| 843 | 3300048912 | Ga0496109_0620230 | Ga0496109_0620230_625_963 | 103 |
| 844 | 3300048913 | Ga0496110_0006093 | Ga0496110_0006093_2234_2578 | 103 |
| 845 | 3300048913 | Ga0496110_0279650 | Ga0496110_0279650_592_930 | 103 |
| 846 | 3300048913 | Ga0496110_0733996 | Ga0496110_0733996_197_535 | 103 |
| 847 | 3300048914 | Ga0496111_0016935 | Ga0496111_0016935_3037_3381 | 103 |
| 848 | 3300048914 | Ga0496111_0022289 | Ga0496111_0022289_732_1070 | 103 |
| 849 | 3300048914 | Ga0496111_0293454 | Ga0496111_0293454_224_571 | 103 |
| 850 | 3300048914 | Ga0496111_1136859 | Ga0496111_1136859_12_350 | 103 |
| 851 | 3300048915 | Ga0496112_0071929 | Ga0496112_0071929_2511_2822 | 103 |
| 852 | 3300048915 | Ga0496112_0087667 | Ga0496112_0087667_1940_2284 | 103 |
| 853 | 3300048915 | Ga0496112_0089402 | Ga0496112_0089402_1839_2177 | 103 |
| 854 | 3300048915 | Ga0496112_0434252 | Ga0496112_0434252_798_1136 | 103 |
| 855 | 3300048915 | Ga0496112_1233356 | Ga0496112_1233356_93_440 | 103 |
| 856 | 3300048916 | Ga0496113_0041344 | Ga0496113_0041344_2747_3058 | 103 |
| 857 | 3300048916 | Ga0496113_0166052 | Ga0496113_0166052_950_1288 | 103 |
| 858 | 3300048916 | Ga0496113_0234272 | Ga0496113_0234272_578_916 | 103 |
| 859 | 3300048917 | Ga0496114_0011562 | Ga0496114_0011562_5450_5794 | 103 |
| 860 | 3300048917 | Ga0496114_0096721 | Ga0496114_0096721_1723_2061 | 103 |
| 861 | 3300048917 | Ga0496114_0176094 | Ga0496114_0176094_1438_1776 | 103 |
| 862 | 3300048918 | Ga0496115_0026093 | Ga0496115_0026093_673_1011 | 103 |
| 863 | 3300048918 | Ga0496115_0080724 | Ga0496115_0080724_836_1180 | 103 |
| 864 | 3300048918 | Ga0496115_0082447 | Ga0496115_0082447_249_587 | 103 |
| 865 | 3300048918 | Ga0496115_0100595 | Ga0496115_0100595_1625_1963 | 103 |
| 866 | 3300048918 | Ga0496115_0199138 | Ga0496115_0199138_1070_1414 | 103 |
| 867 | 3300048918 | Ga0496115_0641835 | Ga0496115_0641835_57_386 | 103 |
| 868 | 3300049583 | Ga0501067_0057526 | Ga0501067_0057526_789_1133 | 103 |
| 869 | 3300049583 | Ga0501067_0274228 | Ga0501067_0274228_471_815 | 103 |
| 870 | 3300049585 | Ga0501069_0033705 | Ga0501069_0033705_959_1303 | 103 |
| 871 | 3300049586 | Ga0501070_0846256 | Ga0501070_0846256_34_378 | 103 |
| 872 | 3300050507 | nmdc:mga05p37_1052152_c1 | nmdc:mga05p37_1052152_c1_355_669 | 103 |
| 873 | 3300050512 | nmdc:mga0n895_180850_c1 | nmdc:mga0n895_180850_c1_1450_1764 | 103 |
| 874 | 3300050512 | nmdc:mga0n895_5478_c1 | nmdc:mga0n895_5478_c1_3608_3946 | 103 |
| 875 | 3300050513 | nmdc:mga0rr50_544609_c1 | nmdc:mga0rr50_544609_c1_581_895 | 103 |
| 876 | 3300050514 | nmdc:mga08x19_381534_c1 | nmdc:mga08x19_381534_c1_582_920 | 103 |
| 877 | 3300050515 | nmdc:mga0a205_299821_c1 | nmdc:mga0a205_299821_c1_850_1188 | 103 |
| 878 | 3300053077 | Ga0495601_0000304 | Ga0495601_0000304_10424_10759 | 103 |
| 879 | 3300053077 | Ga0495601_0026164 | Ga0495601_0026164_2316_2654 | 103 |
| 880 | 3300053077 | Ga0495601_0033652 | Ga0495601_0033652_457_798 | 103 |
| 881 | 3300053077 | Ga0495601_0111956 | Ga0495601_0111956_253_591 | 103 |
| 882 | 3300053078 | Ga0495612_0005159 | Ga0495612_0005159_5012_5353 | 103 |
| 883 | 3300053078 | Ga0495612_0011693 | Ga0495612_0011693_1822_2160 | 103 |
| 884 | 3300053078 | Ga0495612_0601550 | Ga0495612_0601550_50_388 | 103 |
| 885 | 3300053084 | Ga0495595_0004259 | Ga0495595_0004259_3788_4126 | 103 |
| 886 | 3300053084 | Ga0495595_0015196 | Ga0495595_0015196_2345_2680 | 103 |
| 887 | 3300053084 | Ga0495595_0104732 | Ga0495595_0104732_678_1016 | 103 |
| 888 | 3300053084 | Ga0495595_0617963 | Ga0495595_0617963_102_440 | 103 |
| 889 | 3300053084 | Ga0495595_0738570 | Ga0495595_0738570_103_441 | 103 |
| 890 | 3300053085 | Ga0495619_0000836 | Ga0495619_0000836_17149_17484 | 103 |
| 891 | 3300053085 | Ga0495619_0001937 | Ga0495619_0001937_1323_1664 | 103 |
| 892 | 3300053085 | Ga0495619_0109203 | Ga0495619_0109203_797_1135 | 103 |
| 893 | 3300053085 | Ga0495619_0109497 | Ga0495619_0109497_848_1186 | 103 |
| 894 | 3300053085 | Ga0495619_0568792 | Ga0495619_0568792_274_609 | 103 |
| 895 | 3300053094 | Ga0500566_0008196 | Ga0500566_0008196_2283_2624 | 103 |
| 896 | 3300053123 | Ga0500614_224465 | Ga0500614_224465_26_367 | 103 |
| 897 | 3300061719 | Ga0466962_0002608 | Ga0466962_0002608_1828_2157 | 103 |
| 898 | 3300061719 | Ga0466962_0005598 | Ga0466962_0005598_1483_1818 | 103 |
| 899 | 3300061719 | Ga0466962_0012201 | Ga0466962_0012201_2606_2947 | 103 |
| 900 | 3300061719 | Ga0466962_0029341 | Ga0466962_0029341_340_684 | 103 |
| 901 | 3300061719 | Ga0466962_0041976 | Ga0466962_0041976_1510_1854 | 103 |
| 902 | 3300005329 | Ga0070683_100629443 | Ga0070683_1006294432 | 104 |
| 903 | 3300005434 | Ga0070709_10067769 | Ga0070709_100677692 | 104 |
| 904 | 3300005435 | Ga0070714_100071577 | Ga0070714_1000715772 | 104 |
| 905 | 3300005436 | Ga0070713_100518532 | Ga0070713_1005185322 | 104 |
| 906 | 3300005437 | Ga0070710_10448744 | Ga0070710_104487442 | 104 |
| 907 | 3300005439 | Ga0070711_100060945 | Ga0070711_1000609455 | 104 |
| 908 | 3300005518 | Ga0070699_100218255 | Ga0070699_1002182552 | 104 |
| 909 | 3300005614 | Ga0068856_101493298 | Ga0068856_1014932982 | 104 |
| 910 | 3300006028 | Ga0070717_10176291 | Ga0070717_101762912 | 104 |
| 911 | 3300006175 | Ga0070712_100253298 | Ga0070712_1002532981 | 104 |
| 912 | 3300013100 | Ga0157373_10141834 | Ga0157373_101418343 | 104 |
| 913 | 3300013100 | Ga0157373_10208399 | Ga0157373_102083992 | 104 |
| 914 | 3300013104 | Ga0157370_10009353 | Ga0157370_100093535 | 104 |
| 915 | 3300013104 | Ga0157370_11812284 | Ga0157370_118122842 | 104 |
| 916 | 3300013105 | Ga0157369_10001145 | Ga0157369_1000114521 | 104 |
| 917 | 3300013105 | Ga0157369_10040236 | Ga0157369_100402363 | 104 |
| 918 | 3300020070 | Ga0206356_11584572 | Ga0206356_115845722 | 104 |
| 919 | 3300025898 | Ga0207692_11084736 | Ga0207692_110847361 | 104 |
| 920 | 3300025906 | Ga0207699_10045831 | Ga0207699_100458312 | 104 |
| 921 | 3300025915 | Ga0207693_10770359 | Ga0207693_107703592 | 104 |
| 922 | 3300025916 | Ga0207663_10772227 | Ga0207663_107722272 | 104 |
| 923 | 3300025929 | Ga0207664_10003898 | Ga0207664_100038983 | 104 |
| 924 | 3300025929 | Ga0207664_10054343 | Ga0207664_100543435 | 104 |
| 925 | 3300026078 | Ga0207702_10669249 | Ga0207702_106692492 | 104 |
| 926 | 3300026078 | Ga0207702_11244060 | Ga0207702_112440602 | 104 |
| 927 | 3300026142 | Ga0207698_10503608 | Ga0207698_105036082 | 104 |
| 928 | 3300028556 | Ga0265337_1016990 | Ga0265337_10169902 | 104 |
| 929 | 3300028666 | Ga0265336_10101403 | Ga0265336_101014031 | 104 |
| 930 | 3300028800 | Ga0265338_10027009 | Ga0265338_100270095 | 104 |
| 931 | 3300031238 | Ga0265332_10057099 | Ga0265332_100570992 | 104 |
| 932 | 3300031241 | Ga0265325_10060819 | Ga0265325_100608193 | 104 |
| 933 | 3300031247 | Ga0265340_10211349 | Ga0265340_102113492 | 104 |
| 934 | 3300031249 | Ga0265339_10014310 | Ga0265339_100143101 | 104 |
| 935 | 3300031344 | Ga0265316_10025347 | Ga0265316_100253475 | 104 |
| 936 | 3300031595 | Ga0265313_10010563 | Ga0265313_100105634 | 104 |
| 937 | 3300031711 | Ga0265314_10007395 | Ga0265314_100073958 | 104 |
| 938 | 3300031712 | Ga0265342_10011777 | Ga0265342_100117773 | 104 |
| 939 | 3300036401 | Ga0373937_1483170 | Ga0373937_1483170_271_585 | 104 |
| 940 | 3300037312 | Ga0395899_0573369 | Ga0395899_0573369_113_427 | 104 |
| 941 | 3300037418 | Ga0395900_0128055 | Ga0395900_0128055_1811_2125 | 104 |
| 942 | 3300037418 | Ga0395900_1448153 | Ga0395900_1448153_96_410 | 104 |
| 943 | 3300037466 | Ga0395898_0207769 | Ga0395898_0207769_811_1125 | 104 |
| 944 | 3300038443 | Ga0395901_1088901 | Ga0395901_1088901_371_685 | 104 |
| 945 | 3300044694 | Ga0466963_0374982 | Ga0466963_0374982_178_495 | 104 |
| 946 | 3300045976 | Ga0466967_0127686 | Ga0466967_0127686_1175_1498 | 104 |
| 947 | 3300048907 | Ga0496104_0988404 | Ga0496104_0988404_105_422 | 104 |
| 948 | 3300048915 | Ga0496112_0082148 | Ga0496112_0082148_1480_1797 | 104 |
| 949 | 3300053078 | Ga0495612_0424336 | Ga0495612_0424336_73_390 | 104 |
| 950 | 3300025922 | Ga0207646_10783520 | Ga0207646_107835202 | 105 |
| 951 | 3300028558 | Ga0265326_10049203 | Ga0265326_100492032 | 105 |
| 952 | 3300028563 | Ga0265319_1022703 | Ga0265319_10227032 | 105 |
| 953 | 3300028573 | Ga0265334_10009412 | Ga0265334_100094122 | 105 |
| 954 | 3300028577 | Ga0265318_10000788 | Ga0265318_1000078823 | 105 |
| 955 | 3300028654 | Ga0265322_10044206 | Ga0265322_100442062 | 105 |
| 956 | 3300028666 | Ga0265336_10054715 | Ga0265336_100547152 | 105 |
| 957 | 3300028800 | Ga0265338_10003688 | Ga0265338_100036884 | 105 |
| 958 | 3300031235 | Ga0265330_10000672 | Ga0265330_1000067225 | 105 |
| 959 | 3300031238 | Ga0265332_10018992 | Ga0265332_100189922 | 105 |
| 960 | 3300031239 | Ga0265328_10012489 | Ga0265328_100124892 | 105 |
| 961 | 3300031240 | Ga0265320_10099056 | Ga0265320_100990562 | 105 |
| 962 | 3300031241 | Ga0265325_10020864 | Ga0265325_100208643 | 105 |
| 963 | 3300031242 | Ga0265329_10016823 | Ga0265329_100168233 | 105 |
| 964 | 3300031247 | Ga0265340_10006639 | Ga0265340_100066395 | 105 |
| 965 | 3300031249 | Ga0265339_10175665 | Ga0265339_101756652 | 105 |
| 966 | 3300031250 | Ga0265331_10008097 | Ga0265331_100080978 | 105 |
| 967 | 3300031251 | Ga0265327_10006666 | Ga0265327_1000666610 | 105 |
| 968 | 3300031344 | Ga0265316_10068014 | Ga0265316_100680144 | 105 |
| 969 | 3300031595 | Ga0265313_10030697 | Ga0265313_100306973 | 105 |
| 970 | 3300031711 | Ga0265314_10098822 | Ga0265314_100988222 | 105 |
| 971 | 3300031712 | Ga0265342_10210518 | Ga0265342_102105182 | 105 |
| 972 | 3300044842 | Ga0466957_1298025 | Ga0466957_1298025_179_496 | 105 |
| 973 | 3300048915 | Ga0496112_0056461 | Ga0496112_0056461_931_1248 | 105 |
| 974 | 3300048915 | Ga0496112_0186249 | Ga0496112_0186249_65_382 | 105 |
| 975 | 3300048915 | Ga0496112_1036068 | Ga0496112_1036068_61_378 | 105 |
| 976 | 3300048916 | Ga0496113_0300215 | Ga0496113_0300215_853_1170 | 105 |
| 977 | 3300048916 | Ga0496113_0738305 | Ga0496113_0738305_311_628 | 105 |
| 978 | 3300005327 | Ga0070658_10009734 | Ga0070658_100097347 | 106 |
| 979 | 3300005327 | Ga0070658_10374225 | Ga0070658_103742251 | 106 |
| 980 | 3300005337 | Ga0070682_101787717 | Ga0070682_1017877171 | 106 |
| 981 | 3300005339 | Ga0070660_100003328 | Ga0070660_10000332811 | 106 |
| 982 | 3300005339 | Ga0070660_100031952 | Ga0070660_1000319526 | 106 |
| 983 | 3300005344 | Ga0070661_100259758 | Ga0070661_1002597582 | 106 |
| 984 | 3300005435 | Ga0070714_101529976 | Ga0070714_1015299762 | 106 |
| 985 | 3300005435 | Ga0070714_101842380 | Ga0070714_1018423802 | 106 |
| 986 | 3300005458 | Ga0070681_10152629 | Ga0070681_101526293 | 106 |
| 987 | 3300005530 | Ga0070679_100230258 | Ga0070679_1002302581 | 106 |
| 988 | 3300005563 | Ga0068855_100006484 | Ga0068855_1000064849 | 106 |
| 989 | 3300005563 | Ga0068855_100947419 | Ga0068855_1009474192 | 106 |
| 990 | 3300005616 | Ga0068852_101119958 | Ga0068852_1011199582 | 106 |
| 991 | 3300009551 | Ga0105238_11756639 | Ga0105238_117566392 | 106 |
| 992 | 3300013102 | Ga0157371_10144028 | Ga0157371_101440282 | 106 |
| 993 | 3300013102 | Ga0157371_10569547 | Ga0157371_105695472 | 106 |
| 994 | 3300013104 | Ga0157370_10017077 | Ga0157370_100170775 | 106 |
| 995 | 3300013104 | Ga0157370_11389367 | Ga0157370_113893672 | 106 |
| 996 | 3300013105 | Ga0157369_11171477 | Ga0157369_111714772 | 106 |
| 997 | 3300013307 | Ga0157372_10219081 | Ga0157372_102190813 | 106 |
| 998 | 3300013307 | Ga0157372_10917960 | Ga0157372_109179602 | 106 |
| 999 | 3300020070 | Ga0206356_10582850 | Ga0206356_105828501 | 106 |
| 1000 | 3300020075 | Ga0206349_1467851 | Ga0206349_14678512 | 106 |
| 1001 | 3300020081 | Ga0206354_10451936 | Ga0206354_104519366 | 106 |
| 1002 | 3300020082 | Ga0206353_12040664 | Ga0206353_120406646 | 106 |
| 1003 | 3300025909 | Ga0207705_10017947 | Ga0207705_100179473 | 106 |
| 1004 | 3300025909 | Ga0207705_10238310 | Ga0207705_102383102 | 106 |
| 1005 | 3300025912 | Ga0207707_10024218 | Ga0207707_100242185 | 106 |
| 1006 | 3300025913 | Ga0207695_10667101 | Ga0207695_106671012 | 106 |
| 1007 | 3300025919 | Ga0207657_10003170 | Ga0207657_1000317011 | 106 |
| 1008 | 3300025919 | Ga0207657_10014486 | Ga0207657_100144869 | 106 |
| 1009 | 3300025920 | Ga0207649_10030419 | Ga0207649_100304191 | 106 |
| 1010 | 3300025920 | Ga0207649_10205547 | Ga0207649_102055472 | 106 |
| 1011 | 3300025920 | Ga0207649_10547393 | Ga0207649_105473932 | 106 |
| 1012 | 3300025921 | Ga0207652_10571169 | Ga0207652_105711692 | 106 |
| 1013 | 3300025929 | Ga0207664_10458001 | Ga0207664_104580012 | 106 |
| 1014 | 3300025929 | Ga0207664_11366455 | Ga0207664_113664552 | 106 |
| 1015 | 3300025932 | Ga0207690_11837553 | Ga0207690_118375532 | 106 |
| 1016 | 3300025949 | Ga0207667_10182073 | Ga0207667_101820731 | 106 |
| 1017 | 3300025981 | Ga0207640_10090763 | Ga0207640_100907632 | 106 |
| 1018 | 3300037312 | Ga0395899_0080577 | Ga0395899_0080577_289_609 | 106 |
| 1019 | 3300037418 | Ga0395900_0658226 | Ga0395900_0658226_287_607 | 106 |
| 1020 | 3300037466 | Ga0395898_0095120 | Ga0395898_0095120_1885_2205 | 106 |
| 1021 | 3300037471 | Ga0395905_1048441 | Ga0395905_1048441_149_469 | 106 |
| 1022 | 3300038443 | Ga0395901_0089797 | Ga0395901_0089797_1029_1349 | 106 |
| 1023 | 3300048915 | Ga0496112_1216066 | Ga0496112_1216066_233_553 | 106 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qp7-assembly1.cif.gz_1 | structure of the human 48s initiation complex in closed state (h48s aug closed) | 0.7527 | 36 | 71 |
| 5g06-assembly1.cif.gz_D | cryo-em structure of yeast cytoplasmic exosome | 0.7471 | 16 | 52 |
| 7lbm-assembly1.cif.gz_0 | structure of the human mediator-bound transcription pre-initiation complex | 0.7464 | 36 | 73 |
| 6ybt-assembly1.cif.gz_1 | structure of a human 48s translational initiation complex - eif3bgi | 0.7457 | 36 | 71 |
| 6d6k-assembly1.cif.gz_A | structure of polyribonucleotide nucleotidyltransferase from acinetobacter baumannii | 0.7401 | 16 | 51 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4ID27_51_409_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.808 | 36 | 73 | 2.130.10.10 |
| af_Q8S2H5_315_629_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8078 | 36 | 73 | 3.60.21.10 |
| af_Q7XU84_7_321_3.60.40.10 | Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain | 0.7712 | 36 | 51 | 3.60.40.10 |
| af_Q4G061_490_685_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7584 | 36 | 71 | 2.130.10.10 |
| af_A0A2R8Q7Q3_23_327_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7378 | 34 | 73 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-U5HJB3-F1-model_v4 | Zn(2)-C6 fungal-type domain-containing protein | 0.7849 | 36 | 73 |
|
| AF-A0A1G3QPD1-F1-model_v4 | Type II secretion system protein K | 0.7645 | 36 | 73 |
|
| AF-A0A6L7MRY7-F1-model_v4 | General secretion pathway protein GspK | 0.7574 | 36 | 73 |
|
| AF-A0A7S2CZ40-F1-model_v4 | F-box protein Hrt3/FBXO9 C-terminal domain-containing protein | 0.7551 | 34 | 74 |
|
| AF-A0A1S1M166-F1-model_v4 | Uncharacterized protein | 0.7545 | 36 | 73 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar