F488443

General Info

Members Datasets Scaffolds Average Seq Length
1023 306 1023 108

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10207285|Ga0207664_102072853
Length 116
Sequence MDEDELDVPEPDSDERRLNIQMPAELIGGTYANFANVSFSQYEFTLTFARIEHEVEEGDVPGAVVARVNASPRFIPELIAALQDSYSKYVTREGIRNLPEAQGHSDADDTSASPGG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
124 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
125 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
126 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
181 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
182 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
234 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
304 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 8.02
Rhizosphere 91.1
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10009734 3300005327 Bacteria 7719
2 Ga0070658_10085504 3300005327 Bacteria 2594
3 Ga0070658_10374225 3300005327 Bacteria 1221
4 Ga0070658_10566130 3300005327 Bacteria 984
5 Ga0070658_11277009 3300005327 Unclassified 638
6 Ga0070683_100000682 3300005329 Bacteria 24589
7 Ga0070683_100046995 3300005329 Bacteria 3988
8 Ga0070683_100106628 3300005329 Bacteria 2642
9 Ga0070683_100629443 3300005329 Bacteria 1027
10 Ga0070680_100014283 3300005336 Bacteria 6202
11 Ga0070680_100105611 3300005336 Bacteria 2341
12 Ga0070680_100210240 3300005336 Bacteria 1641
13 Ga0070680_100445605 3300005336 Bacteria 1106
14 Ga0070680_100564676 3300005336 Unclassified 976
15 Ga0070682_100015147 3300005337 Bacteria 4464
16 Ga0070682_101354349 3300005337 Unclassified 607
17 Ga0070682_101787717 3300005337 Bacteria 536
18 Ga0068868_101450820 3300005338 Bacteria 641
19 Ga0070660_100001782 3300005339 Bacteria 14790
20 Ga0070660_100003328 3300005339 Bacteria 11044
21 Ga0070660_100031738 3300005339 Bacteria 3969
22 Ga0070660_100031952 3300005339 Bacteria 3958
23 Ga0070691_10056155 3300005341 Bacteria 1886
24 Ga0070691_10253315 3300005341 Bacteria 945
25 Ga0070687_101231344 3300005343 Unclassified 553
26 Ga0070661_100086770 3300005344 Bacteria 2314
27 Ga0070661_100259758 3300005344 Unclassified 1342
28 Ga0070661_100952102 3300005344 Bacteria 710
29 Ga0070671_100034613 3300005355 Bacteria 4182
30 Ga0070659_100846421 3300005366 Unclassified 797
31 Ga0070659_100857674 3300005366 Unclassified 792
32 Ga0070709_10008335 3300005434 Bacteria 5691
33 Ga0070709_10067769 3300005434 Bacteria 2293
34 Ga0070709_10078187 3300005434 Bacteria 2152
35 Ga0070709_10090319 3300005434 Bacteria 2019
36 Ga0070709_10463584 3300005434 Unclassified 956
37 Ga0070709_11766686 3300005434 Unclassified 506
38 Ga0070714_100002904 3300005435 Bacteria 12681
39 Ga0070714_100049516 3300005435 Bacteria 3576
40 Ga0070714_100071577 3300005435 Bacteria 2999
41 Ga0070714_100092539 3300005435 Bacteria 2650
42 Ga0070714_100094496 3300005435 Bacteria 2624
43 Ga0070714_100112726 3300005435 Bacteria 2410
44 Ga0070714_100215384 3300005435 Bacteria 1763
45 Ga0070714_100218997 3300005435 Unclassified 1749
46 Ga0070714_100431830 3300005435 Bacteria 1249
47 Ga0070714_100471587 3300005435 Bacteria 1194
48 Ga0070714_101529976 3300005435 Bacteria 652
49 Ga0070714_101842380 3300005435 Unclassified 591
50 Ga0070713_100000801 3300005436 Bacteria 20125
51 Ga0070713_100024783 3300005436 Bacteria 4680
52 Ga0070713_100518532 3300005436 Unclassified 1126
53 Ga0070710_10009224 3300005437 Bacteria 4822
54 Ga0070710_10025527 3300005437 Bacteria 3130
55 Ga0070710_10448744 3300005437 Unclassified 874
56 Ga0070710_10512121 3300005437 Bacteria 823
57 Ga0070710_10890300 3300005437 Bacteria 642
58 Ga0070711_100002572 3300005439 Bacteria 10383
59 Ga0070711_100053954 3300005439 Bacteria 2772
60 Ga0070711_100060945 3300005439 Bacteria 2625
61 Ga0070711_100926352 3300005439 Bacteria 745
62 Ga0070711_101064732 3300005439 Bacteria 696
63 Ga0070694_100247988 3300005444 Bacteria 1346
64 Ga0070694_100266842 3300005444 Bacteria 1300
65 Ga0070708_100635391 3300005445 Bacteria 1006
66 Ga0070663_101443352 3300005455 Bacteria 610
67 Ga0070681_10046923 3300005458 Bacteria 4319
68 Ga0070681_10071171 3300005458 Bacteria 3442
69 Ga0070681_10082518 3300005458 Bacteria 3170
70 Ga0070681_10152629 3300005458 Bacteria 2236
71 Ga0070681_10190835 3300005458 Bacteria 1968
72 Ga0070681_10211448 3300005458 Bacteria 1856
73 Ga0070681_10226054 3300005458 Bacteria 1786
74 Ga0070681_10227477 3300005458 Bacteria 1780
75 Ga0070681_10243805 3300005458 Bacteria 1710
76 Ga0070706_100718497 3300005467 Unclassified 926
77 Ga0070706_101700403 3300005467 Bacteria 575
78 Ga0070707_100022323 3300005468 Bacteria 5982
79 Ga0070707_100035404 3300005468 Bacteria 4762
80 Ga0070707_100243368 3300005468 Bacteria 1751
81 Ga0070707_100880331 3300005468 Unclassified 860
82 Ga0070698_100041252 3300005471 Bacteria 4738
83 Ga0070698_100049309 3300005471 Bacteria 4298
84 Ga0070698_100133400 3300005471 Bacteria 2438
85 Ga0070698_100366155 3300005471 Bacteria 1373
86 Ga0070699_100218255 3300005518 Bacteria 1699
87 Ga0070699_100274647 3300005518 Bacteria 1509
88 Ga0070699_100437513 3300005518 Bacteria 1185
89 Ga0070679_100012002 3300005530 Bacteria 8268
90 Ga0070679_100031188 3300005530 Bacteria 5265
91 Ga0070679_100091661 3300005530 Bacteria 3027
92 Ga0070679_100179570 3300005530 Bacteria 2089
93 Ga0070679_100230258 3300005530 Bacteria 1813
94 Ga0070679_100332401 3300005530 Bacteria 1468
95 Ga0070679_100399888 3300005530 Bacteria 1320
96 Ga0070684_100008210 3300005535 Bacteria 8157
97 Ga0070684_100071994 3300005535 Bacteria 3042
98 Ga0070684_101479769 3300005535 Bacteria 640
99 Ga0070695_100000265 3300005545 Bacteria 26294
100 Ga0070696_100815919 3300005546 Unclassified 769
101 Ga0070693_100409806 3300005547 Bacteria 942
102 Ga0070704_100109343 3300005549 Unclassified 2100
103 Ga0068855_100006484 3300005563 Bacteria 14232
104 Ga0068855_100409946 3300005563 Bacteria 1484
105 Ga0068855_100818834 3300005563 Bacteria 988
106 Ga0068855_100947419 3300005563 Unclassified 907
107 Ga0070664_101171552 3300005564 Bacteria 725
108 Ga0068857_100199718 3300005577 Bacteria 1823
109 Ga0068857_101844116 3300005577 Bacteria 592
110 Ga0068856_100098406 3300005614 Bacteria 2915
111 Ga0068856_100115279 3300005614 Bacteria 2686
112 Ga0068856_100427551 3300005614 Unclassified 1344
113 Ga0068856_100497399 3300005614 Bacteria 1240
114 Ga0068856_101493298 3300005614 Bacteria 690
115 Ga0070702_100050938 3300005615 Bacteria 2368
116 Ga0068852_100242824 3300005616 Unclassified 1722
117 Ga0068852_101119958 3300005616 Bacteria 807
118 Ga0068852_101257571 3300005616 Bacteria 762
119 Ga0068858_100683461 3300005842 Bacteria 998
120 Ga0068860_101767756 3300005843 Bacteria 640
121 Ga0070717_10007082 3300006028 Bacteria 8307
122 Ga0070717_10013600 3300006028 Bacteria 6243
123 Ga0070717_10031923 3300006028 Bacteria 4240
124 Ga0070717_10049217 3300006028 Bacteria 3459
125 Ga0070717_10176291 3300006028 Bacteria 1861
126 Ga0070717_10426752 3300006028 Bacteria 1193
127 Ga0070717_10477044 3300006028 Bacteria 1126
128 Ga0070717_10680881 3300006028 Bacteria 934
129 Ga0070717_10919315 3300006028 Unclassified 797
130 Ga0075365_10849160 3300006038 Unclassified 644
131 Ga0070715_10005269 3300006163 Bacteria 4300
132 Ga0070716_100003859 3300006173 Bacteria 7114
133 Ga0070716_100018111 3300006173 Bacteria 3664
134 Ga0070716_100020120 3300006173 Bacteria 3500
135 Ga0070716_100210958 3300006173 Bacteria 1298
136 Ga0070716_100436688 3300006173 Bacteria 951
137 Ga0070716_101581982 3300006173 Unclassified 538
138 Ga0070712_100028000 3300006175 Bacteria 3766
139 Ga0070712_100058473 3300006175 Bacteria 2712
140 Ga0070712_100253298 3300006175 Unclassified 1408
141 Ga0070712_100445355 3300006175 Bacteria 1077
142 Ga0070712_100837485 3300006175 Bacteria 791
143 Ga0070712_101081141 3300006175 Bacteria 696
144 Ga0075433_10324794 3300006852 Unclassified 1361
145 Ga0075433_10430070 3300006852 Bacteria 1164
146 Ga0075433_10493077 3300006852 Bacteria 1079
147 Ga0075434_100013210 3300006871 Bacteria 7847
148 Ga0068865_100417737 3300006881 Bacteria 1102
149 Ga0075436_100167210 3300006914 Bacteria 1552
150 Ga0075436_101282923 3300006914 Bacteria 554
151 Ga0075435_100725352 3300007076 Unclassified 864
152 Ga0075435_101357572 3300007076 Archaea 623
153 Ga0099795_10454618 3300007788 Unclassified 590
154 Ga0105240_10037102 3300009093 Bacteria 6265
155 Ga0105240_10058261 3300009093 Bacteria 4822
156 Ga0105240_10640569 3300009093 Unclassified 1166
157 Ga0105240_10808587 3300009093 Unclassified 1015
158 Ga0105240_11669978 3300009093 Bacteria 665
159 Ga0111539_11408433 3300009094 Unclassified 809
160 Ga0105245_10173604 3300009098 Bacteria 2054
161 Ga0105245_10496423 3300009098 Bacteria 1236
162 Ga0105245_11460550 3300009098 Bacteria 734
163 Ga0105247_10055600 3300009101 Bacteria 2442
164 Ga0114129_11629417 3300009147 Unclassified 789
165 Ga0105242_10433116 3300009176 Bacteria 1235
166 Ga0105242_10525862 3300009176 Bacteria 1129
167 Ga0105242_11776964 3300009176 Bacteria 654
168 Ga0105248_10493375 3300009177 Bacteria 1380
169 Ga0105248_10780279 3300009177 Bacteria 1078
170 Ga0105248_10806199 3300009177 Bacteria 1060
171 Ga0105237_10039879 3300009545 Bacteria 4738
172 Ga0105237_12118390 3300009545 Unclassified 571
173 Ga0105237_12284450 3300009545 Unclassified 551
174 Ga0105238_10035269 3300009551 Bacteria 5086
175 Ga0105238_11299361 3300009551 Unclassified 753
176 Ga0105238_11756639 3300009551 Bacteria 652
177 Ga0099796_10360770 3300010159 Bacteria 629
178 Ga0105239_10125430 3300010375 Bacteria 2853
179 Ga0105239_10606228 3300010375 Unclassified 1249
180 Ga0157373_10141834 3300013100 Bacteria 1690
181 Ga0157373_10208399 3300013100 Bacteria 1378
182 Ga0157373_10608029 3300013100 Bacteria 796
183 Ga0157371_10144028 3300013102 Bacteria 1698
184 Ga0157371_10569547 3300013102 Bacteria 841
185 Ga0157370_10009353 3300013104 Bacteria 10485
186 Ga0157370_10017077 3300013104 Bacteria 7331
187 Ga0157370_10141323 3300013104 Bacteria 2243
188 Ga0157370_10530462 3300013104 Unclassified 1080
189 Ga0157370_10605538 3300013104 Unclassified 1003
190 Ga0157370_11335105 3300013104 Unclassified 646
191 Ga0157370_11389367 3300013104 Bacteria 632
192 Ga0157370_11804151 3300013104 Unclassified 549
193 Ga0157370_11812284 3300013104 Unclassified 548
194 Ga0157369_10001145 3300013105 Bacteria 33059
195 Ga0157369_10019029 3300013105 Bacteria 7689
196 Ga0157369_10040236 3300013105 Bacteria 5104
197 Ga0157369_10416301 3300013105 Bacteria 1393
198 Ga0157369_10586687 3300013105 Bacteria 1151
199 Ga0157369_11171477 3300013105 Bacteria 785
200 Ga0157369_11246815 3300013105 Bacteria 758
201 Ga0157374_10120956 3300013296 Bacteria 2527
202 Ga0157374_10139452 3300013296 Bacteria 2353
203 Ga0157374_10882096 3300013296 Bacteria 912
204 Ga0157378_11129856 3300013297 Bacteria 821
205 Ga0163162_10245382 3300013306 Bacteria 1923
206 Ga0157372_10095372 3300013307 Bacteria 3389
207 Ga0157372_10219081 3300013307 Bacteria 2206
208 Ga0157372_10458840 3300013307 Bacteria 1485
209 Ga0157372_10560087 3300013307 Bacteria 1332
210 Ga0157372_10917960 3300013307 Bacteria 1015
211 Ga0157372_10990852 3300013307 Bacteria 973
212 Ga0157372_11772468 3300013307 Unclassified 710
213 Ga0157372_12066558 3300013307 Unclassified 655
214 Ga0157372_13230627 3300013307 Bacteria 520
215 Ga0157375_10327714 3300013308 Bacteria 1696
216 Ga0163163_12825034 3300014325 Unclassified 542
217 Ga0182008_10016723 3300014497 Bacteria 3806
218 Ga0182008_10099413 3300014497 Bacteria 1437
219 Ga0182008_10246628 3300014497 Bacteria 920
220 Ga0182008_10523615 3300014497 Bacteria 655
221 Ga0182008_10584864 3300014497 Bacteria 624
222 Ga0182008_10882034 3300014497 Bacteria 525
223 Ga0157379_10191763 3300014968 Unclassified 1847
224 Ga0157376_10017404 3300014969 Bacteria 5482
225 Ga0157376_11582992 3300014969 Unclassified 689
226 Ga0157376_12130055 3300014969 Unclassified 599
227 Ga0182006_1016295 3300015261 Bacteria 3171
228 Ga0182007_10018540 3300015262 Bacteria 2519
229 Ga0206356_10582850 3300020070 Bacteria 641
230 Ga0206356_11584572 3300020070 Bacteria 1564
231 Ga0206349_1467851 3300020075 Unclassified 666
232 Ga0206354_10451936 3300020081 Bacteria 3526
233 Ga0206354_10531976 3300020081 Unclassified 1148
234 Ga0206354_11239232 3300020081 Bacteria 879
235 Ga0206353_10289596 3300020082 Bacteria 1256
236 Ga0206353_11314291 3300020082 Bacteria 763
237 Ga0206353_12040664 3300020082 Bacteria 5700
238 Ga0213874_10046469 3300021377 Bacteria 1318
239 Ga0213876_10487114 3300021384 Bacteria 656
240 Ga0213871_10030518 3300021441 Bacteria 1403
241 Ga0224712_10655245 3300022467 Bacteria 515
242 Ga0207692_10023816 3300025898 Bacteria 2837
243 Ga0207692_10037256 3300025898 Bacteria 2378
244 Ga0207692_10330626 3300025898 Unclassified 935
245 Ga0207692_11084736 3300025898 Bacteria 530
246 Ga0207710_10062626 3300025900 Unclassified 1691
247 Ga0207647_10590702 3300025904 Bacteria 613
248 Ga0207685_10001113 3300025905 Bacteria 5343
249 Ga0207699_10026168 3300025906 Bacteria 3212
250 Ga0207699_10045831 3300025906 Bacteria 2554
251 Ga0207699_10046097 3300025906 Bacteria 2548
252 Ga0207699_10057762 3300025906 Bacteria 2318
253 Ga0207699_10068842 3300025906 Bacteria 2156
254 Ga0207699_10069126 3300025906 Bacteria 2152
255 Ga0207705_10017947 3300025909 Bacteria 5061
256 Ga0207705_10065177 3300025909 Bacteria 2633
257 Ga0207705_10067247 3300025909 Bacteria 2593
258 Ga0207705_10203568 3300025909 Bacteria 1500
259 Ga0207705_10238310 3300025909 Bacteria 1385
260 Ga0207684_10828969 3300025910 Unclassified 781
261 Ga0207707_10024218 3300025912 Bacteria 5311
262 Ga0207707_10025872 3300025912 Bacteria 5132
263 Ga0207707_10095478 3300025912 Bacteria 2598
264 Ga0207707_10112571 3300025912 Bacteria 2379
265 Ga0207707_10190270 3300025912 Bacteria 1790
266 Ga0207707_10231095 3300025912 Bacteria 1609
267 Ga0207707_10290210 3300025912 Bacteria 1415
268 Ga0207695_10225920 3300025913 Bacteria 1778
269 Ga0207695_10277597 3300025913 Bacteria 1570
270 Ga0207695_10667101 3300025913 Bacteria 921
271 Ga0207671_10190994 3300025914 Bacteria 1597
272 Ga0207693_10000814 3300025915 Bacteria 27803
273 Ga0207693_10000920 3300025915 Bacteria 26422
274 Ga0207693_10065202 3300025915 Bacteria 2853
275 Ga0207693_10259586 3300025915 Bacteria 1363
276 Ga0207693_10283420 3300025915 Bacteria 1298
277 Ga0207693_10395283 3300025915 Bacteria 1081
278 Ga0207693_10770359 3300025915 Bacteria 743
279 Ga0207663_10015847 3300025916 Bacteria 4168
280 Ga0207663_10096802 3300025916 Unclassified 1972
281 Ga0207663_10699025 3300025916 Bacteria 803
282 Ga0207663_10772227 3300025916 Bacteria 764
283 Ga0207663_11134982 3300025916 Bacteria 629
284 Ga0207660_10019550 3300025917 Bacteria 4528
285 Ga0207660_10083143 3300025917 Bacteria 2357
286 Ga0207660_10309987 3300025917 Bacteria 1258
287 Ga0207660_10527571 3300025917 Bacteria 959
288 Ga0207662_10435502 3300025918 Bacteria 894
289 Ga0207657_10003170 3300025919 Bacteria 17601
290 Ga0207657_10008838 3300025919 Bacteria 10190
291 Ga0207657_10014486 3300025919 Bacteria 7695
292 Ga0207657_10026169 3300025919 Bacteria 5367
293 Ga0207649_10030184 3300025920 Bacteria 3208
294 Ga0207649_10030419 3300025920 Unclassified 3198
295 Ga0207649_10142378 3300025920 Unclassified 1642
296 Ga0207649_10205547 3300025920 Unclassified 1394
297 Ga0207649_10547393 3300025920 Unclassified 885
298 Ga0207652_10011197 3300025921 Bacteria 7226
299 Ga0207652_10071202 3300025921 Bacteria 3021
300 Ga0207652_10109179 3300025921 Bacteria 2452
301 Ga0207652_10176255 3300025921 Unclassified 1920
302 Ga0207652_10183542 3300025921 Bacteria 1881
303 Ga0207652_10213223 3300025921 Bacteria 1739
304 Ga0207652_10418300 3300025921 Bacteria 1209
305 Ga0207652_10571169 3300025921 Bacteria 1015
306 Ga0207652_10844137 3300025921 Bacteria 811
307 Ga0207652_11576738 3300025921 Unclassified 561
308 Ga0207646_10001386 3300025922 Bacteria 30019
309 Ga0207646_10035040 3300025922 Bacteria 4536
310 Ga0207646_10617919 3300025922 Bacteria 972
311 Ga0207646_10783520 3300025922 Unclassified 850
312 Ga0207687_10241320 3300025927 Bacteria 1432
313 Ga0207700_10000006 3300025928 Bacteria 348187
314 Ga0207700_10026419 3300025928 Bacteria 4047
315 Ga0207700_10194226 3300025928 Bacteria 1707
316 Ga0207700_10560598 3300025928 Unclassified 1015
317 Ga0207700_11184650 3300025928 Bacteria 682
318 Ga0207664_10001397 3300025929 Bacteria 15865
319 Ga0207664_10003898 3300025929 Bacteria 10020
320 Ga0207664_10017802 3300025929 Bacteria 5220
321 Ga0207664_10018691 3300025929 Bacteria 5109
322 Ga0207664_10032295 3300025929 Bacteria 4011
323 Ga0207664_10035157 3300025929 Bacteria 3864
324 Ga0207664_10054343 3300025929 Bacteria 3173
325 Ga0207664_10190644 3300025929 Bacteria 1764
326 Ga0207664_10200363 3300025929 Bacteria 1723
327 Ga0207664_10207285 3300025929 Bacteria 1695
328 Ga0207664_10233746 3300025929 Unclassified 1598
329 Ga0207664_10458001 3300025929 Bacteria 1139
330 Ga0207664_10707705 3300025929 Bacteria 906
331 Ga0207664_11021426 3300025929 Bacteria 741
332 Ga0207664_11366455 3300025929 Bacteria 629
333 Ga0207664_11422224 3300025929 Bacteria 614
334 Ga0207664_11479422 3300025929 Bacteria 601
335 Ga0207644_10083224 3300025931 Bacteria 2369
336 Ga0207644_10386778 3300025931 Unclassified 1142
337 Ga0207690_10251900 3300025932 Unclassified 1364
338 Ga0207690_11346899 3300025932 Bacteria 597
339 Ga0207690_11811886 3300025932 Bacteria 510
340 Ga0207690_11837553 3300025932 Unclassified 506
341 Ga0207686_10536237 3300025934 Bacteria 913
342 Ga0207686_11233929 3300025934 Bacteria 613
343 Ga0207704_10421870 3300025938 Bacteria 1058
344 Ga0207665_10000247 3300025939 Bacteria 37247
345 Ga0207665_10005520 3300025939 Bacteria 8434
346 Ga0207665_10075321 3300025939 Bacteria 2311
347 Ga0207665_10360193 3300025939 Bacteria 1100
348 Ga0207665_10551896 3300025939 Bacteria 895
349 Ga0207665_11381714 3300025939 Unclassified 561
350 Ga0207711_10280780 3300025941 Bacteria 1534
351 Ga0207711_10429780 3300025941 Unclassified 1229
352 Ga0207711_10464403 3300025941 Bacteria 1179
353 Ga0207711_10964423 3300025941 Bacteria 792
354 Ga0207661_10025875 3300025944 Bacteria 4465
355 Ga0207661_10033486 3300025944 Bacteria 3989
356 Ga0207661_10266862 3300025944 Bacteria 1526
357 Ga0207679_10479241 3300025945 Unclassified 1107
358 Ga0207667_10182073 3300025949 Bacteria 2157
359 Ga0207667_10460936 3300025949 Bacteria 1291
360 Ga0207667_10700870 3300025949 Bacteria 1015
361 Ga0207640_10090763 3300025981 Bacteria 2115
362 Ga0207677_11062385 3300026023 Bacteria 736
363 Ga0207639_12297231 3300026041 Unclassified 501
364 Ga0207678_11260407 3300026067 Bacteria 654
365 Ga0207678_11271975 3300026067 Bacteria 651
366 Ga0207702_10088815 3300026078 Bacteria 2701
367 Ga0207702_10189089 3300026078 Bacteria 1901
368 Ga0207702_10669249 3300026078 Bacteria 1022
369 Ga0207702_11085766 3300026078 Unclassified 794
370 Ga0207702_11244060 3300026078 Bacteria 739
371 Ga0207641_10290913 3300026088 Bacteria 1540
372 Ga0207674_10124716 3300026116 Bacteria 2541
373 Ga0207683_10147298 3300026121 Bacteria 2124
374 Ga0207698_10248799 3300026142 Unclassified 1625
375 Ga0207698_10503608 3300026142 Bacteria 1179
376 Ga0265337_1016990 3300028556 Bacteria 2342
377 Ga0265326_10049203 3300028558 Bacteria 1194
378 Ga0265319_1007813 3300028563 Bacteria 4757
379 Ga0265319_1022703 3300028563 Bacteria 2281
380 Ga0265319_1025818 3300028563 Bacteria 2099
381 Ga0265319_1187408 3300028563 Bacteria 636
382 Ga0265334_10009412 3300028573 Bacteria 4132
383 Ga0265334_10059590 3300028573 Bacteria 1442
384 Ga0265334_10075215 3300028573 Bacteria 1252
385 Ga0265334_10248913 3300028573 Unclassified 612
386 Ga0265318_10000788 3300028577 Bacteria 21011
387 Ga0265318_10029227 3300028577 Bacteria 2150
388 Ga0265318_10038532 3300028577 Bacteria 1827
389 Ga0265318_10077287 3300028577 Bacteria 1231
390 Ga0265322_10012790 3300028654 Bacteria 2430
391 Ga0265322_10044206 3300028654 Bacteria 1268
392 Ga0265322_10048347 3300028654 Bacteria 1209
393 Ga0265336_10001699 3300028666 Bacteria 9698
394 Ga0265336_10037811 3300028666 Bacteria 1483
395 Ga0265336_10054715 3300028666 Bacteria 1201
396 Ga0265336_10101403 3300028666 Bacteria 858
397 Ga0265338_10002456 3300028800 Bacteria 27727
398 Ga0265338_10003688 3300028800 Bacteria 21332
399 Ga0265338_10011083 3300028800 Bacteria 10457
400 Ga0265338_10027009 3300028800 Bacteria 5772
401 Ga0265338_10042058 3300028800 Bacteria 4262
402 Ga0265338_10072190 3300028800 Bacteria 2948
403 Ga0265338_10083009 3300028800 Bacteria 2681
404 Ga0265338_10113409 3300028800 Bacteria 2177
405 Ga0265338_10195867 3300028800 Unclassified 1527
406 Ga0265324_10083740 3300029957 Bacteria 1085
407 Ga0265330_10000672 3300031235 Bacteria 21962
408 Ga0265330_10004373 3300031235 Bacteria 7174
409 Ga0265330_10094669 3300031235 Unclassified 1281
410 Ga0265332_10018992 3300031238 Bacteria 3034
411 Ga0265332_10057099 3300031238 Bacteria 1673
412 Ga0265332_10374389 3300031238 Bacteria 588
413 Ga0265332_10383295 3300031238 Bacteria 581
414 Ga0265328_10012489 3300031239 Bacteria 3379
415 Ga0265328_10068228 3300031239 Bacteria 1306
416 Ga0265320_10014307 3300031240 Bacteria 4522
417 Ga0265320_10099056 3300031240 Bacteria 1343
418 Ga0265320_10169979 3300031240 Unclassified 979
419 Ga0265325_10020864 3300031241 Bacteria 3606
420 Ga0265325_10045429 3300031241 Bacteria 2282
421 Ga0265325_10060819 3300031241 Bacteria 1917
422 Ga0265325_10079377 3300031241 Bacteria 1633
423 Ga0265329_10016823 3300031242 Bacteria 2528
424 Ga0265329_10050423 3300031242 Bacteria 1326
425 Ga0265340_10006639 3300031247 Bacteria 6346
426 Ga0265340_10211349 3300031247 Bacteria 871
427 Ga0265339_10014310 3300031249 Bacteria 4784
428 Ga0265339_10175665 3300031249 Bacteria 1069
429 Ga0265331_10008097 3300031250 Bacteria 6002
430 Ga0265331_10030596 3300031250 Bacteria 2680
431 Ga0265327_10006666 3300031251 Bacteria 9160
432 Ga0265327_10063059 3300031251 Bacteria 1883
433 Ga0265327_10081029 3300031251 Bacteria 1603
434 Ga0265316_10025347 3300031344 Bacteria 4950
435 Ga0265316_10068014 3300031344 Bacteria 2753
436 Ga0265313_10010563 3300031595 Bacteria 5823
437 Ga0265313_10028666 3300031595 Bacteria 2890
438 Ga0265313_10030697 3300031595 Bacteria 2762
439 Ga0265314_10007395 3300031711 Bacteria 9526
440 Ga0265314_10093079 3300031711 Bacteria 1957
441 Ga0265314_10098822 3300031711 Bacteria 1881
442 Ga0265314_10104317 3300031711 Unclassified 1816
443 Ga0265342_10011777 3300031712 Bacteria 5963
444 Ga0265342_10019089 3300031712 Bacteria 4424
445 Ga0265342_10210518 3300031712 Bacteria 1051
446 Ga0265342_10240671 3300031712 Unclassified 969
447 Ga0265342_10528442 3300031712 Unclassified 600
448 Ga0307405_10093478 3300031731 Bacteria 1998
449 Ga0307416_100246297 3300032002 Bacteria 1736
450 Ga0307415_100305825 3300032126 Bacteria 1319
451 Ga0373926_0012170 3300035083 Bacteria 2906
452 Ga0373929_0198666 3300035085 Bacteria 561
453 Ga0373934_0192213 3300035086 Unclassified 840
454 Ga0373944_0136839 3300035089 Bacteria 855
455 Ga0373949_0013045 3300035090 Bacteria 1842
456 Ga0373951_0139555 3300035091 Bacteria 672
457 Ga0373923_0601161 3300035111 Bacteria 542
458 Ga0373936_0125929 3300035113 Bacteria 1098
459 Ga0373945_0581142 3300035116 Unclassified 505
460 Ga0373956_0463976 3300035119 Bacteria 604
461 Ga0373957_0313898 3300035120 Unclassified 666
462 Ga0373960_0292337 3300035121 Unclassified 604
463 Ga0373943_0001012 3300035170 Bacteria 12501
464 Ga0373943_0503745 3300035170 Unclassified 708
465 Ga0373946_0063315 3300035171 Bacteria 1579
466 Ga0373955_0035019 3300035172 Unclassified 2656
467 Ga0373955_1019257 3300035172 Bacteria 510
468 Ga0373961_0243972 3300035241 Unclassified 648
469 Ga0373931_0010780 3300035691 Bacteria 4401
470 Ga0373935_0047048 3300035692 Bacteria 2726
471 Ga0373927_0049245 3300035695 Bacteria 2725
472 Ga0373933_0048671 3300035724 Bacteria 2525
473 Ga0373947_0001552 3300035725 Bacteria 14072
474 Ga0373937_0000355 3300036401 Bacteria 42585
475 Ga0373937_0317727 3300036401 Bacteria 1473
476 Ga0373937_0379173 3300036401 Bacteria 1341
477 Ga0373937_1483170 3300036401 Unclassified 626
478 Ga0373937_1902801 3300036401 Bacteria 541
479 Ga0373925_0007406 3300037068 Bacteria 8008
480 Ga0395899_0080577 3300037312 Bacteria 2369
481 Ga0395899_0102523 3300037312 Bacteria 2065
482 Ga0395899_0143077 3300037312 Bacteria 1700
483 Ga0395899_0573369 3300037312 Bacteria 722
484 Ga0395900_0128055 3300037418 Bacteria 2603
485 Ga0395900_0140283 3300037418 Bacteria 2475
486 Ga0395900_0221277 3300037418 Archaea 1908
487 Ga0395900_0388044 3300037418 Bacteria 1363
488 Ga0395900_0658226 3300037418 Bacteria 983
489 Ga0395900_0709558 3300037418 Bacteria 939
490 Ga0395900_1448153 3300037418 Bacteria 599
491 Ga0395898_0095120 3300037466 Bacteria 2862
492 Ga0395898_0207769 3300037466 Bacteria 1868
493 Ga0395898_0796814 3300037466 Bacteria 885
494 Ga0395898_0904405 3300037466 Bacteria 821
495 Ga0395898_0917966 3300037466 Archaea 813
496 Ga0395898_0924804 3300037466 Bacteria 810
497 Ga0395898_1457309 3300037466 Unclassified 611
498 Ga0395905_0248304 3300037471 Bacteria 1662
499 Ga0395905_1042955 3300037471 Bacteria 721
500 Ga0395905_1048441 3300037471 Bacteria 718
501 Ga0395905_1146403 3300037471 Unclassified 681
502 Ga0395905_1557016 3300037471 Unclassified 566
503 Ga0395901_0089797 3300038443 Bacteria 3215
504 Ga0395901_0629307 3300038443 Bacteria 1079
505 Ga0395901_0789678 3300038443 Bacteria 939
506 Ga0395901_1088901 3300038443 Bacteria 770
507 Ga0395901_1129757 3300038443 Unclassified 753
508 Ga0395901_1273572 3300038443 Bacteria 698
509 Ga0395901_1289827 3300038443 Bacteria 692
510 Ga0436365_1260527 3300039437 Bacteria 708
511 Ga0436360_0134583 3300039438 Unclassified 704
512 Ga0436360_0249670 3300039438 Bacteria 2736
513 Ga0436363_0296049 3300039450 Bacteria 1572
514 Ga0439453_0002236 3300041408 Bacteria 2640
515 Ga0439461_0033180 3300041410 Bacteria 1085
516 Ga0451849_1048234 3300041505 Unclassified 1553
517 Ga0451853_1958868 3300041512 Unclassified 640
518 Ga0439445_0243414 3300042004 Bacteria 536
519 Ga0439448_0047072 3300042005 Bacteria 1406
520 Ga0439451_021447 3300042009 Bacteria 1303
521 Ga0466969_0003223 3300044656 Bacteria 8681
522 Ga0466969_0083616 3300044656 Bacteria 1520
523 Ga0466969_0128896 3300044656 Bacteria 1174
524 Ga0466969_0274891 3300044656 Bacteria 763
525 Ga0466972_0569304 3300044658 Unclassified 535
526 Ga0466965_0050616 3300044683 Unclassified 2060
527 Ga0466965_0052097 3300044683 Bacteria 2032
528 Ga0466965_0074998 3300044683 Bacteria 1705
529 Ga0466965_0075882 3300044683 Bacteria 1696
530 Ga0466965_0080484 3300044683 Unclassified 1646
531 Ga0466965_0515727 3300044683 Unclassified 672
532 Ga0466966_0017398 3300044684 Bacteria 4751
533 Ga0466966_0085063 3300044684 Bacteria 1966
534 Ga0466966_0086218 3300044684 Bacteria 1952
535 Ga0466966_0090799 3300044684 Bacteria 1896
536 Ga0466966_0254890 3300044684 Bacteria 1057
537 Ga0466966_0319246 3300044684 Bacteria 933
538 Ga0466966_0745912 3300044684 Bacteria 590
539 Ga0466961_0005282 3300044693 Bacteria 8128
540 Ga0466961_0008879 3300044693 Bacteria 6410
541 Ga0466961_0027130 3300044693 Bacteria 3682
542 Ga0466961_0079263 3300044693 Bacteria 2080
543 Ga0466961_0106343 3300044693 Unclassified 1766
544 Ga0466961_0133855 3300044693 Bacteria 1553
545 Ga0466961_0418829 3300044693 Bacteria 812
546 Ga0466963_0000010 3300044694 Bacteria 68690
547 Ga0466963_0000649 3300044694 Bacteria 16741
548 Ga0466963_0001770 3300044694 Bacteria 11779
549 Ga0466963_0002000 3300044694 Bacteria 11192
550 Ga0466963_0004407 3300044694 Bacteria 8176
551 Ga0466963_0004464 3300044694 Bacteria 8139
552 Ga0466963_0007182 3300044694 Bacteria 6641
553 Ga0466963_0010186 3300044694 Bacteria 5684
554 Ga0466963_0013797 3300044694 Bacteria 4973
555 Ga0466963_0023343 3300044694 Bacteria 3926
556 Ga0466963_0034779 3300044694 Bacteria 3280
557 Ga0466963_0061633 3300044694 Bacteria 2508
558 Ga0466963_0111563 3300044694 Bacteria 1877
559 Ga0466963_0165855 3300044694 Bacteria 1538
560 Ga0466963_0171253 3300044694 Bacteria 1514
561 Ga0466963_0284073 3300044694 Bacteria 1163
562 Ga0466963_0299326 3300044694 Bacteria 1131
563 Ga0466963_0374982 3300044694 Bacteria 1003
564 Ga0466963_0499035 3300044694 Unclassified 859
565 Ga0466963_0808330 3300044694 Bacteria 661
566 Ga0466963_0888203 3300044694 Unclassified 628
567 Ga0466964_0000213 3300044706 Bacteria 16442
568 Ga0466964_0008591 3300044706 Bacteria 3838
569 Ga0466964_0023691 3300044706 Bacteria 2387
570 Ga0466964_0031496 3300044706 Unclassified 2104
571 Ga0466964_0031869 3300044706 Bacteria 2092
572 Ga0466964_0039198 3300044706 Bacteria 1908
573 Ga0466964_0051369 3300044706 Bacteria 1693
574 Ga0466964_0100868 3300044706 Bacteria 1272
575 Ga0466964_0132499 3300044706 Bacteria 1137
576 Ga0466964_0167304 3300044706 Bacteria 1032
577 Ga0466964_0207540 3300044706 Bacteria 944
578 Ga0466964_0252216 3300044706 Bacteria 870
579 Ga0466964_0348546 3300044706 Unclassified 760
580 Ga0466964_0434408 3300044706 Bacteria 693
581 Ga0466964_0438146 3300044706 Unclassified 690
582 Ga0466964_0581351 3300044706 Unclassified 612
583 Ga0466971_0004429 3300044719 Bacteria 6060
584 Ga0466971_0006123 3300044719 Bacteria 5229
585 Ga0466971_0010450 3300044719 Bacteria 4057
586 Ga0466971_0034738 3300044719 Bacteria 2259
587 Ga0466971_0094401 3300044719 Bacteria 1371
588 Ga0466971_0295719 3300044719 Bacteria 777
589 Ga0466968_0001937 3300044735 Bacteria 7503
590 Ga0466968_0003137 3300044735 Bacteria 6099
591 Ga0466968_0005017 3300044735 Bacteria 4960
592 Ga0466968_0011205 3300044735 Bacteria 3494
593 Ga0466968_0018981 3300044735 Bacteria 2762
594 Ga0466968_0093842 3300044735 Bacteria 1333
595 Ga0466968_0138895 3300044735 Bacteria 1110
596 Ga0466970_0004127 3300044765 Bacteria 7141
597 Ga0466970_0137134 3300044765 Bacteria 1346
598 Ga0466970_0178128 3300044765 Bacteria 1179
599 Ga0466970_0283130 3300044765 Bacteria 933
600 Ga0466970_0724194 3300044765 Bacteria 581
601 Ga0466957_0009295 3300044842 Bacteria 5608
602 Ga0466957_0021958 3300044842 Bacteria 3764
603 Ga0466957_0025441 3300044842 Bacteria 3508
604 Ga0466957_0033272 3300044842 Bacteria 3092
605 Ga0466957_0094799 3300044842 Bacteria 1874
606 Ga0466957_0234214 3300044842 Bacteria 1216
607 Ga0466957_0289971 3300044842 Bacteria 1097
608 Ga0466957_0317661 3300044842 Bacteria 1050
609 Ga0466957_0408286 3300044842 Bacteria 930
610 Ga0466957_0459239 3300044842 Bacteria 878
611 Ga0466957_1067989 3300044842 Bacteria 581
612 Ga0466957_1135314 3300044842 Bacteria 564
613 Ga0466957_1298025 3300044842 Unclassified 528
614 Ga0466957_1433304 3300044842 Bacteria 503
615 Ga0466960_0005761 3300044901 Bacteria 4931
616 Ga0466960_0011815 3300044901 Bacteria 3668
617 Ga0466960_0039338 3300044901 Bacteria 2230
618 Ga0466960_0055310 3300044901 Bacteria 1930
619 Ga0466960_0097033 3300044901 Unclassified 1512
620 Ga0466960_0458479 3300044901 Bacteria 742
621 Ga0466960_0471454 3300044901 Unclassified 732
622 Ga0466960_0481040 3300044901 Bacteria 725
623 Ga0466959_0003840 3300045049 Bacteria 9964
624 Ga0466959_0009312 3300045049 Bacteria 6979
625 Ga0466959_0032586 3300045049 Bacteria 3857
626 Ga0466959_0050692 3300045049 Bacteria 3046
627 Ga0466959_0068110 3300045049 Bacteria 2580
628 Ga0466959_0596101 3300045049 Bacteria 743
629 Ga0466959_0874037 3300045049 Bacteria 600
630 Ga0451576_2700887 3300045051 Unclassified 505
631 Ga0466958_0000431 3300045836 Bacteria 17350
632 Ga0466958_0001425 3300045836 Bacteria 11326
633 Ga0466958_0002150 3300045836 Bacteria 9809
634 Ga0466958_0025195 3300045836 Bacteria 3505
635 Ga0466958_0066615 3300045836 Bacteria 2199
636 Ga0466958_0079309 3300045836 Bacteria 2019
637 Ga0466958_0115347 3300045836 Unclassified 1678
638 Ga0466958_0116169 3300045836 Bacteria 1672
639 Ga0466958_0399438 3300045836 Bacteria 887
640 Ga0466958_0409828 3300045836 Bacteria 875
641 Ga0466958_0551108 3300045836 Bacteria 749
642 Ga0466958_0642807 3300045836 Bacteria 690
643 Ga0466958_0783635 3300045836 Unclassified 621
644 Ga0466958_1069720 3300045836 Unclassified 526
645 Ga0466967_0000332 3300045976 Bacteria 21635
646 Ga0466967_0001331 3300045976 Bacteria 14150
647 Ga0466967_0002063 3300045976 Bacteria 12278
648 Ga0466967_0002354 3300045976 Bacteria 11698
649 Ga0466967_0010334 3300045976 Bacteria 6995
650 Ga0466967_0015409 3300045976 Bacteria 5990
651 Ga0466967_0016719 3300045976 Bacteria 5796
652 Ga0466967_0022864 3300045976 Bacteria 5111
653 Ga0466967_0023774 3300045976 Bacteria 5027
654 Ga0466967_0024167 3300045976 Bacteria 4992
655 Ga0466967_0038072 3300045976 Bacteria 4122
656 Ga0466967_0042311 3300045976 Bacteria 3935
657 Ga0466967_0062915 3300045976 Bacteria 3295
658 Ga0466967_0066290 3300045976 Bacteria 3216
659 Ga0466967_0077443 3300045976 Bacteria 2993
660 Ga0466967_0079621 3300045976 Bacteria 2954
661 Ga0466967_0099263 3300045976 Bacteria 2659
662 Ga0466967_0113945 3300045976 Bacteria 2488
663 Ga0466967_0127686 3300045976 Bacteria 2357
664 Ga0466967_0158743 3300045976 Bacteria 2121
665 Ga0466967_0169342 3300045976 Bacteria 2054
666 Ga0466967_0199979 3300045976 Bacteria 1892
667 Ga0466967_0202306 3300045976 Bacteria 1881
668 Ga0466967_0232813 3300045976 Bacteria 1754
669 Ga0466967_0245079 3300045976 Bacteria 1710
670 Ga0466967_0264260 3300045976 Unclassified 1647
671 Ga0466967_0421752 3300045976 Bacteria 1301
672 Ga0466967_0439108 3300045976 Bacteria 1274
673 Ga0466967_0451495 3300045976 Bacteria 1256
674 Ga0466967_0545234 3300045976 Unclassified 1141
675 Ga0466967_0709865 3300045976 Bacteria 996
676 Ga0466967_0718067 3300045976 Bacteria 990
677 Ga0466967_1210509 3300045976 Bacteria 752
678 Ga0495592_0000732 3300046454 Bacteria 22931
679 Ga0495592_0004058 3300046454 Bacteria 10646
680 Ga0495592_0080194 3300046454 Bacteria 2362
681 Ga0495592_0158825 3300046454 Bacteria 1557
682 Ga0495592_0387691 3300046454 Bacteria 888
683 Ga0495592_0461163 3300046454 Bacteria 794
684 Ga0495592_0769422 3300046454 Bacteria 574
685 Ga0495603_0046829 3300046455 Bacteria 2576
686 Ga0495629_0017747 3300046459 Bacteria 5100
687 Ga0495629_0131264 3300046459 Bacteria 1745
688 Ga0495629_0235242 3300046459 Bacteria 1262
689 Ga0495629_0252307 3300046459 Bacteria 1214
690 Ga0495629_0439069 3300046459 Bacteria 885
691 Ga0495641_0016066 3300046461 Bacteria 3958
692 Ga0495641_0026195 3300046461 Bacteria 2849
693 Ga0495641_0079331 3300046461 Bacteria 1471
694 Ga0495641_0086874 3300046461 Bacteria 1399
695 Ga0495641_0114459 3300046461 Bacteria 1203
696 Ga0495641_0204830 3300046461 Bacteria 884
697 Ga0495651_0000029 3300046462 Bacteria 105042
698 Ga0495651_0037777 3300046462 Bacteria 3760
699 Ga0495651_0139797 3300046462 Bacteria 1757
700 Ga0495651_0161878 3300046462 Bacteria 1602
701 Ga0495651_0342042 3300046462 Bacteria 991
702 Ga0495651_0454263 3300046462 Unclassified 827
703 Ga0495653_0001363 3300046463 Bacteria 18977
704 Ga0495653_0008307 3300046463 Bacteria 8509
705 Ga0495653_0072654 3300046463 Bacteria 2568
706 Ga0495653_0091261 3300046463 Bacteria 2227
707 Ga0495653_0115764 3300046463 Unclassified 1918
708 Ga0495653_0135178 3300046463 Bacteria 1740
709 Ga0495653_0151920 3300046463 Bacteria 1617
710 Ga0495653_0227844 3300046463 Bacteria 1249
711 Ga0495653_0374914 3300046463 Bacteria 910
712 Ga0495653_0575937 3300046463 Unclassified 694
713 Ga0495653_0861213 3300046463 Unclassified 542
714 Ga0495580_0024113 3300046472 Bacteria 4459
715 Ga0495582_0004164 3300046473 Bacteria 8134
716 Ga0495582_0150648 3300046473 Bacteria 1320
717 Ga0495639_0006273 3300046475 Bacteria 5106
718 Ga0495639_0340620 3300046475 Bacteria 752
719 Ga0495662_0001522 3300046476 Bacteria 11502
720 Ga0495662_0023497 3300046476 Bacteria 2977
721 Ga0495664_0042590 3300046477 Bacteria 2689
722 Ga0495664_0201632 3300046477 Bacteria 1205
723 Ga0495664_0267472 3300046477 Bacteria 1033
724 Ga0495584_0007847 3300046491 Bacteria 5550
725 Ga0495585_0025444 3300046492 Bacteria 3390
726 Ga0495594_0145070 3300046499 Bacteria 1347
727 Ga0495594_0319906 3300046499 Bacteria 884
728 Ga0495594_0639243 3300046499 Unclassified 603
729 Ga0495596_0062955 3300046500 Bacteria 1443
730 Ga0495607_0040771 3300046501 Bacteria 2762
731 Ga0495608_0014722 3300046511 Bacteria 5429
732 Ga0495608_0023778 3300046511 Bacteria 4194
733 Ga0495608_0032053 3300046511 Bacteria 3552
734 Ga0495608_0115571 3300046511 Bacteria 1722
735 Ga0495608_0312755 3300046511 Archaea 971
736 Ga0495608_0355764 3300046511 Unclassified 901
737 Ga0495608_0418423 3300046511 Bacteria 818
738 Ga0495618_0009479 3300046514 Bacteria 5882
739 Ga0495618_0034082 3300046514 Bacteria 3191
740 Ga0495618_0067575 3300046514 Bacteria 2273
741 Ga0495618_0104752 3300046514 Bacteria 1811
742 Ga0495618_0736342 3300046514 Unclassified 578
743 Ga0495628_0000016 3300046516 Bacteria 170260
744 Ga0495628_0014430 3300046516 Bacteria 6622
745 Ga0495628_0028205 3300046516 Bacteria 4563
746 Ga0495630_0000505 3300046517 Bacteria 28893
747 Ga0495630_0298166 3300046517 Bacteria 1232
748 Ga0495630_0681174 3300046517 Bacteria 787
749 Ga0495630_0770971 3300046517 Unclassified 735
750 Ga0495630_1362339 3300046517 Unclassified 534
751 Ga0495644_0020878 3300046523 Bacteria 2498
752 Ga0495663_0375953 3300046525 Bacteria 520
753 Ga0495666_0186505 3300046526 Bacteria 957
754 Ga0495652_0000045 3300046529 Bacteria 122469
755 Ga0495652_0006417 3300046529 Bacteria 10948
756 Ga0495652_0042714 3300046529 Bacteria 3908
757 Ga0495652_0081521 3300046529 Bacteria 2668
758 Ga0495652_0083596 3300046529 Bacteria 2627
759 Ga0495652_0118634 3300046529 Unclassified 2114
760 Ga0495652_0232474 3300046529 Unclassified 1378
761 Ga0495665_0029813 3300046531 Bacteria 2921
762 Ga0495640_0007391 3300046533 Bacteria 8645
763 Ga0495640_0014315 3300046533 Bacteria 6006
764 Ga0495640_0125500 3300046533 Bacteria 1665
765 Ga0495640_0954284 3300046533 Unclassified 506
766 Ga0495586_0034130 3300046535 Bacteria 2731
767 Ga0495586_0088546 3300046535 Bacteria 1708
768 Ga0495587_0000083 3300046536 Bacteria 73166
769 Ga0495587_0114475 3300046536 Bacteria 1547
770 Ga0495587_0655845 3300046536 Bacteria 576
771 Ga0495587_0674079 3300046536 Bacteria 568
772 Ga0495645_0001902 3300046543 Bacteria 14187
773 Ga0495645_0021257 3300046543 Bacteria 4689
774 Ga0495645_0028921 3300046543 Bacteria 4027
775 Ga0495645_0306506 3300046543 Bacteria 1035
776 Ga0495667_0025440 3300046559 Bacteria 3989
777 Ga0495667_0069376 3300046559 Bacteria 2300
778 Ga0495667_0111199 3300046559 Unclassified 1770
779 Ga0495667_0120029 3300046559 Bacteria 1698
780 Ga0495667_0193124 3300046559 Bacteria 1304
781 Ga0495667_0223154 3300046559 Archaea 1202
782 Ga0495667_0540690 3300046559 Bacteria 728
783 Ga0495656_0001481 3300046615 Bacteria 7683
784 Ga0495668_0245643 3300046616 Bacteria 980
785 Ga0495634_0003355 3300046642 Bacteria 12860
786 Ga0495634_0038164 3300046642 Bacteria 3276
787 Ga0495634_0091496 3300046642 Bacteria 1975
788 Ga0495634_0200725 3300046642 Bacteria 1239
789 Ga0495611_0124287 3300046648 Bacteria 1203
790 Ga0495635_0004708 3300046663 Bacteria 9481
791 Ga0495635_0044339 3300046663 Bacteria 3069
792 Ga0495635_0159815 3300046663 Unclassified 1533
793 Ga0495635_0275879 3300046663 Unclassified 1130
794 Ga0495635_0402960 3300046663 Bacteria 908
795 Ga0495635_0409722 3300046663 Unclassified 900
796 Ga0495635_0561639 3300046663 Bacteria 747
797 Ga0495635_0816601 3300046663 Bacteria 600
798 Ga0495661_0159110 3300046665 Bacteria 1214
799 Ga0495588_0088482 3300046674 Unclassified 1621
800 Ga0495657_0011595 3300046675 Bacteria 6586
801 Ga0495657_0037285 3300046675 Bacteria 3352
802 Ga0495657_0187772 3300046675 Bacteria 1264
803 Ga0495657_0241416 3300046675 Bacteria 1090
804 Ga0495657_0345525 3300046675 Bacteria 881
805 Ga0495657_0346145 3300046675 Bacteria 880
806 Ga0495657_0399648 3300046675 Bacteria 809
807 Ga0495657_0469575 3300046675 Bacteria 735
808 Ga0495657_0706024 3300046675 Bacteria 579
809 Ga0495599_0000187 3300046678 Bacteria 40807
810 Ga0495599_0000610 3300046678 Bacteria 20335
811 Ga0495599_0200702 3300046678 Bacteria 1225
812 Ga0495599_0235184 3300046678 Unclassified 1118
813 Ga0495599_0463928 3300046678 Unclassified 749
814 Ga0495623_0000121 3300046679 Bacteria 47882
815 Ga0495623_0005723 3300046679 Bacteria 8117
816 Ga0495623_0194689 3300046679 Bacteria 1169
817 Ga0495646_0001537 3300046680 Bacteria 13770
818 Ga0495646_0062692 3300046680 Bacteria 2210
819 Ga0495647_0000468 3300046681 Bacteria 11697
820 Ga0495647_0049997 3300046681 Bacteria 1621
821 Ga0495658_0011253 3300046683 Bacteria 4495
822 Ga0495658_0203263 3300046683 Bacteria 1235
823 Ga0495669_0276031 3300046684 Bacteria 808
824 Ga0495613_0062116 3300046689 Bacteria 2735
825 Ga0495613_0081268 3300046689 Bacteria 2355
826 Ga0495613_0456135 3300046689 Bacteria 865
827 Ga0495624_0005932 3300046690 Bacteria 8730
828 Ga0495624_0022126 3300046690 Bacteria 4208
829 Ga0495624_0408691 3300046690 Bacteria 815
830 Ga0495624_0633771 3300046690 Bacteria 636
831 Ga0495670_0072448 3300046691 Bacteria 1745
832 Ga0495589_0200021 3300046794 Bacteria 943
833 Ga0495600_0041000 3300046809 Bacteria 3017
834 Ga0495600_0228921 3300046809 Bacteria 1187
835 Ga0495600_0268406 3300046809 Bacteria 1083
836 Ga0495600_0473465 3300046809 Unclassified 772
837 Ga0495660_0280624 3300046810 Bacteria 762
838 Ga0495581_0002035 3300047315 Bacteria 11369
839 Ga0495581_0047064 3300047315 Bacteria 2493
840 Ga0495581_0263017 3300047315 Bacteria 1009
841 Ga0495604_0000072 3300047317 Bacteria 88631
842 Ga0495604_0087853 3300047317 Bacteria 2314
843 Ga0495604_0375810 3300047317 Bacteria 940
844 Ga0495604_0601678 3300047317 Bacteria 705
845 Ga0495674_0012591 3300047319 Bacteria 7969
846 Ga0495674_0073771 3300047319 Bacteria 2940
847 Ga0495674_0493489 3300047319 Bacteria 980
848 Ga0495674_0582007 3300047319 Unclassified 888
849 Ga0495676_0071355 3300047321 Bacteria 2670
850 Ga0495676_0155177 3300047321 Bacteria 1625
851 Ga0495676_0160103 3300047321 Bacteria 1593
852 Ga0495676_0429865 3300047321 Bacteria 873
853 Ga0495680_0004810 3300047322 Bacteria 12812
854 Ga0495680_0007057 3300047322 Bacteria 10354
855 Ga0495680_0016342 3300047322 Bacteria 6379
856 Ga0495680_0037008 3300047322 Bacteria 3911
857 Ga0495680_0108643 3300047322 Bacteria 2058
858 Ga0495680_0181638 3300047322 Archaea 1518
859 Ga0495680_0611430 3300047322 Unclassified 728
860 Ga0495680_0929519 3300047322 Bacteria 560
861 Ga0495683_0226532 3300047323 Bacteria 831
862 Ga0495675_0000031 3300047444 Bacteria 99240
863 Ga0495675_0355316 3300047444 Bacteria 861
864 Ga0495675_0563240 3300047444 Bacteria 649
865 Ga0495677_0028578 3300047445 Bacteria 2026
866 Ga0495679_055719 3300047446 Bacteria 1173
867 Ga0495684_0008099 3300047471 Bacteria 8125
868 Ga0495684_0019924 3300047471 Bacteria 5168
869 Ga0495684_0027689 3300047471 Bacteria 4352
870 Ga0495684_0297074 3300047471 Unclassified 1161
871 Ga0495684_0516700 3300047471 Unclassified 818
872 Ga0495684_0674395 3300047471 Unclassified 688
873 Ga0495593_0000333 3300047673 Bacteria 26121
874 Ga0495593_0119571 3300047673 Bacteria 1341
875 Ga0495602_0000133 3300048088 Bacteria 69392
876 Ga0495602_0024934 3300048088 Bacteria 5795
877 Ga0495602_0095157 3300048088 Bacteria 2460
878 Ga0495602_0678536 3300048088 Bacteria 701
879 Ga0495602_0723161 3300048088 Bacteria 674
880 Ga0495614_0001325 3300048089 Bacteria 10682
881 Ga0496100_0034269 3300048903 Bacteria 3184
882 Ga0496100_0049310 3300048903 Bacteria 2722
883 Ga0496100_0144881 3300048903 Bacteria 1688
884 Ga0496100_0974278 3300048903 Unclassified 667
885 Ga0496101_0002509 3300048904 Bacteria 11277
886 Ga0496101_0044485 3300048904 Bacteria 3178
887 Ga0496101_0110389 3300048904 Bacteria 2069
888 Ga0496101_0260787 3300048904 Bacteria 1352
889 Ga0496101_0952560 3300048904 Bacteria 675
890 Ga0496101_1067501 3300048904 Bacteria 634
891 Ga0496102_0005815 3300048905 Bacteria 10487
892 Ga0496102_0055705 3300048905 Bacteria 3605
893 Ga0496102_0100308 3300048905 Bacteria 2689
894 Ga0496102_0185761 3300048905 Bacteria 1959
895 Ga0496102_0352481 3300048905 Bacteria 1386
896 Ga0496102_0849525 3300048905 Bacteria 835
897 Ga0496103_0016363 3300048906 Bacteria 4426
898 Ga0496103_0023625 3300048906 Bacteria 3709
899 Ga0496104_0034254 3300048907 Bacteria 4733
900 Ga0496104_0039390 3300048907 Bacteria 4425
901 Ga0496104_0864155 3300048907 Bacteria 810
902 Ga0496104_0988404 3300048907 Unclassified 746
903 Ga0496105_0010632 3300048908 Bacteria 7240
904 Ga0496105_0017937 3300048908 Bacteria 5680
905 Ga0496105_0104099 3300048908 Unclassified 2344
906 Ga0496105_0845583 3300048908 Bacteria 693
907 Ga0496105_1212534 3300048908 Bacteria 555
908 Ga0496106_0030068 3300048909 Bacteria 4050
909 Ga0496106_0041047 3300048909 Bacteria 3466
910 Ga0496106_0103195 3300048909 Bacteria 2213
911 Ga0496106_0741584 3300048909 Bacteria 781
912 Ga0496107_0010435 3300048910 Bacteria 6453
913 Ga0496107_0093099 3300048910 Bacteria 2204
914 Ga0496107_0154752 3300048910 Bacteria 1697
915 Ga0496107_0155954 3300048910 Bacteria 1690
916 Ga0496107_1045708 3300048910 Unclassified 591
917 Ga0496108_0011946 3300048911 Bacteria 7065
918 Ga0496108_0036442 3300048911 Bacteria 4092
919 Ga0496108_0482952 3300048911 Bacteria 1082
920 Ga0496108_0631030 3300048911 Bacteria 932
921 Ga0496109_0009062 3300048912 Bacteria 8475
922 Ga0496109_0056369 3300048912 Bacteria 3586
923 Ga0496109_0344092 3300048912 Bacteria 1408
924 Ga0496109_0609685 3300048912 Bacteria 1028
925 Ga0496109_0620230 3300048912 Bacteria 1018
926 Ga0496110_0006093 3300048913 Bacteria 9501
927 Ga0496110_0237736 3300048913 Unclassified 1657
928 Ga0496110_0279650 3300048913 Bacteria 1520
929 Ga0496110_0733996 3300048913 Bacteria 890
930 Ga0496111_0016935 3300048914 Bacteria 5030
931 Ga0496111_0022289 3300048914 Bacteria 4432
932 Ga0496111_0271384 3300048914 Unclassified 1258
933 Ga0496111_0293454 3300048914 Bacteria 1206
934 Ga0496111_1136859 3300048914 Bacteria 555
935 Ga0496112_0056461 3300048915 Bacteria 3864
936 Ga0496112_0071929 3300048915 Bacteria 3418
937 Ga0496112_0082148 3300048915 Bacteria 3187
938 Ga0496112_0087667 3300048915 Bacteria 3079
939 Ga0496112_0089402 3300048915 Bacteria 3048
940 Ga0496112_0186249 3300048915 Bacteria 2039
941 Ga0496112_0289113 3300048915 Bacteria 1585
942 Ga0496112_0434252 3300048915 Unclassified 1251
943 Ga0496112_1036068 3300048915 Archaea 740
944 Ga0496112_1216066 3300048915 Bacteria 670
945 Ga0496112_1233356 3300048915 Unclassified 664
946 Ga0496113_0041344 3300048916 Bacteria 3402
947 Ga0496113_0166052 3300048916 Bacteria 1746
948 Ga0496113_0181263 3300048916 Bacteria 1670
949 Ga0496113_0234272 3300048916 Unclassified 1464
950 Ga0496113_0300215 3300048916 Bacteria 1286
951 Ga0496113_0555840 3300048916 Bacteria 920
952 Ga0496113_0738305 3300048916 Bacteria 784
953 Ga0496114_0011562 3300048917 Bacteria 7053
954 Ga0496114_0096721 3300048917 Bacteria 2514
955 Ga0496114_0176094 3300048917 Bacteria 1866
956 Ga0496115_0026093 3300048918 Bacteria 4556
957 Ga0496115_0043589 3300048918 Bacteria 3579
958 Ga0496115_0080724 3300048918 Bacteria 2648
959 Ga0496115_0082447 3300048918 Bacteria 2620
960 Ga0496115_0100595 3300048918 Bacteria 2370
961 Ga0496115_0199138 3300048918 Bacteria 1654
962 Ga0496115_0641835 3300048918 Bacteria 840
963 Ga0501034_0004589 3300049571 Bacteria 15299
964 Ga0501038_0655408 3300049574 Bacteria 790
965 Ga0501048_0291163 3300049582 Bacteria 1161
966 Ga0501067_0027300 3300049583 Bacteria 3163
967 Ga0501067_0057526 3300049583 Unclassified 2153
968 Ga0501067_0238382 3300049583 Bacteria 1012
969 Ga0501067_0274228 3300049583 Bacteria 939
970 Ga0501069_0019863 3300049585 Bacteria 3635
971 Ga0501069_0033705 3300049585 Bacteria 2821
972 Ga0501070_0025291 3300049586 Bacteria 4978
973 Ga0501070_0051543 3300049586 Bacteria 3416
974 Ga0501070_0846256 3300049586 Unclassified 716
975 Ga0501072_0015894 3300049588 Bacteria 5769
976 Ga0501073_0052133 3300049589 Bacteria 2865
977 Ga0501074_0017998 3300049590 Bacteria 5133
978 Ga0501079_0036453 3300049741 Bacteria 3789
979 Ga0501080_0000535 3300049742 Bacteria 29918
980 Ga0501080_0007055 3300049742 Bacteria 10146
981 Ga0501083_0011627 3300049744 Bacteria 6176
982 nmdc:mga05p37_1052152_c1 3300050507 Unclassified 858
983 nmdc:mga0n895_180850_c1 3300050512 Bacteria 2140
984 nmdc:mga0n895_5478_c1 3300050512 Bacteria 10620
985 nmdc:mga0rr50_1006024_c1 3300050513 Archaea 710
986 nmdc:mga0rr50_544609_c1 3300050513 Unclassified 988
987 nmdc:mga08x19_381534_c1 3300050514 Unclassified 987
988 nmdc:mga08x19_737301_c1 3300050514 Bacteria 699
989 nmdc:mga0a205_299821_c1 3300050515 Bacteria 1480
990 nmdc:mga0a205_488426_c1 3300050515 Bacteria 1089
991 Ga0495601_0000304 3300053077 Bacteria 26118
992 Ga0495601_0026164 3300053077 Bacteria 3600
993 Ga0495601_0033652 3300053077 Bacteria 3193
994 Ga0495601_0111956 3300053077 Unclassified 1768
995 Ga0495601_0167849 3300053077 Unclassified 1434
996 Ga0495601_0525157 3300053077 Unclassified 763
997 Ga0495601_0670365 3300053077 Unclassified 663
998 Ga0495612_0005159 3300053078 Bacteria 5399
999 Ga0495612_0011693 3300053078 Bacteria 3538
1000 Ga0495612_0424336 3300053078 Unclassified 606
1001 Ga0495612_0601550 3300053078 Bacteria 508
1002 Ga0495595_0004259 3300053084 Bacteria 5752
1003 Ga0495595_0010303 3300053084 Bacteria 3884
1004 Ga0495595_0015196 3300053084 Bacteria 3280
1005 Ga0495595_0104732 3300053084 Bacteria 1367
1006 Ga0495595_0617963 3300053084 Unclassified 554
1007 Ga0495595_0738570 3300053084 Bacteria 505
1008 Ga0495619_0000836 3300053085 Bacteria 20199
1009 Ga0495619_0001937 3300053085 Bacteria 13798
1010 Ga0495619_0109203 3300053085 Bacteria 1889
1011 Ga0495619_0109497 3300053085 Bacteria 1886
1012 Ga0495619_0296165 3300053085 Bacteria 1121
1013 Ga0495619_0568792 3300053085 Bacteria 777
1014 Ga0500566_0008196 3300053094 Bacteria 6182
1015 Ga0500614_224465 3300053123 Unclassified 583
1016 Ga0501082_0804749 3300060353 Bacteria 822
1017 Ga0466962_0002608 3300061719 Bacteria 8568
1018 Ga0466962_0005598 3300061719 Bacteria 6033
1019 Ga0466962_0012201 3300061719 Bacteria 4131
1020 Ga0466962_0028295 3300061719 Bacteria 2685
1021 Ga0466962_0029341 3300061719 Bacteria 2633
1022 Ga0466962_0041976 3300061719 Unclassified 2189
1023 Ga0466962_0382425 3300061719 Unclassified 703

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0128896 Ga0466969_0128896_831_1121 94
2 3300005436 Ga0070713_100024783 Ga0070713_1000247836 95
3 3300005439 Ga0070711_100926352 Ga0070711_1009263522 95
4 3300006028 Ga0070717_10680881 Ga0070717_106808812 95
5 3300006173 Ga0070716_100003859 Ga0070716_1000038592 95
6 3300006175 Ga0070712_101081141 Ga0070712_1010811412 95
7 3300006852 Ga0075433_10493077 Ga0075433_104930771 95
8 3300021384 Ga0213876_10487114 Ga0213876_104871141 95
9 3300025906 Ga0207699_10046097 Ga0207699_100460973 95
10 3300025915 Ga0207693_10395283 Ga0207693_103952832 95
11 3300025916 Ga0207663_10699025 Ga0207663_106990251 95
12 3300025928 Ga0207700_10000006 Ga0207700_10000006301 95
13 3300025929 Ga0207664_10233746 Ga0207664_102337462 95
14 3300025939 Ga0207665_10005520 Ga0207665_1000552010 95
15 3300031731 Ga0307405_10093478 Ga0307405_100934782 95
16 3300032002 Ga0307416_100246297 Ga0307416_1002462973 95
17 3300032126 Ga0307415_100305825 Ga0307415_1003058251 95
18 3300038443 Ga0395901_0629307 Ga0395901_0629307_351_638 95
19 3300039437 Ga0436365_1260527 Ga0436365_1260527_355_645 95
20 3300041410 Ga0439461_0033180 Ga0439461_0033180_214_516 95
21 3300042004 Ga0439445_0243414 Ga0439445_0243414_87_383 95
22 3300044684 Ga0466966_0017398 Ga0466966_0017398_2483_2824 95
23 3300045049 Ga0466959_0009312 Ga0466959_0009312_2984_3325 95
24 3300045976 Ga0466967_0709865 Ga0466967_0709865_532_819 95
25 3300048908 Ga0496105_0104099 Ga0496105_0104099_1202_1504 95
26 3300048913 Ga0496110_0237736 Ga0496110_0237736_1092_1394 95
27 3300048914 Ga0496111_0271384 Ga0496111_0271384_32_334 95
28 3300048916 Ga0496113_0555840 Ga0496113_0555840_191_493 95
29 3300050515 nmdc:mga0a205_488426_c1 nmdc:mga0a205_488426_c1_726_1028 95
30 3300005341 Ga0070691_10253315 Ga0070691_102533151 96
31 3300005444 Ga0070694_100266842 Ga0070694_1002668421 96
32 3300005458 Ga0070681_10211448 Ga0070681_102114482 96
33 3300005530 Ga0070679_100399888 Ga0070679_1003998882 96
34 3300005545 Ga0070695_100000265 Ga0070695_1000002653 96
35 3300005577 Ga0068857_101844116 Ga0068857_1018441162 96
36 3300009093 Ga0105240_10058261 Ga0105240_100582616 96
37 3300009098 Ga0105245_11460550 Ga0105245_114605502 96
38 3300009545 Ga0105237_10039879 Ga0105237_100398794 96
39 3300013307 Ga0157372_13230627 Ga0157372_132306271 96
40 3300025912 Ga0207707_10290210 Ga0207707_102902103 96
41 3300025913 Ga0207695_10277597 Ga0207695_102775971 96
42 3300025914 Ga0207671_10190994 Ga0207671_101909942 96
43 3300025921 Ga0207652_10844137 Ga0207652_108441372 96
44 3300041408 Ga0439453_0002236 Ga0439453_0002236_2058_2351 96
45 3300042009 Ga0439451_021447 Ga0439451_021447_323_616 96
46 3300044683 Ga0466965_0075882 Ga0466965_0075882_119_424 96
47 3300044706 Ga0466964_0252216 Ga0466964_0252216_497_802 96
48 3300044735 Ga0466968_0093842 Ga0466968_0093842_257_562 96
49 3300044842 Ga0466957_1433304 Ga0466957_1433304_152_457 96
50 3300044901 Ga0466960_0011815 Ga0466960_0011815_1035_1340 96
51 3300045976 Ga0466967_0002354 Ga0466967_0002354_2265_2570 96
52 3300048905 Ga0496102_0005815 Ga0496102_0005815_6110_6454 96
53 3300048906 Ga0496103_0023625 Ga0496103_0023625_279_623 96
54 3300006028 Ga0070717_10426752 Ga0070717_104267522 97
55 3300044706 Ga0466964_0581351 Ga0466964_0581351_308_601 97
56 3300005327 Ga0070658_11277009 Ga0070658_112770092 98
57 3300005329 Ga0070683_100106628 Ga0070683_1001066284 98
58 3300005336 Ga0070680_100014283 Ga0070680_1000142832 98
59 3300005339 Ga0070660_100001782 Ga0070660_1000017829 98
60 3300005344 Ga0070661_100086770 Ga0070661_1000867703 98
61 3300005455 Ga0070663_101443352 Ga0070663_1014433521 98
62 3300005458 Ga0070681_10227477 Ga0070681_102274772 98
63 3300005458 Ga0070681_10243805 Ga0070681_102438053 98
64 3300005530 Ga0070679_100012002 Ga0070679_1000120024 98
65 3300005616 Ga0068852_100242824 Ga0068852_1002428242 98
66 3300020081 Ga0206354_11239232 Ga0206354_112392322 98
67 3300025912 Ga0207707_10025872 Ga0207707_100258724 98
68 3300025917 Ga0207660_10019550 Ga0207660_100195504 98
69 3300025919 Ga0207657_10026169 Ga0207657_100261695 98
70 3300025920 Ga0207649_10030184 Ga0207649_100301843 98
71 3300025921 Ga0207652_10213223 Ga0207652_102132232 98
72 3300025921 Ga0207652_11576738 Ga0207652_115767382 98
73 3300026067 Ga0207678_11271975 Ga0207678_112719752 98
74 3300026142 Ga0207698_10248799 Ga0207698_102487992 98
75 3300044683 Ga0466965_0074998 Ga0466965_0074998_288_623 99
76 3300044684 Ga0466966_0086218 Ga0466966_0086218_1512_1847 99
77 3300044693 Ga0466961_0027130 Ga0466961_0027130_3182_3517 99
78 3300044694 Ga0466963_0111563 Ga0466963_0111563_1122_1457 99
79 3300044706 Ga0466964_0438146 Ga0466964_0438146_75_410 99
80 3300044719 Ga0466971_0004429 Ga0466971_0004429_1391_1726 99
81 3300044735 Ga0466968_0001937 Ga0466968_0001937_1801_2136 99
82 3300044735 Ga0466968_0011205 Ga0466968_0011205_1498_1833 99
83 3300044765 Ga0466970_0178128 Ga0466970_0178128_680_1015 99
84 3300045049 Ga0466959_0003840 Ga0466959_0003840_552_887 99
85 3300045836 Ga0466958_0116169 Ga0466958_0116169_1278_1613 99
86 3300061719 Ga0466962_0028295 Ga0466962_0028295_2144_2479 99
87 3300005435 Ga0070714_100471587 Ga0070714_1004715872 100
88 3300005437 Ga0070710_10890300 Ga0070710_108903002 100
89 3300006173 Ga0070716_100020120 Ga0070716_1000201204 100
90 3300006175 Ga0070712_100837485 Ga0070712_1008374851 100
91 3300025898 Ga0207692_10330626 Ga0207692_103306262 100
92 3300025915 Ga0207693_10259586 Ga0207693_102595862 100
93 3300025929 Ga0207664_10018691 Ga0207664_100186915 100
94 3300045049 Ga0466959_0032586 Ga0466959_0032586_3216_3545 100
95 3300045976 Ga0466967_0421752 Ga0466967_0421752_909_1211 100
96 3300005471 Ga0070698_100366155 Ga0070698_1003661552 101
97 3300006028 Ga0070717_10013600 Ga0070717_100136007 101
98 3300006028 Ga0070717_10477044 Ga0070717_104770442 101
99 3300006038 Ga0075365_10849160 Ga0075365_108491602 101
100 3300007076 Ga0075435_101357572 Ga0075435_1013575722 101
101 3300009176 Ga0105242_11776964 Ga0105242_117769642 101
102 3300025922 Ga0207646_10617919 Ga0207646_106179192 101
103 3300025928 Ga0207700_11184650 Ga0207700_111846501 101
104 3300025929 Ga0207664_10035157 Ga0207664_100351572 101
105 3300025934 Ga0207686_11233929 Ga0207686_112339292 101
106 3300039438 Ga0436360_0134583 Ga0436360_0134583_386_691 101
107 3300046679 Ga0495623_0005723 Ga0495623_0005723_5161_5493 101
108 3300048903 Ga0496100_0974278 Ga0496100_0974278_28_366 101
109 3300048911 Ga0496108_0631030 Ga0496108_0631030_520_858 101
110 3300048912 Ga0496109_0344092 Ga0496109_0344092_237_575 101
111 3300049582 Ga0501048_0291163 Ga0501048_0291163_752_1063 101
112 3300050513 nmdc:mga0rr50_1006024_c1 nmdc:mga0rr50_1006024_c1_101_439 101
113 3300050514 nmdc:mga08x19_737301_c1 nmdc:mga08x19_737301_c1_259_567 101
114 3300005327 Ga0070658_10085504 Ga0070658_100855044 102
115 3300005327 Ga0070658_10566130 Ga0070658_105661302 102
116 3300005336 Ga0070680_100105611 Ga0070680_1001056113 102
117 3300005434 Ga0070709_10078187 Ga0070709_100781872 102
118 3300005434 Ga0070709_10463584 Ga0070709_104635842 102
119 3300005434 Ga0070709_11766686 Ga0070709_117666861 102
120 3300005435 Ga0070714_100002904 Ga0070714_1000029048 102
121 3300005435 Ga0070714_100112726 Ga0070714_1001127263 102
122 3300005435 Ga0070714_100431830 Ga0070714_1004318302 102
123 3300005458 Ga0070681_10226054 Ga0070681_102260541 102
124 3300005471 Ga0070698_100041252 Ga0070698_1000412524 102
125 3300005530 Ga0070679_100332401 Ga0070679_1003324012 102
126 3300005535 Ga0070684_101479769 Ga0070684_1014797691 102
127 3300005563 Ga0068855_100409946 Ga0068855_1004099462 102
128 3300005614 Ga0068856_100497399 Ga0068856_1004973992 102
129 3300006173 Ga0070716_101581982 Ga0070716_1015819822 102
130 3300006175 Ga0070712_100445355 Ga0070712_1004453552 102
131 3300006914 Ga0075436_100167210 Ga0075436_1001672101 102
132 3300009545 Ga0105237_12284450 Ga0105237_122844501 102
133 3300013104 Ga0157370_10141323 Ga0157370_101413233 102
134 3300013104 Ga0157370_11804151 Ga0157370_118041511 102
135 3300013105 Ga0157369_11246815 Ga0157369_112468152 102
136 3300014497 Ga0182008_10246628 Ga0182008_102466282 102
137 3300015261 Ga0182006_1016295 Ga0182006_10162953 102
138 3300015262 Ga0182007_10018540 Ga0182007_100185402 102
139 3300021441 Ga0213871_10030518 Ga0213871_100305182 102
140 3300025906 Ga0207699_10057762 Ga0207699_100577623 102
141 3300025909 Ga0207705_10067247 Ga0207705_100672474 102
142 3300025909 Ga0207705_10203568 Ga0207705_102035681 102
143 3300025912 Ga0207707_10190270 Ga0207707_101902702 102
144 3300025915 Ga0207693_10283420 Ga0207693_102834202 102
145 3300025917 Ga0207660_10083143 Ga0207660_100831432 102
146 3300025921 Ga0207652_10183542 Ga0207652_101835423 102
147 3300025929 Ga0207664_11021426 Ga0207664_110214261 102
148 3300025929 Ga0207664_11422224 Ga0207664_114222241 102
149 3300025939 Ga0207665_11381714 Ga0207665_113817141 102
150 3300025944 Ga0207661_10033486 Ga0207661_100334866 102
151 3300025949 Ga0207667_10460936 Ga0207667_104609362 102
152 3300026041 Ga0207639_12297231 Ga0207639_122972311 102
153 3300026078 Ga0207702_10189089 Ga0207702_101890892 102
154 3300028563 Ga0265319_1007813 Ga0265319_10078132 102
155 3300028573 Ga0265334_10075215 Ga0265334_100752151 102
156 3300028577 Ga0265318_10029227 Ga0265318_100292273 102
157 3300028577 Ga0265318_10038532 Ga0265318_100385322 102
158 3300028654 Ga0265322_10012790 Ga0265322_100127902 102
159 3300028800 Ga0265338_10042058 Ga0265338_100420584 102
160 3300028800 Ga0265338_10083009 Ga0265338_100830093 102
161 3300029957 Ga0265324_10083740 Ga0265324_100837402 102
162 3300031235 Ga0265330_10004373 Ga0265330_100043736 102
163 3300031238 Ga0265332_10374389 Ga0265332_103743892 102
164 3300031238 Ga0265332_10383295 Ga0265332_103832951 102
165 3300031239 Ga0265328_10068228 Ga0265328_100682282 102
166 3300031240 Ga0265320_10014307 Ga0265320_100143072 102
167 3300031241 Ga0265325_10045429 Ga0265325_100454293 102
168 3300031242 Ga0265329_10050423 Ga0265329_100504232 102
169 3300031251 Ga0265327_10063059 Ga0265327_100630592 102
170 3300031251 Ga0265327_10081029 Ga0265327_100810292 102
171 3300031711 Ga0265314_10093079 Ga0265314_100930793 102
172 3300031712 Ga0265342_10019089 Ga0265342_100190892 102
173 3300035172 Ga0373955_0035019 Ga0373955_0035019_1328_1636 102
174 3300035724 Ga0373933_0048671 Ga0373933_0048671_1307_1615 102
175 3300036401 Ga0373937_0317727 Ga0373937_0317727_238_546 102
176 3300036401 Ga0373937_1902801 Ga0373937_1902801_59_367 102
177 3300037418 Ga0395900_0388044 Ga0395900_0388044_354_668 102
178 3300037466 Ga0395898_0904405 Ga0395898_0904405_24_332 102
179 3300037471 Ga0395905_1042955 Ga0395905_1042955_155_469 102
180 3300038443 Ga0395901_1273572 Ga0395901_1273572_284_595 102
181 3300039438 Ga0436360_0249670 Ga0436360_0249670_1943_2257 102
182 3300044683 Ga0466965_0515727 Ga0466965_0515727_133_441 102
183 3300044684 Ga0466966_0085063 Ga0466966_0085063_319_627 102
184 3300044693 Ga0466961_0079263 Ga0466961_0079263_174_482 102
185 3300044693 Ga0466961_0418829 Ga0466961_0418829_474_782 102
186 3300044694 Ga0466963_0007182 Ga0466963_0007182_5155_5463 102
187 3300044694 Ga0466963_0499035 Ga0466963_0499035_288_596 102
188 3300044694 Ga0466963_0888203 Ga0466963_0888203_11_319 102
189 3300044706 Ga0466964_0207540 Ga0466964_0207540_379_690 102
190 3300044706 Ga0466964_0434408 Ga0466964_0434408_332_640 102
191 3300044719 Ga0466971_0295719 Ga0466971_0295719_264_572 102
192 3300044765 Ga0466970_0724194 Ga0466970_0724194_263_571 102
193 3300044842 Ga0466957_0317661 Ga0466957_0317661_675_983 102
194 3300044842 Ga0466957_0408286 Ga0466957_0408286_489_797 102
195 3300044901 Ga0466960_0471454 Ga0466960_0471454_328_636 102
196 3300045049 Ga0466959_0596101 Ga0466959_0596101_420_728 102
197 3300045049 Ga0466959_0874037 Ga0466959_0874037_181_489 102
198 3300045051 Ga0451576_2700887 Ga0451576_2700887_161_472 102
199 3300045836 Ga0466958_0000431 Ga0466958_0000431_11052_11360 102
200 3300045836 Ga0466958_0399438 Ga0466958_0399438_513_821 102
201 3300045836 Ga0466958_0551108 Ga0466958_0551108_413_721 102
202 3300045976 Ga0466967_0002063 Ga0466967_0002063_4026_4334 102
203 3300045976 Ga0466967_0099263 Ga0466967_0099263_2207_2518 102
204 3300045976 Ga0466967_0169342 Ga0466967_0169342_141_452 102
205 3300045976 Ga0466967_0199979 Ga0466967_0199979_1570_1878 102
206 3300045976 Ga0466967_0202306 Ga0466967_0202306_1423_1740 102
207 3300045976 Ga0466967_0718067 Ga0466967_0718067_394_702 102
208 3300046459 Ga0495629_0252307 Ga0495629_0252307_61_369 102
209 3300046461 Ga0495641_0114459 Ga0495641_0114459_55_372 102
210 3300046461 Ga0495641_0204830 Ga0495641_0204830_91_408 102
211 3300046462 Ga0495651_0161878 Ga0495651_0161878_315_623 102
212 3300046463 Ga0495653_0151920 Ga0495653_0151920_233_541 102
213 3300046463 Ga0495653_0861213 Ga0495653_0861213_93_401 102
214 3300046475 Ga0495639_0340620 Ga0495639_0340620_78_395 102
215 3300046511 Ga0495608_0014722 Ga0495608_0014722_4658_4966 102
216 3300046514 Ga0495618_0067575 Ga0495618_0067575_562_870 102
217 3300046517 Ga0495630_1362339 Ga0495630_1362339_104_421 102
218 3300046529 Ga0495652_0232474 Ga0495652_0232474_921_1229 102
219 3300046533 Ga0495640_0125500 Ga0495640_0125500_158_466 102
220 3300046559 Ga0495667_0193124 Ga0495667_0193124_384_692 102
221 3300046642 Ga0495634_0200725 Ga0495634_0200725_809_1117 102
222 3300046663 Ga0495635_0159815 Ga0495635_0159815_1001_1309 102
223 3300046663 Ga0495635_0816601 Ga0495635_0816601_158_475 102
224 3300046675 Ga0495657_0037285 Ga0495657_0037285_1734_2042 102
225 3300046678 Ga0495599_0463928 Ga0495599_0463928_13_321 102
226 3300047317 Ga0495604_0601678 Ga0495604_0601678_294_602 102
227 3300047319 Ga0495674_0493489 Ga0495674_0493489_29_346 102
228 3300047322 Ga0495680_0037008 Ga0495680_0037008_2374_2682 102
229 3300047444 Ga0495675_0355316 Ga0495675_0355316_396_704 102
230 3300047471 Ga0495684_0027689 Ga0495684_0027689_1507_1815 102
231 3300047471 Ga0495684_0516700 Ga0495684_0516700_481_789 102
232 3300048088 Ga0495602_0678536 Ga0495602_0678536_86_394 102
233 3300048904 Ga0496101_0952560 Ga0496101_0952560_294_605 102
234 3300048905 Ga0496102_0100308 Ga0496102_0100308_55_366 102
235 3300048908 Ga0496105_0845583 Ga0496105_0845583_260_577 102
236 3300048909 Ga0496106_0030068 Ga0496106_0030068_2358_2669 102
237 3300048910 Ga0496107_0155954 Ga0496107_0155954_1184_1495 102
238 3300048915 Ga0496112_0289113 Ga0496112_0289113_390_707 102
239 3300048916 Ga0496113_0181263 Ga0496113_0181263_1313_1624 102
240 3300048918 Ga0496115_0043589 Ga0496115_0043589_1211_1528 102
241 3300049571 Ga0501034_0004589 Ga0501034_0004589_6383_6694 102
242 3300049574 Ga0501038_0655408 Ga0501038_0655408_202_513 102
243 3300049583 Ga0501067_0027300 Ga0501067_0027300_1172_1480 102
244 3300049583 Ga0501067_0238382 Ga0501067_0238382_42_353 102
245 3300049585 Ga0501069_0019863 Ga0501069_0019863_285_593 102
246 3300049586 Ga0501070_0025291 Ga0501070_0025291_1914_2225 102
247 3300049586 Ga0501070_0051543 Ga0501070_0051543_3062_3373 102
248 3300049588 Ga0501072_0015894 Ga0501072_0015894_2844_3155 102
249 3300049589 Ga0501073_0052133 Ga0501073_0052133_1905_2216 102
250 3300049590 Ga0501074_0017998 Ga0501074_0017998_2470_2781 102
251 3300049741 Ga0501079_0036453 Ga0501079_0036453_1673_1984 102
252 3300049742 Ga0501080_0000535 Ga0501080_0000535_3132_3443 102
253 3300049742 Ga0501080_0007055 Ga0501080_0007055_775_1086 102
254 3300049744 Ga0501083_0011627 Ga0501083_0011627_79_390 102
255 3300053077 Ga0495601_0167849 Ga0495601_0167849_51_368 102
256 3300053077 Ga0495601_0525157 Ga0495601_0525157_296_613 102
257 3300053077 Ga0495601_0670365 Ga0495601_0670365_47_355 102
258 3300053084 Ga0495595_0010303 Ga0495595_0010303_3369_3677 102
259 3300053085 Ga0495619_0296165 Ga0495619_0296165_720_1037 102
260 3300060353 Ga0501082_0804749 Ga0501082_0804749_442_753 102
261 3300061719 Ga0466962_0382425 Ga0466962_0382425_96_404 102
262 3300005329 Ga0070683_100000682 Ga0070683_10000068216 103
263 3300005329 Ga0070683_100046995 Ga0070683_1000469953 103
264 3300005336 Ga0070680_100210240 Ga0070680_1002102402 103
265 3300005336 Ga0070680_100445605 Ga0070680_1004456052 103
266 3300005336 Ga0070680_100564676 Ga0070680_1005646762 103
267 3300005337 Ga0070682_100015147 Ga0070682_1000151472 103
268 3300005337 Ga0070682_101354349 Ga0070682_1013543491 103
269 3300005338 Ga0068868_101450820 Ga0068868_1014508201 103
270 3300005339 Ga0070660_100031738 Ga0070660_1000317383 103
271 3300005341 Ga0070691_10056155 Ga0070691_100561553 103
272 3300005343 Ga0070687_101231344 Ga0070687_1012313441 103
273 3300005344 Ga0070661_100952102 Ga0070661_1009521021 103
274 3300005355 Ga0070671_100034613 Ga0070671_1000346133 103
275 3300005366 Ga0070659_100846421 Ga0070659_1008464212 103
276 3300005366 Ga0070659_100857674 Ga0070659_1008576741 103
277 3300005434 Ga0070709_10008335 Ga0070709_100083355 103
278 3300005434 Ga0070709_10090319 Ga0070709_100903192 103
279 3300005435 Ga0070714_100049516 Ga0070714_1000495163 103
280 3300005435 Ga0070714_100092539 Ga0070714_1000925394 103
281 3300005435 Ga0070714_100094496 Ga0070714_1000944962 103
282 3300005435 Ga0070714_100215384 Ga0070714_1002153842 103
283 3300005435 Ga0070714_100218997 Ga0070714_1002189972 103
284 3300005436 Ga0070713_100000801 Ga0070713_1000008018 103
285 3300005437 Ga0070710_10009224 Ga0070710_100092242 103
286 3300005437 Ga0070710_10025527 Ga0070710_100255272 103
287 3300005437 Ga0070710_10512121 Ga0070710_105121212 103
288 3300005439 Ga0070711_100002572 Ga0070711_1000025726 103
289 3300005439 Ga0070711_100053954 Ga0070711_1000539542 103
290 3300005439 Ga0070711_101064732 Ga0070711_1010647322 103
291 3300005444 Ga0070694_100247988 Ga0070694_1002479882 103
292 3300005445 Ga0070708_100635391 Ga0070708_1006353912 103
293 3300005458 Ga0070681_10046923 Ga0070681_100469233 103
294 3300005458 Ga0070681_10071171 Ga0070681_100711713 103
295 3300005458 Ga0070681_10082518 Ga0070681_100825185 103
296 3300005458 Ga0070681_10190835 Ga0070681_101908353 103
297 3300005467 Ga0070706_100718497 Ga0070706_1007184972 103
298 3300005467 Ga0070706_101700403 Ga0070706_1017004031 103
299 3300005468 Ga0070707_100022323 Ga0070707_1000223234 103
300 3300005468 Ga0070707_100035404 Ga0070707_1000354044 103
301 3300005468 Ga0070707_100243368 Ga0070707_1002433682 103
302 3300005468 Ga0070707_100880331 Ga0070707_1008803312 103
303 3300005471 Ga0070698_100049309 Ga0070698_1000493093 103
304 3300005471 Ga0070698_100133400 Ga0070698_1001334003 103
305 3300005518 Ga0070699_100274647 Ga0070699_1002746473 103
306 3300005518 Ga0070699_100437513 Ga0070699_1004375132 103
307 3300005530 Ga0070679_100031188 Ga0070679_1000311882 103
308 3300005530 Ga0070679_100091661 Ga0070679_1000916613 103
309 3300005530 Ga0070679_100179570 Ga0070679_1001795702 103
310 3300005535 Ga0070684_100008210 Ga0070684_1000082103 103
311 3300005535 Ga0070684_100071994 Ga0070684_1000719943 103
312 3300005546 Ga0070696_100815919 Ga0070696_1008159192 103
313 3300005547 Ga0070693_100409806 Ga0070693_1004098062 103
314 3300005549 Ga0070704_100109343 Ga0070704_1001093432 103
315 3300005563 Ga0068855_100818834 Ga0068855_1008188342 103
316 3300005564 Ga0070664_101171552 Ga0070664_1011715522 103
317 3300005577 Ga0068857_100199718 Ga0068857_1001997183 103
318 3300005614 Ga0068856_100098406 Ga0068856_1000984065 103
319 3300005614 Ga0068856_100115279 Ga0068856_1001152793 103
320 3300005614 Ga0068856_100427551 Ga0068856_1004275512 103
321 3300005615 Ga0070702_100050938 Ga0070702_1000509383 103
322 3300005616 Ga0068852_101257571 Ga0068852_1012575711 103
323 3300005842 Ga0068858_100683461 Ga0068858_1006834612 103
324 3300005843 Ga0068860_101767756 Ga0068860_1017677562 103
325 3300006028 Ga0070717_10007082 Ga0070717_100070823 103
326 3300006028 Ga0070717_10031923 Ga0070717_100319233 103
327 3300006028 Ga0070717_10049217 Ga0070717_100492173 103
328 3300006028 Ga0070717_10919315 Ga0070717_109193151 103
329 3300006163 Ga0070715_10005269 Ga0070715_100052694 103
330 3300006173 Ga0070716_100018111 Ga0070716_1000181112 103
331 3300006173 Ga0070716_100210958 Ga0070716_1002109582 103
332 3300006173 Ga0070716_100436688 Ga0070716_1004366882 103
333 3300006175 Ga0070712_100028000 Ga0070712_1000280001 103
334 3300006175 Ga0070712_100058473 Ga0070712_1000584733 103
335 3300006852 Ga0075433_10324794 Ga0075433_103247942 103
336 3300006852 Ga0075433_10430070 Ga0075433_104300702 103
337 3300006871 Ga0075434_100013210 Ga0075434_1000132109 103
338 3300006881 Ga0068865_100417737 Ga0068865_1004177372 103
339 3300006914 Ga0075436_101282923 Ga0075436_1012829231 103
340 3300007076 Ga0075435_100725352 Ga0075435_1007253522 103
341 3300007788 Ga0099795_10454618 Ga0099795_104546181 103
342 3300009093 Ga0105240_10037102 Ga0105240_100371025 103
343 3300009093 Ga0105240_10640569 Ga0105240_106405692 103
344 3300009093 Ga0105240_10808587 Ga0105240_108085872 103
345 3300009093 Ga0105240_11669978 Ga0105240_116699781 103
346 3300009094 Ga0111539_11408433 Ga0111539_114084332 103
347 3300009098 Ga0105245_10173604 Ga0105245_101736042 103
348 3300009098 Ga0105245_10496423 Ga0105245_104964231 103
349 3300009101 Ga0105247_10055600 Ga0105247_100556002 103
350 3300009147 Ga0114129_11629417 Ga0114129_116294172 103
351 3300009176 Ga0105242_10433116 Ga0105242_104331162 103
352 3300009176 Ga0105242_10525862 Ga0105242_105258622 103
353 3300009177 Ga0105248_10493375 Ga0105248_104933752 103
354 3300009177 Ga0105248_10780279 Ga0105248_107802792 103
355 3300009177 Ga0105248_10806199 Ga0105248_108061992 103
356 3300009545 Ga0105237_12118390 Ga0105237_121183902 103
357 3300009551 Ga0105238_10035269 Ga0105238_100352692 103
358 3300009551 Ga0105238_11299361 Ga0105238_112993612 103
359 3300010159 Ga0099796_10360770 Ga0099796_103607701 103
360 3300010375 Ga0105239_10125430 Ga0105239_101254302 103
361 3300010375 Ga0105239_10606228 Ga0105239_106062282 103
362 3300013100 Ga0157373_10608029 Ga0157373_106080292 103
363 3300013104 Ga0157370_10530462 Ga0157370_105304622 103
364 3300013104 Ga0157370_10605538 Ga0157370_106055382 103
365 3300013104 Ga0157370_11335105 Ga0157370_113351052 103
366 3300013105 Ga0157369_10019029 Ga0157369_100190298 103
367 3300013105 Ga0157369_10416301 Ga0157369_104163012 103
368 3300013105 Ga0157369_10586687 Ga0157369_105866872 103
369 3300013296 Ga0157374_10120956 Ga0157374_101209562 103
370 3300013296 Ga0157374_10139452 Ga0157374_101394522 103
371 3300013296 Ga0157374_10882096 Ga0157374_108820961 103
372 3300013297 Ga0157378_11129856 Ga0157378_111298562 103
373 3300013306 Ga0163162_10245382 Ga0163162_102453823 103
374 3300013307 Ga0157372_10095372 Ga0157372_100953725 103
375 3300013307 Ga0157372_10458840 Ga0157372_104588402 103
376 3300013307 Ga0157372_10560087 Ga0157372_105600872 103
377 3300013307 Ga0157372_10990852 Ga0157372_109908522 103
378 3300013307 Ga0157372_11772468 Ga0157372_117724681 103
379 3300013307 Ga0157372_12066558 Ga0157372_120665582 103
380 3300013308 Ga0157375_10327714 Ga0157375_103277142 103
381 3300014325 Ga0163163_12825034 Ga0163163_128250341 103
382 3300014497 Ga0182008_10016723 Ga0182008_100167233 103
383 3300014497 Ga0182008_10099413 Ga0182008_100994132 103
384 3300014497 Ga0182008_10523615 Ga0182008_105236152 103
385 3300014497 Ga0182008_10584864 Ga0182008_105848642 103
386 3300014497 Ga0182008_10882034 Ga0182008_108820341 103
387 3300014968 Ga0157379_10191763 Ga0157379_101917632 103
388 3300014969 Ga0157376_10017404 Ga0157376_100174043 103
389 3300014969 Ga0157376_11582992 Ga0157376_115829922 103
390 3300014969 Ga0157376_12130055 Ga0157376_121300551 103
391 3300020081 Ga0206354_10531976 Ga0206354_105319762 103
392 3300020082 Ga0206353_10289596 Ga0206353_102895962 103
393 3300020082 Ga0206353_11314291 Ga0206353_113142912 103
394 3300021377 Ga0213874_10046469 Ga0213874_100464692 103
395 3300022467 Ga0224712_10655245 Ga0224712_106552451 103
396 3300025898 Ga0207692_10023816 Ga0207692_100238163 103
397 3300025898 Ga0207692_10037256 Ga0207692_100372563 103
398 3300025900 Ga0207710_10062626 Ga0207710_100626262 103
399 3300025904 Ga0207647_10590702 Ga0207647_105907022 103
400 3300025905 Ga0207685_10001113 Ga0207685_100011132 103
401 3300025906 Ga0207699_10026168 Ga0207699_100261682 103
402 3300025906 Ga0207699_10068842 Ga0207699_100688423 103
403 3300025906 Ga0207699_10069126 Ga0207699_100691262 103
404 3300025909 Ga0207705_10065177 Ga0207705_100651773 103
405 3300025910 Ga0207684_10828969 Ga0207684_108289692 103
406 3300025912 Ga0207707_10095478 Ga0207707_100954782 103
407 3300025912 Ga0207707_10112571 Ga0207707_101125713 103
408 3300025912 Ga0207707_10231095 Ga0207707_102310951 103
409 3300025913 Ga0207695_10225920 Ga0207695_102259203 103
410 3300025915 Ga0207693_10000814 Ga0207693_100008148 103
411 3300025915 Ga0207693_10000920 Ga0207693_100009203 103
412 3300025915 Ga0207693_10065202 Ga0207693_100652022 103
413 3300025916 Ga0207663_10015847 Ga0207663_100158475 103
414 3300025916 Ga0207663_10096802 Ga0207663_100968022 103
415 3300025916 Ga0207663_11134982 Ga0207663_111349822 103
416 3300025917 Ga0207660_10309987 Ga0207660_103099873 103
417 3300025917 Ga0207660_10527571 Ga0207660_105275712 103
418 3300025918 Ga0207662_10435502 Ga0207662_104355022 103
419 3300025919 Ga0207657_10008838 Ga0207657_100088386 103
420 3300025920 Ga0207649_10142378 Ga0207649_101423782 103
421 3300025921 Ga0207652_10011197 Ga0207652_100111974 103
422 3300025921 Ga0207652_10071202 Ga0207652_100712023 103
423 3300025921 Ga0207652_10109179 Ga0207652_101091793 103
424 3300025921 Ga0207652_10176255 Ga0207652_101762552 103
425 3300025921 Ga0207652_10418300 Ga0207652_104183002 103
426 3300025922 Ga0207646_10001386 Ga0207646_1000138612 103
427 3300025922 Ga0207646_10035040 Ga0207646_100350404 103
428 3300025927 Ga0207687_10241320 Ga0207687_102413202 103
429 3300025928 Ga0207700_10026419 Ga0207700_100264192 103
430 3300025928 Ga0207700_10194226 Ga0207700_101942261 103
431 3300025928 Ga0207700_10560598 Ga0207700_105605982 103
432 3300025929 Ga0207664_10001397 Ga0207664_100013979 103
433 3300025929 Ga0207664_10017802 Ga0207664_100178026 103
434 3300025929 Ga0207664_10032295 Ga0207664_100322953 103
435 3300025929 Ga0207664_10190644 Ga0207664_101906442 103
436 3300025929 Ga0207664_10200363 Ga0207664_102003632 103
437 3300025929 Ga0207664_10207285 Ga0207664_102072853 103
438 3300025929 Ga0207664_10707705 Ga0207664_107077052 103
439 3300025929 Ga0207664_11479422 Ga0207664_114794221 103
440 3300025931 Ga0207644_10083224 Ga0207644_100832242 103
441 3300025931 Ga0207644_10386778 Ga0207644_103867781 103
442 3300025932 Ga0207690_10251900 Ga0207690_102519002 103
443 3300025932 Ga0207690_11346899 Ga0207690_113468991 103
444 3300025932 Ga0207690_11811886 Ga0207690_118118861 103
445 3300025934 Ga0207686_10536237 Ga0207686_105362372 103
446 3300025938 Ga0207704_10421870 Ga0207704_104218702 103
447 3300025939 Ga0207665_10000247 Ga0207665_100002478 103
448 3300025939 Ga0207665_10075321 Ga0207665_100753213 103
449 3300025939 Ga0207665_10360193 Ga0207665_103601932 103
450 3300025939 Ga0207665_10551896 Ga0207665_105518962 103
451 3300025941 Ga0207711_10280780 Ga0207711_102807802 103
452 3300025941 Ga0207711_10429780 Ga0207711_104297802 103
453 3300025941 Ga0207711_10464403 Ga0207711_104644032 103
454 3300025941 Ga0207711_10964423 Ga0207711_109644231 103
455 3300025944 Ga0207661_10025875 Ga0207661_100258753 103
456 3300025944 Ga0207661_10266862 Ga0207661_102668622 103
457 3300025945 Ga0207679_10479241 Ga0207679_104792412 103
458 3300025949 Ga0207667_10700870 Ga0207667_107008702 103
459 3300026023 Ga0207677_11062385 Ga0207677_110623851 103
460 3300026067 Ga0207678_11260407 Ga0207678_112604071 103
461 3300026078 Ga0207702_10088815 Ga0207702_100888151 103
462 3300026078 Ga0207702_11085766 Ga0207702_110857662 103
463 3300026088 Ga0207641_10290913 Ga0207641_102909132 103
464 3300026116 Ga0207674_10124716 Ga0207674_101247163 103
465 3300026121 Ga0207683_10147298 Ga0207683_101472983 103
466 3300028563 Ga0265319_1025818 Ga0265319_10258182 103
467 3300028563 Ga0265319_1187408 Ga0265319_11874082 103
468 3300028573 Ga0265334_10059590 Ga0265334_100595902 103
469 3300028573 Ga0265334_10248913 Ga0265334_102489132 103
470 3300028577 Ga0265318_10077287 Ga0265318_100772872 103
471 3300028654 Ga0265322_10048347 Ga0265322_100483471 103
472 3300028666 Ga0265336_10001699 Ga0265336_1000169910 103
473 3300028666 Ga0265336_10037811 Ga0265336_100378112 103
474 3300028800 Ga0265338_10002456 Ga0265338_100024567 103
475 3300028800 Ga0265338_10011083 Ga0265338_100110832 103
476 3300028800 Ga0265338_10072190 Ga0265338_100721903 103
477 3300028800 Ga0265338_10113409 Ga0265338_101134092 103
478 3300028800 Ga0265338_10195867 Ga0265338_101958671 103
479 3300031235 Ga0265330_10094669 Ga0265330_100946691 103
480 3300031240 Ga0265320_10169979 Ga0265320_101699792 103
481 3300031241 Ga0265325_10079377 Ga0265325_100793771 103
482 3300031250 Ga0265331_10030596 Ga0265331_100305962 103
483 3300031595 Ga0265313_10028666 Ga0265313_100286664 103
484 3300031711 Ga0265314_10104317 Ga0265314_101043173 103
485 3300031712 Ga0265342_10240671 Ga0265342_102406712 103
486 3300031712 Ga0265342_10528442 Ga0265342_105284422 103
487 3300035083 Ga0373926_0012170 Ga0373926_0012170_2336_2677 103
488 3300035085 Ga0373929_0198666 Ga0373929_0198666_94_432 103
489 3300035086 Ga0373934_0192213 Ga0373934_0192213_300_638 103
490 3300035089 Ga0373944_0136839 Ga0373944_0136839_195_536 103
491 3300035090 Ga0373949_0013045 Ga0373949_0013045_219_563 103
492 3300035091 Ga0373951_0139555 Ga0373951_0139555_10_354 103
493 3300035111 Ga0373923_0601161 Ga0373923_0601161_55_369 103
494 3300035113 Ga0373936_0125929 Ga0373936_0125929_18_359 103
495 3300035116 Ga0373945_0581142 Ga0373945_0581142_29_367 103
496 3300035119 Ga0373956_0463976 Ga0373956_0463976_93_428 103
497 3300035120 Ga0373957_0313898 Ga0373957_0313898_134_472 103
498 3300035121 Ga0373960_0292337 Ga0373960_0292337_61_399 103
499 3300035170 Ga0373943_0001012 Ga0373943_0001012_10514_10855 103
500 3300035170 Ga0373943_0503745 Ga0373943_0503745_219_563 103
501 3300035171 Ga0373946_0063315 Ga0373946_0063315_858_1199 103
502 3300035172 Ga0373955_1019257 Ga0373955_1019257_47_385 103
503 3300035241 Ga0373961_0243972 Ga0373961_0243972_60_398 103
504 3300035691 Ga0373931_0010780 Ga0373931_0010780_3263_3607 103
505 3300035692 Ga0373935_0047048 Ga0373935_0047048_946_1287 103
506 3300035695 Ga0373927_0049245 Ga0373927_0049245_549_890 103
507 3300035725 Ga0373947_0001552 Ga0373947_0001552_8847_9188 103
508 3300036401 Ga0373937_0000355 Ga0373937_0000355_8876_9211 103
509 3300036401 Ga0373937_0379173 Ga0373937_0379173_328_666 103
510 3300037068 Ga0373925_0007406 Ga0373925_0007406_3722_4063 103
511 3300037312 Ga0395899_0102523 Ga0395899_0102523_217_555 103
512 3300037312 Ga0395899_0143077 Ga0395899_0143077_1029_1343 103
513 3300037418 Ga0395900_0140283 Ga0395900_0140283_1847_2161 103
514 3300037418 Ga0395900_0221277 Ga0395900_0221277_762_1100 103
515 3300037418 Ga0395900_0709558 Ga0395900_0709558_175_513 103
516 3300037466 Ga0395898_0796814 Ga0395898_0796814_154_465 103
517 3300037466 Ga0395898_0917966 Ga0395898_0917966_287_625 103
518 3300037466 Ga0395898_0924804 Ga0395898_0924804_109_447 103
519 3300037466 Ga0395898_1457309 Ga0395898_1457309_175_486 103
520 3300037471 Ga0395905_0248304 Ga0395905_0248304_676_990 103
521 3300037471 Ga0395905_1146403 Ga0395905_1146403_145_486 103
522 3300037471 Ga0395905_1557016 Ga0395905_1557016_200_511 103
523 3300038443 Ga0395901_0789678 Ga0395901_0789678_561_899 103
524 3300038443 Ga0395901_1129757 Ga0395901_1129757_364_702 103
525 3300038443 Ga0395901_1289827 Ga0395901_1289827_315_629 103
526 3300039450 Ga0436363_0296049 Ga0436363_0296049_651_986 103
527 3300041505 Ga0451849_1048234 Ga0451849_1048234_1129_1467 103
528 3300041512 Ga0451853_1958868 Ga0451853_1958868_184_522 103
529 3300042005 Ga0439448_0047072 Ga0439448_0047072_900_1211 103
530 3300044656 Ga0466969_0003223 Ga0466969_0003223_6515_6853 103
531 3300044656 Ga0466969_0083616 Ga0466969_0083616_537_872 103
532 3300044656 Ga0466969_0274891 Ga0466969_0274891_11_346 103
533 3300044658 Ga0466972_0569304 Ga0466972_0569304_156_494 103
534 3300044683 Ga0466965_0050616 Ga0466965_0050616_333_677 103
535 3300044683 Ga0466965_0052097 Ga0466965_0052097_225_569 103
536 3300044683 Ga0466965_0080484 Ga0466965_0080484_1143_1481 103
537 3300044684 Ga0466966_0090799 Ga0466966_0090799_419_754 103
538 3300044684 Ga0466966_0254890 Ga0466966_0254890_446_781 103
539 3300044684 Ga0466966_0319246 Ga0466966_0319246_216_554 103
540 3300044684 Ga0466966_0745912 Ga0466966_0745912_192_503 103
541 3300044693 Ga0466961_0005282 Ga0466961_0005282_2338_2679 103
542 3300044693 Ga0466961_0008879 Ga0466961_0008879_2407_2742 103
543 3300044693 Ga0466961_0106343 Ga0466961_0106343_1049_1387 103
544 3300044693 Ga0466961_0133855 Ga0466961_0133855_904_1248 103
545 3300044694 Ga0466963_0000010 Ga0466963_0000010_57384_57725 103
546 3300044694 Ga0466963_0000649 Ga0466963_0000649_2984_3328 103
547 3300044694 Ga0466963_0001770 Ga0466963_0001770_3386_3718 103
548 3300044694 Ga0466963_0002000 Ga0466963_0002000_6204_6548 103
549 3300044694 Ga0466963_0004407 Ga0466963_0004407_4329_4664 103
550 3300044694 Ga0466963_0004464 Ga0466963_0004464_1292_1627 103
551 3300044694 Ga0466963_0010186 Ga0466963_0010186_2406_2744 103
552 3300044694 Ga0466963_0013797 Ga0466963_0013797_1439_1780 103
553 3300044694 Ga0466963_0023343 Ga0466963_0023343_2659_2997 103
554 3300044694 Ga0466963_0034779 Ga0466963_0034779_1104_1439 103
555 3300044694 Ga0466963_0061633 Ga0466963_0061633_581_916 103
556 3300044694 Ga0466963_0165855 Ga0466963_0165855_664_1008 103
557 3300044694 Ga0466963_0171253 Ga0466963_0171253_13_324 103
558 3300044694 Ga0466963_0284073 Ga0466963_0284073_416_760 103
559 3300044694 Ga0466963_0299326 Ga0466963_0299326_658_969 103
560 3300044694 Ga0466963_0808330 Ga0466963_0808330_236_574 103
561 3300044706 Ga0466964_0000213 Ga0466964_0000213_2559_2903 103
562 3300044706 Ga0466964_0008591 Ga0466964_0008591_1935_2273 103
563 3300044706 Ga0466964_0023691 Ga0466964_0023691_2029_2373 103
564 3300044706 Ga0466964_0031496 Ga0466964_0031496_471_815 103
565 3300044706 Ga0466964_0031869 Ga0466964_0031869_1465_1803 103
566 3300044706 Ga0466964_0039198 Ga0466964_0039198_606_941 103
567 3300044706 Ga0466964_0051369 Ga0466964_0051369_162_497 103
568 3300044706 Ga0466964_0100868 Ga0466964_0100868_304_642 103
569 3300044706 Ga0466964_0132499 Ga0466964_0132499_214_525 103
570 3300044706 Ga0466964_0167304 Ga0466964_0167304_390_725 103
571 3300044706 Ga0466964_0348546 Ga0466964_0348546_25_360 103
572 3300044719 Ga0466971_0006123 Ga0466971_0006123_1669_1998 103
573 3300044719 Ga0466971_0010450 Ga0466971_0010450_2056_2400 103
574 3300044719 Ga0466971_0034738 Ga0466971_0034738_1035_1370 103
575 3300044719 Ga0466971_0094401 Ga0466971_0094401_908_1249 103
576 3300044735 Ga0466968_0003137 Ga0466968_0003137_417_755 103
577 3300044735 Ga0466968_0005017 Ga0466968_0005017_1359_1694 103
578 3300044735 Ga0466968_0018981 Ga0466968_0018981_1152_1463 103
579 3300044735 Ga0466968_0138895 Ga0466968_0138895_30_368 103
580 3300044765 Ga0466970_0004127 Ga0466970_0004127_3988_4326 103
581 3300044765 Ga0466970_0137134 Ga0466970_0137134_636_980 103
582 3300044765 Ga0466970_0283130 Ga0466970_0283130_471_782 103
583 3300044842 Ga0466957_0009295 Ga0466957_0009295_2035_2373 103
584 3300044842 Ga0466957_0021958 Ga0466957_0021958_2720_3055 103
585 3300044842 Ga0466957_0025441 Ga0466957_0025441_713_1042 103
586 3300044842 Ga0466957_0033272 Ga0466957_0033272_892_1233 103
587 3300044842 Ga0466957_0094799 Ga0466957_0094799_1490_1828 103
588 3300044842 Ga0466957_0234214 Ga0466957_0234214_282_626 103
589 3300044842 Ga0466957_0289971 Ga0466957_0289971_392_703 103
590 3300044842 Ga0466957_0459239 Ga0466957_0459239_120_464 103
591 3300044842 Ga0466957_1067989 Ga0466957_1067989_182_520 103
592 3300044842 Ga0466957_1135314 Ga0466957_1135314_79_414 103
593 3300044901 Ga0466960_0005761 Ga0466960_0005761_1109_1444 103
594 3300044901 Ga0466960_0039338 Ga0466960_0039338_1339_1677 103
595 3300044901 Ga0466960_0055310 Ga0466960_0055310_376_720 103
596 3300044901 Ga0466960_0097033 Ga0466960_0097033_357_695 103
597 3300044901 Ga0466960_0458479 Ga0466960_0458479_290_628 103
598 3300044901 Ga0466960_0481040 Ga0466960_0481040_168_503 103
599 3300045049 Ga0466959_0050692 Ga0466959_0050692_1694_2029 103
600 3300045049 Ga0466959_0068110 Ga0466959_0068110_1861_2202 103
601 3300045836 Ga0466958_0001425 Ga0466958_0001425_10910_11239 103
602 3300045836 Ga0466958_0002150 Ga0466958_0002150_5601_5945 103
603 3300045836 Ga0466958_0025195 Ga0466958_0025195_609_950 103
604 3300045836 Ga0466958_0066615 Ga0466958_0066615_519_854 103
605 3300045836 Ga0466958_0079309 Ga0466958_0079309_369_707 103
606 3300045836 Ga0466958_0115347 Ga0466958_0115347_84_422 103
607 3300045836 Ga0466958_0409828 Ga0466958_0409828_331_666 103
608 3300045836 Ga0466958_0642807 Ga0466958_0642807_208_519 103
609 3300045836 Ga0466958_0783635 Ga0466958_0783635_57_395 103
610 3300045836 Ga0466958_1069720 Ga0466958_1069720_30_362 103
611 3300045976 Ga0466967_0000332 Ga0466967_0000332_3620_3931 103
612 3300045976 Ga0466967_0001331 Ga0466967_0001331_6918_7259 103
613 3300045976 Ga0466967_0010334 Ga0466967_0010334_534_872 103
614 3300045976 Ga0466967_0015409 Ga0466967_0015409_310_645 103
615 3300045976 Ga0466967_0016719 Ga0466967_0016719_1161_1496 103
616 3300045976 Ga0466967_0022864 Ga0466967_0022864_3371_3709 103
617 3300045976 Ga0466967_0023774 Ga0466967_0023774_3667_4005 103
618 3300045976 Ga0466967_0024167 Ga0466967_0024167_2353_2688 103
619 3300045976 Ga0466967_0038072 Ga0466967_0038072_1882_2214 103
620 3300045976 Ga0466967_0042311 Ga0466967_0042311_624_935 103
621 3300045976 Ga0466967_0062915 Ga0466967_0062915_1142_1480 103
622 3300045976 Ga0466967_0066290 Ga0466967_0066290_475_810 103
623 3300045976 Ga0466967_0077443 Ga0466967_0077443_1458_1802 103
624 3300045976 Ga0466967_0079621 Ga0466967_0079621_792_1103 103
625 3300045976 Ga0466967_0113945 Ga0466967_0113945_1073_1417 103
626 3300045976 Ga0466967_0158743 Ga0466967_0158743_1202_1543 103
627 3300045976 Ga0466967_0232813 Ga0466967_0232813_1049_1387 103
628 3300045976 Ga0466967_0245079 Ga0466967_0245079_282_617 103
629 3300045976 Ga0466967_0264260 Ga0466967_0264260_955_1293 103
630 3300045976 Ga0466967_0439108 Ga0466967_0439108_552_887 103
631 3300045976 Ga0466967_0451495 Ga0466967_0451495_365_706 103
632 3300045976 Ga0466967_0545234 Ga0466967_0545234_596_937 103
633 3300045976 Ga0466967_1210509 Ga0466967_1210509_35_379 103
634 3300046454 Ga0495592_0000732 Ga0495592_0000732_5323_5658 103
635 3300046454 Ga0495592_0004058 Ga0495592_0004058_5579_5917 103
636 3300046454 Ga0495592_0080194 Ga0495592_0080194_452_790 103
637 3300046454 Ga0495592_0158825 Ga0495592_0158825_985_1326 103
638 3300046454 Ga0495592_0387691 Ga0495592_0387691_39_380 103
639 3300046454 Ga0495592_0461163 Ga0495592_0461163_219_557 103
640 3300046454 Ga0495592_0769422 Ga0495592_0769422_10_345 103
641 3300046455 Ga0495603_0046829 Ga0495603_0046829_999_1328 103
642 3300046459 Ga0495629_0017747 Ga0495629_0017747_1063_1404 103
643 3300046459 Ga0495629_0131264 Ga0495629_0131264_356_682 103
644 3300046459 Ga0495629_0235242 Ga0495629_0235242_665_1003 103
645 3300046459 Ga0495629_0439069 Ga0495629_0439069_183_518 103
646 3300046461 Ga0495641_0016066 Ga0495641_0016066_1494_1835 103
647 3300046461 Ga0495641_0026195 Ga0495641_0026195_1495_1833 103
648 3300046461 Ga0495641_0079331 Ga0495641_0079331_471_815 103
649 3300046461 Ga0495641_0086874 Ga0495641_0086874_423_761 103
650 3300046462 Ga0495651_0000029 Ga0495651_0000029_39434_39769 103
651 3300046462 Ga0495651_0037777 Ga0495651_0037777_3392_3733 103
652 3300046462 Ga0495651_0139797 Ga0495651_0139797_346_684 103
653 3300046462 Ga0495651_0342042 Ga0495651_0342042_210_548 103
654 3300046462 Ga0495651_0454263 Ga0495651_0454263_87_425 103
655 3300046463 Ga0495653_0001363 Ga0495653_0001363_8253_8588 103
656 3300046463 Ga0495653_0008307 Ga0495653_0008307_2821_3162 103
657 3300046463 Ga0495653_0072654 Ga0495653_0072654_1474_1812 103
658 3300046463 Ga0495653_0091261 Ga0495653_0091261_457_783 103
659 3300046463 Ga0495653_0115764 Ga0495653_0115764_1548_1886 103
660 3300046463 Ga0495653_0135178 Ga0495653_0135178_482_820 103
661 3300046463 Ga0495653_0227844 Ga0495653_0227844_271_609 103
662 3300046463 Ga0495653_0374914 Ga0495653_0374914_426_764 103
663 3300046463 Ga0495653_0575937 Ga0495653_0575937_145_483 103
664 3300046472 Ga0495580_0024113 Ga0495580_0024113_3497_3838 103
665 3300046473 Ga0495582_0004164 Ga0495582_0004164_7337_7678 103
666 3300046473 Ga0495582_0150648 Ga0495582_0150648_172_510 103
667 3300046475 Ga0495639_0006273 Ga0495639_0006273_948_1289 103
668 3300046476 Ga0495662_0001522 Ga0495662_0001522_7337_7678 103
669 3300046476 Ga0495662_0023497 Ga0495662_0023497_1589_1927 103
670 3300046477 Ga0495664_0042590 Ga0495664_0042590_1892_2233 103
671 3300046477 Ga0495664_0201632 Ga0495664_0201632_535_873 103
672 3300046477 Ga0495664_0267472 Ga0495664_0267472_123_461 103
673 3300046491 Ga0495584_0007847 Ga0495584_0007847_5143_5481 103
674 3300046492 Ga0495585_0025444 Ga0495585_0025444_1155_1493 103
675 3300046499 Ga0495594_0145070 Ga0495594_0145070_171_500 103
676 3300046499 Ga0495594_0319906 Ga0495594_0319906_339_683 103
677 3300046499 Ga0495594_0639243 Ga0495594_0639243_38_382 103
678 3300046500 Ga0495596_0062955 Ga0495596_0062955_977_1315 103
679 3300046501 Ga0495607_0040771 Ga0495607_0040771_713_1051 103
680 3300046511 Ga0495608_0023778 Ga0495608_0023778_721_1056 103
681 3300046511 Ga0495608_0032053 Ga0495608_0032053_2403_2741 103
682 3300046511 Ga0495608_0115571 Ga0495608_0115571_772_1110 103
683 3300046511 Ga0495608_0312755 Ga0495608_0312755_522_860 103
684 3300046511 Ga0495608_0355764 Ga0495608_0355764_31_369 103
685 3300046511 Ga0495608_0418423 Ga0495608_0418423_280_606 103
686 3300046514 Ga0495618_0009479 Ga0495618_0009479_1878_2213 103
687 3300046514 Ga0495618_0034082 Ga0495618_0034082_685_1026 103
688 3300046514 Ga0495618_0104752 Ga0495618_0104752_153_488 103
689 3300046514 Ga0495618_0736342 Ga0495618_0736342_206_544 103
690 3300046516 Ga0495628_0000016 Ga0495628_0000016_39407_39742 103
691 3300046516 Ga0495628_0014430 Ga0495628_0014430_277_615 103
692 3300046516 Ga0495628_0028205 Ga0495628_0028205_1530_1871 103
693 3300046517 Ga0495630_0000505 Ga0495630_0000505_18065_18406 103
694 3300046517 Ga0495630_0298166 Ga0495630_0298166_197_523 103
695 3300046517 Ga0495630_0681174 Ga0495630_0681174_273_602 103
696 3300046517 Ga0495630_0770971 Ga0495630_0770971_65_403 103
697 3300046523 Ga0495644_0020878 Ga0495644_0020878_603_941 103
698 3300046525 Ga0495663_0375953 Ga0495663_0375953_112_450 103
699 3300046526 Ga0495666_0186505 Ga0495666_0186505_399_737 103
700 3300046529 Ga0495652_0000045 Ga0495652_0000045_111302_111637 103
701 3300046529 Ga0495652_0006417 Ga0495652_0006417_8929_9267 103
702 3300046529 Ga0495652_0042714 Ga0495652_0042714_1701_2042 103
703 3300046529 Ga0495652_0081521 Ga0495652_0081521_1512_1850 103
704 3300046529 Ga0495652_0083596 Ga0495652_0083596_1634_1972 103
705 3300046529 Ga0495652_0118634 Ga0495652_0118634_971_1309 103
706 3300046531 Ga0495665_0029813 Ga0495665_0029813_2124_2465 103
707 3300046533 Ga0495640_0007391 Ga0495640_0007391_6388_6726 103
708 3300046533 Ga0495640_0014315 Ga0495640_0014315_4850_5191 103
709 3300046533 Ga0495640_0954284 Ga0495640_0954284_20_355 103
710 3300046535 Ga0495586_0034130 Ga0495586_0034130_948_1289 103
711 3300046535 Ga0495586_0088546 Ga0495586_0088546_507_845 103
712 3300046536 Ga0495587_0000083 Ga0495587_0000083_10209_10544 103
713 3300046536 Ga0495587_0114475 Ga0495587_0114475_43_381 103
714 3300046536 Ga0495587_0655845 Ga0495587_0655845_146_481 103
715 3300046536 Ga0495587_0674079 Ga0495587_0674079_162_500 103
716 3300046543 Ga0495645_0001902 Ga0495645_0001902_8192_8527 103
717 3300046543 Ga0495645_0021257 Ga0495645_0021257_1075_1416 103
718 3300046543 Ga0495645_0028921 Ga0495645_0028921_2935_3273 103
719 3300046543 Ga0495645_0306506 Ga0495645_0306506_98_436 103
720 3300046559 Ga0495667_0025440 Ga0495667_0025440_599_940 103
721 3300046559 Ga0495667_0069376 Ga0495667_0069376_1230_1565 103
722 3300046559 Ga0495667_0111199 Ga0495667_0111199_498_836 103
723 3300046559 Ga0495667_0120029 Ga0495667_0120029_857_1195 103
724 3300046559 Ga0495667_0223154 Ga0495667_0223154_542_880 103
725 3300046559 Ga0495667_0540690 Ga0495667_0540690_341_667 103
726 3300046615 Ga0495656_0001481 Ga0495656_0001481_5821_6159 103
727 3300046616 Ga0495668_0245643 Ga0495668_0245643_143_481 103
728 3300046642 Ga0495634_0003355 Ga0495634_0003355_7690_8031 103
729 3300046642 Ga0495634_0038164 Ga0495634_0038164_384_722 103
730 3300046642 Ga0495634_0091496 Ga0495634_0091496_752_1087 103
731 3300046648 Ga0495611_0124287 Ga0495611_0124287_586_924 103
732 3300046663 Ga0495635_0004708 Ga0495635_0004708_2174_2500 103
733 3300046663 Ga0495635_0044339 Ga0495635_0044339_120_458 103
734 3300046663 Ga0495635_0275879 Ga0495635_0275879_23_361 103
735 3300046663 Ga0495635_0402960 Ga0495635_0402960_509_850 103
736 3300046663 Ga0495635_0409722 Ga0495635_0409722_311_649 103
737 3300046663 Ga0495635_0561639 Ga0495635_0561639_187_525 103
738 3300046665 Ga0495661_0159110 Ga0495661_0159110_124_462 103
739 3300046674 Ga0495588_0088482 Ga0495588_0088482_221_550 103
740 3300046675 Ga0495657_0011595 Ga0495657_0011595_1384_1719 103
741 3300046675 Ga0495657_0187772 Ga0495657_0187772_415_753 103
742 3300046675 Ga0495657_0241416 Ga0495657_0241416_534_872 103
743 3300046675 Ga0495657_0345525 Ga0495657_0345525_211_549 103
744 3300046675 Ga0495657_0346145 Ga0495657_0346145_138_464 103
745 3300046675 Ga0495657_0399648 Ga0495657_0399648_458_799 103
746 3300046675 Ga0495657_0469575 Ga0495657_0469575_285_623 103
747 3300046675 Ga0495657_0706024 Ga0495657_0706024_50_388 103
748 3300046678 Ga0495599_0000187 Ga0495599_0000187_3624_3959 103
749 3300046678 Ga0495599_0000610 Ga0495599_0000610_5216_5554 103
750 3300046678 Ga0495599_0200702 Ga0495599_0200702_282_620 103
751 3300046678 Ga0495599_0235184 Ga0495599_0235184_184_522 103
752 3300046679 Ga0495623_0000121 Ga0495623_0000121_39426_39761 103
753 3300046679 Ga0495623_0194689 Ga0495623_0194689_341_679 103
754 3300046680 Ga0495646_0001537 Ga0495646_0001537_5423_5758 103
755 3300046680 Ga0495646_0062692 Ga0495646_0062692_921_1259 103
756 3300046681 Ga0495647_0000468 Ga0495647_0000468_7076_7417 103
757 3300046681 Ga0495647_0049997 Ga0495647_0049997_445_783 103
758 3300046683 Ga0495658_0011253 Ga0495658_0011253_84_425 103
759 3300046683 Ga0495658_0203263 Ga0495658_0203263_273_611 103
760 3300046684 Ga0495669_0276031 Ga0495669_0276031_221_559 103
761 3300046689 Ga0495613_0062116 Ga0495613_0062116_1317_1661 103
762 3300046689 Ga0495613_0081268 Ga0495613_0081268_1717_2055 103
763 3300046689 Ga0495613_0456135 Ga0495613_0456135_196_537 103
764 3300046690 Ga0495624_0005932 Ga0495624_0005932_4444_4785 103
765 3300046690 Ga0495624_0022126 Ga0495624_0022126_1389_1733 103
766 3300046690 Ga0495624_0408691 Ga0495624_0408691_411_749 103
767 3300046690 Ga0495624_0633771 Ga0495624_0633771_29_358 103
768 3300046691 Ga0495670_0072448 Ga0495670_0072448_772_1110 103
769 3300046794 Ga0495589_0200021 Ga0495589_0200021_507_845 103
770 3300046809 Ga0495600_0041000 Ga0495600_0041000_2306_2641 103
771 3300046809 Ga0495600_0228921 Ga0495600_0228921_379_717 103
772 3300046809 Ga0495600_0268406 Ga0495600_0268406_384_722 103
773 3300046809 Ga0495600_0473465 Ga0495600_0473465_311_637 103
774 3300046810 Ga0495660_0280624 Ga0495660_0280624_57_395 103
775 3300047315 Ga0495581_0002035 Ga0495581_0002035_7204_7545 103
776 3300047315 Ga0495581_0047064 Ga0495581_0047064_26_364 103
777 3300047315 Ga0495581_0263017 Ga0495581_0263017_132_470 103
778 3300047317 Ga0495604_0000072 Ga0495604_0000072_79129_79464 103
779 3300047317 Ga0495604_0087853 Ga0495604_0087853_1333_1671 103
780 3300047317 Ga0495604_0375810 Ga0495604_0375810_58_393 103
781 3300047319 Ga0495674_0012591 Ga0495674_0012591_4967_5308 103
782 3300047319 Ga0495674_0073771 Ga0495674_0073771_1306_1644 103
783 3300047319 Ga0495674_0582007 Ga0495674_0582007_354_692 103
784 3300047321 Ga0495676_0071355 Ga0495676_0071355_441_785 103
785 3300047321 Ga0495676_0155177 Ga0495676_0155177_412_750 103
786 3300047321 Ga0495676_0160103 Ga0495676_0160103_68_409 103
787 3300047321 Ga0495676_0429865 Ga0495676_0429865_297_626 103
788 3300047322 Ga0495680_0004810 Ga0495680_0004810_6665_7006 103
789 3300047322 Ga0495680_0007057 Ga0495680_0007057_7560_7895 103
790 3300047322 Ga0495680_0016342 Ga0495680_0016342_5404_5742 103
791 3300047322 Ga0495680_0108643 Ga0495680_0108643_1242_1568 103
792 3300047322 Ga0495680_0181638 Ga0495680_0181638_843_1181 103
793 3300047322 Ga0495680_0611430 Ga0495680_0611430_142_477 103
794 3300047322 Ga0495680_0929519 Ga0495680_0929519_35_373 103
795 3300047323 Ga0495683_0226532 Ga0495683_0226532_202_540 103
796 3300047444 Ga0495675_0000031 Ga0495675_0000031_64087_64422 103
797 3300047444 Ga0495675_0563240 Ga0495675_0563240_158_496 103
798 3300047445 Ga0495677_0028578 Ga0495677_0028578_80_418 103
799 3300047446 Ga0495679_055719 Ga0495679_055719_608_946 103
800 3300047471 Ga0495684_0008099 Ga0495684_0008099_1019_1357 103
801 3300047471 Ga0495684_0019924 Ga0495684_0019924_2166_2507 103
802 3300047471 Ga0495684_0297074 Ga0495684_0297074_314_652 103
803 3300047471 Ga0495684_0674395 Ga0495684_0674395_68_409 103
804 3300047673 Ga0495593_0000333 Ga0495593_0000333_11657_11998 103
805 3300047673 Ga0495593_0119571 Ga0495593_0119571_405_731 103
806 3300048088 Ga0495602_0000133 Ga0495602_0000133_39434_39769 103
807 3300048088 Ga0495602_0024934 Ga0495602_0024934_3104_3442 103
808 3300048088 Ga0495602_0095157 Ga0495602_0095157_72_410 103
809 3300048088 Ga0495602_0723161 Ga0495602_0723161_288_626 103
810 3300048089 Ga0495614_0001325 Ga0495614_0001325_8719_9060 103
811 3300048903 Ga0496100_0034269 Ga0496100_0034269_1430_1774 103
812 3300048903 Ga0496100_0049310 Ga0496100_0049310_1821_2159 103
813 3300048903 Ga0496100_0144881 Ga0496100_0144881_673_1011 103
814 3300048904 Ga0496101_0002509 Ga0496101_0002509_8203_8547 103
815 3300048904 Ga0496101_0044485 Ga0496101_0044485_2761_3099 103
816 3300048904 Ga0496101_0110389 Ga0496101_0110389_472_810 103
817 3300048904 Ga0496101_0260787 Ga0496101_0260787_284_628 103
818 3300048904 Ga0496101_1067501 Ga0496101_1067501_132_470 103
819 3300048905 Ga0496102_0055705 Ga0496102_0055705_1468_1812 103
820 3300048905 Ga0496102_0185761 Ga0496102_0185761_786_1124 103
821 3300048905 Ga0496102_0352481 Ga0496102_0352481_87_425 103
822 3300048905 Ga0496102_0849525 Ga0496102_0849525_319_657 103
823 3300048906 Ga0496103_0016363 Ga0496103_0016363_1222_1566 103
824 3300048907 Ga0496104_0034254 Ga0496104_0034254_2012_2350 103
825 3300048907 Ga0496104_0039390 Ga0496104_0039390_3641_3979 103
826 3300048907 Ga0496104_0864155 Ga0496104_0864155_62_400 103
827 3300048908 Ga0496105_0010632 Ga0496105_0010632_5207_5545 103
828 3300048908 Ga0496105_0017937 Ga0496105_0017937_2607_2945 103
829 3300048908 Ga0496105_1212534 Ga0496105_1212534_159_497 103
830 3300048909 Ga0496106_0041047 Ga0496106_0041047_2404_2748 103
831 3300048909 Ga0496106_0103195 Ga0496106_0103195_808_1146 103
832 3300048909 Ga0496106_0741584 Ga0496106_0741584_323_661 103
833 3300048910 Ga0496107_0010435 Ga0496107_0010435_1235_1579 103
834 3300048910 Ga0496107_0093099 Ga0496107_0093099_541_879 103
835 3300048910 Ga0496107_0154752 Ga0496107_0154752_162_500 103
836 3300048910 Ga0496107_1045708 Ga0496107_1045708_78_389 103
837 3300048911 Ga0496108_0011946 Ga0496108_0011946_4351_4695 103
838 3300048911 Ga0496108_0036442 Ga0496108_0036442_3608_3946 103
839 3300048911 Ga0496108_0482952 Ga0496108_0482952_648_986 103
840 3300048912 Ga0496109_0009062 Ga0496109_0009062_1775_2113 103
841 3300048912 Ga0496109_0056369 Ga0496109_0056369_2093_2431 103
842 3300048912 Ga0496109_0609685 Ga0496109_0609685_92_403 103
843 3300048912 Ga0496109_0620230 Ga0496109_0620230_625_963 103
844 3300048913 Ga0496110_0006093 Ga0496110_0006093_2234_2578 103
845 3300048913 Ga0496110_0279650 Ga0496110_0279650_592_930 103
846 3300048913 Ga0496110_0733996 Ga0496110_0733996_197_535 103
847 3300048914 Ga0496111_0016935 Ga0496111_0016935_3037_3381 103
848 3300048914 Ga0496111_0022289 Ga0496111_0022289_732_1070 103
849 3300048914 Ga0496111_0293454 Ga0496111_0293454_224_571 103
850 3300048914 Ga0496111_1136859 Ga0496111_1136859_12_350 103
851 3300048915 Ga0496112_0071929 Ga0496112_0071929_2511_2822 103
852 3300048915 Ga0496112_0087667 Ga0496112_0087667_1940_2284 103
853 3300048915 Ga0496112_0089402 Ga0496112_0089402_1839_2177 103
854 3300048915 Ga0496112_0434252 Ga0496112_0434252_798_1136 103
855 3300048915 Ga0496112_1233356 Ga0496112_1233356_93_440 103
856 3300048916 Ga0496113_0041344 Ga0496113_0041344_2747_3058 103
857 3300048916 Ga0496113_0166052 Ga0496113_0166052_950_1288 103
858 3300048916 Ga0496113_0234272 Ga0496113_0234272_578_916 103
859 3300048917 Ga0496114_0011562 Ga0496114_0011562_5450_5794 103
860 3300048917 Ga0496114_0096721 Ga0496114_0096721_1723_2061 103
861 3300048917 Ga0496114_0176094 Ga0496114_0176094_1438_1776 103
862 3300048918 Ga0496115_0026093 Ga0496115_0026093_673_1011 103
863 3300048918 Ga0496115_0080724 Ga0496115_0080724_836_1180 103
864 3300048918 Ga0496115_0082447 Ga0496115_0082447_249_587 103
865 3300048918 Ga0496115_0100595 Ga0496115_0100595_1625_1963 103
866 3300048918 Ga0496115_0199138 Ga0496115_0199138_1070_1414 103
867 3300048918 Ga0496115_0641835 Ga0496115_0641835_57_386 103
868 3300049583 Ga0501067_0057526 Ga0501067_0057526_789_1133 103
869 3300049583 Ga0501067_0274228 Ga0501067_0274228_471_815 103
870 3300049585 Ga0501069_0033705 Ga0501069_0033705_959_1303 103
871 3300049586 Ga0501070_0846256 Ga0501070_0846256_34_378 103
872 3300050507 nmdc:mga05p37_1052152_c1 nmdc:mga05p37_1052152_c1_355_669 103
873 3300050512 nmdc:mga0n895_180850_c1 nmdc:mga0n895_180850_c1_1450_1764 103
874 3300050512 nmdc:mga0n895_5478_c1 nmdc:mga0n895_5478_c1_3608_3946 103
875 3300050513 nmdc:mga0rr50_544609_c1 nmdc:mga0rr50_544609_c1_581_895 103
876 3300050514 nmdc:mga08x19_381534_c1 nmdc:mga08x19_381534_c1_582_920 103
877 3300050515 nmdc:mga0a205_299821_c1 nmdc:mga0a205_299821_c1_850_1188 103
878 3300053077 Ga0495601_0000304 Ga0495601_0000304_10424_10759 103
879 3300053077 Ga0495601_0026164 Ga0495601_0026164_2316_2654 103
880 3300053077 Ga0495601_0033652 Ga0495601_0033652_457_798 103
881 3300053077 Ga0495601_0111956 Ga0495601_0111956_253_591 103
882 3300053078 Ga0495612_0005159 Ga0495612_0005159_5012_5353 103
883 3300053078 Ga0495612_0011693 Ga0495612_0011693_1822_2160 103
884 3300053078 Ga0495612_0601550 Ga0495612_0601550_50_388 103
885 3300053084 Ga0495595_0004259 Ga0495595_0004259_3788_4126 103
886 3300053084 Ga0495595_0015196 Ga0495595_0015196_2345_2680 103
887 3300053084 Ga0495595_0104732 Ga0495595_0104732_678_1016 103
888 3300053084 Ga0495595_0617963 Ga0495595_0617963_102_440 103
889 3300053084 Ga0495595_0738570 Ga0495595_0738570_103_441 103
890 3300053085 Ga0495619_0000836 Ga0495619_0000836_17149_17484 103
891 3300053085 Ga0495619_0001937 Ga0495619_0001937_1323_1664 103
892 3300053085 Ga0495619_0109203 Ga0495619_0109203_797_1135 103
893 3300053085 Ga0495619_0109497 Ga0495619_0109497_848_1186 103
894 3300053085 Ga0495619_0568792 Ga0495619_0568792_274_609 103
895 3300053094 Ga0500566_0008196 Ga0500566_0008196_2283_2624 103
896 3300053123 Ga0500614_224465 Ga0500614_224465_26_367 103
897 3300061719 Ga0466962_0002608 Ga0466962_0002608_1828_2157 103
898 3300061719 Ga0466962_0005598 Ga0466962_0005598_1483_1818 103
899 3300061719 Ga0466962_0012201 Ga0466962_0012201_2606_2947 103
900 3300061719 Ga0466962_0029341 Ga0466962_0029341_340_684 103
901 3300061719 Ga0466962_0041976 Ga0466962_0041976_1510_1854 103
902 3300005329 Ga0070683_100629443 Ga0070683_1006294432 104
903 3300005434 Ga0070709_10067769 Ga0070709_100677692 104
904 3300005435 Ga0070714_100071577 Ga0070714_1000715772 104
905 3300005436 Ga0070713_100518532 Ga0070713_1005185322 104
906 3300005437 Ga0070710_10448744 Ga0070710_104487442 104
907 3300005439 Ga0070711_100060945 Ga0070711_1000609455 104
908 3300005518 Ga0070699_100218255 Ga0070699_1002182552 104
909 3300005614 Ga0068856_101493298 Ga0068856_1014932982 104
910 3300006028 Ga0070717_10176291 Ga0070717_101762912 104
911 3300006175 Ga0070712_100253298 Ga0070712_1002532981 104
912 3300013100 Ga0157373_10141834 Ga0157373_101418343 104
913 3300013100 Ga0157373_10208399 Ga0157373_102083992 104
914 3300013104 Ga0157370_10009353 Ga0157370_100093535 104
915 3300013104 Ga0157370_11812284 Ga0157370_118122842 104
916 3300013105 Ga0157369_10001145 Ga0157369_1000114521 104
917 3300013105 Ga0157369_10040236 Ga0157369_100402363 104
918 3300020070 Ga0206356_11584572 Ga0206356_115845722 104
919 3300025898 Ga0207692_11084736 Ga0207692_110847361 104
920 3300025906 Ga0207699_10045831 Ga0207699_100458312 104
921 3300025915 Ga0207693_10770359 Ga0207693_107703592 104
922 3300025916 Ga0207663_10772227 Ga0207663_107722272 104
923 3300025929 Ga0207664_10003898 Ga0207664_100038983 104
924 3300025929 Ga0207664_10054343 Ga0207664_100543435 104
925 3300026078 Ga0207702_10669249 Ga0207702_106692492 104
926 3300026078 Ga0207702_11244060 Ga0207702_112440602 104
927 3300026142 Ga0207698_10503608 Ga0207698_105036082 104
928 3300028556 Ga0265337_1016990 Ga0265337_10169902 104
929 3300028666 Ga0265336_10101403 Ga0265336_101014031 104
930 3300028800 Ga0265338_10027009 Ga0265338_100270095 104
931 3300031238 Ga0265332_10057099 Ga0265332_100570992 104
932 3300031241 Ga0265325_10060819 Ga0265325_100608193 104
933 3300031247 Ga0265340_10211349 Ga0265340_102113492 104
934 3300031249 Ga0265339_10014310 Ga0265339_100143101 104
935 3300031344 Ga0265316_10025347 Ga0265316_100253475 104
936 3300031595 Ga0265313_10010563 Ga0265313_100105634 104
937 3300031711 Ga0265314_10007395 Ga0265314_100073958 104
938 3300031712 Ga0265342_10011777 Ga0265342_100117773 104
939 3300036401 Ga0373937_1483170 Ga0373937_1483170_271_585 104
940 3300037312 Ga0395899_0573369 Ga0395899_0573369_113_427 104
941 3300037418 Ga0395900_0128055 Ga0395900_0128055_1811_2125 104
942 3300037418 Ga0395900_1448153 Ga0395900_1448153_96_410 104
943 3300037466 Ga0395898_0207769 Ga0395898_0207769_811_1125 104
944 3300038443 Ga0395901_1088901 Ga0395901_1088901_371_685 104
945 3300044694 Ga0466963_0374982 Ga0466963_0374982_178_495 104
946 3300045976 Ga0466967_0127686 Ga0466967_0127686_1175_1498 104
947 3300048907 Ga0496104_0988404 Ga0496104_0988404_105_422 104
948 3300048915 Ga0496112_0082148 Ga0496112_0082148_1480_1797 104
949 3300053078 Ga0495612_0424336 Ga0495612_0424336_73_390 104
950 3300025922 Ga0207646_10783520 Ga0207646_107835202 105
951 3300028558 Ga0265326_10049203 Ga0265326_100492032 105
952 3300028563 Ga0265319_1022703 Ga0265319_10227032 105
953 3300028573 Ga0265334_10009412 Ga0265334_100094122 105
954 3300028577 Ga0265318_10000788 Ga0265318_1000078823 105
955 3300028654 Ga0265322_10044206 Ga0265322_100442062 105
956 3300028666 Ga0265336_10054715 Ga0265336_100547152 105
957 3300028800 Ga0265338_10003688 Ga0265338_100036884 105
958 3300031235 Ga0265330_10000672 Ga0265330_1000067225 105
959 3300031238 Ga0265332_10018992 Ga0265332_100189922 105
960 3300031239 Ga0265328_10012489 Ga0265328_100124892 105
961 3300031240 Ga0265320_10099056 Ga0265320_100990562 105
962 3300031241 Ga0265325_10020864 Ga0265325_100208643 105
963 3300031242 Ga0265329_10016823 Ga0265329_100168233 105
964 3300031247 Ga0265340_10006639 Ga0265340_100066395 105
965 3300031249 Ga0265339_10175665 Ga0265339_101756652 105
966 3300031250 Ga0265331_10008097 Ga0265331_100080978 105
967 3300031251 Ga0265327_10006666 Ga0265327_1000666610 105
968 3300031344 Ga0265316_10068014 Ga0265316_100680144 105
969 3300031595 Ga0265313_10030697 Ga0265313_100306973 105
970 3300031711 Ga0265314_10098822 Ga0265314_100988222 105
971 3300031712 Ga0265342_10210518 Ga0265342_102105182 105
972 3300044842 Ga0466957_1298025 Ga0466957_1298025_179_496 105
973 3300048915 Ga0496112_0056461 Ga0496112_0056461_931_1248 105
974 3300048915 Ga0496112_0186249 Ga0496112_0186249_65_382 105
975 3300048915 Ga0496112_1036068 Ga0496112_1036068_61_378 105
976 3300048916 Ga0496113_0300215 Ga0496113_0300215_853_1170 105
977 3300048916 Ga0496113_0738305 Ga0496113_0738305_311_628 105
978 3300005327 Ga0070658_10009734 Ga0070658_100097347 106
979 3300005327 Ga0070658_10374225 Ga0070658_103742251 106
980 3300005337 Ga0070682_101787717 Ga0070682_1017877171 106
981 3300005339 Ga0070660_100003328 Ga0070660_10000332811 106
982 3300005339 Ga0070660_100031952 Ga0070660_1000319526 106
983 3300005344 Ga0070661_100259758 Ga0070661_1002597582 106
984 3300005435 Ga0070714_101529976 Ga0070714_1015299762 106
985 3300005435 Ga0070714_101842380 Ga0070714_1018423802 106
986 3300005458 Ga0070681_10152629 Ga0070681_101526293 106
987 3300005530 Ga0070679_100230258 Ga0070679_1002302581 106
988 3300005563 Ga0068855_100006484 Ga0068855_1000064849 106
989 3300005563 Ga0068855_100947419 Ga0068855_1009474192 106
990 3300005616 Ga0068852_101119958 Ga0068852_1011199582 106
991 3300009551 Ga0105238_11756639 Ga0105238_117566392 106
992 3300013102 Ga0157371_10144028 Ga0157371_101440282 106
993 3300013102 Ga0157371_10569547 Ga0157371_105695472 106
994 3300013104 Ga0157370_10017077 Ga0157370_100170775 106
995 3300013104 Ga0157370_11389367 Ga0157370_113893672 106
996 3300013105 Ga0157369_11171477 Ga0157369_111714772 106
997 3300013307 Ga0157372_10219081 Ga0157372_102190813 106
998 3300013307 Ga0157372_10917960 Ga0157372_109179602 106
999 3300020070 Ga0206356_10582850 Ga0206356_105828501 106
1000 3300020075 Ga0206349_1467851 Ga0206349_14678512 106
1001 3300020081 Ga0206354_10451936 Ga0206354_104519366 106
1002 3300020082 Ga0206353_12040664 Ga0206353_120406646 106
1003 3300025909 Ga0207705_10017947 Ga0207705_100179473 106
1004 3300025909 Ga0207705_10238310 Ga0207705_102383102 106
1005 3300025912 Ga0207707_10024218 Ga0207707_100242185 106
1006 3300025913 Ga0207695_10667101 Ga0207695_106671012 106
1007 3300025919 Ga0207657_10003170 Ga0207657_1000317011 106
1008 3300025919 Ga0207657_10014486 Ga0207657_100144869 106
1009 3300025920 Ga0207649_10030419 Ga0207649_100304191 106
1010 3300025920 Ga0207649_10205547 Ga0207649_102055472 106
1011 3300025920 Ga0207649_10547393 Ga0207649_105473932 106
1012 3300025921 Ga0207652_10571169 Ga0207652_105711692 106
1013 3300025929 Ga0207664_10458001 Ga0207664_104580012 106
1014 3300025929 Ga0207664_11366455 Ga0207664_113664552 106
1015 3300025932 Ga0207690_11837553 Ga0207690_118375532 106
1016 3300025949 Ga0207667_10182073 Ga0207667_101820731 106
1017 3300025981 Ga0207640_10090763 Ga0207640_100907632 106
1018 3300037312 Ga0395899_0080577 Ga0395899_0080577_289_609 106
1019 3300037418 Ga0395900_0658226 Ga0395900_0658226_287_607 106
1020 3300037466 Ga0395898_0095120 Ga0395898_0095120_1885_2205 106
1021 3300037471 Ga0395905_1048441 Ga0395905_1048441_149_469 106
1022 3300038443 Ga0395901_0089797 Ga0395901_0089797_1029_1349 106
1023 3300048915 Ga0496112_1216066 Ga0496112_1216066_233_553 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11950

DUF3467

Protein of unknown function (DUF3467)

2

95

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qp7-assembly1.cif.gz_1 structure of the human 48s initiation complex in closed state (h48s aug closed) 0.7527 36 71
5g06-assembly1.cif.gz_D cryo-em structure of yeast cytoplasmic exosome 0.7471 16 52
7lbm-assembly1.cif.gz_0 structure of the human mediator-bound transcription pre-initiation complex 0.7464 36 73
6ybt-assembly1.cif.gz_1 structure of a human 48s translational initiation complex - eif3bgi 0.7457 36 71
6d6k-assembly1.cif.gz_A structure of polyribonucleotide nucleotidyltransferase from acinetobacter baumannii 0.7401 16 51
ID Description Score Start End Superfamily
af_A4ID27_51_409_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.808 36 73 2.130.10.10
af_Q8S2H5_315_629_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8078 36 73 3.60.21.10
af_Q7XU84_7_321_3.60.40.10 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.7712 36 51 3.60.40.10
af_Q4G061_490_685_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7584 36 71 2.130.10.10
af_A0A2R8Q7Q3_23_327_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7378 34 73 3.60.21.10
ID Description Score Start End GO Terms
AF-U5HJB3-F1-model_v4 Zn(2)-C6 fungal-type domain-containing protein 0.7849 36 73
AF-A0A1G3QPD1-F1-model_v4 Type II secretion system protein K 0.7645 36 73
AF-A0A6L7MRY7-F1-model_v4 General secretion pathway protein GspK 0.7574 36 73
AF-A0A7S2CZ40-F1-model_v4 F-box protein Hrt3/FBXO9 C-terminal domain-containing protein 0.7551 34 74
AF-A0A1S1M166-F1-model_v4 Uncharacterized protein 0.7545 36 73 GO:0016020

Feature Viewer

pLDDT pTM Quality
79.5 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map