F488450
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1023 | 485 | 2046 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0255934|Ga0496102_0255934_221_1030 |
| Length | 261 |
| Sequence | MGQAVFIAGPPPVHLSTLEESMYKIVFMRHGESTWNLENRFTGWTDVDLTAKGVQEAKNAGKVLKEAGFTFDLAYTSVLKRAIRTLWLTMDEMDMLWLPVVNDWRLNERHYGALQGLDKGETAAKYGDAQVLVWRRSYDTPERTSFSDPRYARLERSQIPLTECLKDTVARVMPAWDEEIAPAIRAGRQILISAHGNSLRALIKMLDGISDEDIVGLNIPNGQPLVYELDADLKPIRHYYLGDAAAIAAATAAVANQGKAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 18 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 95 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 124 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 212 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 213 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 214 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 215 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 216 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 225 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 226 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 229 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 233 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 234 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 235 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 240 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 254 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 257 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 260 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 261 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 262 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 267 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 268 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 269 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 270 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 271 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 272 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 362 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 363 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 364 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 365 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 366 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 369 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 370 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 371 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 372 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 373 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 374 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 375 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 376 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 377 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 378 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 379 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 380 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 381 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 382 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 404 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 405 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 409 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 410 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 414 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 418 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 419 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 422 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 423 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 424 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 429 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 430 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 431 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 432 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 433 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 434 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 435 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 436 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 437 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 438 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 439 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 440 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 441 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 442 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 443 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 444 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 445 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 446 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 447 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 448 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 449 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 450 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 451 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 452 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 453 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 454 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 455 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 456 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 457 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 458 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 459 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 460 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 461 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 462 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 463 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 464 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 465 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 466 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 467 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 468 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 469 | 2889415604 | Paludisphaera rhizosphaerae JC665 | Isolate | Rhizosphere |
| 470 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 471 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 472 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 473 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 474 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 475 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 476 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 477 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 478 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 479 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 480 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 481 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 482 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 483 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 484 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 485 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.74 |
| Metatranscriptomes | 0.68 |
| Isolates | 5.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.95 |
| Nodule | 0.88 |
| Rhizoplane | 2.54 |
| Rhizosphere | 76.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496102_0255934 | 3300048905 | Bacteria | 1650 |
| 2 | SwRhRL2b_contig_1435602 | 2162886007 | Bacteria | 1876 |
| 3 | JGI24737J22298_10007165 | 3300001990 | Bacteria | 3774 |
| 4 | JGI25155J39150_1000170 | 3300002704 | Bacteria | 28479 |
| 5 | JGI25155J39150_1000681 | 3300002704 | Bacteria | 6401 |
| 6 | JGI25156J39149_1000293 | 3300002705 | Bacteria | 33788 |
| 7 | JGI25162J39368_1000148 | 3300002737 | Bacteria | 76611 |
| 8 | JGI25154J39366_1000260 | 3300002738 | Bacteria | 33788 |
| 9 | JGI25154J39366_1000267 | 3300002738 | Bacteria | 32817 |
| 10 | JGI25154J39366_1001696 | 3300002738 | Bacteria | 7240 |
| 11 | JGI25158J39367_1003777 | 3300002739 | Bacteria | 2309 |
| 12 | JGI25157J39369_1000327 | 3300002741 | Bacteria | 33804 |
| 13 | JGI25152J39213_1012831 | 3300002773 | Bacteria | 1776 |
| 14 | JGI25150J39212_1001790 | 3300002774 | Bacteria | 5724 |
| 15 | JGI25150J39212_1003475 | 3300002774 | Bacteria | 3677 |
| 16 | JGI25159J45721_1012602 | 3300002987 | Bacteria | 2008 |
| 17 | JGI25159J45721_1014381 | 3300002987 | Bacteria | 1789 |
| 18 | JGI25165J46597_1000030 | 3300003214 | Bacteria | 305254 |
| 19 | JGI25153J46596_10000527 | 3300003215 | Bacteria | 24017 |
| 20 | rootL2_10059351 | 3300003322 | Bacteria | 4970 |
| 21 | rootL2_10082641 | 3300003322 | Bacteria | 4053 |
| 22 | JGI25160J50197_1024978 | 3300003354 | Bacteria | 1682 |
| 23 | JGI25161J50226_1005964 | 3300003374 | Bacteria | 2271 |
| 24 | Ga0007409J51694_1018111 | 3300003575 | Bacteria | 1589 |
| 25 | Ga0055538_1000017 | 3300003751 | Bacteria | 305254 |
| 26 | Ga0055538_1000138 | 3300003751 | Bacteria | 51369 |
| 27 | Ga0055539_1000022 | 3300003752 | Bacteria | 305254 |
| 28 | Ga0055539_1000187 | 3300003752 | Bacteria | 51369 |
| 29 | Ga0055533_1000030 | 3300003756 | Bacteria | 305254 |
| 30 | Ga0055533_1000189 | 3300003756 | Bacteria | 51369 |
| 31 | Ga0055532_1000184 | 3300003758 | Bacteria | 52595 |
| 32 | Ga0055525_1000034 | 3300003759 | Bacteria | 305254 |
| 33 | Ga0055525_1000254 | 3300003759 | Bacteria | 51369 |
| 34 | Ga0055535_1013432 | 3300003761 | Bacteria | 1208 |
| 35 | Ga0055529_1000097 | 3300003763 | Bacteria | 132109 |
| 36 | Ga0055529_1001308 | 3300003763 | Bacteria | 8446 |
| 37 | Ga0055526_1000030 | 3300003771 | Bacteria | 143833 |
| 38 | Ga0055526_1000167 | 3300003771 | Bacteria | 57804 |
| 39 | Ga0055526_1000696 | 3300003771 | Bacteria | 25648 |
| 40 | Ga0055526_1001016 | 3300003771 | Bacteria | 20552 |
| 41 | Ga0055526_1021142 | 3300003771 | Bacteria | 2277 |
| 42 | Ga0055537_1000114 | 3300003773 | Bacteria | 60836 |
| 43 | Ga0055534_1000398 | 3300003784 | Bacteria | 26851 |
| 44 | Ga0055534_1001436 | 3300003784 | Bacteria | 9475 |
| 45 | Ga0055528_1000683 | 3300003790 | Bacteria | 24377 |
| 46 | Ga0055528_1001913 | 3300003790 | Bacteria | 11822 |
| 47 | Ga0055530_10010680 | 3300003791 | Bacteria | 3367 |
| 48 | Ga0055531_10018382 | 3300003794 | Bacteria | 2888 |
| 49 | Ga0055541_1000015 | 3300003841 | Bacteria | 305254 |
| 50 | Ga0055541_1000122 | 3300003841 | Bacteria | 51369 |
| 51 | Ga0055543_1008303 | 3300004625 | Bacteria | 2309 |
| 52 | Ga0065165_1000161 | 3300005262 | Bacteria | 116828 |
| 53 | Ga0065165_1060300 | 3300005262 | Bacteria | 1041 |
| 54 | Ga0065714_10108397 | 3300005288 | Bacteria | 1516 |
| 55 | Ga0065704_10077125 | 3300005289 | Bacteria | 4847 |
| 56 | Ga0065704_10175861 | 3300005289 | Bacteria | 1264 |
| 57 | Ga0070658_10007092 | 3300005327 | Bacteria | 9045 |
| 58 | Ga0070658_10026431 | 3300005327 | Bacteria | 4656 |
| 59 | Ga0070658_10140070 | 3300005327 | Bacteria | 2020 |
| 60 | Ga0070676_10004199 | 3300005328 | Bacteria | 7566 |
| 61 | Ga0070676_10074245 | 3300005328 | Bacteria | 2048 |
| 62 | Ga0070676_10449498 | 3300005328 | Bacteria | 906 |
| 63 | Ga0070683_100181374 | 3300005329 | Bacteria | 1998 |
| 64 | Ga0070670_100016771 | 3300005331 | Bacteria | 6285 |
| 65 | Ga0070670_100202220 | 3300005331 | Bacteria | 1726 |
| 66 | Ga0068869_100132290 | 3300005334 | Bacteria | 1919 |
| 67 | Ga0070666_10074780 | 3300005335 | Bacteria | 2309 |
| 68 | Ga0070680_100009867 | 3300005336 | Bacteria | 7349 |
| 69 | Ga0070682_100012497 | 3300005337 | Bacteria | 4871 |
| 70 | Ga0068868_100039188 | 3300005338 | Bacteria | 3681 |
| 71 | Ga0068868_100054684 | 3300005338 | Bacteria | 3147 |
| 72 | Ga0070660_100003375 | 3300005339 | Bacteria | 10984 |
| 73 | Ga0070660_100267634 | 3300005339 | Bacteria | 1396 |
| 74 | Ga0070660_100321858 | 3300005339 | Bacteria | 1270 |
| 75 | Ga0070687_100102571 | 3300005343 | Bacteria | 1605 |
| 76 | Ga0070661_100009715 | 3300005344 | Bacteria | 6673 |
| 77 | Ga0070668_100059566 | 3300005347 | Bacteria | 2955 |
| 78 | Ga0070668_100144430 | 3300005347 | Bacteria | 1920 |
| 79 | Ga0070668_100574234 | 3300005347 | Bacteria | 984 |
| 80 | Ga0070669_100050314 | 3300005353 | Bacteria | 3043 |
| 81 | Ga0070669_100379589 | 3300005353 | Bacteria | 1152 |
| 82 | Ga0070675_100016252 | 3300005354 | Bacteria | 5904 |
| 83 | Ga0070675_100035845 | 3300005354 | Bacteria | 4034 |
| 84 | Ga0070675_100657543 | 3300005354 | Bacteria | 953 |
| 85 | Ga0070671_100013439 | 3300005355 | Bacteria | 6600 |
| 86 | Ga0070671_100494674 | 3300005355 | Bacteria | 1052 |
| 87 | Ga0070674_100007074 | 3300005356 | Bacteria | 6596 |
| 88 | Ga0070673_100072473 | 3300005364 | Bacteria | 2770 |
| 89 | Ga0070673_100373610 | 3300005364 | Bacteria | 1270 |
| 90 | Ga0070673_100572690 | 3300005364 | Bacteria | 1028 |
| 91 | Ga0070659_100005084 | 3300005366 | Bacteria | 9432 |
| 92 | Ga0070659_100025581 | 3300005366 | Bacteria | 4535 |
| 93 | Ga0070659_100047684 | 3300005366 | Bacteria | 3362 |
| 94 | Ga0070667_100031274 | 3300005367 | Bacteria | 4438 |
| 95 | Ga0070667_100051141 | 3300005367 | Bacteria | 3483 |
| 96 | Ga0070700_100253903 | 3300005441 | Bacteria | 1263 |
| 97 | Ga0070694_100152490 | 3300005444 | Bacteria | 1689 |
| 98 | Ga0070663_100056072 | 3300005455 | Bacteria | 2822 |
| 99 | Ga0070678_100113817 | 3300005456 | Bacteria | 2121 |
| 100 | Ga0070662_100004735 | 3300005457 | Bacteria | 8625 |
| 101 | Ga0070662_100020288 | 3300005457 | Bacteria | 4524 |
| 102 | Ga0070662_100071262 | 3300005457 | Bacteria | 2562 |
| 103 | Ga0070662_100114298 | 3300005457 | Bacteria | 2061 |
| 104 | Ga0070681_10141338 | 3300005458 | Bacteria | 2337 |
| 105 | Ga0068867_100003983 | 3300005459 | Bacteria | 10390 |
| 106 | Ga0068867_100068393 | 3300005459 | Bacteria | 2650 |
| 107 | Ga0068867_100154219 | 3300005459 | Bacteria | 1806 |
| 108 | Ga0070698_100040134 | 3300005471 | Bacteria | 4813 |
| 109 | Ga0070679_100001135 | 3300005530 | Bacteria | 23268 |
| 110 | Ga0070684_100055097 | 3300005535 | Bacteria | 3465 |
| 111 | Ga0070697_100609112 | 3300005536 | Bacteria | 960 |
| 112 | Ga0068853_100081877 | 3300005539 | Bacteria | 2827 |
| 113 | Ga0068853_100136891 | 3300005539 | Bacteria | 2196 |
| 114 | Ga0068853_100370259 | 3300005539 | Bacteria | 1336 |
| 115 | Ga0070672_100003086 | 3300005543 | Bacteria | 10747 |
| 116 | Ga0070672_100006477 | 3300005543 | Bacteria | 7874 |
| 117 | Ga0070672_100020307 | 3300005543 | Bacteria | 4843 |
| 118 | Ga0070693_100003885 | 3300005547 | Bacteria | 7008 |
| 119 | Ga0070704_100019965 | 3300005549 | Bacteria | 4312 |
| 120 | Ga0068855_100016431 | 3300005563 | Bacteria | 8898 |
| 121 | Ga0068855_100155206 | 3300005563 | Bacteria | 2601 |
| 122 | Ga0068855_100468323 | 3300005563 | Bacteria | 1373 |
| 123 | Ga0068855_100817558 | 3300005563 | Bacteria | 989 |
| 124 | Ga0070664_100011679 | 3300005564 | Bacteria | 7127 |
| 125 | Ga0070664_100058114 | 3300005564 | Bacteria | 3289 |
| 126 | Ga0068857_100171310 | 3300005577 | Bacteria | 1973 |
| 127 | Ga0068854_100005545 | 3300005578 | Bacteria | 7973 |
| 128 | Ga0068854_100006914 | 3300005578 | Bacteria | 7235 |
| 129 | Ga0068854_100284426 | 3300005578 | Bacteria | 1333 |
| 130 | Ga0068856_100014658 | 3300005614 | Bacteria | 7568 |
| 131 | Ga0068856_100105392 | 3300005614 | Bacteria | 2813 |
| 132 | Ga0068852_100001864 | 3300005616 | Bacteria | 14345 |
| 133 | Ga0068852_100016051 | 3300005616 | Bacteria | 5831 |
| 134 | Ga0068852_100026218 | 3300005616 | Bacteria | 4734 |
| 135 | Ga0068852_100032708 | 3300005616 | Bacteria | 4309 |
| 136 | Ga0068852_100039754 | 3300005616 | Bacteria | 3962 |
| 137 | Ga0068852_100089122 | 3300005616 | Bacteria | 2756 |
| 138 | Ga0068859_100167420 | 3300005617 | Bacteria | 2278 |
| 139 | Ga0068864_100025908 | 3300005618 | Bacteria | 4942 |
| 140 | Ga0068864_100112595 | 3300005618 | Bacteria | 2425 |
| 141 | Ga0068866_10005780 | 3300005718 | Bacteria | 5130 |
| 142 | Ga0068861_100253840 | 3300005719 | Bacteria | 1502 |
| 143 | Ga0068851_10039543 | 3300005834 | Bacteria | 2369 |
| 144 | Ga0068851_10044585 | 3300005834 | Bacteria | 2239 |
| 145 | Ga0068863_100025161 | 3300005841 | Bacteria | 5676 |
| 146 | Ga0068863_100038014 | 3300005841 | Bacteria | 4580 |
| 147 | Ga0068863_100058931 | 3300005841 | Bacteria | 3633 |
| 148 | Ga0068858_100001998 | 3300005842 | Bacteria | 20859 |
| 149 | Ga0068858_100039965 | 3300005842 | Bacteria | 4350 |
| 150 | Ga0068860_100006591 | 3300005843 | Bacteria | 11658 |
| 151 | Ga0068860_100007427 | 3300005843 | Bacteria | 10961 |
| 152 | Ga0068862_100025452 | 3300005844 | Bacteria | 4969 |
| 153 | Ga0070712_100474367 | 3300006175 | Bacteria | 1045 |
| 154 | Ga0075362_10011637 | 3300006177 | Bacteria | 3471 |
| 155 | Ga0097621_100161101 | 3300006237 | Bacteria | 1929 |
| 156 | Ga0097621_100247032 | 3300006237 | Bacteria | 1561 |
| 157 | Ga0097621_100366525 | 3300006237 | Bacteria | 1284 |
| 158 | Ga0097621_100518447 | 3300006237 | Bacteria | 1082 |
| 159 | Ga0068871_100028510 | 3300006358 | Bacteria | 4377 |
| 160 | Ga0068871_100043305 | 3300006358 | Bacteria | 3616 |
| 161 | Ga0068865_100018012 | 3300006881 | Bacteria | 4552 |
| 162 | Ga0097620_100167407 | 3300006931 | Bacteria | 2278 |
| 163 | Ga0079104_1000001 | 3300006946 | Bacteria | 521847 |
| 164 | Ga0079104_1003285 | 3300006946 | Bacteria | 7707 |
| 165 | Ga0099826_10000033 | 3300006948 | Bacteria | 120668 |
| 166 | Ga0105244_10001268 | 3300009036 | Bacteria | 20676 |
| 167 | Ga0105244_10002331 | 3300009036 | Bacteria | 14435 |
| 168 | Ga0105244_10042192 | 3300009036 | Bacteria | 2360 |
| 169 | Ga0105240_10001692 | 3300009093 | Bacteria | 37346 |
| 170 | Ga0105240_10025647 | 3300009093 | Bacteria | 7742 |
| 171 | Ga0105240_10396201 | 3300009093 | Bacteria | 1556 |
| 172 | Ga0105240_10404556 | 3300009093 | Bacteria | 1537 |
| 173 | Ga0111539_10053128 | 3300009094 | Bacteria | 4823 |
| 174 | Ga0111539_11099926 | 3300009094 | Bacteria | 924 |
| 175 | Ga0105245_10042161 | 3300009098 | Bacteria | 4071 |
| 176 | Ga0105243_10012713 | 3300009148 | Bacteria | 6359 |
| 177 | Ga0105243_10085443 | 3300009148 | Bacteria | 2586 |
| 178 | Ga0105243_10239384 | 3300009148 | Bacteria | 1614 |
| 179 | Ga0105243_10241511 | 3300009148 | Bacteria | 1608 |
| 180 | Ga0105242_10075246 | 3300009176 | Bacteria | 2811 |
| 181 | Ga0105248_10074587 | 3300009177 | Bacteria | 3813 |
| 182 | Ga0105248_10229035 | 3300009177 | Bacteria | 2092 |
| 183 | Ga0105248_10231964 | 3300009177 | Bacteria | 2078 |
| 184 | Ga0105248_10304816 | 3300009177 | Bacteria | 1794 |
| 185 | Ga0105237_10020036 | 3300009545 | Bacteria | 6904 |
| 186 | Ga0105238_10000255 | 3300009551 | Bacteria | 59531 |
| 187 | Ga0105238_10072050 | 3300009551 | Bacteria | 3452 |
| 188 | Ga0105238_10139346 | 3300009551 | Bacteria | 2403 |
| 189 | Ga0105238_10290698 | 3300009551 | Bacteria | 1616 |
| 190 | Ga0105238_10600016 | 3300009551 | Bacteria | 1109 |
| 191 | Ga0105249_10038942 | 3300009553 | Bacteria | 4314 |
| 192 | Ga0105249_10148454 | 3300009553 | Bacteria | 2254 |
| 193 | Ga0105239_10004709 | 3300010375 | Bacteria | 16200 |
| 194 | Ga0105239_10006370 | 3300010375 | Bacteria | 13712 |
| 195 | Ga0105239_10053867 | 3300010375 | Bacteria | 4412 |
| 196 | Ga0105239_10694149 | 3300010375 | Bacteria | 1163 |
| 197 | Ga0105246_10225218 | 3300011119 | Bacteria | 1473 |
| 198 | Ga0157373_10012943 | 3300013100 | Bacteria | 6126 |
| 199 | Ga0157373_10127244 | 3300013100 | Bacteria | 1792 |
| 200 | Ga0157373_10187374 | 3300013100 | Bacteria | 1458 |
| 201 | Ga0157371_10000003 | 3300013102 | Bacteria | 543317 |
| 202 | Ga0157369_10074822 | 3300013105 | Bacteria | 3633 |
| 203 | Ga0157374_10003229 | 3300013296 | Bacteria | 13694 |
| 204 | Ga0157374_10061688 | 3300013296 | Bacteria | 3512 |
| 205 | Ga0163162_10011979 | 3300013306 | Bacteria | 8457 |
| 206 | Ga0163162_10012367 | 3300013306 | Bacteria | 8334 |
| 207 | Ga0157372_10058889 | 3300013307 | Bacteria | 4295 |
| 208 | Ga0157375_10021719 | 3300013308 | Bacteria | 5892 |
| 209 | Ga0157375_10022979 | 3300013308 | Bacteria | 5748 |
| 210 | Ga0157375_10061463 | 3300013308 | Bacteria | 3730 |
| 211 | Ga0157375_10663720 | 3300013308 | Bacteria | 1198 |
| 212 | Ga0163163_10146227 | 3300014325 | Bacteria | 2407 |
| 213 | Ga0157380_10044658 | 3300014326 | Bacteria | 3474 |
| 214 | Ga0157380_10048785 | 3300014326 | Bacteria | 3336 |
| 215 | Ga0182008_10263676 | 3300014497 | Bacteria | 892 |
| 216 | Ga0157379_10013161 | 3300014968 | Bacteria | 7243 |
| 217 | Ga0157379_10016872 | 3300014968 | Bacteria | 6426 |
| 218 | Ga0157376_10016557 | 3300014969 | Bacteria | 5601 |
| 219 | Ga0157376_10233751 | 3300014969 | Bacteria | 1709 |
| 220 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 221 | Ga0182006_1000102 | 3300015261 | Bacteria | 94384 |
| 222 | Ga0182006_1034063 | 3300015261 | Bacteria | 2040 |
| 223 | Ga0182007_10001496 | 3300015262 | Bacteria | 12509 |
| 224 | Ga0182007_10018972 | 3300015262 | Bacteria | 2480 |
| 225 | Ga0182007_10063366 | 3300015262 | Bacteria | 1211 |
| 226 | Ga0182005_1000006 | 3300015265 | Bacteria | 515188 |
| 227 | Ga0182005_1000010 | 3300015265 | Bacteria | 434103 |
| 228 | Ga0182005_1000134 | 3300015265 | Bacteria | 53164 |
| 229 | Ga0163161_10049369 | 3300017792 | Bacteria | 3041 |
| 230 | Ga0163161_10465340 | 3300017792 | Bacteria | 1024 |
| 231 | Ga0213872_10000041 | 3300021361 | Bacteria | 118955 |
| 232 | Ga0213872_10000167 | 3300021361 | Bacteria | 59191 |
| 233 | Ga0213872_10000929 | 3300021361 | Bacteria | 20720 |
| 234 | Ga0213872_10003231 | 3300021361 | Bacteria | 9101 |
| 235 | Ga0213872_10069435 | 3300021361 | Bacteria | 1589 |
| 236 | Ga0209435_100079 | 3300025206 | Bacteria | 51612 |
| 237 | Ga0209435_100657 | 3300025206 | Bacteria | 6146 |
| 238 | Ga0209760_100848 | 3300025207 | Bacteria | 3985 |
| 239 | Ga0209436_100449 | 3300025208 | Bacteria | 18426 |
| 240 | Ga0209436_107310 | 3300025208 | Bacteria | 2322 |
| 241 | Ga0209784_100034 | 3300025224 | Bacteria | 305504 |
| 242 | Ga0209784_100035 | 3300025224 | Bacteria | 299760 |
| 243 | Ga0209566_100038 | 3300025225 | Bacteria | 305504 |
| 244 | Ga0209566_100040 | 3300025225 | Bacteria | 299760 |
| 245 | Ga0209674_100056 | 3300025226 | Bacteria | 305504 |
| 246 | Ga0209674_100057 | 3300025226 | Bacteria | 299760 |
| 247 | Ga0209672_105447 | 3300025228 | Bacteria | 2178 |
| 248 | Ga0209147_100060 | 3300025229 | Bacteria | 249588 |
| 249 | Ga0209563_100057 | 3300025230 | Bacteria | 305604 |
| 250 | Ga0209563_100059 | 3300025230 | Bacteria | 299760 |
| 251 | Ga0207427_101876 | 3300025231 | Bacteria | 6632 |
| 252 | Ga0209437_100071 | 3300025233 | Bacteria | 305604 |
| 253 | Ga0209437_100081 | 3300025233 | Bacteria | 271072 |
| 254 | Ga0209258_100141 | 3300025242 | Bacteria | 166385 |
| 255 | Ga0209258_107060 | 3300025242 | Bacteria | 1696 |
| 256 | Ga0207425_1000009 | 3300025245 | Bacteria | 593135 |
| 257 | Ga0207425_1000068 | 3300025245 | Bacteria | 124067 |
| 258 | Ga0207425_1001046 | 3300025245 | Bacteria | 12809 |
| 259 | Ga0209646_1000251 | 3300025246 | Bacteria | 53754 |
| 260 | Ga0209646_1000265 | 3300025246 | Bacteria | 50897 |
| 261 | Ga0209646_1000290 | 3300025246 | Bacteria | 42743 |
| 262 | Ga0209026_1000330 | 3300025250 | Bacteria | 47453 |
| 263 | Ga0209677_100035 | 3300025253 | Bacteria | 305504 |
| 264 | Ga0209677_100036 | 3300025253 | Bacteria | 299760 |
| 265 | Ga0209148_1001530 | 3300025254 | Bacteria | 11318 |
| 266 | Ga0209759_1000473 | 3300025256 | Bacteria | 44908 |
| 267 | Ga0209759_1000485 | 3300025256 | Bacteria | 43802 |
| 268 | Ga0209129_1000061 | 3300025258 | Bacteria | 246061 |
| 269 | Ga0209233_1000094 | 3300025261 | Bacteria | 305604 |
| 270 | Ga0209565_1000032 | 3300025263 | Bacteria | 316777 |
| 271 | Ga0209565_1001187 | 3300025263 | Bacteria | 12426 |
| 272 | Ga0209565_1005779 | 3300025263 | Bacteria | 3553 |
| 273 | Ga0209565_1006593 | 3300025263 | Bacteria | 3237 |
| 274 | Ga0209565_1007733 | 3300025263 | Bacteria | 2871 |
| 275 | Ga0209455_1000031 | 3300025272 | Bacteria | 519952 |
| 276 | Ga0209455_1000820 | 3300025272 | Bacteria | 16895 |
| 277 | Ga0209455_1003128 | 3300025272 | Bacteria | 6028 |
| 278 | Ga0209673_1000029 | 3300025273 | Bacteria | 351978 |
| 279 | Ga0209673_1004770 | 3300025273 | Bacteria | 7127 |
| 280 | Ga0209130_1000833 | 3300025284 | Bacteria | 25861 |
| 281 | Ga0209130_1001452 | 3300025284 | Bacteria | 15642 |
| 282 | Ga0209130_1002479 | 3300025284 | Bacteria | 9193 |
| 283 | Ga0209675_1000019 | 3300025291 | Bacteria | 351950 |
| 284 | Ga0209675_1001158 | 3300025291 | Bacteria | 16010 |
| 285 | Ga0209025_1001504 | 3300025294 | Bacteria | 30047 |
| 286 | Ga0209025_1020665 | 3300025294 | Bacteria | 3586 |
| 287 | Ga0209564_1000010 | 3300025295 | Bacteria | 885399 |
| 288 | Ga0209564_1000067 | 3300025295 | Bacteria | 311242 |
| 289 | Ga0209564_1000291 | 3300025295 | Bacteria | 101831 |
| 290 | Ga0209564_1000315 | 3300025295 | Bacteria | 95095 |
| 291 | Ga0209564_1001538 | 3300025295 | Bacteria | 22863 |
| 292 | Ga0209758_1000101 | 3300025297 | Bacteria | 225913 |
| 293 | Ga0209758_1001181 | 3300025297 | Bacteria | 33038 |
| 294 | Ga0209050_1000040 | 3300025298 | Bacteria | 408492 |
| 295 | Ga0209050_1000123 | 3300025298 | Bacteria | 195061 |
| 296 | Ga0209256_1000018 | 3300025299 | Bacteria | 568467 |
| 297 | Ga0209256_1000058 | 3300025299 | Bacteria | 272934 |
| 298 | Ga0209256_1001142 | 3300025299 | Bacteria | 30135 |
| 299 | Ga0209256_1002252 | 3300025299 | Bacteria | 16394 |
| 300 | Ga0209256_1002524 | 3300025299 | Bacteria | 14704 |
| 301 | Ga0209256_1008625 | 3300025299 | Bacteria | 4675 |
| 302 | Ga0207426_1002785 | 3300025302 | Bacteria | 10501 |
| 303 | Ga0209257_1000054 | 3300025304 | Bacteria | 416957 |
| 304 | Ga0209257_1022074 | 3300025304 | Bacteria | 2284 |
| 305 | Ga0207697_10197326 | 3300025315 | Bacteria | 885 |
| 306 | Ga0207655_1001917 | 3300025728 | Bacteria | 17826 |
| 307 | Ga0207655_1002585 | 3300025728 | Bacteria | 14437 |
| 308 | Ga0207655_1087104 | 3300025728 | Bacteria | 1109 |
| 309 | Ga0207682_10007962 | 3300025893 | Bacteria | 4206 |
| 310 | Ga0207682_10139083 | 3300025893 | Bacteria | 1089 |
| 311 | Ga0207642_10058223 | 3300025899 | Bacteria | 1782 |
| 312 | Ga0207688_10219599 | 3300025901 | Bacteria | 1145 |
| 313 | Ga0207680_10013820 | 3300025903 | Bacteria | 4158 |
| 314 | Ga0207645_10009451 | 3300025907 | Bacteria | 6743 |
| 315 | Ga0207645_10075307 | 3300025907 | Bacteria | 2160 |
| 316 | Ga0207645_10245722 | 3300025907 | Bacteria | 1183 |
| 317 | Ga0207643_10192237 | 3300025908 | Bacteria | 1239 |
| 318 | Ga0207643_10259738 | 3300025908 | Bacteria | 1072 |
| 319 | Ga0207705_10007914 | 3300025909 | Bacteria | 7800 |
| 320 | Ga0207705_10150054 | 3300025909 | Bacteria | 1746 |
| 321 | Ga0207705_10507884 | 3300025909 | Bacteria | 936 |
| 322 | Ga0207695_10003241 | 3300025913 | Bacteria | 23170 |
| 323 | Ga0207695_10004922 | 3300025913 | Bacteria | 18003 |
| 324 | Ga0207671_10010224 | 3300025914 | Bacteria | 7766 |
| 325 | Ga0207671_10012953 | 3300025914 | Bacteria | 6674 |
| 326 | Ga0207693_10349281 | 3300025915 | Bacteria | 1157 |
| 327 | Ga0207662_10002613 | 3300025918 | Bacteria | 9088 |
| 328 | Ga0207657_10001836 | 3300025919 | Bacteria | 22933 |
| 329 | Ga0207657_10029728 | 3300025919 | Bacteria | 4969 |
| 330 | Ga0207657_10104136 | 3300025919 | Bacteria | 2351 |
| 331 | Ga0207649_10031155 | 3300025920 | Bacteria | 3167 |
| 332 | Ga0207649_10156682 | 3300025920 | Bacteria | 1574 |
| 333 | Ga0207652_10005815 | 3300025921 | Bacteria | 10002 |
| 334 | Ga0207681_10004802 | 3300025923 | Bacteria | 8311 |
| 335 | Ga0207681_10130278 | 3300025923 | Bacteria | 1859 |
| 336 | Ga0207681_10261937 | 3300025923 | Bacteria | 1354 |
| 337 | Ga0207694_10000193 | 3300025924 | Bacteria | 61887 |
| 338 | Ga0207694_10068785 | 3300025924 | Bacteria | 2765 |
| 339 | Ga0207694_10215926 | 3300025924 | Bacteria | 1563 |
| 340 | Ga0207650_10004090 | 3300025925 | Bacteria | 9960 |
| 341 | Ga0207650_10114481 | 3300025925 | Bacteria | 2092 |
| 342 | Ga0207650_10471805 | 3300025925 | Bacteria | 1046 |
| 343 | Ga0207659_10053371 | 3300025926 | Bacteria | 2883 |
| 344 | Ga0207659_10119689 | 3300025926 | Bacteria | 2016 |
| 345 | Ga0207659_10187089 | 3300025926 | Bacteria | 1645 |
| 346 | Ga0207659_10469214 | 3300025926 | Bacteria | 1062 |
| 347 | Ga0207687_10131789 | 3300025927 | Bacteria | 1885 |
| 348 | Ga0207644_10007449 | 3300025931 | Bacteria | 7135 |
| 349 | Ga0207644_10182581 | 3300025931 | Bacteria | 1645 |
| 350 | Ga0207690_10004063 | 3300025932 | Bacteria | 8647 |
| 351 | Ga0207690_10021740 | 3300025932 | Bacteria | 3982 |
| 352 | Ga0207690_10069485 | 3300025932 | Bacteria | 2423 |
| 353 | Ga0207690_10335909 | 3300025932 | Bacteria | 1191 |
| 354 | Ga0207706_10003874 | 3300025933 | Bacteria | 14233 |
| 355 | Ga0207706_10009517 | 3300025933 | Bacteria | 8921 |
| 356 | Ga0207706_10043365 | 3300025933 | Bacteria | 3986 |
| 357 | Ga0207686_10023622 | 3300025934 | Bacteria | 3553 |
| 358 | Ga0207686_10109241 | 3300025934 | Bacteria | 1862 |
| 359 | Ga0207686_10332017 | 3300025934 | Bacteria | 1139 |
| 360 | Ga0207669_10064183 | 3300025937 | Bacteria | 2271 |
| 361 | Ga0207669_10200684 | 3300025937 | Bacteria | 1447 |
| 362 | Ga0207669_10214007 | 3300025937 | Bacteria | 1409 |
| 363 | Ga0207704_10030838 | 3300025938 | Bacteria | 3012 |
| 364 | Ga0207704_10215592 | 3300025938 | Bacteria | 1416 |
| 365 | Ga0207691_10023398 | 3300025940 | Bacteria | 5815 |
| 366 | Ga0207691_10042166 | 3300025940 | Bacteria | 4207 |
| 367 | Ga0207691_10094288 | 3300025940 | Bacteria | 2679 |
| 368 | Ga0207691_10117245 | 3300025940 | Bacteria | 2362 |
| 369 | Ga0207691_10255047 | 3300025940 | Bacteria | 1513 |
| 370 | Ga0207691_10264903 | 3300025940 | Bacteria | 1481 |
| 371 | Ga0207711_10016963 | 3300025941 | Bacteria | 6049 |
| 372 | Ga0207711_10022414 | 3300025941 | Bacteria | 5280 |
| 373 | Ga0207689_10009199 | 3300025942 | Bacteria | 8545 |
| 374 | Ga0207689_10024820 | 3300025942 | Bacteria | 5026 |
| 375 | Ga0207661_10084711 | 3300025944 | Bacteria | 2626 |
| 376 | Ga0207679_10002742 | 3300025945 | Bacteria | 10896 |
| 377 | Ga0207679_10051912 | 3300025945 | Bacteria | 3004 |
| 378 | Ga0207667_10000946 | 3300025949 | Bacteria | 37051 |
| 379 | Ga0207667_10007809 | 3300025949 | Bacteria | 12787 |
| 380 | Ga0207667_10025505 | 3300025949 | Bacteria | 6468 |
| 381 | Ga0207667_10047499 | 3300025949 | Bacteria | 4543 |
| 382 | Ga0207667_10097646 | 3300025949 | Bacteria | 3032 |
| 383 | Ga0207667_10393649 | 3300025949 | Bacteria | 1411 |
| 384 | Ga0207651_10192944 | 3300025960 | Bacteria | 1626 |
| 385 | Ga0207712_10164794 | 3300025961 | Bacteria | 1726 |
| 386 | Ga0207668_10004465 | 3300025972 | Bacteria | 8226 |
| 387 | Ga0207668_10248073 | 3300025972 | Bacteria | 1444 |
| 388 | Ga0207640_10002854 | 3300025981 | Bacteria | 9268 |
| 389 | Ga0207640_10123798 | 3300025981 | Bacteria | 1858 |
| 390 | Ga0207640_10144246 | 3300025981 | Bacteria | 1740 |
| 391 | Ga0207658_10006432 | 3300025986 | Bacteria | 8017 |
| 392 | Ga0207658_10027327 | 3300025986 | Bacteria | 4007 |
| 393 | Ga0207677_10045580 | 3300026023 | Bacteria | 2929 |
| 394 | Ga0207677_10191446 | 3300026023 | Bacteria | 1618 |
| 395 | Ga0207677_10212389 | 3300026023 | Bacteria | 1546 |
| 396 | Ga0207703_10004840 | 3300026035 | Bacteria | 10958 |
| 397 | Ga0207703_10007247 | 3300026035 | Bacteria | 8818 |
| 398 | Ga0207703_10155663 | 3300026035 | Bacteria | 1997 |
| 399 | Ga0207639_10017985 | 3300026041 | Bacteria | 5015 |
| 400 | Ga0207639_10042297 | 3300026041 | Bacteria | 3414 |
| 401 | Ga0207639_10053261 | 3300026041 | Bacteria | 3087 |
| 402 | Ga0207639_10284816 | 3300026041 | Bacteria | 1455 |
| 403 | Ga0207678_10514647 | 3300026067 | Bacteria | 1044 |
| 404 | Ga0207708_10161090 | 3300026075 | Bacteria | 1772 |
| 405 | Ga0207702_10059880 | 3300026078 | Bacteria | 3245 |
| 406 | Ga0207702_10792858 | 3300026078 | Bacteria | 936 |
| 407 | Ga0207641_10012562 | 3300026088 | Bacteria | 6942 |
| 408 | Ga0207641_10045484 | 3300026088 | Bacteria | 3696 |
| 409 | Ga0207641_10142731 | 3300026088 | Bacteria | 2162 |
| 410 | Ga0207648_10014995 | 3300026089 | Bacteria | 7139 |
| 411 | Ga0207648_10073729 | 3300026089 | Bacteria | 2975 |
| 412 | Ga0207648_10105638 | 3300026089 | Bacteria | 2470 |
| 413 | Ga0207676_10160692 | 3300026095 | Bacteria | 1946 |
| 414 | Ga0207676_10216584 | 3300026095 | Bacteria | 1702 |
| 415 | Ga0207676_10275111 | 3300026095 | Bacteria | 1526 |
| 416 | Ga0207675_100004479 | 3300026118 | Bacteria | 13502 |
| 417 | Ga0207675_100286924 | 3300026118 | Bacteria | 1600 |
| 418 | Ga0207683_10019240 | 3300026121 | Bacteria | 5830 |
| 419 | Ga0207683_10027233 | 3300026121 | Bacteria | 4939 |
| 420 | Ga0207683_10131915 | 3300026121 | Bacteria | 2248 |
| 421 | Ga0207698_10005137 | 3300026142 | Bacteria | 8045 |
| 422 | Ga0207698_10031618 | 3300026142 | Bacteria | 3823 |
| 423 | Ga0207698_10034855 | 3300026142 | Bacteria | 3675 |
| 424 | Ga0207698_10284895 | 3300026142 | Bacteria | 1530 |
| 425 | Ga0209281_1000151 | 3300027111 | Bacteria | 167268 |
| 426 | Ga0209281_1003261 | 3300027111 | Bacteria | 5506 |
| 427 | Ga0209282_1000014 | 3300027666 | Bacteria | 207318 |
| 428 | Ga0268266_10561043 | 3300028379 | Bacteria | 1095 |
| 429 | Ga0268265_10008762 | 3300028380 | Bacteria | 6835 |
| 430 | Ga0268264_10002117 | 3300028381 | Bacteria | 17697 |
| 431 | Ga0268264_10009653 | 3300028381 | Bacteria | 7994 |
| 432 | Ga0268264_10104767 | 3300028381 | Bacteria | 2466 |
| 433 | Ga0265323_10009697 | 3300028653 | Bacteria | 3923 |
| 434 | Ga0307515_10000432 | 3300028794 | Bacteria | 100348 |
| 435 | Ga0307515_10005908 | 3300028794 | Bacteria | 24693 |
| 436 | Ga0307515_10024457 | 3300028794 | Bacteria | 10523 |
| 437 | Ga0316177_1029947 | 3300030731 | Bacteria | 4994 |
| 438 | Ga0316182_1085102 | 3300030745 | Bacteria | 1099 |
| 439 | Ga0265325_10006514 | 3300031241 | Bacteria | 7081 |
| 440 | Ga0265329_10000056 | 3300031242 | Bacteria | 49127 |
| 441 | Ga0265339_10124660 | 3300031249 | Bacteria | 1321 |
| 442 | Ga0265327_10192746 | 3300031251 | Bacteria | 927 |
| 443 | Ga0265316_10000484 | 3300031344 | Bacteria | 45058 |
| 444 | Ga0265316_10023663 | 3300031344 | Bacteria | 5157 |
| 445 | Ga0265316_10100890 | 3300031344 | Bacteria | 2194 |
| 446 | Ga0307408_100002393 | 3300031548 | Bacteria | 13234 |
| 447 | Ga0307408_100030624 | 3300031548 | Bacteria | 3738 |
| 448 | Ga0307408_100235289 | 3300031548 | Bacteria | 1502 |
| 449 | Ga0307408_100424224 | 3300031548 | Bacteria | 1148 |
| 450 | Ga0265313_10006226 | 3300031595 | Bacteria | 8521 |
| 451 | Ga0265314_10005760 | 3300031711 | Bacteria | 11117 |
| 452 | Ga0265342_10000405 | 3300031712 | Bacteria | 47657 |
| 453 | Ga0265342_10001757 | 3300031712 | Bacteria | 19789 |
| 454 | Ga0316576_10014776 | 3300031727 | Bacteria | 5221 |
| 455 | Ga0316578_10000134 | 3300031728 | Bacteria | 18909 |
| 456 | Ga0307516_10000127 | 3300031730 | Bacteria | 90180 |
| 457 | Ga0307516_10003164 | 3300031730 | Bacteria | 21417 |
| 458 | Ga0307516_10013408 | 3300031730 | Bacteria | 8738 |
| 459 | Ga0307516_10157567 | 3300031730 | Bacteria | 2024 |
| 460 | Ga0307405_10039787 | 3300031731 | Bacteria | 2844 |
| 461 | Ga0307518_10067826 | 3300031838 | Bacteria | 2586 |
| 462 | Ga0307412_10138629 | 3300031911 | Bacteria | 1778 |
| 463 | Ga0307409_100025249 | 3300031995 | Bacteria | 4163 |
| 464 | Ga0307416_100032061 | 3300032002 | Bacteria | 3965 |
| 465 | Ga0307416_100142601 | 3300032002 | Bacteria | 2180 |
| 466 | Ga0307414_10013571 | 3300032004 | Bacteria | 4855 |
| 467 | Ga0307414_10044379 | 3300032004 | Bacteria | 3036 |
| 468 | Ga0307411_10061113 | 3300032005 | Bacteria | 2506 |
| 469 | Ga0307415_100020811 | 3300032126 | Bacteria | 4015 |
| 470 | Ga0316593_10023535 | 3300032168 | Bacteria | 1945 |
| 471 | Ga0316596_1015766 | 3300033541 | Bacteria | 1887 |
| 472 | Ga0373954_0002027 | 3300035118 | Bacteria | 8419 |
| 473 | Ga0373946_0066994 | 3300035171 | Bacteria | 1541 |
| 474 | Ga0373962_0031080 | 3300035242 | Bacteria | 1464 |
| 475 | Ga0316574_0012379 | 3300035398 | Bacteria | 4879 |
| 476 | Ga0373931_0054053 | 3300035691 | Bacteria | 2145 |
| 477 | Ga0373935_0085832 | 3300035692 | Bacteria | 2053 |
| 478 | Ga0373933_0182179 | 3300035724 | Bacteria | 1340 |
| 479 | Ga0373947_0223568 | 3300035725 | Bacteria | 1238 |
| 480 | Ga0373937_0045307 | 3300036401 | Bacteria | 4020 |
| 481 | Ga0373937_0218595 | 3300036401 | Bacteria | 1793 |
| 482 | Ga0316584_0021567 | 3300036712 | Bacteria | 4684 |
| 483 | Ga0316584_0135137 | 3300036712 | Bacteria | 1841 |
| 484 | Ga0373925_0119245 | 3300037068 | Bacteria | 2047 |
| 485 | Ga0395899_0000329 | 3300037312 | Bacteria | 60135 |
| 486 | Ga0395899_0000787 | 3300037312 | Bacteria | 31050 |
| 487 | Ga0395899_0019086 | 3300037312 | Bacteria | 5211 |
| 488 | Ga0395899_0138806 | 3300037312 | Bacteria | 1731 |
| 489 | Ga0395900_0012488 | 3300037418 | Bacteria | 8686 |
| 490 | Ga0395900_0099595 | 3300037418 | Bacteria | 2985 |
| 491 | Ga0395900_0376962 | 3300037418 | Bacteria | 1387 |
| 492 | Ga0395900_0378752 | 3300037418 | Bacteria | 1383 |
| 493 | Ga0395900_0812681 | 3300037418 | Bacteria | 862 |
| 494 | Ga0395898_0000283 | 3300037466 | Bacteria | 122630 |
| 495 | Ga0395898_0134878 | 3300037466 | Bacteria | 2364 |
| 496 | Ga0395898_0208690 | 3300037466 | Bacteria | 1863 |
| 497 | Ga0395905_0000703 | 3300037471 | Bacteria | 44419 |
| 498 | Ga0395905_0005750 | 3300037471 | Bacteria | 12609 |
| 499 | Ga0395905_0027360 | 3300037471 | Bacteria | 5377 |
| 500 | Ga0395905_0052947 | 3300037471 | Bacteria | 3799 |
| 501 | Ga0395905_0139583 | 3300037471 | Bacteria | 2280 |
| 502 | Ga0395905_0232058 | 3300037471 | Bacteria | 1725 |
| 503 | Ga0395901_0000881 | 3300038443 | Bacteria | 33019 |
| 504 | Ga0395901_0015819 | 3300038443 | Bacteria | 7687 |
| 505 | Ga0395901_0364545 | 3300038443 | Bacteria | 1489 |
| 506 | Ga0400485_08530 | 3300038735 | Bacteria | 9384 |
| 507 | Ga0400489_08019 | 3300039093 | Bacteria | 3322 |
| 508 | Ga0436361_0136418 | 3300039447 | Bacteria | 7819 |
| 509 | Ga0436361_0279393 | 3300039447 | Bacteria | 1911 |
| 510 | Ga0436361_0391791 | 3300039447 | Bacteria | 42494 |
| 511 | Ga0436361_0438991 | 3300039447 | Bacteria | 100787 |
| 512 | Ga0436361_0599511 | 3300039447 | Bacteria | 4326 |
| 513 | Ga0436361_0674579 | 3300039447 | Bacteria | 5395 |
| 514 | Ga0436361_1059260 | 3300039447 | Bacteria | 1308 |
| 515 | Ga0439441_052679 | 3300042001 | Bacteria | 842 |
| 516 | Ga0450904_000871 | 3300042139 | Bacteria | 4938 |
| 517 | Ga0451577_0001500 | 3300042876 | Bacteria | 30862 |
| 518 | Ga0451577_0009424 | 3300042876 | Bacteria | 9411 |
| 519 | Ga0466969_0000013 | 3300044656 | Bacteria | 111537 |
| 520 | Ga0466972_0000453 | 3300044658 | Bacteria | 21090 |
| 521 | Ga0466972_0003939 | 3300044658 | Bacteria | 7409 |
| 522 | Ga0453683_0042631 | 3300044673 | Bacteria | 2849 |
| 523 | Ga0466965_0000132 | 3300044683 | Bacteria | 21358 |
| 524 | Ga0466965_0000278 | 3300044683 | Bacteria | 16904 |
| 525 | Ga0466965_0048747 | 3300044683 | Bacteria | 2099 |
| 526 | Ga0466965_0122743 | 3300044683 | Bacteria | 1342 |
| 527 | Ga0466965_0168340 | 3300044683 | Bacteria | 1151 |
| 528 | Ga0466966_0016417 | 3300044684 | Bacteria | 4892 |
| 529 | Ga0466966_0020568 | 3300044684 | Bacteria | 4337 |
| 530 | Ga0466966_0044546 | 3300044684 | Bacteria | 2840 |
| 531 | Ga0466961_0049174 | 3300044693 | Bacteria | 2695 |
| 532 | Ga0466964_0000573 | 3300044706 | Bacteria | 11581 |
| 533 | Ga0466964_0018762 | 3300044706 | Bacteria | 2656 |
| 534 | Ga0453684_0000694 | 3300044712 | Bacteria | 119688 |
| 535 | Ga0466968_0012527 | 3300044735 | Bacteria | 3323 |
| 536 | Ga0466968_0143545 | 3300044735 | Bacteria | 1093 |
| 537 | Ga0466970_0267197 | 3300044765 | Bacteria | 960 |
| 538 | Ga0466957_0017868 | 3300044842 | Bacteria | 4160 |
| 539 | Ga0466957_0034529 | 3300044842 | Bacteria | 3034 |
| 540 | Ga0466959_0002428 | 3300045049 | Bacteria | 11908 |
| 541 | Ga0466959_0026613 | 3300045049 | Bacteria | 4287 |
| 542 | Ga0466959_0043954 | 3300045049 | Bacteria | 3291 |
| 543 | Ga0466959_0087527 | 3300045049 | Bacteria | 2240 |
| 544 | Ga0451576_0008355 | 3300045051 | Bacteria | 12162 |
| 545 | Ga0451576_0127712 | 3300045051 | Bacteria | 2649 |
| 546 | Ga0451576_0739525 | 3300045051 | Bacteria | 1033 |
| 547 | Ga0466958_0039431 | 3300045836 | Bacteria | 2838 |
| 548 | Ga0466967_0132012 | 3300045976 | Bacteria | 2319 |
| 549 | Ga0466967_0163069 | 3300045976 | Bacteria | 2093 |
| 550 | Ga0495617_000128 | 3300046452 | Bacteria | 50370 |
| 551 | Ga0495617_001419 | 3300046452 | Bacteria | 10526 |
| 552 | Ga0495617_001910 | 3300046452 | Bacteria | 8763 |
| 553 | Ga0495617_085941 | 3300046452 | Bacteria | 1028 |
| 554 | Ga0495627_000004 | 3300046453 | Bacteria | 640612 |
| 555 | Ga0495627_028838 | 3300046453 | Bacteria | 1770 |
| 556 | Ga0495592_0010789 | 3300046454 | Bacteria | 6890 |
| 557 | Ga0495603_0002466 | 3300046455 | Bacteria | 10887 |
| 558 | Ga0495590_0000014 | 3300046457 | Bacteria | 258314 |
| 559 | Ga0495590_0001614 | 3300046457 | Bacteria | 9648 |
| 560 | Ga0495590_0001672 | 3300046457 | Bacteria | 9440 |
| 561 | Ga0495590_0014643 | 3300046457 | Bacteria | 2860 |
| 562 | Ga0495590_0029243 | 3300046457 | Bacteria | 1932 |
| 563 | Ga0495629_0006457 | 3300046459 | Bacteria | 8688 |
| 564 | Ga0495629_0024599 | 3300046459 | Bacteria | 4288 |
| 565 | Ga0495638_0000064 | 3300046460 | Bacteria | 180807 |
| 566 | Ga0495638_0004227 | 3300046460 | Bacteria | 10928 |
| 567 | Ga0495638_0056035 | 3300046460 | Bacteria | 2446 |
| 568 | Ga0495638_0155969 | 3300046460 | Bacteria | 1321 |
| 569 | Ga0495651_0003413 | 3300046462 | Bacteria | 12184 |
| 570 | Ga0495653_0000056 | 3300046463 | Bacteria | 100732 |
| 571 | Ga0495653_0035719 | 3300046463 | Bacteria | 3919 |
| 572 | Ga0495653_0228620 | 3300046463 | Bacteria | 1246 |
| 573 | Ga0495650_0000062 | 3300046471 | Bacteria | 277977 |
| 574 | Ga0495650_0000283 | 3300046471 | Bacteria | 96503 |
| 575 | Ga0495650_0001144 | 3300046471 | Bacteria | 28755 |
| 576 | Ga0495650_0001153 | 3300046471 | Bacteria | 28463 |
| 577 | Ga0495650_0014839 | 3300046471 | Bacteria | 4025 |
| 578 | Ga0495650_0032504 | 3300046471 | Bacteria | 2332 |
| 579 | Ga0495650_0033108 | 3300046471 | Bacteria | 2303 |
| 580 | Ga0495580_0226975 | 3300046472 | Bacteria | 1282 |
| 581 | Ga0495582_0104406 | 3300046473 | Bacteria | 1588 |
| 582 | Ga0495605_0000127 | 3300046474 | Bacteria | 100664 |
| 583 | Ga0495605_0000225 | 3300046474 | Bacteria | 69738 |
| 584 | Ga0495605_0001850 | 3300046474 | Bacteria | 13537 |
| 585 | Ga0495605_0018816 | 3300046474 | Bacteria | 3697 |
| 586 | Ga0495605_0026919 | 3300046474 | Bacteria | 2983 |
| 587 | Ga0495605_0123489 | 3300046474 | Bacteria | 1172 |
| 588 | Ga0495605_0128194 | 3300046474 | Bacteria | 1146 |
| 589 | Ga0495584_0000040 | 3300046491 | Bacteria | 91797 |
| 590 | Ga0495584_0001407 | 3300046491 | Bacteria | 14482 |
| 591 | Ga0495584_0001529 | 3300046491 | Bacteria | 13753 |
| 592 | Ga0495584_0002355 | 3300046491 | Bacteria | 10769 |
| 593 | Ga0495584_0005114 | 3300046491 | Bacteria | 6967 |
| 594 | Ga0495584_0005804 | 3300046491 | Bacteria | 6508 |
| 595 | Ga0495584_0016289 | 3300046491 | Bacteria | 3790 |
| 596 | Ga0495584_0027869 | 3300046491 | Bacteria | 2861 |
| 597 | Ga0495584_0125292 | 3300046491 | Bacteria | 1302 |
| 598 | Ga0495585_0000230 | 3300046492 | Bacteria | 57614 |
| 599 | Ga0495585_0000566 | 3300046492 | Bacteria | 34921 |
| 600 | Ga0495585_0000776 | 3300046492 | Bacteria | 28221 |
| 601 | Ga0495585_0003019 | 3300046492 | Bacteria | 11596 |
| 602 | Ga0495585_0003507 | 3300046492 | Bacteria | 10582 |
| 603 | Ga0495585_0046525 | 3300046492 | Bacteria | 2419 |
| 604 | Ga0495585_0070037 | 3300046492 | Bacteria | 1913 |
| 605 | Ga0495585_0100033 | 3300046492 | Bacteria | 1551 |
| 606 | Ga0495585_0180470 | 3300046492 | Bacteria | 1085 |
| 607 | Ga0495594_0012651 | 3300046499 | Bacteria | 4399 |
| 608 | Ga0495594_0079993 | 3300046499 | Bacteria | 1824 |
| 609 | Ga0495596_0000671 | 3300046500 | Bacteria | 21298 |
| 610 | Ga0495596_0001532 | 3300046500 | Bacteria | 13180 |
| 611 | Ga0495596_0006464 | 3300046500 | Bacteria | 5387 |
| 612 | Ga0495596_0007938 | 3300046500 | Bacteria | 4749 |
| 613 | Ga0495607_0000853 | 3300046501 | Bacteria | 28749 |
| 614 | Ga0495607_0001656 | 3300046501 | Bacteria | 19266 |
| 615 | Ga0495607_0001772 | 3300046501 | Bacteria | 18457 |
| 616 | Ga0495607_0003675 | 3300046501 | Bacteria | 11640 |
| 617 | Ga0495607_0036798 | 3300046501 | Bacteria | 2946 |
| 618 | Ga0495607_0256282 | 3300046501 | Bacteria | 840 |
| 619 | Ga0495583_0000046 | 3300046506 | Bacteria | 218059 |
| 620 | Ga0495583_0000137 | 3300046506 | Bacteria | 123815 |
| 621 | Ga0495583_0000156 | 3300046506 | Bacteria | 114296 |
| 622 | Ga0495583_0000231 | 3300046506 | Bacteria | 93091 |
| 623 | Ga0495583_0000287 | 3300046506 | Bacteria | 80398 |
| 624 | Ga0495583_0001530 | 3300046506 | Bacteria | 22917 |
| 625 | Ga0495583_0001556 | 3300046506 | Bacteria | 22704 |
| 626 | Ga0495583_0004187 | 3300046506 | Bacteria | 10504 |
| 627 | Ga0495606_0000353 | 3300046507 | Bacteria | 78700 |
| 628 | Ga0495606_0000400 | 3300046507 | Bacteria | 73341 |
| 629 | Ga0495606_0000589 | 3300046507 | Bacteria | 57638 |
| 630 | Ga0495606_0000933 | 3300046507 | Bacteria | 43050 |
| 631 | Ga0495606_0001708 | 3300046507 | Bacteria | 28313 |
| 632 | Ga0495606_0002937 | 3300046507 | Bacteria | 18821 |
| 633 | Ga0495606_0006490 | 3300046507 | Bacteria | 10762 |
| 634 | Ga0495606_0067300 | 3300046507 | Bacteria | 2268 |
| 635 | Ga0495608_0018854 | 3300046511 | Bacteria | 4754 |
| 636 | Ga0495610_0000027 | 3300046512 | Bacteria | 275273 |
| 637 | Ga0495610_0001111 | 3300046512 | Bacteria | 24494 |
| 638 | Ga0495610_0016864 | 3300046512 | Bacteria | 4185 |
| 639 | Ga0495610_0036421 | 3300046512 | Bacteria | 2514 |
| 640 | Ga0495616_0000072 | 3300046513 | Bacteria | 87767 |
| 641 | Ga0495616_0002779 | 3300046513 | Bacteria | 11431 |
| 642 | Ga0495616_0009303 | 3300046513 | Bacteria | 5759 |
| 643 | Ga0495616_0059252 | 3300046513 | Bacteria | 1883 |
| 644 | Ga0495616_0070870 | 3300046513 | Bacteria | 1686 |
| 645 | Ga0495616_0221880 | 3300046513 | Bacteria | 822 |
| 646 | Ga0495618_0021041 | 3300046514 | Bacteria | 4019 |
| 647 | Ga0495620_0009333 | 3300046515 | Bacteria | 5223 |
| 648 | Ga0495628_0000076 | 3300046516 | Bacteria | 78344 |
| 649 | Ga0495628_0001441 | 3300046516 | Bacteria | 21826 |
| 650 | Ga0495628_0115865 | 3300046516 | Bacteria | 2058 |
| 651 | Ga0495628_0419528 | 3300046516 | Bacteria | 975 |
| 652 | Ga0495631_0000290 | 3300046518 | Bacteria | 35042 |
| 653 | Ga0495631_0001418 | 3300046518 | Bacteria | 14563 |
| 654 | Ga0495631_0015619 | 3300046518 | Bacteria | 3632 |
| 655 | Ga0495631_0038625 | 3300046518 | Bacteria | 2121 |
| 656 | Ga0495632_0000403 | 3300046519 | Bacteria | 40753 |
| 657 | Ga0495632_0004394 | 3300046519 | Bacteria | 9584 |
| 658 | Ga0495637_0000430 | 3300046520 | Bacteria | 30664 |
| 659 | Ga0495637_0009837 | 3300046520 | Bacteria | 4650 |
| 660 | Ga0495637_0010156 | 3300046520 | Bacteria | 4564 |
| 661 | Ga0495643_0000108 | 3300046522 | Bacteria | 136032 |
| 662 | Ga0495643_0000255 | 3300046522 | Bacteria | 78465 |
| 663 | Ga0495643_0000716 | 3300046522 | Bacteria | 38007 |
| 664 | Ga0495643_0001683 | 3300046522 | Bacteria | 19297 |
| 665 | Ga0495643_0020799 | 3300046522 | Bacteria | 3776 |
| 666 | Ga0495643_0049091 | 3300046522 | Bacteria | 2277 |
| 667 | Ga0495643_0067644 | 3300046522 | Bacteria | 1881 |
| 668 | Ga0495643_0131709 | 3300046522 | Bacteria | 1254 |
| 669 | Ga0495644_0005344 | 3300046523 | Bacteria | 5016 |
| 670 | Ga0495644_0020071 | 3300046523 | Bacteria | 2550 |
| 671 | Ga0495644_0026066 | 3300046523 | Bacteria | 2219 |
| 672 | Ga0495648_0000006 | 3300046524 | Bacteria | 361208 |
| 673 | Ga0495648_0000134 | 3300046524 | Bacteria | 87750 |
| 674 | Ga0495648_0000841 | 3300046524 | Bacteria | 32356 |
| 675 | Ga0495648_0002507 | 3300046524 | Bacteria | 16848 |
| 676 | Ga0495648_0014318 | 3300046524 | Bacteria | 5813 |
| 677 | Ga0495648_0023331 | 3300046524 | Bacteria | 4240 |
| 678 | Ga0495648_0035462 | 3300046524 | Bacteria | 3233 |
| 679 | Ga0495648_0045577 | 3300046524 | Bacteria | 2726 |
| 680 | Ga0495648_0076198 | 3300046524 | Bacteria | 1926 |
| 681 | Ga0495663_0003306 | 3300046525 | Bacteria | 4669 |
| 682 | Ga0495666_0009701 | 3300046526 | Bacteria | 4810 |
| 683 | Ga0495666_0015888 | 3300046526 | Bacteria | 3749 |
| 684 | Ga0495642_0000871 | 3300046528 | Bacteria | 14228 |
| 685 | Ga0495642_0002341 | 3300046528 | Bacteria | 7720 |
| 686 | Ga0495642_0002943 | 3300046528 | Bacteria | 6788 |
| 687 | Ga0495642_0003138 | 3300046528 | Bacteria | 6557 |
| 688 | Ga0495642_0004427 | 3300046528 | Bacteria | 5452 |
| 689 | Ga0495652_0005760 | 3300046529 | Bacteria | 11598 |
| 690 | Ga0495652_0140029 | 3300046529 | Bacteria | 1903 |
| 691 | Ga0495654_0000131 | 3300046530 | Bacteria | 80339 |
| 692 | Ga0495654_0007219 | 3300046530 | Bacteria | 6232 |
| 693 | Ga0495654_0024239 | 3300046530 | Bacteria | 3137 |
| 694 | Ga0495654_0033901 | 3300046530 | Bacteria | 2580 |
| 695 | Ga0495665_0065133 | 3300046531 | Bacteria | 1923 |
| 696 | Ga0495586_0025907 | 3300046535 | Bacteria | 3137 |
| 697 | Ga0495587_0083004 | 3300046536 | Bacteria | 1856 |
| 698 | Ga0495609_0000136 | 3300046538 | Bacteria | 77986 |
| 699 | Ga0495609_0001765 | 3300046538 | Bacteria | 13888 |
| 700 | Ga0495609_0006092 | 3300046538 | Bacteria | 6204 |
| 701 | Ga0495609_0026224 | 3300046538 | Bacteria | 2669 |
| 702 | Ga0495621_0109696 | 3300046539 | Bacteria | 1057 |
| 703 | Ga0495597_0000091 | 3300046542 | Bacteria | 80111 |
| 704 | Ga0495597_0000223 | 3300046542 | Bacteria | 51556 |
| 705 | Ga0495597_0000882 | 3300046542 | Bacteria | 23337 |
| 706 | Ga0495597_0000971 | 3300046542 | Bacteria | 22161 |
| 707 | Ga0495597_0001469 | 3300046542 | Bacteria | 16900 |
| 708 | Ga0495597_0007404 | 3300046542 | Bacteria | 5575 |
| 709 | Ga0495597_0034443 | 3300046542 | Bacteria | 2288 |
| 710 | Ga0495597_0052294 | 3300046542 | Bacteria | 1799 |
| 711 | Ga0495645_0016449 | 3300046543 | Bacteria | 5282 |
| 712 | Ga0495645_0055606 | 3300046543 | Bacteria | 2874 |
| 713 | Ga0495622_0000013 | 3300046557 | Bacteria | 186778 |
| 714 | Ga0495622_0005626 | 3300046557 | Bacteria | 5812 |
| 715 | Ga0495622_0115802 | 3300046557 | Bacteria | 1225 |
| 716 | Ga0495622_0224052 | 3300046557 | Bacteria | 832 |
| 717 | Ga0495633_0001545 | 3300046558 | Bacteria | 17672 |
| 718 | Ga0495633_0002191 | 3300046558 | Bacteria | 13994 |
| 719 | Ga0495633_0002981 | 3300046558 | Bacteria | 11576 |
| 720 | Ga0495633_0003195 | 3300046558 | Bacteria | 11064 |
| 721 | Ga0495633_0015631 | 3300046558 | Bacteria | 3934 |
| 722 | Ga0495633_0148610 | 3300046558 | Bacteria | 1082 |
| 723 | Ga0495633_0168873 | 3300046558 | Bacteria | 1008 |
| 724 | Ga0495656_0000675 | 3300046615 | Bacteria | 10967 |
| 725 | Ga0495656_0037159 | 3300046615 | Bacteria | 2009 |
| 726 | Ga0495668_0000029 | 3300046616 | Bacteria | 279128 |
| 727 | Ga0495668_0000119 | 3300046616 | Bacteria | 118812 |
| 728 | Ga0495668_0000209 | 3300046616 | Bacteria | 84817 |
| 729 | Ga0495668_0000359 | 3300046616 | Bacteria | 60366 |
| 730 | Ga0495668_0003302 | 3300046616 | Bacteria | 12217 |
| 731 | Ga0495668_0022417 | 3300046616 | Bacteria | 3609 |
| 732 | Ga0495668_0086796 | 3300046616 | Bacteria | 1716 |
| 733 | Ga0495611_0015040 | 3300046648 | Bacteria | 3307 |
| 734 | Ga0495611_0018009 | 3300046648 | Bacteria | 3026 |
| 735 | Ga0495625_0000871 | 3300046660 | Bacteria | 41066 |
| 736 | Ga0495625_0001309 | 3300046660 | Bacteria | 31061 |
| 737 | Ga0495625_0001595 | 3300046660 | Bacteria | 26843 |
| 738 | Ga0495625_0007432 | 3300046660 | Bacteria | 9533 |
| 739 | Ga0495625_0007978 | 3300046660 | Bacteria | 9097 |
| 740 | Ga0495625_0010041 | 3300046660 | Bacteria | 7868 |
| 741 | Ga0495625_0011228 | 3300046660 | Bacteria | 7324 |
| 742 | Ga0495625_0015358 | 3300046660 | Bacteria | 6067 |
| 743 | Ga0495659_0001898 | 3300046664 | Bacteria | 6884 |
| 744 | Ga0495659_0002191 | 3300046664 | Bacteria | 6372 |
| 745 | Ga0495659_0044416 | 3300046664 | Bacteria | 1598 |
| 746 | Ga0495661_0000979 | 3300046665 | Bacteria | 25811 |
| 747 | Ga0495661_0007457 | 3300046665 | Bacteria | 7631 |
| 748 | Ga0495661_0013316 | 3300046665 | Bacteria | 5529 |
| 749 | Ga0495661_0021185 | 3300046665 | Bacteria | 4239 |
| 750 | Ga0495661_0027022 | 3300046665 | Bacteria | 3688 |
| 751 | Ga0495661_0055997 | 3300046665 | Bacteria | 2361 |
| 752 | Ga0495588_0000091 | 3300046674 | Bacteria | 183183 |
| 753 | Ga0495588_0077315 | 3300046674 | Bacteria | 1735 |
| 754 | Ga0495657_0041222 | 3300046675 | Bacteria | 3162 |
| 755 | Ga0495657_0277382 | 3300046675 | Bacteria | 1004 |
| 756 | Ga0495599_0003657 | 3300046678 | Bacteria | 9015 |
| 757 | Ga0495599_0071047 | 3300046678 | Bacteria | 2173 |
| 758 | Ga0495623_0000743 | 3300046679 | Bacteria | 21830 |
| 759 | Ga0495646_0005231 | 3300046680 | Bacteria | 8180 |
| 760 | Ga0495646_0161407 | 3300046680 | Bacteria | 1240 |
| 761 | Ga0495658_0009494 | 3300046683 | Bacteria | 4851 |
| 762 | Ga0495658_0073811 | 3300046683 | Bacteria | 1987 |
| 763 | Ga0495669_0000021 | 3300046684 | Bacteria | 121650 |
| 764 | Ga0495669_0001117 | 3300046684 | Bacteria | 11129 |
| 765 | Ga0495613_0117767 | 3300046689 | Bacteria | 1910 |
| 766 | Ga0495624_0036851 | 3300046690 | Bacteria | 3150 |
| 767 | Ga0495624_0062485 | 3300046690 | Bacteria | 2329 |
| 768 | Ga0495670_0016780 | 3300046691 | Bacteria | 3600 |
| 769 | Ga0495670_0035008 | 3300046691 | Bacteria | 2502 |
| 770 | Ga0495670_0063015 | 3300046691 | Bacteria | 1866 |
| 771 | Ga0495670_0064268 | 3300046691 | Bacteria | 1848 |
| 772 | Ga0495670_0074575 | 3300046691 | Bacteria | 1721 |
| 773 | Ga0495671_0000106 | 3300046692 | Bacteria | 74947 |
| 774 | Ga0495671_0002593 | 3300046692 | Bacteria | 11369 |
| 775 | Ga0495671_0022032 | 3300046692 | Bacteria | 3341 |
| 776 | Ga0495671_0051785 | 3300046692 | Bacteria | 2041 |
| 777 | Ga0495671_0111413 | 3300046692 | Bacteria | 1336 |
| 778 | Ga0495649_0000549 | 3300046694 | Bacteria | 31847 |
| 779 | Ga0495649_0000709 | 3300046694 | Bacteria | 27174 |
| 780 | Ga0495649_0014906 | 3300046694 | Bacteria | 4442 |
| 781 | Ga0495649_0015177 | 3300046694 | Bacteria | 4385 |
| 782 | Ga0495589_0000269 | 3300046794 | Bacteria | 42228 |
| 783 | Ga0495600_0000340 | 3300046809 | Bacteria | 24902 |
| 784 | Ga0495660_0000823 | 3300046810 | Bacteria | 23073 |
| 785 | Ga0495660_0001854 | 3300046810 | Bacteria | 13878 |
| 786 | Ga0495660_0015627 | 3300046810 | Bacteria | 4386 |
| 787 | Ga0495660_0016122 | 3300046810 | Bacteria | 4310 |
| 788 | Ga0495660_0047240 | 3300046810 | Bacteria | 2358 |
| 789 | Ga0495660_0073796 | 3300046810 | Bacteria | 1803 |
| 790 | Ga0495660_0086344 | 3300046810 | Bacteria | 1637 |
| 791 | Ga0495581_0175579 | 3300047315 | Bacteria | 1252 |
| 792 | Ga0495604_0085636 | 3300047317 | Bacteria | 2351 |
| 793 | Ga0495604_0227925 | 3300047317 | Bacteria | 1279 |
| 794 | Ga0495636_0000933 | 3300047318 | Bacteria | 10904 |
| 795 | Ga0495636_0002175 | 3300047318 | Bacteria | 7515 |
| 796 | Ga0495636_0006937 | 3300047318 | Bacteria | 4455 |
| 797 | Ga0495636_0053940 | 3300047318 | Bacteria | 1688 |
| 798 | Ga0495636_0122325 | 3300047318 | Bacteria | 1152 |
| 799 | Ga0495674_0032572 | 3300047319 | Bacteria | 4727 |
| 800 | Ga0495672_0000088 | 3300047320 | Bacteria | 153860 |
| 801 | Ga0495672_0001122 | 3300047320 | Bacteria | 27137 |
| 802 | Ga0495676_0028858 | 3300047321 | Bacteria | 4732 |
| 803 | Ga0495676_0094213 | 3300047321 | Bacteria | 2231 |
| 804 | Ga0495680_0054419 | 3300047322 | Bacteria | 3108 |
| 805 | Ga0495680_0183159 | 3300047322 | Bacteria | 1510 |
| 806 | Ga0495683_0000125 | 3300047323 | Bacteria | 76538 |
| 807 | Ga0495683_0000892 | 3300047323 | Bacteria | 21047 |
| 808 | Ga0495683_0018689 | 3300047323 | Bacteria | 3581 |
| 809 | Ga0495687_000042 | 3300047443 | Bacteria | 218868 |
| 810 | Ga0495687_000115 | 3300047443 | Bacteria | 122883 |
| 811 | Ga0495687_001828 | 3300047443 | Bacteria | 18701 |
| 812 | Ga0495687_003232 | 3300047443 | Bacteria | 12032 |
| 813 | Ga0495687_003687 | 3300047443 | Bacteria | 10903 |
| 814 | Ga0495687_009013 | 3300047443 | Bacteria | 5634 |
| 815 | Ga0495687_011544 | 3300047443 | Bacteria | 4741 |
| 816 | Ga0495675_0008756 | 3300047444 | Bacteria | 6282 |
| 817 | Ga0495677_0000156 | 3300047445 | Bacteria | 32695 |
| 818 | Ga0495677_0006078 | 3300047445 | Bacteria | 4563 |
| 819 | Ga0495677_0019510 | 3300047445 | Bacteria | 2458 |
| 820 | Ga0495677_0102268 | 3300047445 | Bacteria | 1085 |
| 821 | Ga0495685_000523 | 3300047447 | Bacteria | 11867 |
| 822 | Ga0495685_001719 | 3300047447 | Bacteria | 6743 |
| 823 | Ga0495685_006046 | 3300047447 | Bacteria | 3956 |
| 824 | Ga0495673_0000008 | 3300047469 | Bacteria | 752462 |
| 825 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 826 | Ga0495673_0000185 | 3300047469 | Bacteria | 100703 |
| 827 | Ga0495673_0007424 | 3300047469 | Bacteria | 6304 |
| 828 | Ga0495681_0000278 | 3300047470 | Bacteria | 40906 |
| 829 | Ga0495681_0000951 | 3300047470 | Bacteria | 22261 |
| 830 | Ga0495681_0001142 | 3300047470 | Bacteria | 20166 |
| 831 | Ga0495681_0010879 | 3300047470 | Bacteria | 5471 |
| 832 | Ga0495684_0058149 | 3300047471 | Bacteria | 2946 |
| 833 | Ga0495686_0000212 | 3300047472 | Bacteria | 107418 |
| 834 | Ga0495686_0001207 | 3300047472 | Bacteria | 29745 |
| 835 | Ga0495686_0003602 | 3300047472 | Bacteria | 13287 |
| 836 | Ga0495686_0004528 | 3300047472 | Bacteria | 11390 |
| 837 | Ga0495686_0011929 | 3300047472 | Bacteria | 6105 |
| 838 | Ga0495686_0019954 | 3300047472 | Bacteria | 4473 |
| 839 | Ga0495686_0115612 | 3300047472 | Bacteria | 1604 |
| 840 | Ga0495686_0147370 | 3300047472 | Bacteria | 1384 |
| 841 | Ga0495593_0001579 | 3300047673 | Bacteria | 13434 |
| 842 | Ga0495593_0009011 | 3300047673 | Bacteria | 5791 |
| 843 | Ga0495602_0059604 | 3300048088 | Bacteria | 3331 |
| 844 | Ga0495602_0168608 | 3300048088 | Bacteria | 1701 |
| 845 | Ga0495626_0000043 | 3300048091 | Bacteria | 168109 |
| 846 | Ga0495626_0000091 | 3300048091 | Bacteria | 118146 |
| 847 | Ga0495626_0000667 | 3300048091 | Bacteria | 33004 |
| 848 | Ga0495626_0001829 | 3300048091 | Bacteria | 15989 |
| 849 | Ga0495626_0004783 | 3300048091 | Bacteria | 8170 |
| 850 | Ga0495626_0008166 | 3300048091 | Bacteria | 5767 |
| 851 | Ga0495626_0024848 | 3300048091 | Bacteria | 2933 |
| 852 | Ga0495626_0084997 | 3300048091 | Bacteria | 1400 |
| 853 | Ga0496101_0136173 | 3300048904 | Bacteria | 1869 |
| 854 | Ga0496102_0001181 | 3300048905 | Bacteria | 23797 |
| 855 | Ga0496102_0370989 | 3300048905 | Bacteria | 1347 |
| 856 | Ga0496103_0010503 | 3300048906 | Bacteria | 5480 |
| 857 | Ga0496103_0212373 | 3300048906 | Bacteria | 1244 |
| 858 | Ga0496104_0039773 | 3300048907 | Bacteria | 4404 |
| 859 | Ga0496104_0040104 | 3300048907 | Bacteria | 4388 |
| 860 | Ga0496105_0037751 | 3300048908 | Bacteria | 3978 |
| 861 | Ga0496106_0190134 | 3300048909 | Bacteria | 1632 |
| 862 | Ga0496107_0086074 | 3300048910 | Bacteria | 2294 |
| 863 | Ga0496107_0113128 | 3300048910 | Bacteria | 1996 |
| 864 | Ga0496108_0056737 | 3300048911 | Bacteria | 3291 |
| 865 | Ga0496108_0407208 | 3300048911 | Bacteria | 1188 |
| 866 | Ga0496109_0082777 | 3300048912 | Bacteria | 2958 |
| 867 | Ga0496110_0021592 | 3300048913 | Bacteria | 5454 |
| 868 | Ga0496110_0085888 | 3300048913 | Bacteria | 2809 |
| 869 | Ga0496110_0706778 | 3300048913 | Bacteria | 910 |
| 870 | Ga0496111_0003127 | 3300048914 | Bacteria | 10186 |
| 871 | Ga0496111_0503122 | 3300048914 | Bacteria | 892 |
| 872 | Ga0496112_0116693 | 3300048915 | Bacteria | 2640 |
| 873 | Ga0496114_0005135 | 3300048917 | Bacteria | 10210 |
| 874 | Ga0496114_0101555 | 3300048917 | Bacteria | 2456 |
| 875 | Ga0496115_0068854 | 3300048918 | Bacteria | 2866 |
| 876 | Ga0496115_0213154 | 3300048918 | Bacteria | 1595 |
| 877 | Ga0496116_0024641 | 3300048919 | Bacteria | 4444 |
| 878 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 879 | Ga0496117_0016121 | 3300048920 | Bacteria | 6323 |
| 880 | Ga0496118_0000022 | 3300048921 | Bacteria | 438602 |
| 881 | Ga0496118_0014998 | 3300048921 | Bacteria | 7207 |
| 882 | Ga0496121_0009122 | 3300048924 | Bacteria | 11480 |
| 883 | Ga0496121_0102810 | 3300048924 | Bacteria | 2200 |
| 884 | Ga0496122_0000968 | 3300048925 | Bacteria | 51537 |
| 885 | Ga0496122_0006223 | 3300048925 | Bacteria | 13823 |
| 886 | Ga0496122_0009051 | 3300048925 | Bacteria | 10568 |
| 887 | Ga0496122_0012265 | 3300048925 | Bacteria | 8565 |
| 888 | Ga0496122_0267623 | 3300048925 | Bacteria | 944 |
| 889 | Ga0496123_0000983 | 3300048926 | Bacteria | 44022 |
| 890 | Ga0496123_0002475 | 3300048926 | Bacteria | 22799 |
| 891 | Ga0496123_0012980 | 3300048926 | Bacteria | 7039 |
| 892 | Ga0496123_0048162 | 3300048926 | Bacteria | 2870 |
| 893 | Ga0496124_0001001 | 3300048927 | Bacteria | 44775 |
| 894 | Ga0496124_0036741 | 3300048927 | Bacteria | 4268 |
| 895 | Ga0496124_0081285 | 3300048927 | Bacteria | 2664 |
| 896 | Ga0496124_0169625 | 3300048927 | Bacteria | 1692 |
| 897 | Ga0496125_0001086 | 3300048928 | Bacteria | 41927 |
| 898 | Ga0496125_0003905 | 3300048928 | Bacteria | 17598 |
| 899 | Ga0496125_0007199 | 3300048928 | Bacteria | 11860 |
| 900 | Ga0496125_0018481 | 3300048928 | Bacteria | 6620 |
| 901 | Ga0496125_0075761 | 3300048928 | Bacteria | 2601 |
| 902 | Ga0496126_0006515 | 3300048929 | Bacteria | 12994 |
| 903 | Ga0496126_0075641 | 3300048929 | Bacteria | 2988 |
| 904 | Ga0495678_000149 | 3300049459 | Bacteria | 84717 |
| 905 | Ga0495678_000259 | 3300049459 | Bacteria | 59034 |
| 906 | Ga0495678_000652 | 3300049459 | Bacteria | 31953 |
| 907 | Ga0495678_005168 | 3300049459 | Bacteria | 7312 |
| 908 | Ga0495682_0000585 | 3300049460 | Bacteria | 24747 |
| 909 | Ga0495682_0000819 | 3300049460 | Bacteria | 19524 |
| 910 | Ga0495682_0002024 | 3300049460 | Bacteria | 9991 |
| 911 | Ga0495682_0009318 | 3300049460 | Bacteria | 3834 |
| 912 | Ga0501316_007077 | 3300049532 | Bacteria | 1210 |
| 913 | Ga0501031_0275151 | 3300049568 | Bacteria | 1093 |
| 914 | Ga0501032_0185265 | 3300049569 | Bacteria | 1362 |
| 915 | Ga0501033_0001795 | 3300049570 | Bacteria | 18727 |
| 916 | Ga0501036_0136855 | 3300049572 | Bacteria | 2067 |
| 917 | Ga0501038_0637578 | 3300049574 | Bacteria | 803 |
| 918 | Ga0501039_0157376 | 3300049575 | Bacteria | 1785 |
| 919 | Ga0501039_0194198 | 3300049575 | Bacteria | 1596 |
| 920 | Ga0501040_0007105 | 3300049576 | Bacteria | 7253 |
| 921 | Ga0501043_0322791 | 3300049579 | Bacteria | 1177 |
| 922 | Ga0501047_0003401 | 3300049581 | Bacteria | 15066 |
| 923 | Ga0501048_0007051 | 3300049582 | Bacteria | 8537 |
| 924 | Ga0501048_0254721 | 3300049582 | Bacteria | 1247 |
| 925 | Ga0501067_0276512 | 3300049583 | Bacteria | 935 |
| 926 | Ga0501069_0043257 | 3300049585 | Bacteria | 2492 |
| 927 | Ga0501070_0006609 | 3300049586 | Bacteria | 9867 |
| 928 | Ga0501070_0010057 | 3300049586 | Bacteria | 8002 |
| 929 | Ga0501070_0104394 | 3300049586 | Bacteria | 2343 |
| 930 | Ga0501072_0002698 | 3300049588 | Bacteria | 13315 |
| 931 | Ga0501074_0001841 | 3300049590 | Bacteria | 14534 |
| 932 | Ga0501075_0004622 | 3300049591 | Bacteria | 9342 |
| 933 | Ga0501076_0000088 | 3300049592 | Bacteria | 48517 |
| 934 | Ga0501077_0040395 | 3300049593 | Bacteria | 2972 |
| 935 | Ga0501230_000829 | 3300049667 | Bacteria | 3417 |
| 936 | Ga0501238_005139 | 3300049671 | Bacteria | 1651 |
| 937 | Ga0501079_0001059 | 3300049741 | Bacteria | 19101 |
| 938 | Ga0501080_0474110 | 3300049742 | Bacteria | 1120 |
| 939 | Ga0501081_0010465 | 3300049743 | Bacteria | 6052 |
| 940 | Ga0501269_000164 | 3300049766 | Bacteria | 20408 |
| 941 | Ga0501279_002426 | 3300049775 | Bacteria | 2447 |
| 942 | Ga0501035_0001552 | 3300049822 | Bacteria | 23412 |
| 943 | Ga0501035_0054021 | 3300049822 | Bacteria | 3590 |
| 944 | Ga0501035_0514817 | 3300049822 | Bacteria | 983 |
| 945 | Ga0501044_0000185 | 3300049823 | Bacteria | 77663 |
| 946 | Ga0501044_0001443 | 3300049823 | Bacteria | 27936 |
| 947 | Ga0501044_0275538 | 3300049823 | Bacteria | 1617 |
| 948 | Ga0501045_0004039 | 3300049824 | Bacteria | 10117 |
| 949 | nmdc:mga00v17_126051_c1 | 3300050491 | Bacteria | 1634 |
| 950 | nmdc:mga0n895_378667_c1 | 3300050512 | Bacteria | 1432 |
| 951 | Ga0495601_0002072 | 3300053077 | Bacteria | 11252 |
| 952 | Ga0495619_0128040 | 3300053085 | Bacteria | 1744 |
| 953 | Ga0500595_016546 | 3300053119 | Bacteria | 2744 |
| 954 | Ga0500607_058486 | 3300053121 | Unclassified | 2028 |
| 955 | Ga0500618_000557 | 3300053125 | Bacteria | 23163 |
| 956 | Ga0500618_003629 | 3300053125 | Bacteria | 5224 |
| 957 | Ga0500559_0014184 | 3300053136 | Bacteria | 3368 |
| 958 | Ga0500574_002040 | 3300053141 | Bacteria | 3212 |
| 959 | Ga0500586_000137 | 3300053145 | Bacteria | 13327 |
| 960 | Ga0500619_000170 | 3300053154 | Bacteria | 15695 |
| 961 | Ga0500619_000263 | 3300053154 | Bacteria | 11028 |
| 962 | Ga0587082_036398 | 3300059504 | Bacteria | 883 |
| 963 | Ga0587083_0002118 | 3300059505 | Bacteria | 2408 |
| 964 | Ga0587072_011698 | 3300059643 | Bacteria | 1439 |
| 965 | Ga0501082_0011645 | 3300060353 | Bacteria | 7561 |
| 966 | Ga0530510_0001266 | 3300061734 | Bacteria | 16876 |
| 967 | 2511247489 | 2511231003 | Bacteria | 5606035 |
| 968 | 2511384300 | 2511231026 | Bacteria | 5225445 |
| 969 | 2521560911 | 2521172590 | Bacteria | 5047645 |
| 970 | 2550696641 | 2548876994 | Bacteria | 4904866 |
| 971 | 2553007620 | 2551306416 | Bacteria | 6152985 |
| 972 | 2578338350 | 2576861424 | Bacteria | 5270569 |
| 973 | 2601671231 | 2600255292 | Bacteria | 6300551 |
| 974 | 2643792722 | 2643221554 | Bacteria | 6603920 |
| 975 | 2644028145 | 2643221603 | Bacteria | 6147767 |
| 976 | 2644212842 | 2643221638 | Bacteria | 6579467 |
| 977 | 2644254894 | 2643221645 | Bacteria | 7207331 |
| 978 | 2644359320 | 2643221664 | Bacteria | 7272945 |
| 979 | 2738738255 | 2738541280 | Bacteria | 6630198 |
| 980 | 2738826610 | 2738541297 | Bacteria | 6549566 |
| 981 | 2738842938 | 2738541300 | Bacteria | 6675882 |
| 982 | 2739150407 | 2738541357 | Bacteria | 6549408 |
| 983 | 2739192326 | 2738543003 | Bacteria | 6549560 |
| 984 | 2739273686 | 2738543018 | Bacteria | 6718814 |
| 985 | 2739318803 | 2738543026 | Bacteria | 6549408 |
| 986 | 2739337044 | 2738543029 | Bacteria | 6549249 |
| 987 | 2739342730 | 2738543030 | Bacteria | 6719714 |
| 988 | 2765567347 | 2765235838 | Bacteria | 5445269 |
| 989 | 2808984255 | 2808606386 | Bacteria | 4471946 |
| 990 | 2809132059 | 2808606415 | Bacteria | 4576710 |
| 991 | 2809151682 | 2808606419 | Bacteria | 4576925 |
| 992 | 2819542297 | 2818991436 | Bacteria | 5376622 |
| 993 | 2819594315 | 2818991445 | Bacteria | 4955017 |
| 994 | 2819618781 | 2818991449 | Bacteria | 5518009 |
| 995 | 2821135322 | 2821131069 | Bacteria | 6108407 |
| 996 | 2839095431 | 2839094727 | Bacteria | 5534556 |
| 997 | 2842717386 | 2842711865 | Bacteria | 7155354 |
| 998 | 2852622858 | 2852618963 | Bacteria | 4577824 |
| 999 | 2857548925 | 2857547612 | Bacteria | 6179999 |
| 1000 | 2857556433 | 2857553236 | Bacteria | 6166726 |
| 1001 | 2857562167 | 2857558681 | Bacteria | 6617694 |
| 1002 | 2857567839 | 2857564685 | Bacteria | 6290584 |
| 1003 | 2884811650 | 2884811622 | Bacteria | 5552861 |
| 1004 | 2884840708 | 2884836552 | Bacteria | 5219991 |
| 1005 | 2884857696 | 2884852848 | Bacteria | 5221161 |
| 1006 | 2885080990 | 2885080285 | Bacteria | 6355622 |
| 1007 | 2889418852 | 2889415604 | Bacteria | 8048700 |
| 1008 | 2896158636 | 2896154374 | Bacteria | 5221518 |
| 1009 | 2904427915 | 2904424332 | Bacteria | 7633521 |
| 1010 | 2904442466 | 2904439833 | Bacteria | 5931679 |
| 1011 | 2904533733 | 2904530477 | Bacteria | 5876334 |
| 1012 | 2904589430 | 2904584206 | Bacteria | 6028872 |
| 1013 | 2904595133 | 2904589729 | Bacteria | 6113573 |
| 1014 | 2904602365 | 2904601388 | Bacteria | 5884906 |
| 1015 | 2919050713 | 2919046199 | Bacteria | 5567169 |
| 1016 | 2919084908 | 2919079590 | Bacteria | 5946433 |
| 1017 | 2919441091 | 2919437846 | Bacteria | 6199444 |
| 1018 | 2919476797 | 2919476304 | Bacteria | 5888696 |
| 1019 | 2923514751 | 2923510766 | Bacteria | 5926163 |
| 1020 | 2928135647 | 2928130867 | Bacteria | 5467269 |
| 1021 | 2932415379 | 2932410948 | Bacteria | 6312192 |
| 1022 | 2932421460 | 2932416698 | Bacteria | 6315112 |
| 1023 | 8048747327 | 8048746797 | Bacteria | 3557226 |
| 1024 | Ga0496102_0255934 | |||
| 1025 | SwRhRL2b_contig_1435602 | |||
| 1026 | JGI24737J22298_10007165 | |||
| 1027 | JGI25155J39150_1000170 | |||
| 1028 | JGI25155J39150_1000681 | |||
| 1029 | JGI25156J39149_1000293 | |||
| 1030 | JGI25162J39368_1000148 | |||
| 1031 | JGI25154J39366_1000260 | |||
| 1032 | JGI25154J39366_1000267 | |||
| 1033 | JGI25154J39366_1001696 | |||
| 1034 | JGI25158J39367_1003777 | |||
| 1035 | JGI25157J39369_1000327 | |||
| 1036 | JGI25152J39213_1012831 | |||
| 1037 | JGI25150J39212_1001790 | |||
| 1038 | JGI25150J39212_1003475 | |||
| 1039 | JGI25159J45721_1012602 | |||
| 1040 | JGI25159J45721_1014381 | |||
| 1041 | JGI25165J46597_1000030 | |||
| 1042 | JGI25153J46596_10000527 | |||
| 1043 | rootL2_10059351 | |||
| 1044 | rootL2_10082641 | |||
| 1045 | JGI25160J50197_1024978 | |||
| 1046 | JGI25161J50226_1005964 | |||
| 1047 | Ga0007409J51694_1018111 | |||
| 1048 | Ga0055538_1000017 | |||
| 1049 | Ga0055538_1000138 | |||
| 1050 | Ga0055539_1000022 | |||
| 1051 | Ga0055539_1000187 | |||
| 1052 | Ga0055533_1000030 | |||
| 1053 | Ga0055533_1000189 | |||
| 1054 | Ga0055532_1000184 | |||
| 1055 | Ga0055525_1000034 | |||
| 1056 | Ga0055525_1000254 | |||
| 1057 | Ga0055535_1013432 | |||
| 1058 | Ga0055529_1000097 | |||
| 1059 | Ga0055529_1001308 | |||
| 1060 | Ga0055526_1000030 | |||
| 1061 | Ga0055526_1000167 | |||
| 1062 | Ga0055526_1000696 | |||
| 1063 | Ga0055526_1001016 | |||
| 1064 | Ga0055526_1021142 | |||
| 1065 | Ga0055537_1000114 | |||
| 1066 | Ga0055534_1000398 | |||
| 1067 | Ga0055534_1001436 | |||
| 1068 | Ga0055528_1000683 | |||
| 1069 | Ga0055528_1001913 | |||
| 1070 | Ga0055530_10010680 | |||
| 1071 | Ga0055531_10018382 | |||
| 1072 | Ga0055541_1000015 | |||
| 1073 | Ga0055541_1000122 | |||
| 1074 | Ga0055543_1008303 | |||
| 1075 | Ga0065165_1000161 | |||
| 1076 | Ga0065165_1060300 | |||
| 1077 | Ga0065714_10108397 | |||
| 1078 | Ga0065704_10077125 | |||
| 1079 | Ga0065704_10175861 | |||
| 1080 | Ga0070658_10007092 | |||
| 1081 | Ga0070658_10026431 | |||
| 1082 | Ga0070658_10140070 | |||
| 1083 | Ga0070676_10004199 | |||
| 1084 | Ga0070676_10074245 | |||
| 1085 | Ga0070676_10449498 | |||
| 1086 | Ga0070683_100181374 | |||
| 1087 | Ga0070670_100016771 | |||
| 1088 | Ga0070670_100202220 | |||
| 1089 | Ga0068869_100132290 | |||
| 1090 | Ga0070666_10074780 | |||
| 1091 | Ga0070680_100009867 | |||
| 1092 | Ga0070682_100012497 | |||
| 1093 | Ga0068868_100039188 | |||
| 1094 | Ga0068868_100054684 | |||
| 1095 | Ga0070660_100003375 | |||
| 1096 | Ga0070660_100267634 | |||
| 1097 | Ga0070660_100321858 | |||
| 1098 | Ga0070687_100102571 | |||
| 1099 | Ga0070661_100009715 | |||
| 1100 | Ga0070668_100059566 | |||
| 1101 | Ga0070668_100144430 | |||
| 1102 | Ga0070668_100574234 | |||
| 1103 | Ga0070669_100050314 | |||
| 1104 | Ga0070669_100379589 | |||
| 1105 | Ga0070675_100016252 | |||
| 1106 | Ga0070675_100035845 | |||
| 1107 | Ga0070675_100657543 | |||
| 1108 | Ga0070671_100013439 | |||
| 1109 | Ga0070671_100494674 | |||
| 1110 | Ga0070674_100007074 | |||
| 1111 | Ga0070673_100072473 | |||
| 1112 | Ga0070673_100373610 | |||
| 1113 | Ga0070673_100572690 | |||
| 1114 | Ga0070659_100005084 | |||
| 1115 | Ga0070659_100025581 | |||
| 1116 | Ga0070659_100047684 | |||
| 1117 | Ga0070667_100031274 | |||
| 1118 | Ga0070667_100051141 | |||
| 1119 | Ga0070700_100253903 | |||
| 1120 | Ga0070694_100152490 | |||
| 1121 | Ga0070663_100056072 | |||
| 1122 | Ga0070678_100113817 | |||
| 1123 | Ga0070662_100004735 | |||
| 1124 | Ga0070662_100020288 | |||
| 1125 | Ga0070662_100071262 | |||
| 1126 | Ga0070662_100114298 | |||
| 1127 | Ga0070681_10141338 | |||
| 1128 | Ga0068867_100003983 | |||
| 1129 | Ga0068867_100068393 | |||
| 1130 | Ga0068867_100154219 | |||
| 1131 | Ga0070698_100040134 | |||
| 1132 | Ga0070679_100001135 | |||
| 1133 | Ga0070684_100055097 | |||
| 1134 | Ga0070697_100609112 | |||
| 1135 | Ga0068853_100081877 | |||
| 1136 | Ga0068853_100136891 | |||
| 1137 | Ga0068853_100370259 | |||
| 1138 | Ga0070672_100003086 | |||
| 1139 | Ga0070672_100006477 | |||
| 1140 | Ga0070672_100020307 | |||
| 1141 | Ga0070693_100003885 | |||
| 1142 | Ga0070704_100019965 | |||
| 1143 | Ga0068855_100016431 | |||
| 1144 | Ga0068855_100155206 | |||
| 1145 | Ga0068855_100468323 | |||
| 1146 | Ga0068855_100817558 | |||
| 1147 | Ga0070664_100011679 | |||
| 1148 | Ga0070664_100058114 | |||
| 1149 | Ga0068857_100171310 | |||
| 1150 | Ga0068854_100005545 | |||
| 1151 | Ga0068854_100006914 | |||
| 1152 | Ga0068854_100284426 | |||
| 1153 | Ga0068856_100014658 | |||
| 1154 | Ga0068856_100105392 | |||
| 1155 | Ga0068852_100001864 | |||
| 1156 | Ga0068852_100016051 | |||
| 1157 | Ga0068852_100026218 | |||
| 1158 | Ga0068852_100032708 | |||
| 1159 | Ga0068852_100039754 | |||
| 1160 | Ga0068852_100089122 | |||
| 1161 | Ga0068859_100167420 | |||
| 1162 | Ga0068864_100025908 | |||
| 1163 | Ga0068864_100112595 | |||
| 1164 | Ga0068866_10005780 | |||
| 1165 | Ga0068861_100253840 | |||
| 1166 | Ga0068851_10039543 | |||
| 1167 | Ga0068851_10044585 | |||
| 1168 | Ga0068863_100025161 | |||
| 1169 | Ga0068863_100038014 | |||
| 1170 | Ga0068863_100058931 | |||
| 1171 | Ga0068858_100001998 | |||
| 1172 | Ga0068858_100039965 | |||
| 1173 | Ga0068860_100006591 | |||
| 1174 | Ga0068860_100007427 | |||
| 1175 | Ga0068862_100025452 | |||
| 1176 | Ga0070712_100474367 | |||
| 1177 | Ga0075362_10011637 | |||
| 1178 | Ga0097621_100161101 | |||
| 1179 | Ga0097621_100247032 | |||
| 1180 | Ga0097621_100366525 | |||
| 1181 | Ga0097621_100518447 | |||
| 1182 | Ga0068871_100028510 | |||
| 1183 | Ga0068871_100043305 | |||
| 1184 | Ga0068865_100018012 | |||
| 1185 | Ga0097620_100167407 | |||
| 1186 | Ga0079104_1000001 | |||
| 1187 | Ga0079104_1003285 | |||
| 1188 | Ga0099826_10000033 | |||
| 1189 | Ga0105244_10001268 | |||
| 1190 | Ga0105244_10002331 | |||
| 1191 | Ga0105244_10042192 | |||
| 1192 | Ga0105240_10001692 | |||
| 1193 | Ga0105240_10025647 | |||
| 1194 | Ga0105240_10396201 | |||
| 1195 | Ga0105240_10404556 | |||
| 1196 | Ga0111539_10053128 | |||
| 1197 | Ga0111539_11099926 | |||
| 1198 | Ga0105245_10042161 | |||
| 1199 | Ga0105243_10012713 | |||
| 1200 | Ga0105243_10085443 | |||
| 1201 | Ga0105243_10239384 | |||
| 1202 | Ga0105243_10241511 | |||
| 1203 | Ga0105242_10075246 | |||
| 1204 | Ga0105248_10074587 | |||
| 1205 | Ga0105248_10229035 | |||
| 1206 | Ga0105248_10231964 | |||
| 1207 | Ga0105248_10304816 | |||
| 1208 | Ga0105237_10020036 | |||
| 1209 | Ga0105238_10000255 | |||
| 1210 | Ga0105238_10072050 | |||
| 1211 | Ga0105238_10139346 | |||
| 1212 | Ga0105238_10290698 | |||
| 1213 | Ga0105238_10600016 | |||
| 1214 | Ga0105249_10038942 | |||
| 1215 | Ga0105249_10148454 | |||
| 1216 | Ga0105239_10004709 | |||
| 1217 | Ga0105239_10006370 | |||
| 1218 | Ga0105239_10053867 | |||
| 1219 | Ga0105239_10694149 | |||
| 1220 | Ga0105246_10225218 | |||
| 1221 | Ga0157373_10012943 | |||
| 1222 | Ga0157373_10127244 | |||
| 1223 | Ga0157373_10187374 | |||
| 1224 | Ga0157371_10000003 | |||
| 1225 | Ga0157369_10074822 | |||
| 1226 | Ga0157374_10003229 | |||
| 1227 | Ga0157374_10061688 | |||
| 1228 | Ga0163162_10011979 | |||
| 1229 | Ga0163162_10012367 | |||
| 1230 | Ga0157372_10058889 | |||
| 1231 | Ga0157375_10021719 | |||
| 1232 | Ga0157375_10022979 | |||
| 1233 | Ga0157375_10061463 | |||
| 1234 | Ga0157375_10663720 | |||
| 1235 | Ga0163163_10146227 | |||
| 1236 | Ga0157380_10044658 | |||
| 1237 | Ga0157380_10048785 | |||
| 1238 | Ga0182008_10263676 | |||
| 1239 | Ga0157379_10013161 | |||
| 1240 | Ga0157379_10016872 | |||
| 1241 | Ga0157376_10016557 | |||
| 1242 | Ga0157376_10233751 | |||
| 1243 | Ga0182006_1000007 | |||
| 1244 | Ga0182006_1000102 | |||
| 1245 | Ga0182006_1034063 | |||
| 1246 | Ga0182007_10001496 | |||
| 1247 | Ga0182007_10018972 | |||
| 1248 | Ga0182007_10063366 | |||
| 1249 | Ga0182005_1000006 | |||
| 1250 | Ga0182005_1000010 | |||
| 1251 | Ga0182005_1000134 | |||
| 1252 | Ga0163161_10049369 | |||
| 1253 | Ga0163161_10465340 | |||
| 1254 | Ga0213872_10000041 | |||
| 1255 | Ga0213872_10000167 | |||
| 1256 | Ga0213872_10000929 | |||
| 1257 | Ga0213872_10003231 | |||
| 1258 | Ga0213872_10069435 | |||
| 1259 | Ga0209435_100079 | |||
| 1260 | Ga0209435_100657 | |||
| 1261 | Ga0209760_100848 | |||
| 1262 | Ga0209436_100449 | |||
| 1263 | Ga0209436_107310 | |||
| 1264 | Ga0209784_100034 | |||
| 1265 | Ga0209784_100035 | |||
| 1266 | Ga0209566_100038 | |||
| 1267 | Ga0209566_100040 | |||
| 1268 | Ga0209674_100056 | |||
| 1269 | Ga0209674_100057 | |||
| 1270 | Ga0209672_105447 | |||
| 1271 | Ga0209147_100060 | |||
| 1272 | Ga0209563_100057 | |||
| 1273 | Ga0209563_100059 | |||
| 1274 | Ga0207427_101876 | |||
| 1275 | Ga0209437_100071 | |||
| 1276 | Ga0209437_100081 | |||
| 1277 | Ga0209258_100141 | |||
| 1278 | Ga0209258_107060 | |||
| 1279 | Ga0207425_1000009 | |||
| 1280 | Ga0207425_1000068 | |||
| 1281 | Ga0207425_1001046 | |||
| 1282 | Ga0209646_1000251 | |||
| 1283 | Ga0209646_1000265 | |||
| 1284 | Ga0209646_1000290 | |||
| 1285 | Ga0209026_1000330 | |||
| 1286 | Ga0209677_100035 | |||
| 1287 | Ga0209677_100036 | |||
| 1288 | Ga0209148_1001530 | |||
| 1289 | Ga0209759_1000473 | |||
| 1290 | Ga0209759_1000485 | |||
| 1291 | Ga0209129_1000061 | |||
| 1292 | Ga0209233_1000094 | |||
| 1293 | Ga0209565_1000032 | |||
| 1294 | Ga0209565_1001187 | |||
| 1295 | Ga0209565_1005779 | |||
| 1296 | Ga0209565_1006593 | |||
| 1297 | Ga0209565_1007733 | |||
| 1298 | Ga0209455_1000031 | |||
| 1299 | Ga0209455_1000820 | |||
| 1300 | Ga0209455_1003128 | |||
| 1301 | Ga0209673_1000029 | |||
| 1302 | Ga0209673_1004770 | |||
| 1303 | Ga0209130_1000833 | |||
| 1304 | Ga0209130_1001452 | |||
| 1305 | Ga0209130_1002479 | |||
| 1306 | Ga0209675_1000019 | |||
| 1307 | Ga0209675_1001158 | |||
| 1308 | Ga0209025_1001504 | |||
| 1309 | Ga0209025_1020665 | |||
| 1310 | Ga0209564_1000010 | |||
| 1311 | Ga0209564_1000067 | |||
| 1312 | Ga0209564_1000291 | |||
| 1313 | Ga0209564_1000315 | |||
| 1314 | Ga0209564_1001538 | |||
| 1315 | Ga0209758_1000101 | |||
| 1316 | Ga0209758_1001181 | |||
| 1317 | Ga0209050_1000040 | |||
| 1318 | Ga0209050_1000123 | |||
| 1319 | Ga0209256_1000018 | |||
| 1320 | Ga0209256_1000058 | |||
| 1321 | Ga0209256_1001142 | |||
| 1322 | Ga0209256_1002252 | |||
| 1323 | Ga0209256_1002524 | |||
| 1324 | Ga0209256_1008625 | |||
| 1325 | Ga0207426_1002785 | |||
| 1326 | Ga0209257_1000054 | |||
| 1327 | Ga0209257_1022074 | |||
| 1328 | Ga0207697_10197326 | |||
| 1329 | Ga0207655_1001917 | |||
| 1330 | Ga0207655_1002585 | |||
| 1331 | Ga0207655_1087104 | |||
| 1332 | Ga0207682_10007962 | |||
| 1333 | Ga0207682_10139083 | |||
| 1334 | Ga0207642_10058223 | |||
| 1335 | Ga0207688_10219599 | |||
| 1336 | Ga0207680_10013820 | |||
| 1337 | Ga0207645_10009451 | |||
| 1338 | Ga0207645_10075307 | |||
| 1339 | Ga0207645_10245722 | |||
| 1340 | Ga0207643_10192237 | |||
| 1341 | Ga0207643_10259738 | |||
| 1342 | Ga0207705_10007914 | |||
| 1343 | Ga0207705_10150054 | |||
| 1344 | Ga0207705_10507884 | |||
| 1345 | Ga0207695_10003241 | |||
| 1346 | Ga0207695_10004922 | |||
| 1347 | Ga0207671_10010224 | |||
| 1348 | Ga0207671_10012953 | |||
| 1349 | Ga0207693_10349281 | |||
| 1350 | Ga0207662_10002613 | |||
| 1351 | Ga0207657_10001836 | |||
| 1352 | Ga0207657_10029728 | |||
| 1353 | Ga0207657_10104136 | |||
| 1354 | Ga0207649_10031155 | |||
| 1355 | Ga0207649_10156682 | |||
| 1356 | Ga0207652_10005815 | |||
| 1357 | Ga0207681_10004802 | |||
| 1358 | Ga0207681_10130278 | |||
| 1359 | Ga0207681_10261937 | |||
| 1360 | Ga0207694_10000193 | |||
| 1361 | Ga0207694_10068785 | |||
| 1362 | Ga0207694_10215926 | |||
| 1363 | Ga0207650_10004090 | |||
| 1364 | Ga0207650_10114481 | |||
| 1365 | Ga0207650_10471805 | |||
| 1366 | Ga0207659_10053371 | |||
| 1367 | Ga0207659_10119689 | |||
| 1368 | Ga0207659_10187089 | |||
| 1369 | Ga0207659_10469214 | |||
| 1370 | Ga0207687_10131789 | |||
| 1371 | Ga0207644_10007449 | |||
| 1372 | Ga0207644_10182581 | |||
| 1373 | Ga0207690_10004063 | |||
| 1374 | Ga0207690_10021740 | |||
| 1375 | Ga0207690_10069485 | |||
| 1376 | Ga0207690_10335909 | |||
| 1377 | Ga0207706_10003874 | |||
| 1378 | Ga0207706_10009517 | |||
| 1379 | Ga0207706_10043365 | |||
| 1380 | Ga0207686_10023622 | |||
| 1381 | Ga0207686_10109241 | |||
| 1382 | Ga0207686_10332017 | |||
| 1383 | Ga0207669_10064183 | |||
| 1384 | Ga0207669_10200684 | |||
| 1385 | Ga0207669_10214007 | |||
| 1386 | Ga0207704_10030838 | |||
| 1387 | Ga0207704_10215592 | |||
| 1388 | Ga0207691_10023398 | |||
| 1389 | Ga0207691_10042166 | |||
| 1390 | Ga0207691_10094288 | |||
| 1391 | Ga0207691_10117245 | |||
| 1392 | Ga0207691_10255047 | |||
| 1393 | Ga0207691_10264903 | |||
| 1394 | Ga0207711_10016963 | |||
| 1395 | Ga0207711_10022414 | |||
| 1396 | Ga0207689_10009199 | |||
| 1397 | Ga0207689_10024820 | |||
| 1398 | Ga0207661_10084711 | |||
| 1399 | Ga0207679_10002742 | |||
| 1400 | Ga0207679_10051912 | |||
| 1401 | Ga0207667_10000946 | |||
| 1402 | Ga0207667_10007809 | |||
| 1403 | Ga0207667_10025505 | |||
| 1404 | Ga0207667_10047499 | |||
| 1405 | Ga0207667_10097646 | |||
| 1406 | Ga0207667_10393649 | |||
| 1407 | Ga0207651_10192944 | |||
| 1408 | Ga0207712_10164794 | |||
| 1409 | Ga0207668_10004465 | |||
| 1410 | Ga0207668_10248073 | |||
| 1411 | Ga0207640_10002854 | |||
| 1412 | Ga0207640_10123798 | |||
| 1413 | Ga0207640_10144246 | |||
| 1414 | Ga0207658_10006432 | |||
| 1415 | Ga0207658_10027327 | |||
| 1416 | Ga0207677_10045580 | |||
| 1417 | Ga0207677_10191446 | |||
| 1418 | Ga0207677_10212389 | |||
| 1419 | Ga0207703_10004840 | |||
| 1420 | Ga0207703_10007247 | |||
| 1421 | Ga0207703_10155663 | |||
| 1422 | Ga0207639_10017985 | |||
| 1423 | Ga0207639_10042297 | |||
| 1424 | Ga0207639_10053261 | |||
| 1425 | Ga0207639_10284816 | |||
| 1426 | Ga0207678_10514647 | |||
| 1427 | Ga0207708_10161090 | |||
| 1428 | Ga0207702_10059880 | |||
| 1429 | Ga0207702_10792858 | |||
| 1430 | Ga0207641_10012562 | |||
| 1431 | Ga0207641_10045484 | |||
| 1432 | Ga0207641_10142731 | |||
| 1433 | Ga0207648_10014995 | |||
| 1434 | Ga0207648_10073729 | |||
| 1435 | Ga0207648_10105638 | |||
| 1436 | Ga0207676_10160692 | |||
| 1437 | Ga0207676_10216584 | |||
| 1438 | Ga0207676_10275111 | |||
| 1439 | Ga0207675_100004479 | |||
| 1440 | Ga0207675_100286924 | |||
| 1441 | Ga0207683_10019240 | |||
| 1442 | Ga0207683_10027233 | |||
| 1443 | Ga0207683_10131915 | |||
| 1444 | Ga0207698_10005137 | |||
| 1445 | Ga0207698_10031618 | |||
| 1446 | Ga0207698_10034855 | |||
| 1447 | Ga0207698_10284895 | |||
| 1448 | Ga0209281_1000151 | |||
| 1449 | Ga0209281_1003261 | |||
| 1450 | Ga0209282_1000014 | |||
| 1451 | Ga0268266_10561043 | |||
| 1452 | Ga0268265_10008762 | |||
| 1453 | Ga0268264_10002117 | |||
| 1454 | Ga0268264_10009653 | |||
| 1455 | Ga0268264_10104767 | |||
| 1456 | Ga0265323_10009697 | |||
| 1457 | Ga0307515_10000432 | |||
| 1458 | Ga0307515_10005908 | |||
| 1459 | Ga0307515_10024457 | |||
| 1460 | Ga0316177_1029947 | |||
| 1461 | Ga0316182_1085102 | |||
| 1462 | Ga0265325_10006514 | |||
| 1463 | Ga0265329_10000056 | |||
| 1464 | Ga0265339_10124660 | |||
| 1465 | Ga0265327_10192746 | |||
| 1466 | Ga0265316_10000484 | |||
| 1467 | Ga0265316_10023663 | |||
| 1468 | Ga0265316_10100890 | |||
| 1469 | Ga0307408_100002393 | |||
| 1470 | Ga0307408_100030624 | |||
| 1471 | Ga0307408_100235289 | |||
| 1472 | Ga0307408_100424224 | |||
| 1473 | Ga0265313_10006226 | |||
| 1474 | Ga0265314_10005760 | |||
| 1475 | Ga0265342_10000405 | |||
| 1476 | Ga0265342_10001757 | |||
| 1477 | Ga0316576_10014776 | |||
| 1478 | Ga0316578_10000134 | |||
| 1479 | Ga0307516_10000127 | |||
| 1480 | Ga0307516_10003164 | |||
| 1481 | Ga0307516_10013408 | |||
| 1482 | Ga0307516_10157567 | |||
| 1483 | Ga0307405_10039787 | |||
| 1484 | Ga0307518_10067826 | |||
| 1485 | Ga0307412_10138629 | |||
| 1486 | Ga0307409_100025249 | |||
| 1487 | Ga0307416_100032061 | |||
| 1488 | Ga0307416_100142601 | |||
| 1489 | Ga0307414_10013571 | |||
| 1490 | Ga0307414_10044379 | |||
| 1491 | Ga0307411_10061113 | |||
| 1492 | Ga0307415_100020811 | |||
| 1493 | Ga0316593_10023535 | |||
| 1494 | Ga0316596_1015766 | |||
| 1495 | Ga0373954_0002027 | |||
| 1496 | Ga0373946_0066994 | |||
| 1497 | Ga0373962_0031080 | |||
| 1498 | Ga0316574_0012379 | |||
| 1499 | Ga0373931_0054053 | |||
| 1500 | Ga0373935_0085832 | |||
| 1501 | Ga0373933_0182179 | |||
| 1502 | Ga0373947_0223568 | |||
| 1503 | Ga0373937_0045307 | |||
| 1504 | Ga0373937_0218595 | |||
| 1505 | Ga0316584_0021567 | |||
| 1506 | Ga0316584_0135137 | |||
| 1507 | Ga0373925_0119245 | |||
| 1508 | Ga0395899_0000329 | |||
| 1509 | Ga0395899_0000787 | |||
| 1510 | Ga0395899_0019086 | |||
| 1511 | Ga0395899_0138806 | |||
| 1512 | Ga0395900_0012488 | |||
| 1513 | Ga0395900_0099595 | |||
| 1514 | Ga0395900_0376962 | |||
| 1515 | Ga0395900_0378752 | |||
| 1516 | Ga0395900_0812681 | |||
| 1517 | Ga0395898_0000283 | |||
| 1518 | Ga0395898_0134878 | |||
| 1519 | Ga0395898_0208690 | |||
| 1520 | Ga0395905_0000703 | |||
| 1521 | Ga0395905_0005750 | |||
| 1522 | Ga0395905_0027360 | |||
| 1523 | Ga0395905_0052947 | |||
| 1524 | Ga0395905_0139583 | |||
| 1525 | Ga0395905_0232058 | |||
| 1526 | Ga0395901_0000881 | |||
| 1527 | Ga0395901_0015819 | |||
| 1528 | Ga0395901_0364545 | |||
| 1529 | Ga0400485_08530 | |||
| 1530 | Ga0400489_08019 | |||
| 1531 | Ga0436361_0136418 | |||
| 1532 | Ga0436361_0279393 | |||
| 1533 | Ga0436361_0391791 | |||
| 1534 | Ga0436361_0438991 | |||
| 1535 | Ga0436361_0599511 | |||
| 1536 | Ga0436361_0674579 | |||
| 1537 | Ga0436361_1059260 | |||
| 1538 | Ga0439441_052679 | |||
| 1539 | Ga0450904_000871 | |||
| 1540 | Ga0451577_0001500 | |||
| 1541 | Ga0451577_0009424 | |||
| 1542 | Ga0466969_0000013 | |||
| 1543 | Ga0466972_0000453 | |||
| 1544 | Ga0466972_0003939 | |||
| 1545 | Ga0453683_0042631 | |||
| 1546 | Ga0466965_0000132 | |||
| 1547 | Ga0466965_0000278 | |||
| 1548 | Ga0466965_0048747 | |||
| 1549 | Ga0466965_0122743 | |||
| 1550 | Ga0466965_0168340 | |||
| 1551 | Ga0466966_0016417 | |||
| 1552 | Ga0466966_0020568 | |||
| 1553 | Ga0466966_0044546 | |||
| 1554 | Ga0466961_0049174 | |||
| 1555 | Ga0466964_0000573 | |||
| 1556 | Ga0466964_0018762 | |||
| 1557 | Ga0453684_0000694 | |||
| 1558 | Ga0466968_0012527 | |||
| 1559 | Ga0466968_0143545 | |||
| 1560 | Ga0466970_0267197 | |||
| 1561 | Ga0466957_0017868 | |||
| 1562 | Ga0466957_0034529 | |||
| 1563 | Ga0466959_0002428 | |||
| 1564 | Ga0466959_0026613 | |||
| 1565 | Ga0466959_0043954 | |||
| 1566 | Ga0466959_0087527 | |||
| 1567 | Ga0451576_0008355 | |||
| 1568 | Ga0451576_0127712 | |||
| 1569 | Ga0451576_0739525 | |||
| 1570 | Ga0466958_0039431 | |||
| 1571 | Ga0466967_0132012 | |||
| 1572 | Ga0466967_0163069 | |||
| 1573 | Ga0495617_000128 | |||
| 1574 | Ga0495617_001419 | |||
| 1575 | Ga0495617_001910 | |||
| 1576 | Ga0495617_085941 | |||
| 1577 | Ga0495627_000004 | |||
| 1578 | Ga0495627_028838 | |||
| 1579 | Ga0495592_0010789 | |||
| 1580 | Ga0495603_0002466 | |||
| 1581 | Ga0495590_0000014 | |||
| 1582 | Ga0495590_0001614 | |||
| 1583 | Ga0495590_0001672 | |||
| 1584 | Ga0495590_0014643 | |||
| 1585 | Ga0495590_0029243 | |||
| 1586 | Ga0495629_0006457 | |||
| 1587 | Ga0495629_0024599 | |||
| 1588 | Ga0495638_0000064 | |||
| 1589 | Ga0495638_0004227 | |||
| 1590 | Ga0495638_0056035 | |||
| 1591 | Ga0495638_0155969 | |||
| 1592 | Ga0495651_0003413 | |||
| 1593 | Ga0495653_0000056 | |||
| 1594 | Ga0495653_0035719 | |||
| 1595 | Ga0495653_0228620 | |||
| 1596 | Ga0495650_0000062 | |||
| 1597 | Ga0495650_0000283 | |||
| 1598 | Ga0495650_0001144 | |||
| 1599 | Ga0495650_0001153 | |||
| 1600 | Ga0495650_0014839 | |||
| 1601 | Ga0495650_0032504 | |||
| 1602 | Ga0495650_0033108 | |||
| 1603 | Ga0495580_0226975 | |||
| 1604 | Ga0495582_0104406 | |||
| 1605 | Ga0495605_0000127 | |||
| 1606 | Ga0495605_0000225 | |||
| 1607 | Ga0495605_0001850 | |||
| 1608 | Ga0495605_0018816 | |||
| 1609 | Ga0495605_0026919 | |||
| 1610 | Ga0495605_0123489 | |||
| 1611 | Ga0495605_0128194 | |||
| 1612 | Ga0495584_0000040 | |||
| 1613 | Ga0495584_0001407 | |||
| 1614 | Ga0495584_0001529 | |||
| 1615 | Ga0495584_0002355 | |||
| 1616 | Ga0495584_0005114 | |||
| 1617 | Ga0495584_0005804 | |||
| 1618 | Ga0495584_0016289 | |||
| 1619 | Ga0495584_0027869 | |||
| 1620 | Ga0495584_0125292 | |||
| 1621 | Ga0495585_0000230 | |||
| 1622 | Ga0495585_0000566 | |||
| 1623 | Ga0495585_0000776 | |||
| 1624 | Ga0495585_0003019 | |||
| 1625 | Ga0495585_0003507 | |||
| 1626 | Ga0495585_0046525 | |||
| 1627 | Ga0495585_0070037 | |||
| 1628 | Ga0495585_0100033 | |||
| 1629 | Ga0495585_0180470 | |||
| 1630 | Ga0495594_0012651 | |||
| 1631 | Ga0495594_0079993 | |||
| 1632 | Ga0495596_0000671 | |||
| 1633 | Ga0495596_0001532 | |||
| 1634 | Ga0495596_0006464 | |||
| 1635 | Ga0495596_0007938 | |||
| 1636 | Ga0495607_0000853 | |||
| 1637 | Ga0495607_0001656 | |||
| 1638 | Ga0495607_0001772 | |||
| 1639 | Ga0495607_0003675 | |||
| 1640 | Ga0495607_0036798 | |||
| 1641 | Ga0495607_0256282 | |||
| 1642 | Ga0495583_0000046 | |||
| 1643 | Ga0495583_0000137 | |||
| 1644 | Ga0495583_0000156 | |||
| 1645 | Ga0495583_0000231 | |||
| 1646 | Ga0495583_0000287 | |||
| 1647 | Ga0495583_0001530 | |||
| 1648 | Ga0495583_0001556 | |||
| 1649 | Ga0495583_0004187 | |||
| 1650 | Ga0495606_0000353 | |||
| 1651 | Ga0495606_0000400 | |||
| 1652 | Ga0495606_0000589 | |||
| 1653 | Ga0495606_0000933 | |||
| 1654 | Ga0495606_0001708 | |||
| 1655 | Ga0495606_0002937 | |||
| 1656 | Ga0495606_0006490 | |||
| 1657 | Ga0495606_0067300 | |||
| 1658 | Ga0495608_0018854 | |||
| 1659 | Ga0495610_0000027 | |||
| 1660 | Ga0495610_0001111 | |||
| 1661 | Ga0495610_0016864 | |||
| 1662 | Ga0495610_0036421 | |||
| 1663 | Ga0495616_0000072 | |||
| 1664 | Ga0495616_0002779 | |||
| 1665 | Ga0495616_0009303 | |||
| 1666 | Ga0495616_0059252 | |||
| 1667 | Ga0495616_0070870 | |||
| 1668 | Ga0495616_0221880 | |||
| 1669 | Ga0495618_0021041 | |||
| 1670 | Ga0495620_0009333 | |||
| 1671 | Ga0495628_0000076 | |||
| 1672 | Ga0495628_0001441 | |||
| 1673 | Ga0495628_0115865 | |||
| 1674 | Ga0495628_0419528 | |||
| 1675 | Ga0495631_0000290 | |||
| 1676 | Ga0495631_0001418 | |||
| 1677 | Ga0495631_0015619 | |||
| 1678 | Ga0495631_0038625 | |||
| 1679 | Ga0495632_0000403 | |||
| 1680 | Ga0495632_0004394 | |||
| 1681 | Ga0495637_0000430 | |||
| 1682 | Ga0495637_0009837 | |||
| 1683 | Ga0495637_0010156 | |||
| 1684 | Ga0495643_0000108 | |||
| 1685 | Ga0495643_0000255 | |||
| 1686 | Ga0495643_0000716 | |||
| 1687 | Ga0495643_0001683 | |||
| 1688 | Ga0495643_0020799 | |||
| 1689 | Ga0495643_0049091 | |||
| 1690 | Ga0495643_0067644 | |||
| 1691 | Ga0495643_0131709 | |||
| 1692 | Ga0495644_0005344 | |||
| 1693 | Ga0495644_0020071 | |||
| 1694 | Ga0495644_0026066 | |||
| 1695 | Ga0495648_0000006 | |||
| 1696 | Ga0495648_0000134 | |||
| 1697 | Ga0495648_0000841 | |||
| 1698 | Ga0495648_0002507 | |||
| 1699 | Ga0495648_0014318 | |||
| 1700 | Ga0495648_0023331 | |||
| 1701 | Ga0495648_0035462 | |||
| 1702 | Ga0495648_0045577 | |||
| 1703 | Ga0495648_0076198 | |||
| 1704 | Ga0495663_0003306 | |||
| 1705 | Ga0495666_0009701 | |||
| 1706 | Ga0495666_0015888 | |||
| 1707 | Ga0495642_0000871 | |||
| 1708 | Ga0495642_0002341 | |||
| 1709 | Ga0495642_0002943 | |||
| 1710 | Ga0495642_0003138 | |||
| 1711 | Ga0495642_0004427 | |||
| 1712 | Ga0495652_0005760 | |||
| 1713 | Ga0495652_0140029 | |||
| 1714 | Ga0495654_0000131 | |||
| 1715 | Ga0495654_0007219 | |||
| 1716 | Ga0495654_0024239 | |||
| 1717 | Ga0495654_0033901 | |||
| 1718 | Ga0495665_0065133 | |||
| 1719 | Ga0495586_0025907 | |||
| 1720 | Ga0495587_0083004 | |||
| 1721 | Ga0495609_0000136 | |||
| 1722 | Ga0495609_0001765 | |||
| 1723 | Ga0495609_0006092 | |||
| 1724 | Ga0495609_0026224 | |||
| 1725 | Ga0495621_0109696 | |||
| 1726 | Ga0495597_0000091 | |||
| 1727 | Ga0495597_0000223 | |||
| 1728 | Ga0495597_0000882 | |||
| 1729 | Ga0495597_0000971 | |||
| 1730 | Ga0495597_0001469 | |||
| 1731 | Ga0495597_0007404 | |||
| 1732 | Ga0495597_0034443 | |||
| 1733 | Ga0495597_0052294 | |||
| 1734 | Ga0495645_0016449 | |||
| 1735 | Ga0495645_0055606 | |||
| 1736 | Ga0495622_0000013 | |||
| 1737 | Ga0495622_0005626 | |||
| 1738 | Ga0495622_0115802 | |||
| 1739 | Ga0495622_0224052 | |||
| 1740 | Ga0495633_0001545 | |||
| 1741 | Ga0495633_0002191 | |||
| 1742 | Ga0495633_0002981 | |||
| 1743 | Ga0495633_0003195 | |||
| 1744 | Ga0495633_0015631 | |||
| 1745 | Ga0495633_0148610 | |||
| 1746 | Ga0495633_0168873 | |||
| 1747 | Ga0495656_0000675 | |||
| 1748 | Ga0495656_0037159 | |||
| 1749 | Ga0495668_0000029 | |||
| 1750 | Ga0495668_0000119 | |||
| 1751 | Ga0495668_0000209 | |||
| 1752 | Ga0495668_0000359 | |||
| 1753 | Ga0495668_0003302 | |||
| 1754 | Ga0495668_0022417 | |||
| 1755 | Ga0495668_0086796 | |||
| 1756 | Ga0495611_0015040 | |||
| 1757 | Ga0495611_0018009 | |||
| 1758 | Ga0495625_0000871 | |||
| 1759 | Ga0495625_0001309 | |||
| 1760 | Ga0495625_0001595 | |||
| 1761 | Ga0495625_0007432 | |||
| 1762 | Ga0495625_0007978 | |||
| 1763 | Ga0495625_0010041 | |||
| 1764 | Ga0495625_0011228 | |||
| 1765 | Ga0495625_0015358 | |||
| 1766 | Ga0495659_0001898 | |||
| 1767 | Ga0495659_0002191 | |||
| 1768 | Ga0495659_0044416 | |||
| 1769 | Ga0495661_0000979 | |||
| 1770 | Ga0495661_0007457 | |||
| 1771 | Ga0495661_0013316 | |||
| 1772 | Ga0495661_0021185 | |||
| 1773 | Ga0495661_0027022 | |||
| 1774 | Ga0495661_0055997 | |||
| 1775 | Ga0495588_0000091 | |||
| 1776 | Ga0495588_0077315 | |||
| 1777 | Ga0495657_0041222 | |||
| 1778 | Ga0495657_0277382 | |||
| 1779 | Ga0495599_0003657 | |||
| 1780 | Ga0495599_0071047 | |||
| 1781 | Ga0495623_0000743 | |||
| 1782 | Ga0495646_0005231 | |||
| 1783 | Ga0495646_0161407 | |||
| 1784 | Ga0495658_0009494 | |||
| 1785 | Ga0495658_0073811 | |||
| 1786 | Ga0495669_0000021 | |||
| 1787 | Ga0495669_0001117 | |||
| 1788 | Ga0495613_0117767 | |||
| 1789 | Ga0495624_0036851 | |||
| 1790 | Ga0495624_0062485 | |||
| 1791 | Ga0495670_0016780 | |||
| 1792 | Ga0495670_0035008 | |||
| 1793 | Ga0495670_0063015 | |||
| 1794 | Ga0495670_0064268 | |||
| 1795 | Ga0495670_0074575 | |||
| 1796 | Ga0495671_0000106 | |||
| 1797 | Ga0495671_0002593 | |||
| 1798 | Ga0495671_0022032 | |||
| 1799 | Ga0495671_0051785 | |||
| 1800 | Ga0495671_0111413 | |||
| 1801 | Ga0495649_0000549 | |||
| 1802 | Ga0495649_0000709 | |||
| 1803 | Ga0495649_0014906 | |||
| 1804 | Ga0495649_0015177 | |||
| 1805 | Ga0495589_0000269 | |||
| 1806 | Ga0495600_0000340 | |||
| 1807 | Ga0495660_0000823 | |||
| 1808 | Ga0495660_0001854 | |||
| 1809 | Ga0495660_0015627 | |||
| 1810 | Ga0495660_0016122 | |||
| 1811 | Ga0495660_0047240 | |||
| 1812 | Ga0495660_0073796 | |||
| 1813 | Ga0495660_0086344 | |||
| 1814 | Ga0495581_0175579 | |||
| 1815 | Ga0495604_0085636 | |||
| 1816 | Ga0495604_0227925 | |||
| 1817 | Ga0495636_0000933 | |||
| 1818 | Ga0495636_0002175 | |||
| 1819 | Ga0495636_0006937 | |||
| 1820 | Ga0495636_0053940 | |||
| 1821 | Ga0495636_0122325 | |||
| 1822 | Ga0495674_0032572 | |||
| 1823 | Ga0495672_0000088 | |||
| 1824 | Ga0495672_0001122 | |||
| 1825 | Ga0495676_0028858 | |||
| 1826 | Ga0495676_0094213 | |||
| 1827 | Ga0495680_0054419 | |||
| 1828 | Ga0495680_0183159 | |||
| 1829 | Ga0495683_0000125 | |||
| 1830 | Ga0495683_0000892 | |||
| 1831 | Ga0495683_0018689 | |||
| 1832 | Ga0495687_000042 | |||
| 1833 | Ga0495687_000115 | |||
| 1834 | Ga0495687_001828 | |||
| 1835 | Ga0495687_003232 | |||
| 1836 | Ga0495687_003687 | |||
| 1837 | Ga0495687_009013 | |||
| 1838 | Ga0495687_011544 | |||
| 1839 | Ga0495675_0008756 | |||
| 1840 | Ga0495677_0000156 | |||
| 1841 | Ga0495677_0006078 | |||
| 1842 | Ga0495677_0019510 | |||
| 1843 | Ga0495677_0102268 | |||
| 1844 | Ga0495685_000523 | |||
| 1845 | Ga0495685_001719 | |||
| 1846 | Ga0495685_006046 | |||
| 1847 | Ga0495673_0000008 | |||
| 1848 | Ga0495673_0000009 | |||
| 1849 | Ga0495673_0000185 | |||
| 1850 | Ga0495673_0007424 | |||
| 1851 | Ga0495681_0000278 | |||
| 1852 | Ga0495681_0000951 | |||
| 1853 | Ga0495681_0001142 | |||
| 1854 | Ga0495681_0010879 | |||
| 1855 | Ga0495684_0058149 | |||
| 1856 | Ga0495686_0000212 | |||
| 1857 | Ga0495686_0001207 | |||
| 1858 | Ga0495686_0003602 | |||
| 1859 | Ga0495686_0004528 | |||
| 1860 | Ga0495686_0011929 | |||
| 1861 | Ga0495686_0019954 | |||
| 1862 | Ga0495686_0115612 | |||
| 1863 | Ga0495686_0147370 | |||
| 1864 | Ga0495593_0001579 | |||
| 1865 | Ga0495593_0009011 | |||
| 1866 | Ga0495602_0059604 | |||
| 1867 | Ga0495602_0168608 | |||
| 1868 | Ga0495626_0000043 | |||
| 1869 | Ga0495626_0000091 | |||
| 1870 | Ga0495626_0000667 | |||
| 1871 | Ga0495626_0001829 | |||
| 1872 | Ga0495626_0004783 | |||
| 1873 | Ga0495626_0008166 | |||
| 1874 | Ga0495626_0024848 | |||
| 1875 | Ga0495626_0084997 | |||
| 1876 | Ga0496101_0136173 | |||
| 1877 | Ga0496102_0001181 | |||
| 1878 | Ga0496102_0370989 | |||
| 1879 | Ga0496103_0010503 | |||
| 1880 | Ga0496103_0212373 | |||
| 1881 | Ga0496104_0039773 | |||
| 1882 | Ga0496104_0040104 | |||
| 1883 | Ga0496105_0037751 | |||
| 1884 | Ga0496106_0190134 | |||
| 1885 | Ga0496107_0086074 | |||
| 1886 | Ga0496107_0113128 | |||
| 1887 | Ga0496108_0056737 | |||
| 1888 | Ga0496108_0407208 | |||
| 1889 | Ga0496109_0082777 | |||
| 1890 | Ga0496110_0021592 | |||
| 1891 | Ga0496110_0085888 | |||
| 1892 | Ga0496110_0706778 | |||
| 1893 | Ga0496111_0003127 | |||
| 1894 | Ga0496111_0503122 | |||
| 1895 | Ga0496112_0116693 | |||
| 1896 | Ga0496114_0005135 | |||
| 1897 | Ga0496114_0101555 | |||
| 1898 | Ga0496115_0068854 | |||
| 1899 | Ga0496115_0213154 | |||
| 1900 | Ga0496116_0024641 | |||
| 1901 | Ga0496117_0000005 | |||
| 1902 | Ga0496117_0016121 | |||
| 1903 | Ga0496118_0000022 | |||
| 1904 | Ga0496118_0014998 | |||
| 1905 | Ga0496121_0009122 | |||
| 1906 | Ga0496121_0102810 | |||
| 1907 | Ga0496122_0000968 | |||
| 1908 | Ga0496122_0006223 | |||
| 1909 | Ga0496122_0009051 | |||
| 1910 | Ga0496122_0012265 | |||
| 1911 | Ga0496122_0267623 | |||
| 1912 | Ga0496123_0000983 | |||
| 1913 | Ga0496123_0002475 | |||
| 1914 | Ga0496123_0012980 | |||
| 1915 | Ga0496123_0048162 | |||
| 1916 | Ga0496124_0001001 | |||
| 1917 | Ga0496124_0036741 | |||
| 1918 | Ga0496124_0081285 | |||
| 1919 | Ga0496124_0169625 | |||
| 1920 | Ga0496125_0001086 | |||
| 1921 | Ga0496125_0003905 | |||
| 1922 | Ga0496125_0007199 | |||
| 1923 | Ga0496125_0018481 | |||
| 1924 | Ga0496125_0075761 | |||
| 1925 | Ga0496126_0006515 | |||
| 1926 | Ga0496126_0075641 | |||
| 1927 | Ga0495678_000149 | |||
| 1928 | Ga0495678_000259 | |||
| 1929 | Ga0495678_000652 | |||
| 1930 | Ga0495678_005168 | |||
| 1931 | Ga0495682_0000585 | |||
| 1932 | Ga0495682_0000819 | |||
| 1933 | Ga0495682_0002024 | |||
| 1934 | Ga0495682_0009318 | |||
| 1935 | Ga0501316_007077 | |||
| 1936 | Ga0501031_0275151 | |||
| 1937 | Ga0501032_0185265 | |||
| 1938 | Ga0501033_0001795 | |||
| 1939 | Ga0501036_0136855 | |||
| 1940 | Ga0501038_0637578 | |||
| 1941 | Ga0501039_0157376 | |||
| 1942 | Ga0501039_0194198 | |||
| 1943 | Ga0501040_0007105 | |||
| 1944 | Ga0501043_0322791 | |||
| 1945 | Ga0501047_0003401 | |||
| 1946 | Ga0501048_0007051 | |||
| 1947 | Ga0501048_0254721 | |||
| 1948 | Ga0501067_0276512 | |||
| 1949 | Ga0501069_0043257 | |||
| 1950 | Ga0501070_0006609 | |||
| 1951 | Ga0501070_0010057 | |||
| 1952 | Ga0501070_0104394 | |||
| 1953 | Ga0501072_0002698 | |||
| 1954 | Ga0501074_0001841 | |||
| 1955 | Ga0501075_0004622 | |||
| 1956 | Ga0501076_0000088 | |||
| 1957 | Ga0501077_0040395 | |||
| 1958 | Ga0501230_000829 | |||
| 1959 | Ga0501238_005139 | |||
| 1960 | Ga0501079_0001059 | |||
| 1961 | Ga0501080_0474110 | |||
| 1962 | Ga0501081_0010465 | |||
| 1963 | Ga0501269_000164 | |||
| 1964 | Ga0501279_002426 | |||
| 1965 | Ga0501035_0001552 | |||
| 1966 | Ga0501035_0054021 | |||
| 1967 | Ga0501035_0514817 | |||
| 1968 | Ga0501044_0000185 | |||
| 1969 | Ga0501044_0001443 | |||
| 1970 | Ga0501044_0275538 | |||
| 1971 | Ga0501045_0004039 | |||
| 1972 | nmdc:mga00v17_126051_c1 | |||
| 1973 | nmdc:mga0n895_378667_c1 | |||
| 1974 | Ga0495601_0002072 | |||
| 1975 | Ga0495619_0128040 | |||
| 1976 | Ga0500595_016546 | |||
| 1977 | Ga0500607_058486 | |||
| 1978 | Ga0500618_000557 | |||
| 1979 | Ga0500618_003629 | |||
| 1980 | Ga0500559_0014184 | |||
| 1981 | Ga0500574_002040 | |||
| 1982 | Ga0500586_000137 | |||
| 1983 | Ga0500619_000170 | |||
| 1984 | Ga0500619_000263 | |||
| 1985 | Ga0587082_036398 | |||
| 1986 | Ga0587083_0002118 | |||
| 1987 | Ga0587072_011698 | |||
| 1988 | Ga0501082_0011645 | |||
| 1989 | Ga0530510_0001266 | |||
| 1990 | 2511247489 | |||
| 1991 | 2511384300 | |||
| 1992 | 2521560911 | |||
| 1993 | 2550696641 | |||
| 1994 | 2553007620 | |||
| 1995 | 2578338350 | |||
| 1996 | 2601671231 | |||
| 1997 | 2643792722 | |||
| 1998 | 2644028145 | |||
| 1999 | 2644212842 | |||
| 2000 | 2644254894 | |||
| 2001 | 2644359320 | |||
| 2002 | 2738738255 | |||
| 2003 | 2738826610 | |||
| 2004 | 2738842938 | |||
| 2005 | 2739150407 | |||
| 2006 | 2739192326 | |||
| 2007 | 2739273686 | |||
| 2008 | 2739318803 | |||
| 2009 | 2739337044 | |||
| 2010 | 2739342730 | |||
| 2011 | 2765567347 | |||
| 2012 | 2808984255 | |||
| 2013 | 2809132059 | |||
| 2014 | 2809151682 | |||
| 2015 | 2819542297 | |||
| 2016 | 2819594315 | |||
| 2017 | 2819618781 | |||
| 2018 | 2821135322 | |||
| 2019 | 2839095431 | |||
| 2020 | 2842717386 | |||
| 2021 | 2852622858 | |||
| 2022 | 2857548925 | |||
| 2023 | 2857556433 | |||
| 2024 | 2857562167 | |||
| 2025 | 2857567839 | |||
| 2026 | 2884811650 | |||
| 2027 | 2884840708 | |||
| 2028 | 2884857696 | |||
| 2029 | 2885080990 | |||
| 2030 | 2889418852 | |||
| 2031 | 2896158636 | |||
| 2032 | 2904427915 | |||
| 2033 | 2904442466 | |||
| 2034 | 2904533733 | |||
| 2035 | 2904589430 | |||
| 2036 | 2904595133 | |||
| 2037 | 2904602365 | |||
| 2038 | 2919050713 | |||
| 2039 | 2919084908 | |||
| 2040 | 2919441091 | |||
| 2041 | 2919476797 | |||
| 2042 | 2923514751 | |||
| 2043 | 2928135647 | |||
| 2044 | 2932415379 | |||
| 2045 | 2932421460 | |||
| 2046 | 8048747327 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ezn-assembly1.cif.gz_A | crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b | 0.992 | 1 | 235 |
| 1e59-assembly1.cif.gz_A-2 | e.coli cofactor-dependent phosphoglycerate mutase complexed with vanadate | 0.9911 | 1 | 238 |
| 3fdz-assembly1.cif.gz_B | crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3-phosphoglyceric acid | 0.9904 | 1 | 229 |
| 5um0-assembly1.cif.gz_D | crystal structure of 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase from neisseria gonorrhoeae | 0.9903 | 1 | 228 |
| 5vve-assembly1.cif.gz_A | crystal structure of phosphoglycerate mutase from naegleria fowleri | 0.9869 | 2 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P36623_9_210_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9873 | 4 | 229 | 3.40.50.1240 |
| af_P36623_9_210_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9777 | 4 | 229 | 3.40.50.1240 |
| 1riiA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9658 | 2 | 242 | 3.40.50.1240 |
| 1riiA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.954 | 2 | 242 | 3.40.50.1240 |
| af_Q8T8W6_17_267_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9473 | 2 | 239 | 3.40.50.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259JAP8-F1-model_v4 | deleted | 0.9974 | 1 | 227 |
|
| AF-A0A4Q6DXN7-F1-model_v4 | 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) | 0.9952 | 1 | 226 |
GO:0006094
GO:0006096 GO:0046538 |
| AF-A0A150H3G3-F1-model_v4 | Phosphoglycerate mutase (EC 5.4.2.11) | 0.9952 | 2 | 229 |
GO:0006096
GO:0046538 |
| AF-A0A7X6WPX0-F1-model_v4 | deleted | 0.9952 | 25 | 229 |
|
| AF-C6E639-F1-model_v4 | 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (BPG-dependent PGAM) (PGAM) (Phosphoglyceromutase) (dPGM) (EC 5.4.2.11) | 0.9951 | 1 | 229 |
GO:0006094
GO:0006096 GO:0046538 |