F488450

General Info

Members Datasets Scaffolds Average Seq Length
1023 485 2046 247

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0255934|Ga0496102_0255934_221_1030
Length 261
Sequence MGQAVFIAGPPPVHLSTLEESMYKIVFMRHGESTWNLENRFTGWTDVDLTAKGVQEAKNAGKVLKEAGFTFDLAYTSVLKRAIRTLWLTMDEMDMLWLPVVNDWRLNERHYGALQGLDKGETAAKYGDAQVLVWRRSYDTPERTSFSDPRYARLERSQIPLTECLKDTVARVMPAWDEEIAPAIRAGRQILISAHGNSLRALIKMLDGISDEDIVGLNIPNGQPLVYELDADLKPIRHYYLGDAAAIAAATAAVANQGKAK

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
22 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
52 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
53 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
54 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
124 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
125 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
127 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
207 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
214 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
225 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
226 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
235 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
239 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
240 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
241 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
242 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
254 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
257 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
262 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
263 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
264 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
268 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
275 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
287 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
288 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
293 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
294 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
295 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
296 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
297 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
298 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
299 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
300 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
301 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
302 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
303 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
304 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
305 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
306 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
307 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
308 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
309 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
310 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
313 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
314 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
315 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
316 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
317 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
318 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
319 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
320 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
323 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
324 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
325 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
326 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
327 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
328 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
329 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
330 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
335 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
336 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
337 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
338 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
343 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
344 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
345 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
346 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
347 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
348 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
349 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
350 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
351 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
352 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
353 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
354 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
355 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
356 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
357 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
358 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
359 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
360 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
361 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
362 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
363 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
364 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
365 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
366 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
367 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
368 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
369 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
370 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
371 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
372 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
373 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
374 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
375 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
376 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
377 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
378 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
379 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
380 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
381 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
382 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
383 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
384 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
396 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
399 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
400 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
401 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
402 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
403 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
404 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
405 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
406 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
407 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
408 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
409 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
410 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
413 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
414 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
415 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
416 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
417 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
418 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
419 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
420 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
421 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
422 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
423 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
424 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
428 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
429 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
430 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
431 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
432 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
433 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
434 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
435 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
436 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
437 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
438 2643221638 Duganella sp. Root336D2 Isolate Unclassified
439 2643221645 Massilia sp. Root351 Isolate Unclassified
440 2643221664 Massilia sp. Root418 Isolate Unclassified
441 2738541280 Massilia sp. GV090 Isolate Unclassified
442 2738541297 Duganella sp. GV083 Isolate Unclassified
443 2738541300 Massilia sp. GV016 Isolate Unclassified
444 2738541357 Duganella sp. GV053 Isolate Unclassified
445 2738543003 Duganella sp. GV066 Isolate Unclassified
446 2738543018 Massilia sp. GV045 Isolate Unclassified
447 2738543026 Duganella sp. GV089 Isolate Unclassified
448 2738543029 Duganella sp. GV039 Isolate Unclassified
449 2738543030 Massilia sp. GV097 Isolate Unclassified
450 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
451 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
452 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
453 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
454 2818991436 Collimonas arenae 515 Isolate Unclassified
455 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
456 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
457 2821131069 Duganella sp. 1224 Isolate Unclassified
458 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
459 2842711865 Duganella sp. R-73148 Isolate Unclassified
460 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
461 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
462 2857553236 Duganella sp. R-74557 Isolate Unclassified
463 2857558681 Duganella sp. R-74565 Isolate Unclassified
464 2857564685 Duganella sp. R-74599 Isolate Unclassified
465 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
466 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
467 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
468 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
469 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
470 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
471 2904424332 Duganella sp. 1411 Isolate Rhizosphere
472 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
473 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
474 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
475 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
476 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
477 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
478 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
479 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
480 2919476304 Duganella sp. 3397 Isolate Unclassified
481 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
482 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
483 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
484 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
485 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.74
Metatranscriptomes 0.68
Isolates 5.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.95
Nodule 0.88
Rhizoplane 2.54
Rhizosphere 76.83
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0255934 3300048905 Bacteria 1650
2 SwRhRL2b_contig_1435602 2162886007 Bacteria 1876
3 JGI24737J22298_10007165 3300001990 Bacteria 3774
4 JGI25155J39150_1000170 3300002704 Bacteria 28479
5 JGI25155J39150_1000681 3300002704 Bacteria 6401
6 JGI25156J39149_1000293 3300002705 Bacteria 33788
7 JGI25162J39368_1000148 3300002737 Bacteria 76611
8 JGI25154J39366_1000260 3300002738 Bacteria 33788
9 JGI25154J39366_1000267 3300002738 Bacteria 32817
10 JGI25154J39366_1001696 3300002738 Bacteria 7240
11 JGI25158J39367_1003777 3300002739 Bacteria 2309
12 JGI25157J39369_1000327 3300002741 Bacteria 33804
13 JGI25152J39213_1012831 3300002773 Bacteria 1776
14 JGI25150J39212_1001790 3300002774 Bacteria 5724
15 JGI25150J39212_1003475 3300002774 Bacteria 3677
16 JGI25159J45721_1012602 3300002987 Bacteria 2008
17 JGI25159J45721_1014381 3300002987 Bacteria 1789
18 JGI25165J46597_1000030 3300003214 Bacteria 305254
19 JGI25153J46596_10000527 3300003215 Bacteria 24017
20 rootL2_10059351 3300003322 Bacteria 4970
21 rootL2_10082641 3300003322 Bacteria 4053
22 JGI25160J50197_1024978 3300003354 Bacteria 1682
23 JGI25161J50226_1005964 3300003374 Bacteria 2271
24 Ga0007409J51694_1018111 3300003575 Bacteria 1589
25 Ga0055538_1000017 3300003751 Bacteria 305254
26 Ga0055538_1000138 3300003751 Bacteria 51369
27 Ga0055539_1000022 3300003752 Bacteria 305254
28 Ga0055539_1000187 3300003752 Bacteria 51369
29 Ga0055533_1000030 3300003756 Bacteria 305254
30 Ga0055533_1000189 3300003756 Bacteria 51369
31 Ga0055532_1000184 3300003758 Bacteria 52595
32 Ga0055525_1000034 3300003759 Bacteria 305254
33 Ga0055525_1000254 3300003759 Bacteria 51369
34 Ga0055535_1013432 3300003761 Bacteria 1208
35 Ga0055529_1000097 3300003763 Bacteria 132109
36 Ga0055529_1001308 3300003763 Bacteria 8446
37 Ga0055526_1000030 3300003771 Bacteria 143833
38 Ga0055526_1000167 3300003771 Bacteria 57804
39 Ga0055526_1000696 3300003771 Bacteria 25648
40 Ga0055526_1001016 3300003771 Bacteria 20552
41 Ga0055526_1021142 3300003771 Bacteria 2277
42 Ga0055537_1000114 3300003773 Bacteria 60836
43 Ga0055534_1000398 3300003784 Bacteria 26851
44 Ga0055534_1001436 3300003784 Bacteria 9475
45 Ga0055528_1000683 3300003790 Bacteria 24377
46 Ga0055528_1001913 3300003790 Bacteria 11822
47 Ga0055530_10010680 3300003791 Bacteria 3367
48 Ga0055531_10018382 3300003794 Bacteria 2888
49 Ga0055541_1000015 3300003841 Bacteria 305254
50 Ga0055541_1000122 3300003841 Bacteria 51369
51 Ga0055543_1008303 3300004625 Bacteria 2309
52 Ga0065165_1000161 3300005262 Bacteria 116828
53 Ga0065165_1060300 3300005262 Bacteria 1041
54 Ga0065714_10108397 3300005288 Bacteria 1516
55 Ga0065704_10077125 3300005289 Bacteria 4847
56 Ga0065704_10175861 3300005289 Bacteria 1264
57 Ga0070658_10007092 3300005327 Bacteria 9045
58 Ga0070658_10026431 3300005327 Bacteria 4656
59 Ga0070658_10140070 3300005327 Bacteria 2020
60 Ga0070676_10004199 3300005328 Bacteria 7566
61 Ga0070676_10074245 3300005328 Bacteria 2048
62 Ga0070676_10449498 3300005328 Bacteria 906
63 Ga0070683_100181374 3300005329 Bacteria 1998
64 Ga0070670_100016771 3300005331 Bacteria 6285
65 Ga0070670_100202220 3300005331 Bacteria 1726
66 Ga0068869_100132290 3300005334 Bacteria 1919
67 Ga0070666_10074780 3300005335 Bacteria 2309
68 Ga0070680_100009867 3300005336 Bacteria 7349
69 Ga0070682_100012497 3300005337 Bacteria 4871
70 Ga0068868_100039188 3300005338 Bacteria 3681
71 Ga0068868_100054684 3300005338 Bacteria 3147
72 Ga0070660_100003375 3300005339 Bacteria 10984
73 Ga0070660_100267634 3300005339 Bacteria 1396
74 Ga0070660_100321858 3300005339 Bacteria 1270
75 Ga0070687_100102571 3300005343 Bacteria 1605
76 Ga0070661_100009715 3300005344 Bacteria 6673
77 Ga0070668_100059566 3300005347 Bacteria 2955
78 Ga0070668_100144430 3300005347 Bacteria 1920
79 Ga0070668_100574234 3300005347 Bacteria 984
80 Ga0070669_100050314 3300005353 Bacteria 3043
81 Ga0070669_100379589 3300005353 Bacteria 1152
82 Ga0070675_100016252 3300005354 Bacteria 5904
83 Ga0070675_100035845 3300005354 Bacteria 4034
84 Ga0070675_100657543 3300005354 Bacteria 953
85 Ga0070671_100013439 3300005355 Bacteria 6600
86 Ga0070671_100494674 3300005355 Bacteria 1052
87 Ga0070674_100007074 3300005356 Bacteria 6596
88 Ga0070673_100072473 3300005364 Bacteria 2770
89 Ga0070673_100373610 3300005364 Bacteria 1270
90 Ga0070673_100572690 3300005364 Bacteria 1028
91 Ga0070659_100005084 3300005366 Bacteria 9432
92 Ga0070659_100025581 3300005366 Bacteria 4535
93 Ga0070659_100047684 3300005366 Bacteria 3362
94 Ga0070667_100031274 3300005367 Bacteria 4438
95 Ga0070667_100051141 3300005367 Bacteria 3483
96 Ga0070700_100253903 3300005441 Bacteria 1263
97 Ga0070694_100152490 3300005444 Bacteria 1689
98 Ga0070663_100056072 3300005455 Bacteria 2822
99 Ga0070678_100113817 3300005456 Bacteria 2121
100 Ga0070662_100004735 3300005457 Bacteria 8625
101 Ga0070662_100020288 3300005457 Bacteria 4524
102 Ga0070662_100071262 3300005457 Bacteria 2562
103 Ga0070662_100114298 3300005457 Bacteria 2061
104 Ga0070681_10141338 3300005458 Bacteria 2337
105 Ga0068867_100003983 3300005459 Bacteria 10390
106 Ga0068867_100068393 3300005459 Bacteria 2650
107 Ga0068867_100154219 3300005459 Bacteria 1806
108 Ga0070698_100040134 3300005471 Bacteria 4813
109 Ga0070679_100001135 3300005530 Bacteria 23268
110 Ga0070684_100055097 3300005535 Bacteria 3465
111 Ga0070697_100609112 3300005536 Bacteria 960
112 Ga0068853_100081877 3300005539 Bacteria 2827
113 Ga0068853_100136891 3300005539 Bacteria 2196
114 Ga0068853_100370259 3300005539 Bacteria 1336
115 Ga0070672_100003086 3300005543 Bacteria 10747
116 Ga0070672_100006477 3300005543 Bacteria 7874
117 Ga0070672_100020307 3300005543 Bacteria 4843
118 Ga0070693_100003885 3300005547 Bacteria 7008
119 Ga0070704_100019965 3300005549 Bacteria 4312
120 Ga0068855_100016431 3300005563 Bacteria 8898
121 Ga0068855_100155206 3300005563 Bacteria 2601
122 Ga0068855_100468323 3300005563 Bacteria 1373
123 Ga0068855_100817558 3300005563 Bacteria 989
124 Ga0070664_100011679 3300005564 Bacteria 7127
125 Ga0070664_100058114 3300005564 Bacteria 3289
126 Ga0068857_100171310 3300005577 Bacteria 1973
127 Ga0068854_100005545 3300005578 Bacteria 7973
128 Ga0068854_100006914 3300005578 Bacteria 7235
129 Ga0068854_100284426 3300005578 Bacteria 1333
130 Ga0068856_100014658 3300005614 Bacteria 7568
131 Ga0068856_100105392 3300005614 Bacteria 2813
132 Ga0068852_100001864 3300005616 Bacteria 14345
133 Ga0068852_100016051 3300005616 Bacteria 5831
134 Ga0068852_100026218 3300005616 Bacteria 4734
135 Ga0068852_100032708 3300005616 Bacteria 4309
136 Ga0068852_100039754 3300005616 Bacteria 3962
137 Ga0068852_100089122 3300005616 Bacteria 2756
138 Ga0068859_100167420 3300005617 Bacteria 2278
139 Ga0068864_100025908 3300005618 Bacteria 4942
140 Ga0068864_100112595 3300005618 Bacteria 2425
141 Ga0068866_10005780 3300005718 Bacteria 5130
142 Ga0068861_100253840 3300005719 Bacteria 1502
143 Ga0068851_10039543 3300005834 Bacteria 2369
144 Ga0068851_10044585 3300005834 Bacteria 2239
145 Ga0068863_100025161 3300005841 Bacteria 5676
146 Ga0068863_100038014 3300005841 Bacteria 4580
147 Ga0068863_100058931 3300005841 Bacteria 3633
148 Ga0068858_100001998 3300005842 Bacteria 20859
149 Ga0068858_100039965 3300005842 Bacteria 4350
150 Ga0068860_100006591 3300005843 Bacteria 11658
151 Ga0068860_100007427 3300005843 Bacteria 10961
152 Ga0068862_100025452 3300005844 Bacteria 4969
153 Ga0070712_100474367 3300006175 Bacteria 1045
154 Ga0075362_10011637 3300006177 Bacteria 3471
155 Ga0097621_100161101 3300006237 Bacteria 1929
156 Ga0097621_100247032 3300006237 Bacteria 1561
157 Ga0097621_100366525 3300006237 Bacteria 1284
158 Ga0097621_100518447 3300006237 Bacteria 1082
159 Ga0068871_100028510 3300006358 Bacteria 4377
160 Ga0068871_100043305 3300006358 Bacteria 3616
161 Ga0068865_100018012 3300006881 Bacteria 4552
162 Ga0097620_100167407 3300006931 Bacteria 2278
163 Ga0079104_1000001 3300006946 Bacteria 521847
164 Ga0079104_1003285 3300006946 Bacteria 7707
165 Ga0099826_10000033 3300006948 Bacteria 120668
166 Ga0105244_10001268 3300009036 Bacteria 20676
167 Ga0105244_10002331 3300009036 Bacteria 14435
168 Ga0105244_10042192 3300009036 Bacteria 2360
169 Ga0105240_10001692 3300009093 Bacteria 37346
170 Ga0105240_10025647 3300009093 Bacteria 7742
171 Ga0105240_10396201 3300009093 Bacteria 1556
172 Ga0105240_10404556 3300009093 Bacteria 1537
173 Ga0111539_10053128 3300009094 Bacteria 4823
174 Ga0111539_11099926 3300009094 Bacteria 924
175 Ga0105245_10042161 3300009098 Bacteria 4071
176 Ga0105243_10012713 3300009148 Bacteria 6359
177 Ga0105243_10085443 3300009148 Bacteria 2586
178 Ga0105243_10239384 3300009148 Bacteria 1614
179 Ga0105243_10241511 3300009148 Bacteria 1608
180 Ga0105242_10075246 3300009176 Bacteria 2811
181 Ga0105248_10074587 3300009177 Bacteria 3813
182 Ga0105248_10229035 3300009177 Bacteria 2092
183 Ga0105248_10231964 3300009177 Bacteria 2078
184 Ga0105248_10304816 3300009177 Bacteria 1794
185 Ga0105237_10020036 3300009545 Bacteria 6904
186 Ga0105238_10000255 3300009551 Bacteria 59531
187 Ga0105238_10072050 3300009551 Bacteria 3452
188 Ga0105238_10139346 3300009551 Bacteria 2403
189 Ga0105238_10290698 3300009551 Bacteria 1616
190 Ga0105238_10600016 3300009551 Bacteria 1109
191 Ga0105249_10038942 3300009553 Bacteria 4314
192 Ga0105249_10148454 3300009553 Bacteria 2254
193 Ga0105239_10004709 3300010375 Bacteria 16200
194 Ga0105239_10006370 3300010375 Bacteria 13712
195 Ga0105239_10053867 3300010375 Bacteria 4412
196 Ga0105239_10694149 3300010375 Bacteria 1163
197 Ga0105246_10225218 3300011119 Bacteria 1473
198 Ga0157373_10012943 3300013100 Bacteria 6126
199 Ga0157373_10127244 3300013100 Bacteria 1792
200 Ga0157373_10187374 3300013100 Bacteria 1458
201 Ga0157371_10000003 3300013102 Bacteria 543317
202 Ga0157369_10074822 3300013105 Bacteria 3633
203 Ga0157374_10003229 3300013296 Bacteria 13694
204 Ga0157374_10061688 3300013296 Bacteria 3512
205 Ga0163162_10011979 3300013306 Bacteria 8457
206 Ga0163162_10012367 3300013306 Bacteria 8334
207 Ga0157372_10058889 3300013307 Bacteria 4295
208 Ga0157375_10021719 3300013308 Bacteria 5892
209 Ga0157375_10022979 3300013308 Bacteria 5748
210 Ga0157375_10061463 3300013308 Bacteria 3730
211 Ga0157375_10663720 3300013308 Bacteria 1198
212 Ga0163163_10146227 3300014325 Bacteria 2407
213 Ga0157380_10044658 3300014326 Bacteria 3474
214 Ga0157380_10048785 3300014326 Bacteria 3336
215 Ga0182008_10263676 3300014497 Bacteria 892
216 Ga0157379_10013161 3300014968 Bacteria 7243
217 Ga0157379_10016872 3300014968 Bacteria 6426
218 Ga0157376_10016557 3300014969 Bacteria 5601
219 Ga0157376_10233751 3300014969 Bacteria 1709
220 Ga0182006_1000007 3300015261 Bacteria 452190
221 Ga0182006_1000102 3300015261 Bacteria 94384
222 Ga0182006_1034063 3300015261 Bacteria 2040
223 Ga0182007_10001496 3300015262 Bacteria 12509
224 Ga0182007_10018972 3300015262 Bacteria 2480
225 Ga0182007_10063366 3300015262 Bacteria 1211
226 Ga0182005_1000006 3300015265 Bacteria 515188
227 Ga0182005_1000010 3300015265 Bacteria 434103
228 Ga0182005_1000134 3300015265 Bacteria 53164
229 Ga0163161_10049369 3300017792 Bacteria 3041
230 Ga0163161_10465340 3300017792 Bacteria 1024
231 Ga0213872_10000041 3300021361 Bacteria 118955
232 Ga0213872_10000167 3300021361 Bacteria 59191
233 Ga0213872_10000929 3300021361 Bacteria 20720
234 Ga0213872_10003231 3300021361 Bacteria 9101
235 Ga0213872_10069435 3300021361 Bacteria 1589
236 Ga0209435_100079 3300025206 Bacteria 51612
237 Ga0209435_100657 3300025206 Bacteria 6146
238 Ga0209760_100848 3300025207 Bacteria 3985
239 Ga0209436_100449 3300025208 Bacteria 18426
240 Ga0209436_107310 3300025208 Bacteria 2322
241 Ga0209784_100034 3300025224 Bacteria 305504
242 Ga0209784_100035 3300025224 Bacteria 299760
243 Ga0209566_100038 3300025225 Bacteria 305504
244 Ga0209566_100040 3300025225 Bacteria 299760
245 Ga0209674_100056 3300025226 Bacteria 305504
246 Ga0209674_100057 3300025226 Bacteria 299760
247 Ga0209672_105447 3300025228 Bacteria 2178
248 Ga0209147_100060 3300025229 Bacteria 249588
249 Ga0209563_100057 3300025230 Bacteria 305604
250 Ga0209563_100059 3300025230 Bacteria 299760
251 Ga0207427_101876 3300025231 Bacteria 6632
252 Ga0209437_100071 3300025233 Bacteria 305604
253 Ga0209437_100081 3300025233 Bacteria 271072
254 Ga0209258_100141 3300025242 Bacteria 166385
255 Ga0209258_107060 3300025242 Bacteria 1696
256 Ga0207425_1000009 3300025245 Bacteria 593135
257 Ga0207425_1000068 3300025245 Bacteria 124067
258 Ga0207425_1001046 3300025245 Bacteria 12809
259 Ga0209646_1000251 3300025246 Bacteria 53754
260 Ga0209646_1000265 3300025246 Bacteria 50897
261 Ga0209646_1000290 3300025246 Bacteria 42743
262 Ga0209026_1000330 3300025250 Bacteria 47453
263 Ga0209677_100035 3300025253 Bacteria 305504
264 Ga0209677_100036 3300025253 Bacteria 299760
265 Ga0209148_1001530 3300025254 Bacteria 11318
266 Ga0209759_1000473 3300025256 Bacteria 44908
267 Ga0209759_1000485 3300025256 Bacteria 43802
268 Ga0209129_1000061 3300025258 Bacteria 246061
269 Ga0209233_1000094 3300025261 Bacteria 305604
270 Ga0209565_1000032 3300025263 Bacteria 316777
271 Ga0209565_1001187 3300025263 Bacteria 12426
272 Ga0209565_1005779 3300025263 Bacteria 3553
273 Ga0209565_1006593 3300025263 Bacteria 3237
274 Ga0209565_1007733 3300025263 Bacteria 2871
275 Ga0209455_1000031 3300025272 Bacteria 519952
276 Ga0209455_1000820 3300025272 Bacteria 16895
277 Ga0209455_1003128 3300025272 Bacteria 6028
278 Ga0209673_1000029 3300025273 Bacteria 351978
279 Ga0209673_1004770 3300025273 Bacteria 7127
280 Ga0209130_1000833 3300025284 Bacteria 25861
281 Ga0209130_1001452 3300025284 Bacteria 15642
282 Ga0209130_1002479 3300025284 Bacteria 9193
283 Ga0209675_1000019 3300025291 Bacteria 351950
284 Ga0209675_1001158 3300025291 Bacteria 16010
285 Ga0209025_1001504 3300025294 Bacteria 30047
286 Ga0209025_1020665 3300025294 Bacteria 3586
287 Ga0209564_1000010 3300025295 Bacteria 885399
288 Ga0209564_1000067 3300025295 Bacteria 311242
289 Ga0209564_1000291 3300025295 Bacteria 101831
290 Ga0209564_1000315 3300025295 Bacteria 95095
291 Ga0209564_1001538 3300025295 Bacteria 22863
292 Ga0209758_1000101 3300025297 Bacteria 225913
293 Ga0209758_1001181 3300025297 Bacteria 33038
294 Ga0209050_1000040 3300025298 Bacteria 408492
295 Ga0209050_1000123 3300025298 Bacteria 195061
296 Ga0209256_1000018 3300025299 Bacteria 568467
297 Ga0209256_1000058 3300025299 Bacteria 272934
298 Ga0209256_1001142 3300025299 Bacteria 30135
299 Ga0209256_1002252 3300025299 Bacteria 16394
300 Ga0209256_1002524 3300025299 Bacteria 14704
301 Ga0209256_1008625 3300025299 Bacteria 4675
302 Ga0207426_1002785 3300025302 Bacteria 10501
303 Ga0209257_1000054 3300025304 Bacteria 416957
304 Ga0209257_1022074 3300025304 Bacteria 2284
305 Ga0207697_10197326 3300025315 Bacteria 885
306 Ga0207655_1001917 3300025728 Bacteria 17826
307 Ga0207655_1002585 3300025728 Bacteria 14437
308 Ga0207655_1087104 3300025728 Bacteria 1109
309 Ga0207682_10007962 3300025893 Bacteria 4206
310 Ga0207682_10139083 3300025893 Bacteria 1089
311 Ga0207642_10058223 3300025899 Bacteria 1782
312 Ga0207688_10219599 3300025901 Bacteria 1145
313 Ga0207680_10013820 3300025903 Bacteria 4158
314 Ga0207645_10009451 3300025907 Bacteria 6743
315 Ga0207645_10075307 3300025907 Bacteria 2160
316 Ga0207645_10245722 3300025907 Bacteria 1183
317 Ga0207643_10192237 3300025908 Bacteria 1239
318 Ga0207643_10259738 3300025908 Bacteria 1072
319 Ga0207705_10007914 3300025909 Bacteria 7800
320 Ga0207705_10150054 3300025909 Bacteria 1746
321 Ga0207705_10507884 3300025909 Bacteria 936
322 Ga0207695_10003241 3300025913 Bacteria 23170
323 Ga0207695_10004922 3300025913 Bacteria 18003
324 Ga0207671_10010224 3300025914 Bacteria 7766
325 Ga0207671_10012953 3300025914 Bacteria 6674
326 Ga0207693_10349281 3300025915 Bacteria 1157
327 Ga0207662_10002613 3300025918 Bacteria 9088
328 Ga0207657_10001836 3300025919 Bacteria 22933
329 Ga0207657_10029728 3300025919 Bacteria 4969
330 Ga0207657_10104136 3300025919 Bacteria 2351
331 Ga0207649_10031155 3300025920 Bacteria 3167
332 Ga0207649_10156682 3300025920 Bacteria 1574
333 Ga0207652_10005815 3300025921 Bacteria 10002
334 Ga0207681_10004802 3300025923 Bacteria 8311
335 Ga0207681_10130278 3300025923 Bacteria 1859
336 Ga0207681_10261937 3300025923 Bacteria 1354
337 Ga0207694_10000193 3300025924 Bacteria 61887
338 Ga0207694_10068785 3300025924 Bacteria 2765
339 Ga0207694_10215926 3300025924 Bacteria 1563
340 Ga0207650_10004090 3300025925 Bacteria 9960
341 Ga0207650_10114481 3300025925 Bacteria 2092
342 Ga0207650_10471805 3300025925 Bacteria 1046
343 Ga0207659_10053371 3300025926 Bacteria 2883
344 Ga0207659_10119689 3300025926 Bacteria 2016
345 Ga0207659_10187089 3300025926 Bacteria 1645
346 Ga0207659_10469214 3300025926 Bacteria 1062
347 Ga0207687_10131789 3300025927 Bacteria 1885
348 Ga0207644_10007449 3300025931 Bacteria 7135
349 Ga0207644_10182581 3300025931 Bacteria 1645
350 Ga0207690_10004063 3300025932 Bacteria 8647
351 Ga0207690_10021740 3300025932 Bacteria 3982
352 Ga0207690_10069485 3300025932 Bacteria 2423
353 Ga0207690_10335909 3300025932 Bacteria 1191
354 Ga0207706_10003874 3300025933 Bacteria 14233
355 Ga0207706_10009517 3300025933 Bacteria 8921
356 Ga0207706_10043365 3300025933 Bacteria 3986
357 Ga0207686_10023622 3300025934 Bacteria 3553
358 Ga0207686_10109241 3300025934 Bacteria 1862
359 Ga0207686_10332017 3300025934 Bacteria 1139
360 Ga0207669_10064183 3300025937 Bacteria 2271
361 Ga0207669_10200684 3300025937 Bacteria 1447
362 Ga0207669_10214007 3300025937 Bacteria 1409
363 Ga0207704_10030838 3300025938 Bacteria 3012
364 Ga0207704_10215592 3300025938 Bacteria 1416
365 Ga0207691_10023398 3300025940 Bacteria 5815
366 Ga0207691_10042166 3300025940 Bacteria 4207
367 Ga0207691_10094288 3300025940 Bacteria 2679
368 Ga0207691_10117245 3300025940 Bacteria 2362
369 Ga0207691_10255047 3300025940 Bacteria 1513
370 Ga0207691_10264903 3300025940 Bacteria 1481
371 Ga0207711_10016963 3300025941 Bacteria 6049
372 Ga0207711_10022414 3300025941 Bacteria 5280
373 Ga0207689_10009199 3300025942 Bacteria 8545
374 Ga0207689_10024820 3300025942 Bacteria 5026
375 Ga0207661_10084711 3300025944 Bacteria 2626
376 Ga0207679_10002742 3300025945 Bacteria 10896
377 Ga0207679_10051912 3300025945 Bacteria 3004
378 Ga0207667_10000946 3300025949 Bacteria 37051
379 Ga0207667_10007809 3300025949 Bacteria 12787
380 Ga0207667_10025505 3300025949 Bacteria 6468
381 Ga0207667_10047499 3300025949 Bacteria 4543
382 Ga0207667_10097646 3300025949 Bacteria 3032
383 Ga0207667_10393649 3300025949 Bacteria 1411
384 Ga0207651_10192944 3300025960 Bacteria 1626
385 Ga0207712_10164794 3300025961 Bacteria 1726
386 Ga0207668_10004465 3300025972 Bacteria 8226
387 Ga0207668_10248073 3300025972 Bacteria 1444
388 Ga0207640_10002854 3300025981 Bacteria 9268
389 Ga0207640_10123798 3300025981 Bacteria 1858
390 Ga0207640_10144246 3300025981 Bacteria 1740
391 Ga0207658_10006432 3300025986 Bacteria 8017
392 Ga0207658_10027327 3300025986 Bacteria 4007
393 Ga0207677_10045580 3300026023 Bacteria 2929
394 Ga0207677_10191446 3300026023 Bacteria 1618
395 Ga0207677_10212389 3300026023 Bacteria 1546
396 Ga0207703_10004840 3300026035 Bacteria 10958
397 Ga0207703_10007247 3300026035 Bacteria 8818
398 Ga0207703_10155663 3300026035 Bacteria 1997
399 Ga0207639_10017985 3300026041 Bacteria 5015
400 Ga0207639_10042297 3300026041 Bacteria 3414
401 Ga0207639_10053261 3300026041 Bacteria 3087
402 Ga0207639_10284816 3300026041 Bacteria 1455
403 Ga0207678_10514647 3300026067 Bacteria 1044
404 Ga0207708_10161090 3300026075 Bacteria 1772
405 Ga0207702_10059880 3300026078 Bacteria 3245
406 Ga0207702_10792858 3300026078 Bacteria 936
407 Ga0207641_10012562 3300026088 Bacteria 6942
408 Ga0207641_10045484 3300026088 Bacteria 3696
409 Ga0207641_10142731 3300026088 Bacteria 2162
410 Ga0207648_10014995 3300026089 Bacteria 7139
411 Ga0207648_10073729 3300026089 Bacteria 2975
412 Ga0207648_10105638 3300026089 Bacteria 2470
413 Ga0207676_10160692 3300026095 Bacteria 1946
414 Ga0207676_10216584 3300026095 Bacteria 1702
415 Ga0207676_10275111 3300026095 Bacteria 1526
416 Ga0207675_100004479 3300026118 Bacteria 13502
417 Ga0207675_100286924 3300026118 Bacteria 1600
418 Ga0207683_10019240 3300026121 Bacteria 5830
419 Ga0207683_10027233 3300026121 Bacteria 4939
420 Ga0207683_10131915 3300026121 Bacteria 2248
421 Ga0207698_10005137 3300026142 Bacteria 8045
422 Ga0207698_10031618 3300026142 Bacteria 3823
423 Ga0207698_10034855 3300026142 Bacteria 3675
424 Ga0207698_10284895 3300026142 Bacteria 1530
425 Ga0209281_1000151 3300027111 Bacteria 167268
426 Ga0209281_1003261 3300027111 Bacteria 5506
427 Ga0209282_1000014 3300027666 Bacteria 207318
428 Ga0268266_10561043 3300028379 Bacteria 1095
429 Ga0268265_10008762 3300028380 Bacteria 6835
430 Ga0268264_10002117 3300028381 Bacteria 17697
431 Ga0268264_10009653 3300028381 Bacteria 7994
432 Ga0268264_10104767 3300028381 Bacteria 2466
433 Ga0265323_10009697 3300028653 Bacteria 3923
434 Ga0307515_10000432 3300028794 Bacteria 100348
435 Ga0307515_10005908 3300028794 Bacteria 24693
436 Ga0307515_10024457 3300028794 Bacteria 10523
437 Ga0316177_1029947 3300030731 Bacteria 4994
438 Ga0316182_1085102 3300030745 Bacteria 1099
439 Ga0265325_10006514 3300031241 Bacteria 7081
440 Ga0265329_10000056 3300031242 Bacteria 49127
441 Ga0265339_10124660 3300031249 Bacteria 1321
442 Ga0265327_10192746 3300031251 Bacteria 927
443 Ga0265316_10000484 3300031344 Bacteria 45058
444 Ga0265316_10023663 3300031344 Bacteria 5157
445 Ga0265316_10100890 3300031344 Bacteria 2194
446 Ga0307408_100002393 3300031548 Bacteria 13234
447 Ga0307408_100030624 3300031548 Bacteria 3738
448 Ga0307408_100235289 3300031548 Bacteria 1502
449 Ga0307408_100424224 3300031548 Bacteria 1148
450 Ga0265313_10006226 3300031595 Bacteria 8521
451 Ga0265314_10005760 3300031711 Bacteria 11117
452 Ga0265342_10000405 3300031712 Bacteria 47657
453 Ga0265342_10001757 3300031712 Bacteria 19789
454 Ga0316576_10014776 3300031727 Bacteria 5221
455 Ga0316578_10000134 3300031728 Bacteria 18909
456 Ga0307516_10000127 3300031730 Bacteria 90180
457 Ga0307516_10003164 3300031730 Bacteria 21417
458 Ga0307516_10013408 3300031730 Bacteria 8738
459 Ga0307516_10157567 3300031730 Bacteria 2024
460 Ga0307405_10039787 3300031731 Bacteria 2844
461 Ga0307518_10067826 3300031838 Bacteria 2586
462 Ga0307412_10138629 3300031911 Bacteria 1778
463 Ga0307409_100025249 3300031995 Bacteria 4163
464 Ga0307416_100032061 3300032002 Bacteria 3965
465 Ga0307416_100142601 3300032002 Bacteria 2180
466 Ga0307414_10013571 3300032004 Bacteria 4855
467 Ga0307414_10044379 3300032004 Bacteria 3036
468 Ga0307411_10061113 3300032005 Bacteria 2506
469 Ga0307415_100020811 3300032126 Bacteria 4015
470 Ga0316593_10023535 3300032168 Bacteria 1945
471 Ga0316596_1015766 3300033541 Bacteria 1887
472 Ga0373954_0002027 3300035118 Bacteria 8419
473 Ga0373946_0066994 3300035171 Bacteria 1541
474 Ga0373962_0031080 3300035242 Bacteria 1464
475 Ga0316574_0012379 3300035398 Bacteria 4879
476 Ga0373931_0054053 3300035691 Bacteria 2145
477 Ga0373935_0085832 3300035692 Bacteria 2053
478 Ga0373933_0182179 3300035724 Bacteria 1340
479 Ga0373947_0223568 3300035725 Bacteria 1238
480 Ga0373937_0045307 3300036401 Bacteria 4020
481 Ga0373937_0218595 3300036401 Bacteria 1793
482 Ga0316584_0021567 3300036712 Bacteria 4684
483 Ga0316584_0135137 3300036712 Bacteria 1841
484 Ga0373925_0119245 3300037068 Bacteria 2047
485 Ga0395899_0000329 3300037312 Bacteria 60135
486 Ga0395899_0000787 3300037312 Bacteria 31050
487 Ga0395899_0019086 3300037312 Bacteria 5211
488 Ga0395899_0138806 3300037312 Bacteria 1731
489 Ga0395900_0012488 3300037418 Bacteria 8686
490 Ga0395900_0099595 3300037418 Bacteria 2985
491 Ga0395900_0376962 3300037418 Bacteria 1387
492 Ga0395900_0378752 3300037418 Bacteria 1383
493 Ga0395900_0812681 3300037418 Bacteria 862
494 Ga0395898_0000283 3300037466 Bacteria 122630
495 Ga0395898_0134878 3300037466 Bacteria 2364
496 Ga0395898_0208690 3300037466 Bacteria 1863
497 Ga0395905_0000703 3300037471 Bacteria 44419
498 Ga0395905_0005750 3300037471 Bacteria 12609
499 Ga0395905_0027360 3300037471 Bacteria 5377
500 Ga0395905_0052947 3300037471 Bacteria 3799
501 Ga0395905_0139583 3300037471 Bacteria 2280
502 Ga0395905_0232058 3300037471 Bacteria 1725
503 Ga0395901_0000881 3300038443 Bacteria 33019
504 Ga0395901_0015819 3300038443 Bacteria 7687
505 Ga0395901_0364545 3300038443 Bacteria 1489
506 Ga0400485_08530 3300038735 Bacteria 9384
507 Ga0400489_08019 3300039093 Bacteria 3322
508 Ga0436361_0136418 3300039447 Bacteria 7819
509 Ga0436361_0279393 3300039447 Bacteria 1911
510 Ga0436361_0391791 3300039447 Bacteria 42494
511 Ga0436361_0438991 3300039447 Bacteria 100787
512 Ga0436361_0599511 3300039447 Bacteria 4326
513 Ga0436361_0674579 3300039447 Bacteria 5395
514 Ga0436361_1059260 3300039447 Bacteria 1308
515 Ga0439441_052679 3300042001 Bacteria 842
516 Ga0450904_000871 3300042139 Bacteria 4938
517 Ga0451577_0001500 3300042876 Bacteria 30862
518 Ga0451577_0009424 3300042876 Bacteria 9411
519 Ga0466969_0000013 3300044656 Bacteria 111537
520 Ga0466972_0000453 3300044658 Bacteria 21090
521 Ga0466972_0003939 3300044658 Bacteria 7409
522 Ga0453683_0042631 3300044673 Bacteria 2849
523 Ga0466965_0000132 3300044683 Bacteria 21358
524 Ga0466965_0000278 3300044683 Bacteria 16904
525 Ga0466965_0048747 3300044683 Bacteria 2099
526 Ga0466965_0122743 3300044683 Bacteria 1342
527 Ga0466965_0168340 3300044683 Bacteria 1151
528 Ga0466966_0016417 3300044684 Bacteria 4892
529 Ga0466966_0020568 3300044684 Bacteria 4337
530 Ga0466966_0044546 3300044684 Bacteria 2840
531 Ga0466961_0049174 3300044693 Bacteria 2695
532 Ga0466964_0000573 3300044706 Bacteria 11581
533 Ga0466964_0018762 3300044706 Bacteria 2656
534 Ga0453684_0000694 3300044712 Bacteria 119688
535 Ga0466968_0012527 3300044735 Bacteria 3323
536 Ga0466968_0143545 3300044735 Bacteria 1093
537 Ga0466970_0267197 3300044765 Bacteria 960
538 Ga0466957_0017868 3300044842 Bacteria 4160
539 Ga0466957_0034529 3300044842 Bacteria 3034
540 Ga0466959_0002428 3300045049 Bacteria 11908
541 Ga0466959_0026613 3300045049 Bacteria 4287
542 Ga0466959_0043954 3300045049 Bacteria 3291
543 Ga0466959_0087527 3300045049 Bacteria 2240
544 Ga0451576_0008355 3300045051 Bacteria 12162
545 Ga0451576_0127712 3300045051 Bacteria 2649
546 Ga0451576_0739525 3300045051 Bacteria 1033
547 Ga0466958_0039431 3300045836 Bacteria 2838
548 Ga0466967_0132012 3300045976 Bacteria 2319
549 Ga0466967_0163069 3300045976 Bacteria 2093
550 Ga0495617_000128 3300046452 Bacteria 50370
551 Ga0495617_001419 3300046452 Bacteria 10526
552 Ga0495617_001910 3300046452 Bacteria 8763
553 Ga0495617_085941 3300046452 Bacteria 1028
554 Ga0495627_000004 3300046453 Bacteria 640612
555 Ga0495627_028838 3300046453 Bacteria 1770
556 Ga0495592_0010789 3300046454 Bacteria 6890
557 Ga0495603_0002466 3300046455 Bacteria 10887
558 Ga0495590_0000014 3300046457 Bacteria 258314
559 Ga0495590_0001614 3300046457 Bacteria 9648
560 Ga0495590_0001672 3300046457 Bacteria 9440
561 Ga0495590_0014643 3300046457 Bacteria 2860
562 Ga0495590_0029243 3300046457 Bacteria 1932
563 Ga0495629_0006457 3300046459 Bacteria 8688
564 Ga0495629_0024599 3300046459 Bacteria 4288
565 Ga0495638_0000064 3300046460 Bacteria 180807
566 Ga0495638_0004227 3300046460 Bacteria 10928
567 Ga0495638_0056035 3300046460 Bacteria 2446
568 Ga0495638_0155969 3300046460 Bacteria 1321
569 Ga0495651_0003413 3300046462 Bacteria 12184
570 Ga0495653_0000056 3300046463 Bacteria 100732
571 Ga0495653_0035719 3300046463 Bacteria 3919
572 Ga0495653_0228620 3300046463 Bacteria 1246
573 Ga0495650_0000062 3300046471 Bacteria 277977
574 Ga0495650_0000283 3300046471 Bacteria 96503
575 Ga0495650_0001144 3300046471 Bacteria 28755
576 Ga0495650_0001153 3300046471 Bacteria 28463
577 Ga0495650_0014839 3300046471 Bacteria 4025
578 Ga0495650_0032504 3300046471 Bacteria 2332
579 Ga0495650_0033108 3300046471 Bacteria 2303
580 Ga0495580_0226975 3300046472 Bacteria 1282
581 Ga0495582_0104406 3300046473 Bacteria 1588
582 Ga0495605_0000127 3300046474 Bacteria 100664
583 Ga0495605_0000225 3300046474 Bacteria 69738
584 Ga0495605_0001850 3300046474 Bacteria 13537
585 Ga0495605_0018816 3300046474 Bacteria 3697
586 Ga0495605_0026919 3300046474 Bacteria 2983
587 Ga0495605_0123489 3300046474 Bacteria 1172
588 Ga0495605_0128194 3300046474 Bacteria 1146
589 Ga0495584_0000040 3300046491 Bacteria 91797
590 Ga0495584_0001407 3300046491 Bacteria 14482
591 Ga0495584_0001529 3300046491 Bacteria 13753
592 Ga0495584_0002355 3300046491 Bacteria 10769
593 Ga0495584_0005114 3300046491 Bacteria 6967
594 Ga0495584_0005804 3300046491 Bacteria 6508
595 Ga0495584_0016289 3300046491 Bacteria 3790
596 Ga0495584_0027869 3300046491 Bacteria 2861
597 Ga0495584_0125292 3300046491 Bacteria 1302
598 Ga0495585_0000230 3300046492 Bacteria 57614
599 Ga0495585_0000566 3300046492 Bacteria 34921
600 Ga0495585_0000776 3300046492 Bacteria 28221
601 Ga0495585_0003019 3300046492 Bacteria 11596
602 Ga0495585_0003507 3300046492 Bacteria 10582
603 Ga0495585_0046525 3300046492 Bacteria 2419
604 Ga0495585_0070037 3300046492 Bacteria 1913
605 Ga0495585_0100033 3300046492 Bacteria 1551
606 Ga0495585_0180470 3300046492 Bacteria 1085
607 Ga0495594_0012651 3300046499 Bacteria 4399
608 Ga0495594_0079993 3300046499 Bacteria 1824
609 Ga0495596_0000671 3300046500 Bacteria 21298
610 Ga0495596_0001532 3300046500 Bacteria 13180
611 Ga0495596_0006464 3300046500 Bacteria 5387
612 Ga0495596_0007938 3300046500 Bacteria 4749
613 Ga0495607_0000853 3300046501 Bacteria 28749
614 Ga0495607_0001656 3300046501 Bacteria 19266
615 Ga0495607_0001772 3300046501 Bacteria 18457
616 Ga0495607_0003675 3300046501 Bacteria 11640
617 Ga0495607_0036798 3300046501 Bacteria 2946
618 Ga0495607_0256282 3300046501 Bacteria 840
619 Ga0495583_0000046 3300046506 Bacteria 218059
620 Ga0495583_0000137 3300046506 Bacteria 123815
621 Ga0495583_0000156 3300046506 Bacteria 114296
622 Ga0495583_0000231 3300046506 Bacteria 93091
623 Ga0495583_0000287 3300046506 Bacteria 80398
624 Ga0495583_0001530 3300046506 Bacteria 22917
625 Ga0495583_0001556 3300046506 Bacteria 22704
626 Ga0495583_0004187 3300046506 Bacteria 10504
627 Ga0495606_0000353 3300046507 Bacteria 78700
628 Ga0495606_0000400 3300046507 Bacteria 73341
629 Ga0495606_0000589 3300046507 Bacteria 57638
630 Ga0495606_0000933 3300046507 Bacteria 43050
631 Ga0495606_0001708 3300046507 Bacteria 28313
632 Ga0495606_0002937 3300046507 Bacteria 18821
633 Ga0495606_0006490 3300046507 Bacteria 10762
634 Ga0495606_0067300 3300046507 Bacteria 2268
635 Ga0495608_0018854 3300046511 Bacteria 4754
636 Ga0495610_0000027 3300046512 Bacteria 275273
637 Ga0495610_0001111 3300046512 Bacteria 24494
638 Ga0495610_0016864 3300046512 Bacteria 4185
639 Ga0495610_0036421 3300046512 Bacteria 2514
640 Ga0495616_0000072 3300046513 Bacteria 87767
641 Ga0495616_0002779 3300046513 Bacteria 11431
642 Ga0495616_0009303 3300046513 Bacteria 5759
643 Ga0495616_0059252 3300046513 Bacteria 1883
644 Ga0495616_0070870 3300046513 Bacteria 1686
645 Ga0495616_0221880 3300046513 Bacteria 822
646 Ga0495618_0021041 3300046514 Bacteria 4019
647 Ga0495620_0009333 3300046515 Bacteria 5223
648 Ga0495628_0000076 3300046516 Bacteria 78344
649 Ga0495628_0001441 3300046516 Bacteria 21826
650 Ga0495628_0115865 3300046516 Bacteria 2058
651 Ga0495628_0419528 3300046516 Bacteria 975
652 Ga0495631_0000290 3300046518 Bacteria 35042
653 Ga0495631_0001418 3300046518 Bacteria 14563
654 Ga0495631_0015619 3300046518 Bacteria 3632
655 Ga0495631_0038625 3300046518 Bacteria 2121
656 Ga0495632_0000403 3300046519 Bacteria 40753
657 Ga0495632_0004394 3300046519 Bacteria 9584
658 Ga0495637_0000430 3300046520 Bacteria 30664
659 Ga0495637_0009837 3300046520 Bacteria 4650
660 Ga0495637_0010156 3300046520 Bacteria 4564
661 Ga0495643_0000108 3300046522 Bacteria 136032
662 Ga0495643_0000255 3300046522 Bacteria 78465
663 Ga0495643_0000716 3300046522 Bacteria 38007
664 Ga0495643_0001683 3300046522 Bacteria 19297
665 Ga0495643_0020799 3300046522 Bacteria 3776
666 Ga0495643_0049091 3300046522 Bacteria 2277
667 Ga0495643_0067644 3300046522 Bacteria 1881
668 Ga0495643_0131709 3300046522 Bacteria 1254
669 Ga0495644_0005344 3300046523 Bacteria 5016
670 Ga0495644_0020071 3300046523 Bacteria 2550
671 Ga0495644_0026066 3300046523 Bacteria 2219
672 Ga0495648_0000006 3300046524 Bacteria 361208
673 Ga0495648_0000134 3300046524 Bacteria 87750
674 Ga0495648_0000841 3300046524 Bacteria 32356
675 Ga0495648_0002507 3300046524 Bacteria 16848
676 Ga0495648_0014318 3300046524 Bacteria 5813
677 Ga0495648_0023331 3300046524 Bacteria 4240
678 Ga0495648_0035462 3300046524 Bacteria 3233
679 Ga0495648_0045577 3300046524 Bacteria 2726
680 Ga0495648_0076198 3300046524 Bacteria 1926
681 Ga0495663_0003306 3300046525 Bacteria 4669
682 Ga0495666_0009701 3300046526 Bacteria 4810
683 Ga0495666_0015888 3300046526 Bacteria 3749
684 Ga0495642_0000871 3300046528 Bacteria 14228
685 Ga0495642_0002341 3300046528 Bacteria 7720
686 Ga0495642_0002943 3300046528 Bacteria 6788
687 Ga0495642_0003138 3300046528 Bacteria 6557
688 Ga0495642_0004427 3300046528 Bacteria 5452
689 Ga0495652_0005760 3300046529 Bacteria 11598
690 Ga0495652_0140029 3300046529 Bacteria 1903
691 Ga0495654_0000131 3300046530 Bacteria 80339
692 Ga0495654_0007219 3300046530 Bacteria 6232
693 Ga0495654_0024239 3300046530 Bacteria 3137
694 Ga0495654_0033901 3300046530 Bacteria 2580
695 Ga0495665_0065133 3300046531 Bacteria 1923
696 Ga0495586_0025907 3300046535 Bacteria 3137
697 Ga0495587_0083004 3300046536 Bacteria 1856
698 Ga0495609_0000136 3300046538 Bacteria 77986
699 Ga0495609_0001765 3300046538 Bacteria 13888
700 Ga0495609_0006092 3300046538 Bacteria 6204
701 Ga0495609_0026224 3300046538 Bacteria 2669
702 Ga0495621_0109696 3300046539 Bacteria 1057
703 Ga0495597_0000091 3300046542 Bacteria 80111
704 Ga0495597_0000223 3300046542 Bacteria 51556
705 Ga0495597_0000882 3300046542 Bacteria 23337
706 Ga0495597_0000971 3300046542 Bacteria 22161
707 Ga0495597_0001469 3300046542 Bacteria 16900
708 Ga0495597_0007404 3300046542 Bacteria 5575
709 Ga0495597_0034443 3300046542 Bacteria 2288
710 Ga0495597_0052294 3300046542 Bacteria 1799
711 Ga0495645_0016449 3300046543 Bacteria 5282
712 Ga0495645_0055606 3300046543 Bacteria 2874
713 Ga0495622_0000013 3300046557 Bacteria 186778
714 Ga0495622_0005626 3300046557 Bacteria 5812
715 Ga0495622_0115802 3300046557 Bacteria 1225
716 Ga0495622_0224052 3300046557 Bacteria 832
717 Ga0495633_0001545 3300046558 Bacteria 17672
718 Ga0495633_0002191 3300046558 Bacteria 13994
719 Ga0495633_0002981 3300046558 Bacteria 11576
720 Ga0495633_0003195 3300046558 Bacteria 11064
721 Ga0495633_0015631 3300046558 Bacteria 3934
722 Ga0495633_0148610 3300046558 Bacteria 1082
723 Ga0495633_0168873 3300046558 Bacteria 1008
724 Ga0495656_0000675 3300046615 Bacteria 10967
725 Ga0495656_0037159 3300046615 Bacteria 2009
726 Ga0495668_0000029 3300046616 Bacteria 279128
727 Ga0495668_0000119 3300046616 Bacteria 118812
728 Ga0495668_0000209 3300046616 Bacteria 84817
729 Ga0495668_0000359 3300046616 Bacteria 60366
730 Ga0495668_0003302 3300046616 Bacteria 12217
731 Ga0495668_0022417 3300046616 Bacteria 3609
732 Ga0495668_0086796 3300046616 Bacteria 1716
733 Ga0495611_0015040 3300046648 Bacteria 3307
734 Ga0495611_0018009 3300046648 Bacteria 3026
735 Ga0495625_0000871 3300046660 Bacteria 41066
736 Ga0495625_0001309 3300046660 Bacteria 31061
737 Ga0495625_0001595 3300046660 Bacteria 26843
738 Ga0495625_0007432 3300046660 Bacteria 9533
739 Ga0495625_0007978 3300046660 Bacteria 9097
740 Ga0495625_0010041 3300046660 Bacteria 7868
741 Ga0495625_0011228 3300046660 Bacteria 7324
742 Ga0495625_0015358 3300046660 Bacteria 6067
743 Ga0495659_0001898 3300046664 Bacteria 6884
744 Ga0495659_0002191 3300046664 Bacteria 6372
745 Ga0495659_0044416 3300046664 Bacteria 1598
746 Ga0495661_0000979 3300046665 Bacteria 25811
747 Ga0495661_0007457 3300046665 Bacteria 7631
748 Ga0495661_0013316 3300046665 Bacteria 5529
749 Ga0495661_0021185 3300046665 Bacteria 4239
750 Ga0495661_0027022 3300046665 Bacteria 3688
751 Ga0495661_0055997 3300046665 Bacteria 2361
752 Ga0495588_0000091 3300046674 Bacteria 183183
753 Ga0495588_0077315 3300046674 Bacteria 1735
754 Ga0495657_0041222 3300046675 Bacteria 3162
755 Ga0495657_0277382 3300046675 Bacteria 1004
756 Ga0495599_0003657 3300046678 Bacteria 9015
757 Ga0495599_0071047 3300046678 Bacteria 2173
758 Ga0495623_0000743 3300046679 Bacteria 21830
759 Ga0495646_0005231 3300046680 Bacteria 8180
760 Ga0495646_0161407 3300046680 Bacteria 1240
761 Ga0495658_0009494 3300046683 Bacteria 4851
762 Ga0495658_0073811 3300046683 Bacteria 1987
763 Ga0495669_0000021 3300046684 Bacteria 121650
764 Ga0495669_0001117 3300046684 Bacteria 11129
765 Ga0495613_0117767 3300046689 Bacteria 1910
766 Ga0495624_0036851 3300046690 Bacteria 3150
767 Ga0495624_0062485 3300046690 Bacteria 2329
768 Ga0495670_0016780 3300046691 Bacteria 3600
769 Ga0495670_0035008 3300046691 Bacteria 2502
770 Ga0495670_0063015 3300046691 Bacteria 1866
771 Ga0495670_0064268 3300046691 Bacteria 1848
772 Ga0495670_0074575 3300046691 Bacteria 1721
773 Ga0495671_0000106 3300046692 Bacteria 74947
774 Ga0495671_0002593 3300046692 Bacteria 11369
775 Ga0495671_0022032 3300046692 Bacteria 3341
776 Ga0495671_0051785 3300046692 Bacteria 2041
777 Ga0495671_0111413 3300046692 Bacteria 1336
778 Ga0495649_0000549 3300046694 Bacteria 31847
779 Ga0495649_0000709 3300046694 Bacteria 27174
780 Ga0495649_0014906 3300046694 Bacteria 4442
781 Ga0495649_0015177 3300046694 Bacteria 4385
782 Ga0495589_0000269 3300046794 Bacteria 42228
783 Ga0495600_0000340 3300046809 Bacteria 24902
784 Ga0495660_0000823 3300046810 Bacteria 23073
785 Ga0495660_0001854 3300046810 Bacteria 13878
786 Ga0495660_0015627 3300046810 Bacteria 4386
787 Ga0495660_0016122 3300046810 Bacteria 4310
788 Ga0495660_0047240 3300046810 Bacteria 2358
789 Ga0495660_0073796 3300046810 Bacteria 1803
790 Ga0495660_0086344 3300046810 Bacteria 1637
791 Ga0495581_0175579 3300047315 Bacteria 1252
792 Ga0495604_0085636 3300047317 Bacteria 2351
793 Ga0495604_0227925 3300047317 Bacteria 1279
794 Ga0495636_0000933 3300047318 Bacteria 10904
795 Ga0495636_0002175 3300047318 Bacteria 7515
796 Ga0495636_0006937 3300047318 Bacteria 4455
797 Ga0495636_0053940 3300047318 Bacteria 1688
798 Ga0495636_0122325 3300047318 Bacteria 1152
799 Ga0495674_0032572 3300047319 Bacteria 4727
800 Ga0495672_0000088 3300047320 Bacteria 153860
801 Ga0495672_0001122 3300047320 Bacteria 27137
802 Ga0495676_0028858 3300047321 Bacteria 4732
803 Ga0495676_0094213 3300047321 Bacteria 2231
804 Ga0495680_0054419 3300047322 Bacteria 3108
805 Ga0495680_0183159 3300047322 Bacteria 1510
806 Ga0495683_0000125 3300047323 Bacteria 76538
807 Ga0495683_0000892 3300047323 Bacteria 21047
808 Ga0495683_0018689 3300047323 Bacteria 3581
809 Ga0495687_000042 3300047443 Bacteria 218868
810 Ga0495687_000115 3300047443 Bacteria 122883
811 Ga0495687_001828 3300047443 Bacteria 18701
812 Ga0495687_003232 3300047443 Bacteria 12032
813 Ga0495687_003687 3300047443 Bacteria 10903
814 Ga0495687_009013 3300047443 Bacteria 5634
815 Ga0495687_011544 3300047443 Bacteria 4741
816 Ga0495675_0008756 3300047444 Bacteria 6282
817 Ga0495677_0000156 3300047445 Bacteria 32695
818 Ga0495677_0006078 3300047445 Bacteria 4563
819 Ga0495677_0019510 3300047445 Bacteria 2458
820 Ga0495677_0102268 3300047445 Bacteria 1085
821 Ga0495685_000523 3300047447 Bacteria 11867
822 Ga0495685_001719 3300047447 Bacteria 6743
823 Ga0495685_006046 3300047447 Bacteria 3956
824 Ga0495673_0000008 3300047469 Bacteria 752462
825 Ga0495673_0000009 3300047469 Bacteria 731993
826 Ga0495673_0000185 3300047469 Bacteria 100703
827 Ga0495673_0007424 3300047469 Bacteria 6304
828 Ga0495681_0000278 3300047470 Bacteria 40906
829 Ga0495681_0000951 3300047470 Bacteria 22261
830 Ga0495681_0001142 3300047470 Bacteria 20166
831 Ga0495681_0010879 3300047470 Bacteria 5471
832 Ga0495684_0058149 3300047471 Bacteria 2946
833 Ga0495686_0000212 3300047472 Bacteria 107418
834 Ga0495686_0001207 3300047472 Bacteria 29745
835 Ga0495686_0003602 3300047472 Bacteria 13287
836 Ga0495686_0004528 3300047472 Bacteria 11390
837 Ga0495686_0011929 3300047472 Bacteria 6105
838 Ga0495686_0019954 3300047472 Bacteria 4473
839 Ga0495686_0115612 3300047472 Bacteria 1604
840 Ga0495686_0147370 3300047472 Bacteria 1384
841 Ga0495593_0001579 3300047673 Bacteria 13434
842 Ga0495593_0009011 3300047673 Bacteria 5791
843 Ga0495602_0059604 3300048088 Bacteria 3331
844 Ga0495602_0168608 3300048088 Bacteria 1701
845 Ga0495626_0000043 3300048091 Bacteria 168109
846 Ga0495626_0000091 3300048091 Bacteria 118146
847 Ga0495626_0000667 3300048091 Bacteria 33004
848 Ga0495626_0001829 3300048091 Bacteria 15989
849 Ga0495626_0004783 3300048091 Bacteria 8170
850 Ga0495626_0008166 3300048091 Bacteria 5767
851 Ga0495626_0024848 3300048091 Bacteria 2933
852 Ga0495626_0084997 3300048091 Bacteria 1400
853 Ga0496101_0136173 3300048904 Bacteria 1869
854 Ga0496102_0001181 3300048905 Bacteria 23797
855 Ga0496102_0370989 3300048905 Bacteria 1347
856 Ga0496103_0010503 3300048906 Bacteria 5480
857 Ga0496103_0212373 3300048906 Bacteria 1244
858 Ga0496104_0039773 3300048907 Bacteria 4404
859 Ga0496104_0040104 3300048907 Bacteria 4388
860 Ga0496105_0037751 3300048908 Bacteria 3978
861 Ga0496106_0190134 3300048909 Bacteria 1632
862 Ga0496107_0086074 3300048910 Bacteria 2294
863 Ga0496107_0113128 3300048910 Bacteria 1996
864 Ga0496108_0056737 3300048911 Bacteria 3291
865 Ga0496108_0407208 3300048911 Bacteria 1188
866 Ga0496109_0082777 3300048912 Bacteria 2958
867 Ga0496110_0021592 3300048913 Bacteria 5454
868 Ga0496110_0085888 3300048913 Bacteria 2809
869 Ga0496110_0706778 3300048913 Bacteria 910
870 Ga0496111_0003127 3300048914 Bacteria 10186
871 Ga0496111_0503122 3300048914 Bacteria 892
872 Ga0496112_0116693 3300048915 Bacteria 2640
873 Ga0496114_0005135 3300048917 Bacteria 10210
874 Ga0496114_0101555 3300048917 Bacteria 2456
875 Ga0496115_0068854 3300048918 Bacteria 2866
876 Ga0496115_0213154 3300048918 Bacteria 1595
877 Ga0496116_0024641 3300048919 Bacteria 4444
878 Ga0496117_0000005 3300048920 Bacteria 777468
879 Ga0496117_0016121 3300048920 Bacteria 6323
880 Ga0496118_0000022 3300048921 Bacteria 438602
881 Ga0496118_0014998 3300048921 Bacteria 7207
882 Ga0496121_0009122 3300048924 Bacteria 11480
883 Ga0496121_0102810 3300048924 Bacteria 2200
884 Ga0496122_0000968 3300048925 Bacteria 51537
885 Ga0496122_0006223 3300048925 Bacteria 13823
886 Ga0496122_0009051 3300048925 Bacteria 10568
887 Ga0496122_0012265 3300048925 Bacteria 8565
888 Ga0496122_0267623 3300048925 Bacteria 944
889 Ga0496123_0000983 3300048926 Bacteria 44022
890 Ga0496123_0002475 3300048926 Bacteria 22799
891 Ga0496123_0012980 3300048926 Bacteria 7039
892 Ga0496123_0048162 3300048926 Bacteria 2870
893 Ga0496124_0001001 3300048927 Bacteria 44775
894 Ga0496124_0036741 3300048927 Bacteria 4268
895 Ga0496124_0081285 3300048927 Bacteria 2664
896 Ga0496124_0169625 3300048927 Bacteria 1692
897 Ga0496125_0001086 3300048928 Bacteria 41927
898 Ga0496125_0003905 3300048928 Bacteria 17598
899 Ga0496125_0007199 3300048928 Bacteria 11860
900 Ga0496125_0018481 3300048928 Bacteria 6620
901 Ga0496125_0075761 3300048928 Bacteria 2601
902 Ga0496126_0006515 3300048929 Bacteria 12994
903 Ga0496126_0075641 3300048929 Bacteria 2988
904 Ga0495678_000149 3300049459 Bacteria 84717
905 Ga0495678_000259 3300049459 Bacteria 59034
906 Ga0495678_000652 3300049459 Bacteria 31953
907 Ga0495678_005168 3300049459 Bacteria 7312
908 Ga0495682_0000585 3300049460 Bacteria 24747
909 Ga0495682_0000819 3300049460 Bacteria 19524
910 Ga0495682_0002024 3300049460 Bacteria 9991
911 Ga0495682_0009318 3300049460 Bacteria 3834
912 Ga0501316_007077 3300049532 Bacteria 1210
913 Ga0501031_0275151 3300049568 Bacteria 1093
914 Ga0501032_0185265 3300049569 Bacteria 1362
915 Ga0501033_0001795 3300049570 Bacteria 18727
916 Ga0501036_0136855 3300049572 Bacteria 2067
917 Ga0501038_0637578 3300049574 Bacteria 803
918 Ga0501039_0157376 3300049575 Bacteria 1785
919 Ga0501039_0194198 3300049575 Bacteria 1596
920 Ga0501040_0007105 3300049576 Bacteria 7253
921 Ga0501043_0322791 3300049579 Bacteria 1177
922 Ga0501047_0003401 3300049581 Bacteria 15066
923 Ga0501048_0007051 3300049582 Bacteria 8537
924 Ga0501048_0254721 3300049582 Bacteria 1247
925 Ga0501067_0276512 3300049583 Bacteria 935
926 Ga0501069_0043257 3300049585 Bacteria 2492
927 Ga0501070_0006609 3300049586 Bacteria 9867
928 Ga0501070_0010057 3300049586 Bacteria 8002
929 Ga0501070_0104394 3300049586 Bacteria 2343
930 Ga0501072_0002698 3300049588 Bacteria 13315
931 Ga0501074_0001841 3300049590 Bacteria 14534
932 Ga0501075_0004622 3300049591 Bacteria 9342
933 Ga0501076_0000088 3300049592 Bacteria 48517
934 Ga0501077_0040395 3300049593 Bacteria 2972
935 Ga0501230_000829 3300049667 Bacteria 3417
936 Ga0501238_005139 3300049671 Bacteria 1651
937 Ga0501079_0001059 3300049741 Bacteria 19101
938 Ga0501080_0474110 3300049742 Bacteria 1120
939 Ga0501081_0010465 3300049743 Bacteria 6052
940 Ga0501269_000164 3300049766 Bacteria 20408
941 Ga0501279_002426 3300049775 Bacteria 2447
942 Ga0501035_0001552 3300049822 Bacteria 23412
943 Ga0501035_0054021 3300049822 Bacteria 3590
944 Ga0501035_0514817 3300049822 Bacteria 983
945 Ga0501044_0000185 3300049823 Bacteria 77663
946 Ga0501044_0001443 3300049823 Bacteria 27936
947 Ga0501044_0275538 3300049823 Bacteria 1617
948 Ga0501045_0004039 3300049824 Bacteria 10117
949 nmdc:mga00v17_126051_c1 3300050491 Bacteria 1634
950 nmdc:mga0n895_378667_c1 3300050512 Bacteria 1432
951 Ga0495601_0002072 3300053077 Bacteria 11252
952 Ga0495619_0128040 3300053085 Bacteria 1744
953 Ga0500595_016546 3300053119 Bacteria 2744
954 Ga0500607_058486 3300053121 Unclassified 2028
955 Ga0500618_000557 3300053125 Bacteria 23163
956 Ga0500618_003629 3300053125 Bacteria 5224
957 Ga0500559_0014184 3300053136 Bacteria 3368
958 Ga0500574_002040 3300053141 Bacteria 3212
959 Ga0500586_000137 3300053145 Bacteria 13327
960 Ga0500619_000170 3300053154 Bacteria 15695
961 Ga0500619_000263 3300053154 Bacteria 11028
962 Ga0587082_036398 3300059504 Bacteria 883
963 Ga0587083_0002118 3300059505 Bacteria 2408
964 Ga0587072_011698 3300059643 Bacteria 1439
965 Ga0501082_0011645 3300060353 Bacteria 7561
966 Ga0530510_0001266 3300061734 Bacteria 16876
967 2511247489 2511231003 Bacteria 5606035
968 2511384300 2511231026 Bacteria 5225445
969 2521560911 2521172590 Bacteria 5047645
970 2550696641 2548876994 Bacteria 4904866
971 2553007620 2551306416 Bacteria 6152985
972 2578338350 2576861424 Bacteria 5270569
973 2601671231 2600255292 Bacteria 6300551
974 2643792722 2643221554 Bacteria 6603920
975 2644028145 2643221603 Bacteria 6147767
976 2644212842 2643221638 Bacteria 6579467
977 2644254894 2643221645 Bacteria 7207331
978 2644359320 2643221664 Bacteria 7272945
979 2738738255 2738541280 Bacteria 6630198
980 2738826610 2738541297 Bacteria 6549566
981 2738842938 2738541300 Bacteria 6675882
982 2739150407 2738541357 Bacteria 6549408
983 2739192326 2738543003 Bacteria 6549560
984 2739273686 2738543018 Bacteria 6718814
985 2739318803 2738543026 Bacteria 6549408
986 2739337044 2738543029 Bacteria 6549249
987 2739342730 2738543030 Bacteria 6719714
988 2765567347 2765235838 Bacteria 5445269
989 2808984255 2808606386 Bacteria 4471946
990 2809132059 2808606415 Bacteria 4576710
991 2809151682 2808606419 Bacteria 4576925
992 2819542297 2818991436 Bacteria 5376622
993 2819594315 2818991445 Bacteria 4955017
994 2819618781 2818991449 Bacteria 5518009
995 2821135322 2821131069 Bacteria 6108407
996 2839095431 2839094727 Bacteria 5534556
997 2842717386 2842711865 Bacteria 7155354
998 2852622858 2852618963 Bacteria 4577824
999 2857548925 2857547612 Bacteria 6179999
1000 2857556433 2857553236 Bacteria 6166726
1001 2857562167 2857558681 Bacteria 6617694
1002 2857567839 2857564685 Bacteria 6290584
1003 2884811650 2884811622 Bacteria 5552861
1004 2884840708 2884836552 Bacteria 5219991
1005 2884857696 2884852848 Bacteria 5221161
1006 2885080990 2885080285 Bacteria 6355622
1007 2889418852 2889415604 Bacteria 8048700
1008 2896158636 2896154374 Bacteria 5221518
1009 2904427915 2904424332 Bacteria 7633521
1010 2904442466 2904439833 Bacteria 5931679
1011 2904533733 2904530477 Bacteria 5876334
1012 2904589430 2904584206 Bacteria 6028872
1013 2904595133 2904589729 Bacteria 6113573
1014 2904602365 2904601388 Bacteria 5884906
1015 2919050713 2919046199 Bacteria 5567169
1016 2919084908 2919079590 Bacteria 5946433
1017 2919441091 2919437846 Bacteria 6199444
1018 2919476797 2919476304 Bacteria 5888696
1019 2923514751 2923510766 Bacteria 5926163
1020 2928135647 2928130867 Bacteria 5467269
1021 2932415379 2932410948 Bacteria 6312192
1022 2932421460 2932416698 Bacteria 6315112
1023 8048747327 8048746797 Bacteria 3557226
1024 Ga0496102_0255934
1025 SwRhRL2b_contig_1435602
1026 JGI24737J22298_10007165
1027 JGI25155J39150_1000170
1028 JGI25155J39150_1000681
1029 JGI25156J39149_1000293
1030 JGI25162J39368_1000148
1031 JGI25154J39366_1000260
1032 JGI25154J39366_1000267
1033 JGI25154J39366_1001696
1034 JGI25158J39367_1003777
1035 JGI25157J39369_1000327
1036 JGI25152J39213_1012831
1037 JGI25150J39212_1001790
1038 JGI25150J39212_1003475
1039 JGI25159J45721_1012602
1040 JGI25159J45721_1014381
1041 JGI25165J46597_1000030
1042 JGI25153J46596_10000527
1043 rootL2_10059351
1044 rootL2_10082641
1045 JGI25160J50197_1024978
1046 JGI25161J50226_1005964
1047 Ga0007409J51694_1018111
1048 Ga0055538_1000017
1049 Ga0055538_1000138
1050 Ga0055539_1000022
1051 Ga0055539_1000187
1052 Ga0055533_1000030
1053 Ga0055533_1000189
1054 Ga0055532_1000184
1055 Ga0055525_1000034
1056 Ga0055525_1000254
1057 Ga0055535_1013432
1058 Ga0055529_1000097
1059 Ga0055529_1001308
1060 Ga0055526_1000030
1061 Ga0055526_1000167
1062 Ga0055526_1000696
1063 Ga0055526_1001016
1064 Ga0055526_1021142
1065 Ga0055537_1000114
1066 Ga0055534_1000398
1067 Ga0055534_1001436
1068 Ga0055528_1000683
1069 Ga0055528_1001913
1070 Ga0055530_10010680
1071 Ga0055531_10018382
1072 Ga0055541_1000015
1073 Ga0055541_1000122
1074 Ga0055543_1008303
1075 Ga0065165_1000161
1076 Ga0065165_1060300
1077 Ga0065714_10108397
1078 Ga0065704_10077125
1079 Ga0065704_10175861
1080 Ga0070658_10007092
1081 Ga0070658_10026431
1082 Ga0070658_10140070
1083 Ga0070676_10004199
1084 Ga0070676_10074245
1085 Ga0070676_10449498
1086 Ga0070683_100181374
1087 Ga0070670_100016771
1088 Ga0070670_100202220
1089 Ga0068869_100132290
1090 Ga0070666_10074780
1091 Ga0070680_100009867
1092 Ga0070682_100012497
1093 Ga0068868_100039188
1094 Ga0068868_100054684
1095 Ga0070660_100003375
1096 Ga0070660_100267634
1097 Ga0070660_100321858
1098 Ga0070687_100102571
1099 Ga0070661_100009715
1100 Ga0070668_100059566
1101 Ga0070668_100144430
1102 Ga0070668_100574234
1103 Ga0070669_100050314
1104 Ga0070669_100379589
1105 Ga0070675_100016252
1106 Ga0070675_100035845
1107 Ga0070675_100657543
1108 Ga0070671_100013439
1109 Ga0070671_100494674
1110 Ga0070674_100007074
1111 Ga0070673_100072473
1112 Ga0070673_100373610
1113 Ga0070673_100572690
1114 Ga0070659_100005084
1115 Ga0070659_100025581
1116 Ga0070659_100047684
1117 Ga0070667_100031274
1118 Ga0070667_100051141
1119 Ga0070700_100253903
1120 Ga0070694_100152490
1121 Ga0070663_100056072
1122 Ga0070678_100113817
1123 Ga0070662_100004735
1124 Ga0070662_100020288
1125 Ga0070662_100071262
1126 Ga0070662_100114298
1127 Ga0070681_10141338
1128 Ga0068867_100003983
1129 Ga0068867_100068393
1130 Ga0068867_100154219
1131 Ga0070698_100040134
1132 Ga0070679_100001135
1133 Ga0070684_100055097
1134 Ga0070697_100609112
1135 Ga0068853_100081877
1136 Ga0068853_100136891
1137 Ga0068853_100370259
1138 Ga0070672_100003086
1139 Ga0070672_100006477
1140 Ga0070672_100020307
1141 Ga0070693_100003885
1142 Ga0070704_100019965
1143 Ga0068855_100016431
1144 Ga0068855_100155206
1145 Ga0068855_100468323
1146 Ga0068855_100817558
1147 Ga0070664_100011679
1148 Ga0070664_100058114
1149 Ga0068857_100171310
1150 Ga0068854_100005545
1151 Ga0068854_100006914
1152 Ga0068854_100284426
1153 Ga0068856_100014658
1154 Ga0068856_100105392
1155 Ga0068852_100001864
1156 Ga0068852_100016051
1157 Ga0068852_100026218
1158 Ga0068852_100032708
1159 Ga0068852_100039754
1160 Ga0068852_100089122
1161 Ga0068859_100167420
1162 Ga0068864_100025908
1163 Ga0068864_100112595
1164 Ga0068866_10005780
1165 Ga0068861_100253840
1166 Ga0068851_10039543
1167 Ga0068851_10044585
1168 Ga0068863_100025161
1169 Ga0068863_100038014
1170 Ga0068863_100058931
1171 Ga0068858_100001998
1172 Ga0068858_100039965
1173 Ga0068860_100006591
1174 Ga0068860_100007427
1175 Ga0068862_100025452
1176 Ga0070712_100474367
1177 Ga0075362_10011637
1178 Ga0097621_100161101
1179 Ga0097621_100247032
1180 Ga0097621_100366525
1181 Ga0097621_100518447
1182 Ga0068871_100028510
1183 Ga0068871_100043305
1184 Ga0068865_100018012
1185 Ga0097620_100167407
1186 Ga0079104_1000001
1187 Ga0079104_1003285
1188 Ga0099826_10000033
1189 Ga0105244_10001268
1190 Ga0105244_10002331
1191 Ga0105244_10042192
1192 Ga0105240_10001692
1193 Ga0105240_10025647
1194 Ga0105240_10396201
1195 Ga0105240_10404556
1196 Ga0111539_10053128
1197 Ga0111539_11099926
1198 Ga0105245_10042161
1199 Ga0105243_10012713
1200 Ga0105243_10085443
1201 Ga0105243_10239384
1202 Ga0105243_10241511
1203 Ga0105242_10075246
1204 Ga0105248_10074587
1205 Ga0105248_10229035
1206 Ga0105248_10231964
1207 Ga0105248_10304816
1208 Ga0105237_10020036
1209 Ga0105238_10000255
1210 Ga0105238_10072050
1211 Ga0105238_10139346
1212 Ga0105238_10290698
1213 Ga0105238_10600016
1214 Ga0105249_10038942
1215 Ga0105249_10148454
1216 Ga0105239_10004709
1217 Ga0105239_10006370
1218 Ga0105239_10053867
1219 Ga0105239_10694149
1220 Ga0105246_10225218
1221 Ga0157373_10012943
1222 Ga0157373_10127244
1223 Ga0157373_10187374
1224 Ga0157371_10000003
1225 Ga0157369_10074822
1226 Ga0157374_10003229
1227 Ga0157374_10061688
1228 Ga0163162_10011979
1229 Ga0163162_10012367
1230 Ga0157372_10058889
1231 Ga0157375_10021719
1232 Ga0157375_10022979
1233 Ga0157375_10061463
1234 Ga0157375_10663720
1235 Ga0163163_10146227
1236 Ga0157380_10044658
1237 Ga0157380_10048785
1238 Ga0182008_10263676
1239 Ga0157379_10013161
1240 Ga0157379_10016872
1241 Ga0157376_10016557
1242 Ga0157376_10233751
1243 Ga0182006_1000007
1244 Ga0182006_1000102
1245 Ga0182006_1034063
1246 Ga0182007_10001496
1247 Ga0182007_10018972
1248 Ga0182007_10063366
1249 Ga0182005_1000006
1250 Ga0182005_1000010
1251 Ga0182005_1000134
1252 Ga0163161_10049369
1253 Ga0163161_10465340
1254 Ga0213872_10000041
1255 Ga0213872_10000167
1256 Ga0213872_10000929
1257 Ga0213872_10003231
1258 Ga0213872_10069435
1259 Ga0209435_100079
1260 Ga0209435_100657
1261 Ga0209760_100848
1262 Ga0209436_100449
1263 Ga0209436_107310
1264 Ga0209784_100034
1265 Ga0209784_100035
1266 Ga0209566_100038
1267 Ga0209566_100040
1268 Ga0209674_100056
1269 Ga0209674_100057
1270 Ga0209672_105447
1271 Ga0209147_100060
1272 Ga0209563_100057
1273 Ga0209563_100059
1274 Ga0207427_101876
1275 Ga0209437_100071
1276 Ga0209437_100081
1277 Ga0209258_100141
1278 Ga0209258_107060
1279 Ga0207425_1000009
1280 Ga0207425_1000068
1281 Ga0207425_1001046
1282 Ga0209646_1000251
1283 Ga0209646_1000265
1284 Ga0209646_1000290
1285 Ga0209026_1000330
1286 Ga0209677_100035
1287 Ga0209677_100036
1288 Ga0209148_1001530
1289 Ga0209759_1000473
1290 Ga0209759_1000485
1291 Ga0209129_1000061
1292 Ga0209233_1000094
1293 Ga0209565_1000032
1294 Ga0209565_1001187
1295 Ga0209565_1005779
1296 Ga0209565_1006593
1297 Ga0209565_1007733
1298 Ga0209455_1000031
1299 Ga0209455_1000820
1300 Ga0209455_1003128
1301 Ga0209673_1000029
1302 Ga0209673_1004770
1303 Ga0209130_1000833
1304 Ga0209130_1001452
1305 Ga0209130_1002479
1306 Ga0209675_1000019
1307 Ga0209675_1001158
1308 Ga0209025_1001504
1309 Ga0209025_1020665
1310 Ga0209564_1000010
1311 Ga0209564_1000067
1312 Ga0209564_1000291
1313 Ga0209564_1000315
1314 Ga0209564_1001538
1315 Ga0209758_1000101
1316 Ga0209758_1001181
1317 Ga0209050_1000040
1318 Ga0209050_1000123
1319 Ga0209256_1000018
1320 Ga0209256_1000058
1321 Ga0209256_1001142
1322 Ga0209256_1002252
1323 Ga0209256_1002524
1324 Ga0209256_1008625
1325 Ga0207426_1002785
1326 Ga0209257_1000054
1327 Ga0209257_1022074
1328 Ga0207697_10197326
1329 Ga0207655_1001917
1330 Ga0207655_1002585
1331 Ga0207655_1087104
1332 Ga0207682_10007962
1333 Ga0207682_10139083
1334 Ga0207642_10058223
1335 Ga0207688_10219599
1336 Ga0207680_10013820
1337 Ga0207645_10009451
1338 Ga0207645_10075307
1339 Ga0207645_10245722
1340 Ga0207643_10192237
1341 Ga0207643_10259738
1342 Ga0207705_10007914
1343 Ga0207705_10150054
1344 Ga0207705_10507884
1345 Ga0207695_10003241
1346 Ga0207695_10004922
1347 Ga0207671_10010224
1348 Ga0207671_10012953
1349 Ga0207693_10349281
1350 Ga0207662_10002613
1351 Ga0207657_10001836
1352 Ga0207657_10029728
1353 Ga0207657_10104136
1354 Ga0207649_10031155
1355 Ga0207649_10156682
1356 Ga0207652_10005815
1357 Ga0207681_10004802
1358 Ga0207681_10130278
1359 Ga0207681_10261937
1360 Ga0207694_10000193
1361 Ga0207694_10068785
1362 Ga0207694_10215926
1363 Ga0207650_10004090
1364 Ga0207650_10114481
1365 Ga0207650_10471805
1366 Ga0207659_10053371
1367 Ga0207659_10119689
1368 Ga0207659_10187089
1369 Ga0207659_10469214
1370 Ga0207687_10131789
1371 Ga0207644_10007449
1372 Ga0207644_10182581
1373 Ga0207690_10004063
1374 Ga0207690_10021740
1375 Ga0207690_10069485
1376 Ga0207690_10335909
1377 Ga0207706_10003874
1378 Ga0207706_10009517
1379 Ga0207706_10043365
1380 Ga0207686_10023622
1381 Ga0207686_10109241
1382 Ga0207686_10332017
1383 Ga0207669_10064183
1384 Ga0207669_10200684
1385 Ga0207669_10214007
1386 Ga0207704_10030838
1387 Ga0207704_10215592
1388 Ga0207691_10023398
1389 Ga0207691_10042166
1390 Ga0207691_10094288
1391 Ga0207691_10117245
1392 Ga0207691_10255047
1393 Ga0207691_10264903
1394 Ga0207711_10016963
1395 Ga0207711_10022414
1396 Ga0207689_10009199
1397 Ga0207689_10024820
1398 Ga0207661_10084711
1399 Ga0207679_10002742
1400 Ga0207679_10051912
1401 Ga0207667_10000946
1402 Ga0207667_10007809
1403 Ga0207667_10025505
1404 Ga0207667_10047499
1405 Ga0207667_10097646
1406 Ga0207667_10393649
1407 Ga0207651_10192944
1408 Ga0207712_10164794
1409 Ga0207668_10004465
1410 Ga0207668_10248073
1411 Ga0207640_10002854
1412 Ga0207640_10123798
1413 Ga0207640_10144246
1414 Ga0207658_10006432
1415 Ga0207658_10027327
1416 Ga0207677_10045580
1417 Ga0207677_10191446
1418 Ga0207677_10212389
1419 Ga0207703_10004840
1420 Ga0207703_10007247
1421 Ga0207703_10155663
1422 Ga0207639_10017985
1423 Ga0207639_10042297
1424 Ga0207639_10053261
1425 Ga0207639_10284816
1426 Ga0207678_10514647
1427 Ga0207708_10161090
1428 Ga0207702_10059880
1429 Ga0207702_10792858
1430 Ga0207641_10012562
1431 Ga0207641_10045484
1432 Ga0207641_10142731
1433 Ga0207648_10014995
1434 Ga0207648_10073729
1435 Ga0207648_10105638
1436 Ga0207676_10160692
1437 Ga0207676_10216584
1438 Ga0207676_10275111
1439 Ga0207675_100004479
1440 Ga0207675_100286924
1441 Ga0207683_10019240
1442 Ga0207683_10027233
1443 Ga0207683_10131915
1444 Ga0207698_10005137
1445 Ga0207698_10031618
1446 Ga0207698_10034855
1447 Ga0207698_10284895
1448 Ga0209281_1000151
1449 Ga0209281_1003261
1450 Ga0209282_1000014
1451 Ga0268266_10561043
1452 Ga0268265_10008762
1453 Ga0268264_10002117
1454 Ga0268264_10009653
1455 Ga0268264_10104767
1456 Ga0265323_10009697
1457 Ga0307515_10000432
1458 Ga0307515_10005908
1459 Ga0307515_10024457
1460 Ga0316177_1029947
1461 Ga0316182_1085102
1462 Ga0265325_10006514
1463 Ga0265329_10000056
1464 Ga0265339_10124660
1465 Ga0265327_10192746
1466 Ga0265316_10000484
1467 Ga0265316_10023663
1468 Ga0265316_10100890
1469 Ga0307408_100002393
1470 Ga0307408_100030624
1471 Ga0307408_100235289
1472 Ga0307408_100424224
1473 Ga0265313_10006226
1474 Ga0265314_10005760
1475 Ga0265342_10000405
1476 Ga0265342_10001757
1477 Ga0316576_10014776
1478 Ga0316578_10000134
1479 Ga0307516_10000127
1480 Ga0307516_10003164
1481 Ga0307516_10013408
1482 Ga0307516_10157567
1483 Ga0307405_10039787
1484 Ga0307518_10067826
1485 Ga0307412_10138629
1486 Ga0307409_100025249
1487 Ga0307416_100032061
1488 Ga0307416_100142601
1489 Ga0307414_10013571
1490 Ga0307414_10044379
1491 Ga0307411_10061113
1492 Ga0307415_100020811
1493 Ga0316593_10023535
1494 Ga0316596_1015766
1495 Ga0373954_0002027
1496 Ga0373946_0066994
1497 Ga0373962_0031080
1498 Ga0316574_0012379
1499 Ga0373931_0054053
1500 Ga0373935_0085832
1501 Ga0373933_0182179
1502 Ga0373947_0223568
1503 Ga0373937_0045307
1504 Ga0373937_0218595
1505 Ga0316584_0021567
1506 Ga0316584_0135137
1507 Ga0373925_0119245
1508 Ga0395899_0000329
1509 Ga0395899_0000787
1510 Ga0395899_0019086
1511 Ga0395899_0138806
1512 Ga0395900_0012488
1513 Ga0395900_0099595
1514 Ga0395900_0376962
1515 Ga0395900_0378752
1516 Ga0395900_0812681
1517 Ga0395898_0000283
1518 Ga0395898_0134878
1519 Ga0395898_0208690
1520 Ga0395905_0000703
1521 Ga0395905_0005750
1522 Ga0395905_0027360
1523 Ga0395905_0052947
1524 Ga0395905_0139583
1525 Ga0395905_0232058
1526 Ga0395901_0000881
1527 Ga0395901_0015819
1528 Ga0395901_0364545
1529 Ga0400485_08530
1530 Ga0400489_08019
1531 Ga0436361_0136418
1532 Ga0436361_0279393
1533 Ga0436361_0391791
1534 Ga0436361_0438991
1535 Ga0436361_0599511
1536 Ga0436361_0674579
1537 Ga0436361_1059260
1538 Ga0439441_052679
1539 Ga0450904_000871
1540 Ga0451577_0001500
1541 Ga0451577_0009424
1542 Ga0466969_0000013
1543 Ga0466972_0000453
1544 Ga0466972_0003939
1545 Ga0453683_0042631
1546 Ga0466965_0000132
1547 Ga0466965_0000278
1548 Ga0466965_0048747
1549 Ga0466965_0122743
1550 Ga0466965_0168340
1551 Ga0466966_0016417
1552 Ga0466966_0020568
1553 Ga0466966_0044546
1554 Ga0466961_0049174
1555 Ga0466964_0000573
1556 Ga0466964_0018762
1557 Ga0453684_0000694
1558 Ga0466968_0012527
1559 Ga0466968_0143545
1560 Ga0466970_0267197
1561 Ga0466957_0017868
1562 Ga0466957_0034529
1563 Ga0466959_0002428
1564 Ga0466959_0026613
1565 Ga0466959_0043954
1566 Ga0466959_0087527
1567 Ga0451576_0008355
1568 Ga0451576_0127712
1569 Ga0451576_0739525
1570 Ga0466958_0039431
1571 Ga0466967_0132012
1572 Ga0466967_0163069
1573 Ga0495617_000128
1574 Ga0495617_001419
1575 Ga0495617_001910
1576 Ga0495617_085941
1577 Ga0495627_000004
1578 Ga0495627_028838
1579 Ga0495592_0010789
1580 Ga0495603_0002466
1581 Ga0495590_0000014
1582 Ga0495590_0001614
1583 Ga0495590_0001672
1584 Ga0495590_0014643
1585 Ga0495590_0029243
1586 Ga0495629_0006457
1587 Ga0495629_0024599
1588 Ga0495638_0000064
1589 Ga0495638_0004227
1590 Ga0495638_0056035
1591 Ga0495638_0155969
1592 Ga0495651_0003413
1593 Ga0495653_0000056
1594 Ga0495653_0035719
1595 Ga0495653_0228620
1596 Ga0495650_0000062
1597 Ga0495650_0000283
1598 Ga0495650_0001144
1599 Ga0495650_0001153
1600 Ga0495650_0014839
1601 Ga0495650_0032504
1602 Ga0495650_0033108
1603 Ga0495580_0226975
1604 Ga0495582_0104406
1605 Ga0495605_0000127
1606 Ga0495605_0000225
1607 Ga0495605_0001850
1608 Ga0495605_0018816
1609 Ga0495605_0026919
1610 Ga0495605_0123489
1611 Ga0495605_0128194
1612 Ga0495584_0000040
1613 Ga0495584_0001407
1614 Ga0495584_0001529
1615 Ga0495584_0002355
1616 Ga0495584_0005114
1617 Ga0495584_0005804
1618 Ga0495584_0016289
1619 Ga0495584_0027869
1620 Ga0495584_0125292
1621 Ga0495585_0000230
1622 Ga0495585_0000566
1623 Ga0495585_0000776
1624 Ga0495585_0003019
1625 Ga0495585_0003507
1626 Ga0495585_0046525
1627 Ga0495585_0070037
1628 Ga0495585_0100033
1629 Ga0495585_0180470
1630 Ga0495594_0012651
1631 Ga0495594_0079993
1632 Ga0495596_0000671
1633 Ga0495596_0001532
1634 Ga0495596_0006464
1635 Ga0495596_0007938
1636 Ga0495607_0000853
1637 Ga0495607_0001656
1638 Ga0495607_0001772
1639 Ga0495607_0003675
1640 Ga0495607_0036798
1641 Ga0495607_0256282
1642 Ga0495583_0000046
1643 Ga0495583_0000137
1644 Ga0495583_0000156
1645 Ga0495583_0000231
1646 Ga0495583_0000287
1647 Ga0495583_0001530
1648 Ga0495583_0001556
1649 Ga0495583_0004187
1650 Ga0495606_0000353
1651 Ga0495606_0000400
1652 Ga0495606_0000589
1653 Ga0495606_0000933
1654 Ga0495606_0001708
1655 Ga0495606_0002937
1656 Ga0495606_0006490
1657 Ga0495606_0067300
1658 Ga0495608_0018854
1659 Ga0495610_0000027
1660 Ga0495610_0001111
1661 Ga0495610_0016864
1662 Ga0495610_0036421
1663 Ga0495616_0000072
1664 Ga0495616_0002779
1665 Ga0495616_0009303
1666 Ga0495616_0059252
1667 Ga0495616_0070870
1668 Ga0495616_0221880
1669 Ga0495618_0021041
1670 Ga0495620_0009333
1671 Ga0495628_0000076
1672 Ga0495628_0001441
1673 Ga0495628_0115865
1674 Ga0495628_0419528
1675 Ga0495631_0000290
1676 Ga0495631_0001418
1677 Ga0495631_0015619
1678 Ga0495631_0038625
1679 Ga0495632_0000403
1680 Ga0495632_0004394
1681 Ga0495637_0000430
1682 Ga0495637_0009837
1683 Ga0495637_0010156
1684 Ga0495643_0000108
1685 Ga0495643_0000255
1686 Ga0495643_0000716
1687 Ga0495643_0001683
1688 Ga0495643_0020799
1689 Ga0495643_0049091
1690 Ga0495643_0067644
1691 Ga0495643_0131709
1692 Ga0495644_0005344
1693 Ga0495644_0020071
1694 Ga0495644_0026066
1695 Ga0495648_0000006
1696 Ga0495648_0000134
1697 Ga0495648_0000841
1698 Ga0495648_0002507
1699 Ga0495648_0014318
1700 Ga0495648_0023331
1701 Ga0495648_0035462
1702 Ga0495648_0045577
1703 Ga0495648_0076198
1704 Ga0495663_0003306
1705 Ga0495666_0009701
1706 Ga0495666_0015888
1707 Ga0495642_0000871
1708 Ga0495642_0002341
1709 Ga0495642_0002943
1710 Ga0495642_0003138
1711 Ga0495642_0004427
1712 Ga0495652_0005760
1713 Ga0495652_0140029
1714 Ga0495654_0000131
1715 Ga0495654_0007219
1716 Ga0495654_0024239
1717 Ga0495654_0033901
1718 Ga0495665_0065133
1719 Ga0495586_0025907
1720 Ga0495587_0083004
1721 Ga0495609_0000136
1722 Ga0495609_0001765
1723 Ga0495609_0006092
1724 Ga0495609_0026224
1725 Ga0495621_0109696
1726 Ga0495597_0000091
1727 Ga0495597_0000223
1728 Ga0495597_0000882
1729 Ga0495597_0000971
1730 Ga0495597_0001469
1731 Ga0495597_0007404
1732 Ga0495597_0034443
1733 Ga0495597_0052294
1734 Ga0495645_0016449
1735 Ga0495645_0055606
1736 Ga0495622_0000013
1737 Ga0495622_0005626
1738 Ga0495622_0115802
1739 Ga0495622_0224052
1740 Ga0495633_0001545
1741 Ga0495633_0002191
1742 Ga0495633_0002981
1743 Ga0495633_0003195
1744 Ga0495633_0015631
1745 Ga0495633_0148610
1746 Ga0495633_0168873
1747 Ga0495656_0000675
1748 Ga0495656_0037159
1749 Ga0495668_0000029
1750 Ga0495668_0000119
1751 Ga0495668_0000209
1752 Ga0495668_0000359
1753 Ga0495668_0003302
1754 Ga0495668_0022417
1755 Ga0495668_0086796
1756 Ga0495611_0015040
1757 Ga0495611_0018009
1758 Ga0495625_0000871
1759 Ga0495625_0001309
1760 Ga0495625_0001595
1761 Ga0495625_0007432
1762 Ga0495625_0007978
1763 Ga0495625_0010041
1764 Ga0495625_0011228
1765 Ga0495625_0015358
1766 Ga0495659_0001898
1767 Ga0495659_0002191
1768 Ga0495659_0044416
1769 Ga0495661_0000979
1770 Ga0495661_0007457
1771 Ga0495661_0013316
1772 Ga0495661_0021185
1773 Ga0495661_0027022
1774 Ga0495661_0055997
1775 Ga0495588_0000091
1776 Ga0495588_0077315
1777 Ga0495657_0041222
1778 Ga0495657_0277382
1779 Ga0495599_0003657
1780 Ga0495599_0071047
1781 Ga0495623_0000743
1782 Ga0495646_0005231
1783 Ga0495646_0161407
1784 Ga0495658_0009494
1785 Ga0495658_0073811
1786 Ga0495669_0000021
1787 Ga0495669_0001117
1788 Ga0495613_0117767
1789 Ga0495624_0036851
1790 Ga0495624_0062485
1791 Ga0495670_0016780
1792 Ga0495670_0035008
1793 Ga0495670_0063015
1794 Ga0495670_0064268
1795 Ga0495670_0074575
1796 Ga0495671_0000106
1797 Ga0495671_0002593
1798 Ga0495671_0022032
1799 Ga0495671_0051785
1800 Ga0495671_0111413
1801 Ga0495649_0000549
1802 Ga0495649_0000709
1803 Ga0495649_0014906
1804 Ga0495649_0015177
1805 Ga0495589_0000269
1806 Ga0495600_0000340
1807 Ga0495660_0000823
1808 Ga0495660_0001854
1809 Ga0495660_0015627
1810 Ga0495660_0016122
1811 Ga0495660_0047240
1812 Ga0495660_0073796
1813 Ga0495660_0086344
1814 Ga0495581_0175579
1815 Ga0495604_0085636
1816 Ga0495604_0227925
1817 Ga0495636_0000933
1818 Ga0495636_0002175
1819 Ga0495636_0006937
1820 Ga0495636_0053940
1821 Ga0495636_0122325
1822 Ga0495674_0032572
1823 Ga0495672_0000088
1824 Ga0495672_0001122
1825 Ga0495676_0028858
1826 Ga0495676_0094213
1827 Ga0495680_0054419
1828 Ga0495680_0183159
1829 Ga0495683_0000125
1830 Ga0495683_0000892
1831 Ga0495683_0018689
1832 Ga0495687_000042
1833 Ga0495687_000115
1834 Ga0495687_001828
1835 Ga0495687_003232
1836 Ga0495687_003687
1837 Ga0495687_009013
1838 Ga0495687_011544
1839 Ga0495675_0008756
1840 Ga0495677_0000156
1841 Ga0495677_0006078
1842 Ga0495677_0019510
1843 Ga0495677_0102268
1844 Ga0495685_000523
1845 Ga0495685_001719
1846 Ga0495685_006046
1847 Ga0495673_0000008
1848 Ga0495673_0000009
1849 Ga0495673_0000185
1850 Ga0495673_0007424
1851 Ga0495681_0000278
1852 Ga0495681_0000951
1853 Ga0495681_0001142
1854 Ga0495681_0010879
1855 Ga0495684_0058149
1856 Ga0495686_0000212
1857 Ga0495686_0001207
1858 Ga0495686_0003602
1859 Ga0495686_0004528
1860 Ga0495686_0011929
1861 Ga0495686_0019954
1862 Ga0495686_0115612
1863 Ga0495686_0147370
1864 Ga0495593_0001579
1865 Ga0495593_0009011
1866 Ga0495602_0059604
1867 Ga0495602_0168608
1868 Ga0495626_0000043
1869 Ga0495626_0000091
1870 Ga0495626_0000667
1871 Ga0495626_0001829
1872 Ga0495626_0004783
1873 Ga0495626_0008166
1874 Ga0495626_0024848
1875 Ga0495626_0084997
1876 Ga0496101_0136173
1877 Ga0496102_0001181
1878 Ga0496102_0370989
1879 Ga0496103_0010503
1880 Ga0496103_0212373
1881 Ga0496104_0039773
1882 Ga0496104_0040104
1883 Ga0496105_0037751
1884 Ga0496106_0190134
1885 Ga0496107_0086074
1886 Ga0496107_0113128
1887 Ga0496108_0056737
1888 Ga0496108_0407208
1889 Ga0496109_0082777
1890 Ga0496110_0021592
1891 Ga0496110_0085888
1892 Ga0496110_0706778
1893 Ga0496111_0003127
1894 Ga0496111_0503122
1895 Ga0496112_0116693
1896 Ga0496114_0005135
1897 Ga0496114_0101555
1898 Ga0496115_0068854
1899 Ga0496115_0213154
1900 Ga0496116_0024641
1901 Ga0496117_0000005
1902 Ga0496117_0016121
1903 Ga0496118_0000022
1904 Ga0496118_0014998
1905 Ga0496121_0009122
1906 Ga0496121_0102810
1907 Ga0496122_0000968
1908 Ga0496122_0006223
1909 Ga0496122_0009051
1910 Ga0496122_0012265
1911 Ga0496122_0267623
1912 Ga0496123_0000983
1913 Ga0496123_0002475
1914 Ga0496123_0012980
1915 Ga0496123_0048162
1916 Ga0496124_0001001
1917 Ga0496124_0036741
1918 Ga0496124_0081285
1919 Ga0496124_0169625
1920 Ga0496125_0001086
1921 Ga0496125_0003905
1922 Ga0496125_0007199
1923 Ga0496125_0018481
1924 Ga0496125_0075761
1925 Ga0496126_0006515
1926 Ga0496126_0075641
1927 Ga0495678_000149
1928 Ga0495678_000259
1929 Ga0495678_000652
1930 Ga0495678_005168
1931 Ga0495682_0000585
1932 Ga0495682_0000819
1933 Ga0495682_0002024
1934 Ga0495682_0009318
1935 Ga0501316_007077
1936 Ga0501031_0275151
1937 Ga0501032_0185265
1938 Ga0501033_0001795
1939 Ga0501036_0136855
1940 Ga0501038_0637578
1941 Ga0501039_0157376
1942 Ga0501039_0194198
1943 Ga0501040_0007105
1944 Ga0501043_0322791
1945 Ga0501047_0003401
1946 Ga0501048_0007051
1947 Ga0501048_0254721
1948 Ga0501067_0276512
1949 Ga0501069_0043257
1950 Ga0501070_0006609
1951 Ga0501070_0010057
1952 Ga0501070_0104394
1953 Ga0501072_0002698
1954 Ga0501074_0001841
1955 Ga0501075_0004622
1956 Ga0501076_0000088
1957 Ga0501077_0040395
1958 Ga0501230_000829
1959 Ga0501238_005139
1960 Ga0501079_0001059
1961 Ga0501080_0474110
1962 Ga0501081_0010465
1963 Ga0501269_000164
1964 Ga0501279_002426
1965 Ga0501035_0001552
1966 Ga0501035_0054021
1967 Ga0501035_0514817
1968 Ga0501044_0000185
1969 Ga0501044_0001443
1970 Ga0501044_0275538
1971 Ga0501045_0004039
1972 nmdc:mga00v17_126051_c1
1973 nmdc:mga0n895_378667_c1
1974 Ga0495601_0002072
1975 Ga0495619_0128040
1976 Ga0500595_016546
1977 Ga0500607_058486
1978 Ga0500618_000557
1979 Ga0500618_003629
1980 Ga0500559_0014184
1981 Ga0500574_002040
1982 Ga0500586_000137
1983 Ga0500619_000170
1984 Ga0500619_000263
1985 Ga0587082_036398
1986 Ga0587083_0002118
1987 Ga0587072_011698
1988 Ga0501082_0011645
1989 Ga0530510_0001266
1990 2511247489
1991 2511384300
1992 2521560911
1993 2550696641
1994 2553007620
1995 2578338350
1996 2601671231
1997 2643792722
1998 2644028145
1999 2644212842
2000 2644254894
2001 2644359320
2002 2738738255
2003 2738826610
2004 2738842938
2005 2739150407
2006 2739192326
2007 2739273686
2008 2739318803
2009 2739337044
2010 2739342730
2011 2765567347
2012 2808984255
2013 2809132059
2014 2809151682
2015 2819542297
2016 2819594315
2017 2819618781
2018 2821135322
2019 2839095431
2020 2842717386
2021 2852622858
2022 2857548925
2023 2857556433
2024 2857562167
2025 2857567839
2026 2884811650
2027 2884840708
2028 2884857696
2029 2885080990
2030 2889418852
2031 2896158636
2032 2904427915
2033 2904442466
2034 2904533733
2035 2904589430
2036 2904595133
2037 2904602365
2038 2919050713
2039 2919084908
2040 2919441091
2041 2919476797
2042 2923514751
2043 2928135647
2044 2932415379
2045 2932421460
2046 8048747327

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

25

241

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ezn-assembly1.cif.gz_A crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b 0.992 1 235
1e59-assembly1.cif.gz_A-2 e.coli cofactor-dependent phosphoglycerate mutase complexed with vanadate 0.9911 1 238
3fdz-assembly1.cif.gz_B crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3-phosphoglyceric acid 0.9904 1 229
5um0-assembly1.cif.gz_D crystal structure of 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase from neisseria gonorrhoeae 0.9903 1 228
5vve-assembly1.cif.gz_A crystal structure of phosphoglycerate mutase from naegleria fowleri 0.9869 2 241
ID Description Score Start End Superfamily
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9873 4 229 3.40.50.1240
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9777 4 229 3.40.50.1240
1riiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9658 2 242 3.40.50.1240
1riiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.954 2 242 3.40.50.1240
af_Q8T8W6_17_267_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9473 2 239 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A259JAP8-F1-model_v4 deleted 0.9974 1 227
AF-A0A4Q6DXN7-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) 0.9952 1 226 GO:0006094
GO:0006096
GO:0046538
AF-A0A150H3G3-F1-model_v4 Phosphoglycerate mutase (EC 5.4.2.11) 0.9952 2 229 GO:0006096
GO:0046538
AF-A0A7X6WPX0-F1-model_v4 deleted 0.9952 25 229
AF-C6E639-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (BPG-dependent PGAM) (PGAM) (Phosphoglyceromutase) (dPGM) (EC 5.4.2.11) 0.9951 1 229 GO:0006094
GO:0006096
GO:0046538

Map