F488451
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1023 | 624 | 2046 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300049460|Ga0495682_0000020|Ga0495682_0000020_196776_197873 |
| Length | 365 |
| Sequence | MNDWPRPVSTDCFATNNNMHFNRSLYMSSHALKLGVIGTGAIGQDHIRRCSQTLLNSQVVAVTDINLQQAAKVVADLKLSAEVYADGHALIKSPEVEAILVTSWGPSHEAFVLAAIAAGKPVFCEKPLAVTAEGCRKIVEAEVAHGKRLVQVGFMRPYDQGYRALKAVIDSGQIGEPLMLHCAHRNPSVGENYKTDMAITDTLIHELDVLRWLLADDYVSVQVVFPRKTSKAHAHLKDPQIVLLETAKGTRIDVEVFVNCQYGYDIQCEVVGESGIAKLPEPSQVQMRSGAKLSNAILMDWKDRFIAAYDVELQAFIDGVRAGQVGGPSAWDGFAAAVAADACVEAQQSGAIVKVALPERPRFYG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 24 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 49 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 50 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 51 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 71 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 73 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 74 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 77 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 89 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 95 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 134 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 137 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 143 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 144 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 145 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 146 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 149 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 150 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 154 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 155 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 157 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 160 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 161 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 168 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 169 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 170 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 171 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 173 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 174 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 175 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 176 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 177 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 178 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 179 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 180 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 181 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 182 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 183 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 184 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 185 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 186 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 187 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 188 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 191 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 192 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 297 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 298 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 299 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 300 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 301 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 302 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 303 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 318 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 320 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 321 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 322 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 323 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 324 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 325 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 326 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 327 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 328 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 329 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 330 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 331 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 332 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 333 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 334 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 335 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 336 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 337 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 338 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 339 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 340 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 341 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 342 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 343 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 344 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 345 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 346 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 347 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 348 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 349 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 350 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 351 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 352 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 353 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 354 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 355 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 356 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 357 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 358 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 359 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 360 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 361 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 362 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 363 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 364 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 365 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 366 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 367 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 368 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 369 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 370 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 371 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 372 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 373 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 374 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 375 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 376 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 377 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 378 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 379 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 380 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 381 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 382 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 383 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 384 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 385 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 386 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 387 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 388 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 389 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 390 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 391 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 392 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 393 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 394 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 395 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 396 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 397 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 398 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 399 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 400 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 401 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 402 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 403 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 404 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 405 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 406 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 407 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 408 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 409 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 410 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 411 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 412 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 413 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 414 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 415 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 416 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 417 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 418 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 419 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 420 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 421 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 422 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 423 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 424 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 425 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 426 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 427 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 428 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 429 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 430 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 431 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 432 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 433 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 434 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 435 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 436 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 437 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 438 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 439 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 440 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 441 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 442 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 443 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 444 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 445 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 446 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 447 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 448 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 449 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 450 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 451 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 452 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 453 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 454 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 455 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 456 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 457 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 458 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 459 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 460 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 461 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 462 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 463 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 464 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 465 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 466 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 467 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 468 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 469 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 470 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 471 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 472 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 473 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 474 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 475 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 476 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 477 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 478 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 479 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 480 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 481 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 482 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 483 | 2802429420 | Priestia filamentosa HL2HP6 | Isolate | Unclassified |
| 484 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 485 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 486 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 487 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 488 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 489 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 490 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 491 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 492 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 493 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 494 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 495 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 496 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 497 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 498 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 499 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 500 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 501 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 502 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 503 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 504 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 505 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 506 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 507 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 508 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 509 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 510 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 511 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 512 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 513 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 514 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 515 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 516 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 517 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 518 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 519 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 520 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 521 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 522 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 523 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 524 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 525 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 526 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 527 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 528 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 529 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 530 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 531 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 532 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 533 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 534 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 535 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 536 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 537 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 538 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 539 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 540 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 541 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 542 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 543 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 544 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 545 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 546 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 547 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 548 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 549 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 550 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 551 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 552 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 553 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 554 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 555 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 556 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 557 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 558 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 559 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 560 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 561 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 562 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 563 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 564 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 565 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 566 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 567 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 568 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 569 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 570 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 571 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 572 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 573 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 574 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 575 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 576 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 577 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 578 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 579 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 580 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 581 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 582 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 583 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 584 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 585 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 586 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 587 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 588 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 589 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 590 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 591 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 592 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 593 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 594 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 595 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 596 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 597 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 598 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 599 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 600 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 601 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 602 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 603 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 604 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 605 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 606 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 607 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 608 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 609 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 610 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 611 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 612 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 613 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 614 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 615 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 616 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 617 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 618 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 619 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 620 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 621 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 622 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 623 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 624 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.7 |
| Metatranscriptomes | 0.39 |
| Isolates | 29.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 8.11 |
| Nodule | 2.25 |
| Rhizoplane | 12.41 |
| Rhizosphere | 59.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495682_0000020 | 3300049460 | Bacteria | 210849 |
| 2 | MRS2a_Contig_11 | 2124908027 | Bacteria | 54720 |
| 3 | MRS2a_Contig_9428 | 2124908027 | Bacteria | 2296 |
| 4 | JGI24739J22299_10011364 | 3300001989 | Bacteria | 3288 |
| 5 | JGI24739J22299_10036641 | 3300001989 | Bacteria | 1656 |
| 6 | JGI25162J39368_1000014 | 3300002737 | Bacteria | 328873 |
| 7 | JGI25162J39368_1000060 | 3300002737 | Bacteria | 137745 |
| 8 | JGI25163J39215_1000784 | 3300002771 | Bacteria | 7761 |
| 9 | JGI25163J39215_1000792 | 3300002771 | Bacteria | 7675 |
| 10 | JGI25164J39214_1000037 | 3300002772 | Bacteria | 137530 |
| 11 | JGI25164J39214_1000059 | 3300002772 | Bacteria | 111483 |
| 12 | JGI25151J46595_10022352 | 3300003187 | Bacteria | 2627 |
| 13 | JGI25165J46597_1000027 | 3300003214 | Bacteria | 328873 |
| 14 | JGI25165J46597_1000118 | 3300003214 | Bacteria | 137530 |
| 15 | rootH2_10002244 | 3300003320 | Bacteria | 2298 |
| 16 | rootH2_10154959 | 3300003320 | Bacteria | 1993 |
| 17 | rootL2_10107293 | 3300003322 | Bacteria | 7020 |
| 18 | Ga0055538_1000158 | 3300003751 | Bacteria | 45679 |
| 19 | Ga0055539_1000208 | 3300003752 | Bacteria | 45679 |
| 20 | Ga0055533_1000209 | 3300003756 | Bacteria | 45679 |
| 21 | Ga0055532_1000214 | 3300003758 | Bacteria | 45671 |
| 22 | Ga0055532_1001585 | 3300003758 | Bacteria | 6045 |
| 23 | Ga0055532_1003700 | 3300003758 | Bacteria | 2513 |
| 24 | Ga0055525_1000287 | 3300003759 | Bacteria | 45679 |
| 25 | Ga0055529_1000493 | 3300003763 | Bacteria | 35995 |
| 26 | Ga0055536_1000046 | 3300003781 | Bacteria | 118284 |
| 27 | Ga0055536_1000128 | 3300003781 | Bacteria | 64931 |
| 28 | Ga0055528_1001894 | 3300003790 | Bacteria | 11896 |
| 29 | Ga0055528_1005086 | 3300003790 | Bacteria | 6202 |
| 30 | Ga0055530_10000133 | 3300003791 | Bacteria | 65211 |
| 31 | Ga0055530_10000136 | 3300003791 | Bacteria | 64931 |
| 32 | Ga0055530_10000373 | 3300003791 | Bacteria | 40491 |
| 33 | Ga0055540_1000070 | 3300003792 | Bacteria | 118483 |
| 34 | Ga0055540_1000168 | 3300003792 | Bacteria | 65211 |
| 35 | Ga0055540_1000303 | 3300003792 | Bacteria | 43632 |
| 36 | Ga0055531_10010863 | 3300003794 | Bacteria | 4470 |
| 37 | Ga0055541_1000067 | 3300003841 | Bacteria | 99013 |
| 38 | Ga0058692_1000041 | 3300003856 | Bacteria | 129687 |
| 39 | Ga0058692_1001554 | 3300003856 | Bacteria | 8318 |
| 40 | Ga0065703_1018788 | 3300005272 | Bacteria | 7981 |
| 41 | Ga0065714_10000651 | 3300005288 | Bacteria | 3160 |
| 42 | Ga0065714_10002705 | 3300005288 | Bacteria | 16648 |
| 43 | Ga0065714_10003341 | 3300005288 | Bacteria | 8043 |
| 44 | Ga0065714_10023470 | 3300005288 | Bacteria | 2893 |
| 45 | Ga0065714_10064673 | 3300005288 | Bacteria | 24513 |
| 46 | Ga0065714_10065808 | 3300005288 | Bacteria | 8446 |
| 47 | Ga0065704_10002589 | 3300005289 | Bacteria | 8396 |
| 48 | Ga0065704_10120447 | 3300005289 | Bacteria | 1782 |
| 49 | Ga0065712_10117901 | 3300005290 | Bacteria | 1714 |
| 50 | Ga0070658_10030936 | 3300005327 | Bacteria | 4299 |
| 51 | Ga0070670_100007505 | 3300005331 | Bacteria | 9259 |
| 52 | Ga0070670_100041367 | 3300005331 | Bacteria | 3962 |
| 53 | Ga0070660_100000080 | 3300005339 | Bacteria | 57858 |
| 54 | Ga0070661_100000399 | 3300005344 | Bacteria | 33668 |
| 55 | Ga0070669_100003105 | 3300005353 | Bacteria | 11955 |
| 56 | Ga0070659_100000068 | 3300005366 | Bacteria | 81455 |
| 57 | Ga0070714_100007884 | 3300005435 | Bacteria | 8295 |
| 58 | Ga0070708_100019352 | 3300005445 | Bacteria | 5719 |
| 59 | Ga0070708_100039180 | 3300005445 | Bacteria | 4145 |
| 60 | Ga0070708_100145467 | 3300005445 | Bacteria | 2201 |
| 61 | Ga0070663_100001611 | 3300005455 | Bacteria | 12453 |
| 62 | Ga0070662_100001000 | 3300005457 | Bacteria | 17295 |
| 63 | Ga0070706_100032802 | 3300005467 | Bacteria | 4791 |
| 64 | Ga0070706_100305455 | 3300005467 | Bacteria | 1484 |
| 65 | Ga0070699_100006669 | 3300005518 | Bacteria | 10039 |
| 66 | Ga0070664_100000824 | 3300005564 | Bacteria | 23877 |
| 67 | Ga0068854_100011802 | 3300005578 | Bacteria | 5705 |
| 68 | Ga0068852_100022859 | 3300005616 | Bacteria | 5023 |
| 69 | Ga0068851_10000400 | 3300005834 | Bacteria | 19656 |
| 70 | Ga0081455_10135792 | 3300005937 | Bacteria | 1917 |
| 71 | Ga0075368_10021479 | 3300006042 | Bacteria | 2452 |
| 72 | Ga0075363_100020018 | 3300006048 | Bacteria | 3352 |
| 73 | Ga0075363_100052756 | 3300006048 | Bacteria | 2171 |
| 74 | Ga0075367_10001716 | 3300006178 | Bacteria | 9597 |
| 75 | Ga0079104_1000004 | 3300006946 | Bacteria | 444549 |
| 76 | Ga0079104_1000823 | 3300006946 | Bacteria | 25811 |
| 77 | Ga0079104_1002497 | 3300006946 | Bacteria | 9789 |
| 78 | Ga0079104_1004114 | 3300006946 | Bacteria | 6388 |
| 79 | Ga0099826_10006487 | 3300006948 | Bacteria | 8530 |
| 80 | Ga0099794_10037220 | 3300007265 | Bacteria | 2303 |
| 81 | Ga0105251_10000089 | 3300009011 | Bacteria | 88101 |
| 82 | Ga0105251_10000230 | 3300009011 | Bacteria | 56255 |
| 83 | Ga0105251_10000233 | 3300009011 | Bacteria | 55865 |
| 84 | Ga0105251_10000302 | 3300009011 | Bacteria | 49476 |
| 85 | Ga0105251_10000842 | 3300009011 | Bacteria | 27494 |
| 86 | Ga0105251_10000924 | 3300009011 | Bacteria | 26310 |
| 87 | Ga0105251_10003948 | 3300009011 | Bacteria | 10517 |
| 88 | Ga0105251_10010267 | 3300009011 | Bacteria | 5448 |
| 89 | Ga0105251_10014142 | 3300009011 | Bacteria | 4429 |
| 90 | Ga0105251_10014525 | 3300009011 | Bacteria | 4347 |
| 91 | Ga0105251_10029298 | 3300009011 | Bacteria | 2773 |
| 92 | Ga0105251_10030780 | 3300009011 | Bacteria | 2691 |
| 93 | Ga0105251_10048242 | 3300009011 | Bacteria | 2042 |
| 94 | Ga0105244_10000564 | 3300009036 | Bacteria | 33108 |
| 95 | Ga0105244_10000658 | 3300009036 | Bacteria | 30291 |
| 96 | Ga0105244_10000989 | 3300009036 | Bacteria | 23885 |
| 97 | Ga0105244_10001094 | 3300009036 | Bacteria | 22555 |
| 98 | Ga0105244_10001338 | 3300009036 | Bacteria | 20125 |
| 99 | Ga0105244_10002323 | 3300009036 | Bacteria | 14461 |
| 100 | Ga0105244_10004498 | 3300009036 | Bacteria | 9575 |
| 101 | Ga0105244_10024564 | 3300009036 | Bacteria | 3287 |
| 102 | Ga0105244_10027027 | 3300009036 | Bacteria | 3098 |
| 103 | Ga0105244_10057902 | 3300009036 | Bacteria | 1958 |
| 104 | Ga0105244_10061629 | 3300009036 | Bacteria | 1887 |
| 105 | Ga0105244_10062378 | 3300009036 | Bacteria | 1874 |
| 106 | Ga0105244_10078934 | 3300009036 | Bacteria | 1632 |
| 107 | Ga0105244_10084125 | 3300009036 | Bacteria | 1572 |
| 108 | Ga0105244_10097524 | 3300009036 | Bacteria | 1440 |
| 109 | Ga0105250_10000093 | 3300009092 | Bacteria | 79800 |
| 110 | Ga0105250_10000370 | 3300009092 | Bacteria | 33590 |
| 111 | Ga0105250_10000480 | 3300009092 | Bacteria | 28082 |
| 112 | Ga0105250_10001079 | 3300009092 | Bacteria | 15444 |
| 113 | Ga0105250_10002704 | 3300009092 | Bacteria | 8767 |
| 114 | Ga0105250_10003415 | 3300009092 | Bacteria | 7530 |
| 115 | Ga0105250_10009314 | 3300009092 | Bacteria | 4141 |
| 116 | Ga0105250_10015252 | 3300009092 | Bacteria | 3148 |
| 117 | Ga0105250_10016876 | 3300009092 | Bacteria | 2971 |
| 118 | Ga0105245_10177015 | 3300009098 | Bacteria | 2035 |
| 119 | Ga0105247_10000396 | 3300009101 | Bacteria | 36915 |
| 120 | Ga0114129_10040552 | 3300009147 | Bacteria | 6564 |
| 121 | Ga0105243_10000045 | 3300009148 | Bacteria | 156620 |
| 122 | Ga0105241_10000013 | 3300009174 | Bacteria | 172249 |
| 123 | Ga0105242_10050494 | 3300009176 | Bacteria | 3386 |
| 124 | Ga0105237_10001264 | 3300009545 | Bacteria | 33746 |
| 125 | Ga0105238_10001781 | 3300009551 | Bacteria | 21549 |
| 126 | Ga0105246_10012437 | 3300011119 | Bacteria | 5312 |
| 127 | Ga0105246_10013729 | 3300011119 | Bacteria | 5081 |
| 128 | Ga0105246_10016141 | 3300011119 | Bacteria | 4726 |
| 129 | Ga0105246_10019801 | 3300011119 | Bacteria | 4309 |
| 130 | Ga0105246_10081297 | 3300011119 | Bacteria | 2309 |
| 131 | Ga0157373_10004744 | 3300013100 | Bacteria | 10228 |
| 132 | Ga0157373_10004812 | 3300013100 | Bacteria | 10159 |
| 133 | Ga0157373_10033938 | 3300013100 | Bacteria | 3666 |
| 134 | Ga0157373_10033979 | 3300013100 | Bacteria | 3664 |
| 135 | Ga0157371_10000726 | 3300013102 | Bacteria | 38632 |
| 136 | Ga0157371_10009826 | 3300013102 | Bacteria | 7500 |
| 137 | Ga0157371_10011902 | 3300013102 | Bacteria | 6675 |
| 138 | Ga0157371_10012245 | 3300013102 | Bacteria | 6567 |
| 139 | Ga0157371_10025604 | 3300013102 | Bacteria | 4297 |
| 140 | Ga0157371_10089884 | 3300013102 | Bacteria | 2175 |
| 141 | Ga0157370_10028217 | 3300013104 | Bacteria | 5524 |
| 142 | Ga0157370_10043959 | 3300013104 | Bacteria | 4297 |
| 143 | Ga0157370_10205620 | 3300013104 | Bacteria | 1826 |
| 144 | Ga0157370_10360854 | 3300013104 | Bacteria | 1339 |
| 145 | Ga0157370_10536904 | 3300013104 | Bacteria | 1073 |
| 146 | Ga0157369_10006024 | 3300013105 | Bacteria | 14079 |
| 147 | Ga0157369_10012687 | 3300013105 | Bacteria | 9556 |
| 148 | Ga0157369_10029566 | 3300013105 | Bacteria | 6054 |
| 149 | Ga0157369_10037630 | 3300013105 | Bacteria | 5297 |
| 150 | Ga0163162_10096668 | 3300013306 | Bacteria | 3042 |
| 151 | Ga0163162_10196954 | 3300013306 | Bacteria | 2143 |
| 152 | Ga0157372_10008819 | 3300013307 | Bacteria | 10711 |
| 153 | Ga0157372_10047419 | 3300013307 | Bacteria | 4775 |
| 154 | Ga0157372_10050110 | 3300013307 | Bacteria | 4645 |
| 155 | Ga0157372_10198433 | 3300013307 | Bacteria | 2324 |
| 156 | Ga0157375_10008636 | 3300013308 | Bacteria | 8923 |
| 157 | Ga0157375_10015239 | 3300013308 | Bacteria | 6878 |
| 158 | Ga0182008_10003483 | 3300014497 | Bacteria | 9496 |
| 159 | Ga0182008_10004004 | 3300014497 | Bacteria | 8711 |
| 160 | Ga0182008_10004201 | 3300014497 | Bacteria | 8466 |
| 161 | Ga0182008_10045535 | 3300014497 | Bacteria | 2181 |
| 162 | Ga0182006_1001860 | 3300015261 | Bacteria | 12091 |
| 163 | Ga0182006_1005531 | 3300015261 | Bacteria | 6001 |
| 164 | Ga0182006_1033063 | 3300015261 | Bacteria | 2074 |
| 165 | Ga0182006_1036527 | 3300015261 | Bacteria | 1953 |
| 166 | Ga0182006_1080660 | 3300015261 | Bacteria | 1188 |
| 167 | Ga0182007_10000177 | 3300015262 | Bacteria | 43427 |
| 168 | Ga0182005_1003224 | 3300015265 | Bacteria | 5579 |
| 169 | Ga0183367_1021 | 3300015688 | Bacteria | 82913 |
| 170 | Ga0163161_10000028 | 3300017792 | Bacteria | 197151 |
| 171 | Ga0163161_10154678 | 3300017792 | Bacteria | 1745 |
| 172 | Ga0163161_10186014 | 3300017792 | Bacteria | 1594 |
| 173 | Ga0163161_10278142 | 3300017792 | Bacteria | 1312 |
| 174 | Ga0163161_10360184 | 3300017792 | Bacteria | 1158 |
| 175 | Ga0213872_10110645 | 3300021361 | Bacteria | 1220 |
| 176 | Ga0209435_101168 | 3300025206 | Bacteria | 3590 |
| 177 | Ga0209760_100023 | 3300025207 | Bacteria | 159144 |
| 178 | Ga0209760_100025 | 3300025207 | Bacteria | 156628 |
| 179 | Ga0209784_100058 | 3300025224 | Bacteria | 167327 |
| 180 | Ga0209566_100045 | 3300025225 | Bacteria | 258557 |
| 181 | Ga0209566_100313 | 3300025225 | Bacteria | 43940 |
| 182 | Ga0209674_100096 | 3300025226 | Bacteria | 167418 |
| 183 | Ga0209674_101130 | 3300025226 | Bacteria | 7786 |
| 184 | Ga0209672_100019 | 3300025228 | Bacteria | 432215 |
| 185 | Ga0209672_100065 | 3300025228 | Bacteria | 198168 |
| 186 | Ga0209147_100026 | 3300025229 | Bacteria | 421622 |
| 187 | Ga0209147_100056 | 3300025229 | Bacteria | 258557 |
| 188 | Ga0209147_100180 | 3300025229 | Bacteria | 78654 |
| 189 | Ga0209147_100228 | 3300025229 | Bacteria | 55836 |
| 190 | Ga0209147_102004 | 3300025229 | Bacteria | 5888 |
| 191 | Ga0209563_100064 | 3300025230 | Bacteria | 258557 |
| 192 | Ga0207427_100003 | 3300025231 | Bacteria | 1035004 |
| 193 | Ga0207427_100018 | 3300025231 | Bacteria | 530735 |
| 194 | Ga0209437_100002 | 3300025233 | Bacteria | 1574801 |
| 195 | Ga0209437_100031 | 3300025233 | Bacteria | 530871 |
| 196 | Ga0209437_100032 | 3300025233 | Bacteria | 520075 |
| 197 | Ga0209437_104633 | 3300025233 | Bacteria | 2400 |
| 198 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 199 | Ga0209258_100079 | 3300025242 | Bacteria | 263132 |
| 200 | Ga0209258_100446 | 3300025242 | Bacteria | 45941 |
| 201 | Ga0209646_1000147 | 3300025246 | Bacteria | 103287 |
| 202 | Ga0209677_100053 | 3300025253 | Bacteria | 167537 |
| 203 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 204 | Ga0209759_1002071 | 3300025256 | Bacteria | 9392 |
| 205 | Ga0209759_1021692 | 3300025256 | Bacteria | 1454 |
| 206 | Ga0209233_1000004 | 3300025261 | Bacteria | 1574798 |
| 207 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 208 | Ga0209455_1000058 | 3300025272 | Bacteria | 342028 |
| 209 | Ga0209673_1000420 | 3300025273 | Bacteria | 74545 |
| 210 | Ga0209673_1003279 | 3300025273 | Bacteria | 9749 |
| 211 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 212 | Ga0209676_1000055 | 3300025292 | Bacteria | 361565 |
| 213 | Ga0209676_1001524 | 3300025292 | Bacteria | 21049 |
| 214 | Ga0209025_1013242 | 3300025294 | Bacteria | 5203 |
| 215 | Ga0209564_1011389 | 3300025295 | Bacteria | 3991 |
| 216 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 217 | Ga0209050_1000043 | 3300025298 | Bacteria | 398654 |
| 218 | Ga0209050_1000231 | 3300025298 | Bacteria | 122373 |
| 219 | Ga0209051_1000030 | 3300025303 | Bacteria | 398654 |
| 220 | Ga0209051_1000052 | 3300025303 | Bacteria | 283346 |
| 221 | Ga0209051_1000165 | 3300025303 | Bacteria | 122373 |
| 222 | Ga0209257_1000767 | 3300025304 | Bacteria | 47879 |
| 223 | Ga0207656_10000382 | 3300025321 | Bacteria | 14888 |
| 224 | Ga0207696_1000041 | 3300025711 | Bacteria | 311695 |
| 225 | Ga0207696_1000049 | 3300025711 | Bacteria | 281296 |
| 226 | Ga0207696_1000068 | 3300025711 | Bacteria | 228017 |
| 227 | Ga0207696_1000076 | 3300025711 | Bacteria | 210418 |
| 228 | Ga0207696_1000078 | 3300025711 | Bacteria | 207623 |
| 229 | Ga0207696_1000628 | 3300025711 | Bacteria | 25903 |
| 230 | Ga0207696_1001235 | 3300025711 | Bacteria | 14456 |
| 231 | Ga0207696_1023979 | 3300025711 | Bacteria | 1917 |
| 232 | Ga0207696_1025493 | 3300025711 | Bacteria | 1843 |
| 233 | Ga0207655_1000030 | 3300025728 | Bacteria | 413221 |
| 234 | Ga0207655_1000085 | 3300025728 | Bacteria | 206425 |
| 235 | Ga0207655_1000106 | 3300025728 | Bacteria | 181416 |
| 236 | Ga0207655_1000137 | 3300025728 | Bacteria | 140084 |
| 237 | Ga0207655_1000141 | 3300025728 | Bacteria | 138956 |
| 238 | Ga0207655_1007004 | 3300025728 | Bacteria | 7381 |
| 239 | Ga0207655_1007620 | 3300025728 | Bacteria | 6992 |
| 240 | Ga0207655_1009069 | 3300025728 | Bacteria | 6226 |
| 241 | Ga0207655_1012405 | 3300025728 | Bacteria | 4983 |
| 242 | Ga0207655_1012654 | 3300025728 | Bacteria | 4908 |
| 243 | Ga0207655_1019266 | 3300025728 | Bacteria | 3576 |
| 244 | Ga0207655_1029070 | 3300025728 | Bacteria | 2595 |
| 245 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 246 | Ga0207713_1000011 | 3300025735 | Bacteria | 507224 |
| 247 | Ga0207713_1000044 | 3300025735 | Bacteria | 238074 |
| 248 | Ga0207713_1000062 | 3300025735 | Bacteria | 208832 |
| 249 | Ga0207713_1000127 | 3300025735 | Bacteria | 118502 |
| 250 | Ga0207713_1000265 | 3300025735 | Bacteria | 64796 |
| 251 | Ga0207713_1000850 | 3300025735 | Bacteria | 28055 |
| 252 | Ga0207713_1001279 | 3300025735 | Bacteria | 20735 |
| 253 | Ga0207713_1002699 | 3300025735 | Bacteria | 12673 |
| 254 | Ga0207713_1003516 | 3300025735 | Bacteria | 10623 |
| 255 | Ga0207713_1020770 | 3300025735 | Bacteria | 3169 |
| 256 | Ga0207713_1022742 | 3300025735 | Bacteria | 2966 |
| 257 | Ga0207713_1035899 | 3300025735 | Bacteria | 2134 |
| 258 | Ga0207713_1043414 | 3300025735 | Bacteria | 1858 |
| 259 | Ga0207713_1060405 | 3300025735 | Bacteria | 1449 |
| 260 | Ga0207713_1060765 | 3300025735 | Bacteria | 1442 |
| 261 | Ga0207692_10084300 | 3300025898 | Bacteria | 1707 |
| 262 | Ga0207692_10150188 | 3300025898 | Bacteria | 1334 |
| 263 | Ga0207710_10000145 | 3300025900 | Bacteria | 80941 |
| 264 | Ga0207647_10006893 | 3300025904 | Bacteria | 8234 |
| 265 | Ga0207647_10026170 | 3300025904 | Bacteria | 3820 |
| 266 | Ga0207699_10128166 | 3300025906 | Bacteria | 1651 |
| 267 | Ga0207705_10041564 | 3300025909 | Bacteria | 3298 |
| 268 | Ga0207684_10034820 | 3300025910 | Bacteria | 4277 |
| 269 | Ga0207654_10000016 | 3300025911 | Bacteria | 211550 |
| 270 | Ga0207695_10001626 | 3300025913 | Bacteria | 36374 |
| 271 | Ga0207671_10000394 | 3300025914 | Bacteria | 61087 |
| 272 | Ga0207663_10119766 | 3300025916 | Bacteria | 1800 |
| 273 | Ga0207663_10125752 | 3300025916 | Bacteria | 1763 |
| 274 | Ga0207657_10000494 | 3300025919 | Bacteria | 41647 |
| 275 | Ga0207649_10000251 | 3300025920 | Bacteria | 43152 |
| 276 | Ga0207681_10003619 | 3300025923 | Bacteria | 9608 |
| 277 | Ga0207694_10029030 | 3300025924 | Bacteria | 4218 |
| 278 | Ga0207650_10000384 | 3300025925 | Bacteria | 40899 |
| 279 | Ga0207650_10010667 | 3300025925 | Bacteria | 6311 |
| 280 | Ga0207664_10026885 | 3300025929 | Bacteria | 4355 |
| 281 | Ga0207690_10000026 | 3300025932 | Bacteria | 175904 |
| 282 | Ga0207706_10002791 | 3300025933 | Bacteria | 16966 |
| 283 | Ga0207686_10031618 | 3300025934 | Bacteria | 3144 |
| 284 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 285 | Ga0207709_10011361 | 3300025935 | Bacteria | 4910 |
| 286 | Ga0207679_10000016 | 3300025945 | Bacteria | 253494 |
| 287 | Ga0207667_10149635 | 3300025949 | Bacteria | 2403 |
| 288 | Ga0207668_10006823 | 3300025972 | Bacteria | 6767 |
| 289 | Ga0207640_10028871 | 3300025981 | Bacteria | 3398 |
| 290 | Ga0207678_10001257 | 3300026067 | Bacteria | 23391 |
| 291 | Ga0207702_10116828 | 3300026078 | Bacteria | 2381 |
| 292 | Ga0207683_10227559 | 3300026121 | Bacteria | 1700 |
| 293 | Ga0207698_10016462 | 3300026142 | Bacteria | 4985 |
| 294 | Ga0209281_1000005 | 3300027111 | Bacteria | 1242284 |
| 295 | Ga0209281_1000009 | 3300027111 | Bacteria | 771717 |
| 296 | Ga0209281_1000107 | 3300027111 | Bacteria | 218397 |
| 297 | Ga0209281_1008151 | 3300027111 | Bacteria | 2568 |
| 298 | Ga0209371_1000036 | 3300027312 | Bacteria | 367250 |
| 299 | Ga0209371_1000858 | 3300027312 | Bacteria | 24618 |
| 300 | Ga0209371_1001177 | 3300027312 | Bacteria | 19097 |
| 301 | Ga0209371_1005345 | 3300027312 | Bacteria | 5146 |
| 302 | Ga0209984_1003582 | 3300027424 | Bacteria | 1785 |
| 303 | Ga0209282_1101036 | 3300027666 | Bacteria | 1485 |
| 304 | Ga0209588_1005005 | 3300027671 | Bacteria | 3772 |
| 305 | Ga0209813_10006743 | 3300027866 | Bacteria | 2845 |
| 306 | Ga0209974_10041124 | 3300027876 | Bacteria | 1539 |
| 307 | Ga0207428_10001057 | 3300027907 | Bacteria | 30209 |
| 308 | Ga0307515_10026799 | 3300028794 | Bacteria | 9892 |
| 309 | Ga0268256_1000040 | 3300030500 | Bacteria | 348002 |
| 310 | Ga0268256_1000477 | 3300030500 | Bacteria | 34416 |
| 311 | Ga0268256_1001008 | 3300030500 | Bacteria | 19097 |
| 312 | Ga0268256_1001594 | 3300030500 | Bacteria | 13219 |
| 313 | Ga0307511_10002260 | 3300030521 | Bacteria | 20135 |
| 314 | Ga0307512_10071665 | 3300030522 | Bacteria | 2570 |
| 315 | Ga0307513_10000099 | 3300031456 | Bacteria | 125847 |
| 316 | Ga0307513_10225720 | 3300031456 | Bacteria | 1690 |
| 317 | Ga0307509_10009838 | 3300031507 | Bacteria | 11836 |
| 318 | Ga0307408_100003833 | 3300031548 | Bacteria | 10233 |
| 319 | Ga0307408_100009042 | 3300031548 | Bacteria | 6579 |
| 320 | Ga0307508_10033599 | 3300031616 | Bacteria | 4630 |
| 321 | Ga0307514_10021075 | 3300031649 | Bacteria | 5312 |
| 322 | Ga0307514_10137524 | 3300031649 | Bacteria | 1668 |
| 323 | Ga0307516_10042249 | 3300031730 | Bacteria | 4524 |
| 324 | Ga0307405_10002090 | 3300031731 | Bacteria | 8705 |
| 325 | Ga0307405_10063581 | 3300031731 | Bacteria | 2341 |
| 326 | Ga0307413_10033700 | 3300031824 | Bacteria | 2919 |
| 327 | Ga0307518_10167657 | 3300031838 | Bacteria | 1501 |
| 328 | Ga0307407_10031947 | 3300031903 | Bacteria | 2856 |
| 329 | Ga0307412_10001950 | 3300031911 | Bacteria | 11412 |
| 330 | Ga0307412_10014413 | 3300031911 | Bacteria | 4661 |
| 331 | Ga0307409_100181830 | 3300031995 | Bacteria | 1862 |
| 332 | Ga0307414_10036060 | 3300032004 | Bacteria | 3297 |
| 333 | Ga0307414_10328011 | 3300032004 | Bacteria | 1305 |
| 334 | Ga0307411_10028873 | 3300032005 | Bacteria | 3378 |
| 335 | Ga0307507_10116832 | 3300033179 | Bacteria | 2153 |
| 336 | Ga0307507_10212507 | 3300033179 | Bacteria | 1316 |
| 337 | Ga0307510_10034138 | 3300033180 | Bacteria | 5700 |
| 338 | Ga0307510_10181433 | 3300033180 | Bacteria | 1667 |
| 339 | Ga0373928_0026032 | 3300035084 | Bacteria | 1265 |
| 340 | Ga0373949_0008916 | 3300035090 | Bacteria | 2196 |
| 341 | Ga0373932_0005473 | 3300035112 | Bacteria | 2988 |
| 342 | Ga0373941_0002472 | 3300035115 | Bacteria | 4075 |
| 343 | Ga0373931_0067601 | 3300035691 | Bacteria | 1943 |
| 344 | Ga0436365_0778140 | 3300039437 | Bacteria | 3964 |
| 345 | Ga0436361_0048296 | 3300039447 | Bacteria | 2699 |
| 346 | Ga0436361_0401522 | 3300039447 | Bacteria | 1430 |
| 347 | Ga0439438_004505 | 3300041405 | Bacteria | 5318 |
| 348 | Ga0439438_005931 | 3300041405 | Bacteria | 4409 |
| 349 | Ga0439438_010402 | 3300041405 | Bacteria | 2942 |
| 350 | Ga0439438_014038 | 3300041405 | Bacteria | 2394 |
| 351 | Ga0439438_019883 | 3300041405 | Bacteria | 1891 |
| 352 | Ga0439447_019181 | 3300041407 | Bacteria | 1826 |
| 353 | Ga0439466_0000270 | 3300041411 | Bacteria | 20132 |
| 354 | Ga0439466_0003546 | 3300041411 | Bacteria | 6034 |
| 355 | Ga0439466_0039569 | 3300041411 | Bacteria | 1579 |
| 356 | Ga0439466_0044976 | 3300041411 | Bacteria | 1460 |
| 357 | Ga0439466_0045899 | 3300041411 | Bacteria | 1444 |
| 358 | Ga0451802_0529951 | 3300041460 | Bacteria | 1183 |
| 359 | Ga0451853_1210111 | 3300041512 | Bacteria | 6555 |
| 360 | Ga0439433_0002805 | 3300041999 | Bacteria | 3718 |
| 361 | Ga0439448_0022166 | 3300042005 | Bacteria | 1972 |
| 362 | Ga0439432_001555 | 3300042006 | Bacteria | 8614 |
| 363 | Ga0439432_002562 | 3300042006 | Bacteria | 6852 |
| 364 | Ga0439432_005338 | 3300042006 | Bacteria | 4638 |
| 365 | Ga0439432_043073 | 3300042006 | Bacteria | 1425 |
| 366 | Ga0439449_0000216 | 3300042007 | Bacteria | 20485 |
| 367 | Ga0439449_0000368 | 3300042007 | Bacteria | 16559 |
| 368 | Ga0439449_0008568 | 3300042007 | Bacteria | 3883 |
| 369 | Ga0439449_0018834 | 3300042007 | Bacteria | 2588 |
| 370 | Ga0439451_010560 | 3300042009 | Bacteria | 1861 |
| 371 | Ga0439456_023049 | 3300042013 | Bacteria | 1319 |
| 372 | Ga0439457_000640 | 3300042014 | Bacteria | 10343 |
| 373 | Ga0439457_008039 | 3300042014 | Bacteria | 2502 |
| 374 | Ga0439463_001049 | 3300042016 | Bacteria | 7480 |
| 375 | Ga0450907_000010 | 3300042146 | Bacteria | 95376 |
| 376 | Ga0450907_000818 | 3300042146 | Bacteria | 7673 |
| 377 | Ga0450909_002314 | 3300042185 | Bacteria | 2699 |
| 378 | Ga0439464_0006455 | 3300042439 | Bacteria | 3054 |
| 379 | Ga0466969_0008961 | 3300044656 | Bacteria | 5305 |
| 380 | Ga0466969_0009317 | 3300044656 | Bacteria | 5204 |
| 381 | Ga0466969_0009870 | 3300044656 | Bacteria | 5061 |
| 382 | Ga0466969_0061355 | 3300044656 | Bacteria | 1826 |
| 383 | Ga0466972_0009451 | 3300044658 | Bacteria | 4896 |
| 384 | Ga0466972_0043806 | 3300044658 | Bacteria | 2172 |
| 385 | Ga0466965_0001653 | 3300044683 | Bacteria | 9138 |
| 386 | Ga0466965_0002532 | 3300044683 | Bacteria | 7799 |
| 387 | Ga0466966_0000885 | 3300044684 | Bacteria | 19103 |
| 388 | Ga0466966_0099599 | 3300044684 | Bacteria | 1798 |
| 389 | Ga0466966_0124791 | 3300044684 | Bacteria | 1579 |
| 390 | Ga0466961_0000876 | 3300044693 | Bacteria | 18697 |
| 391 | Ga0466961_0027290 | 3300044693 | Bacteria | 3671 |
| 392 | Ga0466961_0038877 | 3300044693 | Bacteria | 3051 |
| 393 | Ga0466963_0001810 | 3300044694 | Bacteria | 11642 |
| 394 | Ga0466963_0214754 | 3300044694 | Bacteria | 1346 |
| 395 | Ga0466964_0004446 | 3300044706 | Bacteria | 5180 |
| 396 | Ga0466964_0091067 | 3300044706 | Bacteria | 1327 |
| 397 | Ga0466971_0000701 | 3300044719 | Bacteria | 13393 |
| 398 | Ga0466971_0036236 | 3300044719 | Bacteria | 2212 |
| 399 | Ga0466970_0000432 | 3300044765 | Bacteria | 20530 |
| 400 | Ga0466957_0000574 | 3300044842 | Bacteria | 18531 |
| 401 | Ga0466957_0141141 | 3300044842 | Bacteria | 1552 |
| 402 | Ga0466959_0002628 | 3300045049 | Bacteria | 11537 |
| 403 | Ga0466959_0018725 | 3300045049 | Bacteria | 5085 |
| 404 | Ga0466959_0076966 | 3300045049 | Bacteria | 2408 |
| 405 | Ga0466958_0005448 | 3300045836 | Bacteria | 6852 |
| 406 | Ga0466967_0000976 | 3300045976 | Bacteria | 15525 |
| 407 | Ga0466967_0267087 | 3300045976 | Bacteria | 1638 |
| 408 | Ga0495617_000054 | 3300046452 | Bacteria | 102256 |
| 409 | Ga0495617_000144 | 3300046452 | Bacteria | 46606 |
| 410 | Ga0495617_008090 | 3300046452 | Bacteria | 3634 |
| 411 | Ga0495617_020775 | 3300046452 | Bacteria | 2219 |
| 412 | Ga0495627_000100 | 3300046453 | Bacteria | 106276 |
| 413 | Ga0495627_000308 | 3300046453 | Bacteria | 48367 |
| 414 | Ga0495627_002826 | 3300046453 | Bacteria | 8036 |
| 415 | Ga0495592_0000800 | 3300046454 | Bacteria | 21805 |
| 416 | Ga0495603_0001986 | 3300046455 | Bacteria | 12045 |
| 417 | Ga0495603_0021119 | 3300046455 | Bacteria | 3942 |
| 418 | Ga0495603_0021860 | 3300046455 | Bacteria | 3873 |
| 419 | Ga0495603_0041783 | 3300046455 | Bacteria | 2741 |
| 420 | Ga0495590_0001206 | 3300046457 | Bacteria | 11305 |
| 421 | Ga0495590_0004191 | 3300046457 | Bacteria | 5835 |
| 422 | Ga0495591_000315 | 3300046458 | Bacteria | 43798 |
| 423 | Ga0495591_001261 | 3300046458 | Bacteria | 16235 |
| 424 | Ga0495591_023221 | 3300046458 | Bacteria | 1992 |
| 425 | Ga0495629_0022330 | 3300046459 | Bacteria | 4512 |
| 426 | Ga0495629_0154682 | 3300046459 | Bacteria | 1594 |
| 427 | Ga0495651_0021970 | 3300046462 | Bacteria | 4963 |
| 428 | Ga0495653_0001170 | 3300046463 | Bacteria | 20256 |
| 429 | Ga0495653_0037631 | 3300046463 | Bacteria | 3799 |
| 430 | Ga0495650_0000881 | 3300046471 | Bacteria | 35559 |
| 431 | Ga0495650_0005496 | 3300046471 | Bacteria | 8193 |
| 432 | Ga0495650_0060045 | 3300046471 | Bacteria | 1528 |
| 433 | Ga0495580_0025815 | 3300046472 | Bacteria | 4290 |
| 434 | Ga0495580_0067123 | 3300046472 | Bacteria | 2510 |
| 435 | Ga0495605_0000794 | 3300046474 | Bacteria | 22656 |
| 436 | Ga0495605_0001665 | 3300046474 | Bacteria | 14288 |
| 437 | Ga0495605_0010840 | 3300046474 | Bacteria | 5090 |
| 438 | Ga0495605_0039013 | 3300046474 | Bacteria | 2380 |
| 439 | Ga0495639_0000032 | 3300046475 | Bacteria | 64548 |
| 440 | Ga0495662_0002045 | 3300046476 | Bacteria | 10107 |
| 441 | Ga0495664_0154183 | 3300046477 | Bacteria | 1393 |
| 442 | Ga0495584_0000409 | 3300046491 | Bacteria | 29687 |
| 443 | Ga0495584_0000547 | 3300046491 | Bacteria | 25497 |
| 444 | Ga0495584_0001764 | 3300046491 | Bacteria | 12598 |
| 445 | Ga0495584_0002662 | 3300046491 | Bacteria | 10055 |
| 446 | Ga0495585_0004329 | 3300046492 | Bacteria | 9231 |
| 447 | Ga0495585_0018164 | 3300046492 | Bacteria | 4057 |
| 448 | Ga0495585_0075797 | 3300046492 | Bacteria | 1828 |
| 449 | Ga0495585_0096331 | 3300046492 | Bacteria | 1588 |
| 450 | Ga0495594_0050018 | 3300046499 | Bacteria | 2298 |
| 451 | Ga0495607_0000185 | 3300046501 | Bacteria | 66759 |
| 452 | Ga0495607_0000290 | 3300046501 | Bacteria | 53251 |
| 453 | Ga0495607_0000617 | 3300046501 | Bacteria | 34500 |
| 454 | Ga0495607_0018916 | 3300046501 | Bacteria | 4381 |
| 455 | Ga0495607_0026414 | 3300046501 | Bacteria | 3603 |
| 456 | Ga0495607_0048900 | 3300046501 | Bacteria | 2469 |
| 457 | Ga0495583_0003663 | 3300046506 | Bacteria | 11448 |
| 458 | Ga0495583_0011288 | 3300046506 | Bacteria | 5139 |
| 459 | Ga0495583_0021045 | 3300046506 | Bacteria | 3360 |
| 460 | Ga0495606_0000633 | 3300046507 | Bacteria | 55270 |
| 461 | Ga0495606_0003155 | 3300046507 | Bacteria | 17833 |
| 462 | Ga0495606_0025714 | 3300046507 | Bacteria | 4209 |
| 463 | Ga0495608_0004232 | 3300046511 | Bacteria | 10289 |
| 464 | Ga0495610_0002898 | 3300046512 | Bacteria | 13883 |
| 465 | Ga0495610_0039563 | 3300046512 | Bacteria | 2383 |
| 466 | Ga0495616_0000226 | 3300046513 | Bacteria | 46396 |
| 467 | Ga0495616_0000661 | 3300046513 | Bacteria | 25616 |
| 468 | Ga0495616_0008245 | 3300046513 | Bacteria | 6185 |
| 469 | Ga0495616_0027410 | 3300046513 | Bacteria | 3022 |
| 470 | Ga0495616_0032013 | 3300046513 | Bacteria | 2750 |
| 471 | Ga0495618_0224363 | 3300046514 | Bacteria | 1184 |
| 472 | Ga0495620_0001031 | 3300046515 | Bacteria | 17120 |
| 473 | Ga0495620_0002862 | 3300046515 | Bacteria | 9918 |
| 474 | Ga0495620_0056787 | 3300046515 | Bacteria | 1645 |
| 475 | Ga0495628_0046540 | 3300046516 | Bacteria | 3444 |
| 476 | Ga0495630_0047238 | 3300046517 | Bacteria | 3219 |
| 477 | Ga0495632_0000754 | 3300046519 | Bacteria | 29135 |
| 478 | Ga0495632_0001740 | 3300046519 | Bacteria | 17652 |
| 479 | Ga0495637_0007143 | 3300046520 | Bacteria | 5560 |
| 480 | Ga0495637_0007481 | 3300046520 | Bacteria | 5410 |
| 481 | Ga0495637_0076198 | 3300046520 | Bacteria | 1344 |
| 482 | Ga0495643_0031124 | 3300046522 | Bacteria | 2972 |
| 483 | Ga0495643_0051205 | 3300046522 | Bacteria | 2221 |
| 484 | Ga0495643_0066575 | 3300046522 | Bacteria | 1900 |
| 485 | Ga0495648_0001506 | 3300046524 | Bacteria | 22801 |
| 486 | Ga0495648_0002095 | 3300046524 | Bacteria | 18834 |
| 487 | Ga0495648_0005959 | 3300046524 | Bacteria | 10028 |
| 488 | Ga0495648_0035448 | 3300046524 | Bacteria | 3234 |
| 489 | Ga0495648_0057823 | 3300046524 | Bacteria | 2322 |
| 490 | Ga0495666_0010570 | 3300046526 | Bacteria | 4600 |
| 491 | Ga0495642_0000316 | 3300046528 | Bacteria | 26656 |
| 492 | Ga0495642_0004676 | 3300046528 | Bacteria | 5303 |
| 493 | Ga0495652_0067382 | 3300046529 | Bacteria | 3001 |
| 494 | Ga0495654_0000288 | 3300046530 | Bacteria | 45799 |
| 495 | Ga0495654_0000306 | 3300046530 | Bacteria | 43427 |
| 496 | Ga0495654_0000616 | 3300046530 | Bacteria | 28330 |
| 497 | Ga0495654_0002069 | 3300046530 | Bacteria | 13171 |
| 498 | Ga0495654_0011451 | 3300046530 | Bacteria | 4799 |
| 499 | Ga0495654_0048471 | 3300046530 | Bacteria | 2084 |
| 500 | Ga0495665_0005951 | 3300046531 | Bacteria | 6570 |
| 501 | Ga0495640_0007888 | 3300046533 | Bacteria | 8371 |
| 502 | Ga0495640_0076155 | 3300046533 | Bacteria | 2239 |
| 503 | Ga0495586_0004174 | 3300046535 | Bacteria | 7739 |
| 504 | Ga0495587_0004867 | 3300046536 | Bacteria | 8808 |
| 505 | Ga0495609_0007500 | 3300046538 | Bacteria | 5440 |
| 506 | Ga0495609_0008213 | 3300046538 | Bacteria | 5123 |
| 507 | Ga0495609_0043234 | 3300046538 | Bacteria | 2023 |
| 508 | Ga0495597_0018574 | 3300046542 | Bacteria | 3262 |
| 509 | Ga0495597_0047574 | 3300046542 | Bacteria | 1898 |
| 510 | Ga0495622_0002772 | 3300046557 | Bacteria | 8372 |
| 511 | Ga0495622_0007970 | 3300046557 | Bacteria | 4911 |
| 512 | Ga0495622_0008609 | 3300046557 | Bacteria | 4729 |
| 513 | Ga0495633_0124689 | 3300046558 | Bacteria | 1192 |
| 514 | Ga0495667_0038294 | 3300046559 | Bacteria | 3193 |
| 515 | Ga0495656_0001994 | 3300046615 | Bacteria | 6722 |
| 516 | Ga0495634_0000025 | 3300046642 | Bacteria | 115964 |
| 517 | Ga0495634_0191337 | 3300046642 | Bacteria | 1276 |
| 518 | Ga0495611_0021347 | 3300046648 | Bacteria | 2797 |
| 519 | Ga0495625_0000847 | 3300046660 | Bacteria | 41784 |
| 520 | Ga0495625_0030964 | 3300046660 | Bacteria | 3984 |
| 521 | Ga0495635_0032535 | 3300046663 | Bacteria | 3618 |
| 522 | Ga0495635_0034169 | 3300046663 | Bacteria | 3527 |
| 523 | Ga0495635_0083363 | 3300046663 | Bacteria | 2187 |
| 524 | Ga0495659_0001160 | 3300046664 | Bacteria | 9145 |
| 525 | Ga0495659_0003525 | 3300046664 | Bacteria | 4987 |
| 526 | Ga0495661_0000028 | 3300046665 | Bacteria | 182191 |
| 527 | Ga0495661_0000083 | 3300046665 | Bacteria | 116027 |
| 528 | Ga0495661_0004052 | 3300046665 | Bacteria | 10673 |
| 529 | Ga0495588_0012539 | 3300046674 | Bacteria | 4009 |
| 530 | Ga0495657_0024393 | 3300046675 | Bacteria | 4308 |
| 531 | Ga0495599_0147771 | 3300046678 | Bacteria | 1456 |
| 532 | Ga0495623_0063191 | 3300046679 | Bacteria | 2318 |
| 533 | Ga0495623_0135382 | 3300046679 | Bacteria | 1471 |
| 534 | Ga0495646_0074166 | 3300046680 | Bacteria | 1997 |
| 535 | Ga0495646_0092979 | 3300046680 | Bacteria | 1738 |
| 536 | Ga0495669_0001097 | 3300046684 | Bacteria | 11202 |
| 537 | Ga0495624_0016369 | 3300046690 | Bacteria | 4991 |
| 538 | Ga0495670_0013939 | 3300046691 | Bacteria | 3954 |
| 539 | Ga0495671_0000295 | 3300046692 | Bacteria | 41756 |
| 540 | Ga0495671_0001060 | 3300046692 | Bacteria | 19054 |
| 541 | Ga0495671_0031802 | 3300046692 | Bacteria | 2696 |
| 542 | Ga0495649_0000013 | 3300046694 | Bacteria | 316013 |
| 543 | Ga0495649_0000909 | 3300046694 | Bacteria | 23449 |
| 544 | Ga0495649_0005272 | 3300046694 | Bacteria | 8264 |
| 545 | Ga0495649_0066204 | 3300046694 | Bacteria | 1939 |
| 546 | Ga0495589_0000010 | 3300046794 | Bacteria | 250407 |
| 547 | Ga0495589_0000141 | 3300046794 | Bacteria | 66457 |
| 548 | Ga0495589_0050688 | 3300046794 | Bacteria | 2052 |
| 549 | Ga0495600_0076365 | 3300046809 | Bacteria | 2187 |
| 550 | Ga0495600_0231613 | 3300046809 | Bacteria | 1179 |
| 551 | Ga0495660_0043368 | 3300046810 | Bacteria | 2482 |
| 552 | Ga0495604_0000491 | 3300047317 | Bacteria | 34687 |
| 553 | Ga0495604_0002087 | 3300047317 | Bacteria | 16085 |
| 554 | Ga0495636_0036577 | 3300047318 | Bacteria | 2025 |
| 555 | Ga0495636_0042658 | 3300047318 | Bacteria | 1886 |
| 556 | Ga0495674_0013289 | 3300047319 | Bacteria | 7742 |
| 557 | Ga0495672_0000289 | 3300047320 | Bacteria | 69285 |
| 558 | Ga0495672_0001978 | 3300047320 | Bacteria | 19360 |
| 559 | Ga0495672_0006656 | 3300047320 | Bacteria | 8875 |
| 560 | Ga0495672_0016761 | 3300047320 | Bacteria | 4918 |
| 561 | Ga0495672_0056286 | 3300047320 | Bacteria | 2289 |
| 562 | Ga0495676_0031256 | 3300047321 | Bacteria | 4505 |
| 563 | Ga0495676_0046429 | 3300047321 | Bacteria | 3524 |
| 564 | Ga0495680_0010178 | 3300047322 | Bacteria | 8403 |
| 565 | Ga0495683_0005005 | 3300047323 | Bacteria | 7421 |
| 566 | Ga0495683_0006189 | 3300047323 | Bacteria | 6552 |
| 567 | Ga0495683_0087446 | 3300047323 | Bacteria | 1513 |
| 568 | Ga0495683_0139904 | 3300047323 | Bacteria | 1135 |
| 569 | Ga0495687_000715 | 3300047443 | Bacteria | 36786 |
| 570 | Ga0495687_004143 | 3300047443 | Bacteria | 9986 |
| 571 | Ga0495687_008394 | 3300047443 | Bacteria | 5915 |
| 572 | Ga0495687_011525 | 3300047443 | Bacteria | 4747 |
| 573 | Ga0495687_038970 | 3300047443 | Bacteria | 2105 |
| 574 | Ga0495675_0011462 | 3300047444 | Bacteria | 5565 |
| 575 | Ga0495679_000711 | 3300047446 | Bacteria | 21533 |
| 576 | Ga0495679_005752 | 3300047446 | Bacteria | 5460 |
| 577 | Ga0495679_005912 | 3300047446 | Bacteria | 5361 |
| 578 | Ga0495679_007398 | 3300047446 | Bacteria | 4579 |
| 579 | Ga0495679_014366 | 3300047446 | Bacteria | 2937 |
| 580 | Ga0495685_003608 | 3300047447 | Bacteria | 4949 |
| 581 | Ga0495685_007685 | 3300047447 | Bacteria | 3564 |
| 582 | Ga0495673_0000190 | 3300047469 | Bacteria | 97539 |
| 583 | Ga0495673_0000833 | 3300047469 | Bacteria | 28784 |
| 584 | Ga0495673_0002842 | 3300047469 | Bacteria | 11791 |
| 585 | Ga0495673_0027701 | 3300047469 | Bacteria | 2692 |
| 586 | Ga0495681_0000027 | 3300047470 | Bacteria | 141884 |
| 587 | Ga0495681_0000237 | 3300047470 | Bacteria | 45823 |
| 588 | Ga0495684_0080737 | 3300047471 | Bacteria | 2468 |
| 589 | Ga0495686_0135393 | 3300047472 | Bacteria | 1457 |
| 590 | Ga0495593_0006494 | 3300047673 | Bacteria | 6853 |
| 591 | Ga0495602_0017638 | 3300048088 | Bacteria | 7152 |
| 592 | Ga0495614_0020018 | 3300048089 | Bacteria | 2894 |
| 593 | Ga0495614_0020284 | 3300048089 | Bacteria | 2875 |
| 594 | Ga0495626_0000352 | 3300048091 | Bacteria | 48007 |
| 595 | Ga0495626_0005473 | 3300048091 | Bacteria | 7412 |
| 596 | Ga0495626_0129223 | 3300048091 | Bacteria | 1080 |
| 597 | Ga0496100_0000516 | 3300048903 | Bacteria | 18505 |
| 598 | Ga0496100_0051117 | 3300048903 | Bacteria | 2681 |
| 599 | Ga0496101_0000023 | 3300048904 | Bacteria | 209923 |
| 600 | Ga0496101_0004518 | 3300048904 | Bacteria | 8779 |
| 601 | Ga0496102_0000038 | 3300048905 | Bacteria | 198844 |
| 602 | Ga0496102_0007086 | 3300048905 | Bacteria | 9568 |
| 603 | Ga0496102_0026298 | 3300048905 | Bacteria | 5189 |
| 604 | Ga0496103_0005594 | 3300048906 | Bacteria | 7516 |
| 605 | Ga0496103_0096252 | 3300048906 | Bacteria | 1871 |
| 606 | Ga0496104_0001353 | 3300048907 | Bacteria | 21218 |
| 607 | Ga0496105_0000207 | 3300048908 | Bacteria | 39354 |
| 608 | Ga0496105_0026938 | 3300048908 | Bacteria | 4691 |
| 609 | Ga0496106_0002123 | 3300048909 | Bacteria | 14835 |
| 610 | Ga0496107_0002440 | 3300048910 | Bacteria | 12045 |
| 611 | Ga0496108_0001726 | 3300048911 | Bacteria | 17345 |
| 612 | Ga0496109_0002642 | 3300048912 | Bacteria | 15026 |
| 613 | Ga0496109_0221970 | 3300048912 | Bacteria | 1777 |
| 614 | Ga0496110_0052572 | 3300048913 | Bacteria | 3579 |
| 615 | Ga0496111_0000662 | 3300048914 | Bacteria | 18077 |
| 616 | Ga0496111_0125801 | 3300048914 | Bacteria | 1895 |
| 617 | Ga0496111_0508339 | 3300048914 | Bacteria | 886 |
| 618 | Ga0496112_0002268 | 3300048915 | Bacteria | 15382 |
| 619 | Ga0496112_0060524 | 3300048915 | Bacteria | 3732 |
| 620 | Ga0496113_0011643 | 3300048916 | Bacteria | 5881 |
| 621 | Ga0496113_0169763 | 3300048916 | Bacteria | 1727 |
| 622 | Ga0496115_0028447 | 3300048918 | Bacteria | 4381 |
| 623 | Ga0496116_0000077 | 3300048919 | Bacteria | 227959 |
| 624 | Ga0496116_0000221 | 3300048919 | Bacteria | 106314 |
| 625 | Ga0496116_0000984 | 3300048919 | Bacteria | 34981 |
| 626 | Ga0496116_0001107 | 3300048919 | Bacteria | 32303 |
| 627 | Ga0496116_0003444 | 3300048919 | Bacteria | 15629 |
| 628 | Ga0496116_0047963 | 3300048919 | Bacteria | 2870 |
| 629 | Ga0496116_0107552 | 3300048919 | Bacteria | 1648 |
| 630 | Ga0496117_0000017 | 3300048920 | Bacteria | 490421 |
| 631 | Ga0496117_0000219 | 3300048920 | Bacteria | 109688 |
| 632 | Ga0496117_0001257 | 3300048920 | Bacteria | 37760 |
| 633 | Ga0496117_0001570 | 3300048920 | Bacteria | 32425 |
| 634 | Ga0496117_0002611 | 3300048920 | Bacteria | 22395 |
| 635 | Ga0496117_0031730 | 3300048920 | Bacteria | 4028 |
| 636 | Ga0496117_0032512 | 3300048920 | Bacteria | 3962 |
| 637 | Ga0496117_0036374 | 3300048920 | Bacteria | 3684 |
| 638 | Ga0496117_0092248 | 3300048920 | Bacteria | 1946 |
| 639 | Ga0496117_0135562 | 3300048920 | Bacteria | 1484 |
| 640 | Ga0496118_0000018 | 3300048921 | Bacteria | 490421 |
| 641 | Ga0496118_0000301 | 3300048921 | Bacteria | 85827 |
| 642 | Ga0496118_0008371 | 3300048921 | Bacteria | 10697 |
| 643 | Ga0496118_0024337 | 3300048921 | Bacteria | 5228 |
| 644 | Ga0496118_0038172 | 3300048921 | Bacteria | 3853 |
| 645 | Ga0496118_0051169 | 3300048921 | Bacteria | 3162 |
| 646 | Ga0496118_0067827 | 3300048921 | Bacteria | 2594 |
| 647 | Ga0496118_0102657 | 3300048921 | Bacteria | 1926 |
| 648 | Ga0496118_0103732 | 3300048921 | Bacteria | 1911 |
| 649 | Ga0496118_0110937 | 3300048921 | Bacteria | 1820 |
| 650 | Ga0496119_0000005 | 3300048922 | Bacteria | 529799 |
| 651 | Ga0496119_0001451 | 3300048922 | Bacteria | 28525 |
| 652 | Ga0496119_0001653 | 3300048922 | Bacteria | 26225 |
| 653 | Ga0496119_0002190 | 3300048922 | Bacteria | 21858 |
| 654 | Ga0496119_0006142 | 3300048922 | Bacteria | 11245 |
| 655 | Ga0496119_0012321 | 3300048922 | Bacteria | 6959 |
| 656 | Ga0496119_0014815 | 3300048922 | Bacteria | 6067 |
| 657 | Ga0496119_0025426 | 3300048922 | Bacteria | 4136 |
| 658 | Ga0496119_0067699 | 3300048922 | Bacteria | 2105 |
| 659 | Ga0496120_0000005 | 3300048923 | Bacteria | 529797 |
| 660 | Ga0496120_0000010 | 3300048923 | Bacteria | 385791 |
| 661 | Ga0496120_0000028 | 3300048923 | Bacteria | 230249 |
| 662 | Ga0496120_0000112 | 3300048923 | Bacteria | 136735 |
| 663 | Ga0496120_0000139 | 3300048923 | Bacteria | 120489 |
| 664 | Ga0496120_0001588 | 3300048923 | Bacteria | 26426 |
| 665 | Ga0496120_0006263 | 3300048923 | Bacteria | 9182 |
| 666 | Ga0496121_0000055 | 3300048924 | Bacteria | 304572 |
| 667 | Ga0496121_0000307 | 3300048924 | Bacteria | 101849 |
| 668 | Ga0496121_0004753 | 3300048924 | Bacteria | 17930 |
| 669 | Ga0496121_0007545 | 3300048924 | Bacteria | 13107 |
| 670 | Ga0496122_0001299 | 3300048925 | Bacteria | 41264 |
| 671 | Ga0496122_0009382 | 3300048925 | Bacteria | 10326 |
| 672 | Ga0496122_0011679 | 3300048925 | Bacteria | 8850 |
| 673 | Ga0496122_0025572 | 3300048925 | Bacteria | 5122 |
| 674 | Ga0496123_0001034 | 3300048926 | Bacteria | 42222 |
| 675 | Ga0496123_0004814 | 3300048926 | Bacteria | 13927 |
| 676 | Ga0496123_0017123 | 3300048926 | Bacteria | 5847 |
| 677 | Ga0496123_0078198 | 3300048926 | Bacteria | 2027 |
| 678 | Ga0496124_0000100 | 3300048927 | Bacteria | 181404 |
| 679 | Ga0496124_0000158 | 3300048927 | Bacteria | 137433 |
| 680 | Ga0496124_0003813 | 3300048927 | Bacteria | 18088 |
| 681 | Ga0496124_0003909 | 3300048927 | Bacteria | 17810 |
| 682 | Ga0496124_0004394 | 3300048927 | Bacteria | 16469 |
| 683 | Ga0496124_0007113 | 3300048927 | Bacteria | 11983 |
| 684 | Ga0496124_0029540 | 3300048927 | Bacteria | 4882 |
| 685 | Ga0496124_0098283 | 3300048927 | Bacteria | 2376 |
| 686 | Ga0496124_0172450 | 3300048927 | Bacteria | 1673 |
| 687 | Ga0496125_0002257 | 3300048928 | Bacteria | 25575 |
| 688 | Ga0496125_0003672 | 3300048928 | Bacteria | 18339 |
| 689 | Ga0496125_0011347 | 3300048928 | Bacteria | 8921 |
| 690 | Ga0496125_0012606 | 3300048928 | Bacteria | 8375 |
| 691 | Ga0496125_0138322 | 3300048928 | Bacteria | 1698 |
| 692 | Ga0496126_0002392 | 3300048929 | Bacteria | 25512 |
| 693 | Ga0496126_0029144 | 3300048929 | Bacteria | 5247 |
| 694 | Ga0496126_0035768 | 3300048929 | Bacteria | 4650 |
| 695 | Ga0496126_0057901 | 3300048929 | Bacteria | 3495 |
| 696 | Ga0496126_0167995 | 3300048929 | Bacteria | 1871 |
| 697 | Ga0501305_009082 | 3300049161 | Bacteria | 1299 |
| 698 | Ga0495678_000724 | 3300049459 | Bacteria | 29966 |
| 699 | Ga0495678_002190 | 3300049459 | Bacteria | 13698 |
| 700 | Ga0495678_006568 | 3300049459 | Bacteria | 6168 |
| 701 | Ga0495678_007868 | 3300049459 | Bacteria | 5475 |
| 702 | Ga0495678_012807 | 3300049459 | Bacteria | 3961 |
| 703 | Ga0495678_033179 | 3300049459 | Bacteria | 2133 |
| 704 | Ga0495682_0001677 | 3300049460 | Bacteria | 11299 |
| 705 | Ga0495682_0008178 | 3300049460 | Bacteria | 4131 |
| 706 | Ga0501312_000335 | 3300049528 | Bacteria | 3576 |
| 707 | Ga0501335_000125 | 3300049551 | Bacteria | 3752 |
| 708 | Ga0501336_000511 | 3300049552 | Bacteria | 1951 |
| 709 | Ga0501038_0104816 | 3300049574 | Bacteria | 2350 |
| 710 | nmdc:mga06z11_1188_c1 | 3300050494 | Bacteria | 9582 |
| 711 | nmdc:mga04h51_1659_c1 | 3300050495 | Bacteria | 5200 |
| 712 | nmdc:mga05p37_382408_c1 | 3300050507 | Bacteria | 1649 |
| 713 | Ga0495601_0008947 | 3300053077 | Bacteria | 5911 |
| 714 | Ga0500578_0128023 | 3300053086 | Bacteria | 1594 |
| 715 | Ga0500618_007443 | 3300053125 | Bacteria | 3125 |
| 716 | Ga0500573_0091310 | 3300053140 | Bacteria | 1720 |
| 717 | Ga0466962_0002211 | 3300061719 | Bacteria | 9192 |
| 718 | 2506580856 | 2506520007 | Bacteria | 5442880 |
| 719 | 2506585995 | 2506520008 | Bacteria | 5443009 |
| 720 | 2508854665 | 2508501071 | Bacteria | 5454741 |
| 721 | 2510284536 | 2510065053 | Bacteria | 5005518 |
| 722 | 2510295986 | 2510065055 | Bacteria | 5037935 |
| 723 | 2510311914 | 2510065058 | Bacteria | 5005894 |
| 724 | 2511253802 | 2511231004 | Bacteria | 6669789 |
| 725 | 2511255458 | 2511231004 | Bacteria | 6669789 |
| 726 | 2511268221 | 2511231006 | Bacteria | 6794709 |
| 727 | 2511272546 | 2511231007 | Bacteria | 6306603 |
| 728 | 2511290773 | 2511231010 | Bacteria | 6373152 |
| 729 | 2511313847 | 2511231014 | Bacteria | 6462302 |
| 730 | 2511323318 | 2511231015 | Bacteria | 6598026 |
| 731 | 2511327779 | 2511231016 | Bacteria | 6704427 |
| 732 | 2511343835 | 2511231019 | Bacteria | 6520662 |
| 733 | 2511358631 | 2511231021 | Bacteria | 7302637 |
| 734 | 2511362414 | 2511231022 | Bacteria | 6719296 |
| 735 | 2511380672 | 2511231025 | Bacteria | 5324661 |
| 736 | 2511437281 | 2511231035 | Bacteria | 5341610 |
| 737 | 2511824369 | 2511231156 | Bacteria | 6845832 |
| 738 | 2512328379 | 2512047018 | Bacteria | 6663241 |
| 739 | 2512731739 | 2512564039 | Bacteria | 8739048 |
| 740 | 2519458511 | 2519103095 | Bacteria | 6629912 |
| 741 | 2555262202 | 2554235234 | Bacteria | 5762085 |
| 742 | 2555669599 | 2554235341 | Bacteria | 6867980 |
| 743 | 2583792851 | 2582580891 | Bacteria | 6800976 |
| 744 | 2585292917 | 2582581311 | Bacteria | 6763856 |
| 745 | 2585320302 | 2582581314 | Bacteria | 11452267 |
| 746 | 2597857604 | 2597489887 | Bacteria | 6666321 |
| 747 | 2597864244 | 2597489888 | Bacteria | 6179543 |
| 748 | 2597869501 | 2597489889 | Bacteria | 6297495 |
| 749 | 2599330607 | 2599185155 | Bacteria | 5827168 |
| 750 | 2599353404 | 2599185160 | Bacteria | 6844013 |
| 751 | 2599363797 | 2599185161 | Bacteria | 6960462 |
| 752 | 2599370117 | 2599185162 | Bacteria | 6957254 |
| 753 | 2599372424 | 2599185163 | Bacteria | 6995158 |
| 754 | 2599378512 | 2599185164 | Bacteria | 6841688 |
| 755 | 2599384111 | 2599185165 | Bacteria | 6843250 |
| 756 | 2599391283 | 2599185166 | Bacteria | 6959206 |
| 757 | 2599399233 | 2599185167 | Bacteria | 6353609 |
| 758 | 2599407528 | 2599185168 | Bacteria | 6997636 |
| 759 | 2599412358 | 2599185169 | Bacteria | 5441380 |
| 760 | 2599453666 | 2599185179 | Bacteria | 6611171 |
| 761 | 2599460238 | 2599185181 | Bacteria | 6844519 |
| 762 | 2599470630 | 2599185182 | Bacteria | 6883168 |
| 763 | 2599484461 | 2599185185 | Bacteria | 6652270 |
| 764 | 2599489259 | 2599185186 | Bacteria | 6831633 |
| 765 | 2599502202 | 2599185188 | Bacteria | 6164180 |
| 766 | 2599509112 | 2599185189 | Bacteria | 5862825 |
| 767 | 2599513725 | 2599185190 | Bacteria | 6285678 |
| 768 | 2599518905 | 2599185191 | Bacteria | 6297582 |
| 769 | 2599616067 | 2599185212 | Bacteria | 6765997 |
| 770 | 2599737435 | 2599185239 | Bacteria | 8686614 |
| 771 | 2599748704 | 2599185240 | Bacteria | 7968121 |
| 772 | 2599772658 | 2599185248 | Bacteria | 6696816 |
| 773 | 2599802267 | 2599185257 | Bacteria | 6492581 |
| 774 | 2599881042 | 2599185288 | Bacteria | 6666191 |
| 775 | 2599885068 | 2599185289 | Bacteria | 6778765 |
| 776 | 2599892782 | 2599185290 | Bacteria | 6289611 |
| 777 | 2599899793 | 2599185291 | Bacteria | 6775623 |
| 778 | 2599932738 | 2599185300 | Bacteria | 6062622 |
| 779 | 2599945254 | 2599185302 | Bacteria | 5954930 |
| 780 | 2599949676 | 2599185303 | Bacteria | 6512725 |
| 781 | 2599955394 | 2599185304 | Bacteria | 5951361 |
| 782 | 2599960884 | 2599185305 | Bacteria | 6748700 |
| 783 | 2599965489 | 2599185306 | Bacteria | 6637356 |
| 784 | 2599976604 | 2599185308 | Bacteria | 6621546 |
| 785 | 2599984429 | 2599185309 | Bacteria | 5969593 |
| 786 | 2599990400 | 2599185310 | Bacteria | 6014457 |
| 787 | 2599992829 | 2599185311 | Bacteria | 6354990 |
| 788 | 2600001658 | 2599185312 | Bacteria | 5912071 |
| 789 | 2600008912 | 2599185313 | Bacteria | 6658188 |
| 790 | 2600010651 | 2599185314 | Bacteria | 6621749 |
| 791 | 2600018378 | 2599185315 | Bacteria | 6771107 |
| 792 | 2600023308 | 2599185316 | Bacteria | 6320029 |
| 793 | 2600028221 | 2599185317 | Bacteria | 6435722 |
| 794 | 2600034158 | 2599185318 | Bacteria | 6961590 |
| 795 | 2600040329 | 2599185319 | Bacteria | 6637840 |
| 796 | 2600049238 | 2599185320 | Bacteria | 5963263 |
| 797 | 2600052898 | 2599185321 | Bacteria | 6764560 |
| 798 | 2600056979 | 2599185322 | Bacteria | 6763055 |
| 799 | 2600066806 | 2599185323 | Bacteria | 6688755 |
| 800 | 2600074058 | 2599185324 | Bacteria | 6590677 |
| 801 | 2600077535 | 2599185325 | Bacteria | 6324919 |
| 802 | 2600210615 | 2599185355 | Bacteria | 7968906 |
| 803 | 2600212847 | 2599185356 | Bacteria | 6843884 |
| 804 | 2600357330 | 2600254930 | Bacteria | 6431253 |
| 805 | 2600366910 | 2600254931 | Bacteria | 6734225 |
| 806 | 2601526248 | 2600255254 | Bacteria | 5281859 |
| 807 | 2601530219 | 2600255255 | Bacteria | 5282785 |
| 808 | 2601617177 | 2600255280 | Bacteria | 5292309 |
| 809 | 2601622136 | 2600255281 | Bacteria | 5288753 |
| 810 | 2601645681 | 2600255287 | Bacteria | 5210468 |
| 811 | 2601649933 | 2600255288 | Bacteria | 5282738 |
| 812 | 2601655223 | 2600255289 | Bacteria | 5281907 |
| 813 | 2601661559 | 2600255290 | Bacteria | 5282218 |
| 814 | 2601665820 | 2600255291 | Bacteria | 5217298 |
| 815 | 2601690402 | 2600255296 | Bacteria | 5784754 |
| 816 | 2601698678 | 2600255298 | Bacteria | 5215185 |
| 817 | 2601703829 | 2600255299 | Bacteria | 5218662 |
| 818 | 2601709388 | 2600255300 | Bacteria | 5287774 |
| 819 | 2601712923 | 2600255301 | Bacteria | 5280532 |
| 820 | 2601718359 | 2600255302 | Bacteria | 5288235 |
| 821 | 2601723765 | 2600255303 | Bacteria | 5219315 |
| 822 | 2601728646 | 2600255304 | Bacteria | 5283973 |
| 823 | 2601733307 | 2600255305 | Bacteria | 5282329 |
| 824 | 2601737581 | 2600255306 | Bacteria | 5281613 |
| 825 | 2601744419 | 2600255307 | Bacteria | 5439064 |
| 826 | 2601752900 | 2600255309 | Bacteria | 5431045 |
| 827 | 2601773015 | 2600255313 | Bacteria | 6842543 |
| 828 | 2602019386 | 2600255392 | Bacteria | 5437392 |
| 829 | 2603663355 | 2602042052 | Bacteria | 5215873 |
| 830 | 2603668557 | 2602042053 | Bacteria | 5214361 |
| 831 | 2603840851 | 2602042103 | Bacteria | 5284714 |
| 832 | 2603846162 | 2602042104 | Bacteria | 5281639 |
| 833 | 2603850998 | 2602042105 | Bacteria | 5282303 |
| 834 | 2603856304 | 2602042106 | Bacteria | 5282744 |
| 835 | 2603869109 | 2602042109 | Bacteria | 5152801 |
| 836 | 2603873883 | 2602042110 | Bacteria | 5283285 |
| 837 | 2603879048 | 2602042111 | Bacteria | 5212080 |
| 838 | 2606051063 | 2603880178 | Bacteria | 5283018 |
| 839 | 2606072980 | 2603880184 | Bacteria | 5217896 |
| 840 | 2606148512 | 2603880202 | Bacteria | 5284684 |
| 841 | 2606178955 | 2603880211 | Bacteria | 5284226 |
| 842 | 2621300196 | 2619619299 | Bacteria | 6649820 |
| 843 | 2624491488 | 2623620446 | Bacteria | 6500345 |
| 844 | 2637227357 | 2636415599 | Bacteria | 5718434 |
| 845 | 2643871068 | 2643221571 | Bacteria | 6228673 |
| 846 | 2644190361 | 2643221633 | Bacteria | 6733554 |
| 847 | 2644270631 | 2643221647 | Bacteria | 10741251 |
| 848 | 2644284920 | 2643221650 | Bacteria | 7029547 |
| 849 | 2644622519 | 2643221713 | Bacteria | 6554480 |
| 850 | 2644630566 | 2643221714 | Bacteria | 9015452 |
| 851 | 2644716823 | 2643221731 | Bacteria | 5623886 |
| 852 | 2644725626 | 2643221732 | Bacteria | 5756404 |
| 853 | 2652547173 | 2651869719 | Bacteria | 6047974 |
| 854 | 2656276696 | 2654587920 | Bacteria | 5475511 |
| 855 | 2671094656 | 2667528170 | Bacteria | 6786960 |
| 856 | 2671095029 | 2667528171 | Bacteria | 6900659 |
| 857 | 2671124822 | 2667528176 | Bacteria | 6724917 |
| 858 | 2671770114 | 2671180172 | Bacteria | 6495783 |
| 859 | 2676409336 | 2675903046 | Bacteria | 5451247 |
| 860 | 2676746865 | 2675903129 | Bacteria | 7964495 |
| 861 | 2677901165 | 2675903420 | Bacteria | 6247433 |
| 862 | 2678263884 | 2675903515 | Bacteria | 6580491 |
| 863 | 2689447413 | 2687453601 | Bacteria | 5546041 |
| 864 | 2723249072 | 2721755607 | Bacteria | 5841722 |
| 865 | 2738675108 | 2738541265 | Bacteria | 6594665 |
| 866 | 2738753398 | 2738541282 | Bacteria | 6593925 |
| 867 | 2738810539 | 2738541294 | Bacteria | 6925949 |
| 868 | 2738862310 | 2738541303 | Bacteria | 6591772 |
| 869 | 2738897899 | 2738541309 | Bacteria | 6926455 |
| 870 | 2739257986 | 2738543015 | Bacteria | 6750701 |
| 871 | 2743737039 | 2740892503 | Bacteria | 6855563 |
| 872 | 2745004337 | 2744054620 | Bacteria | 6551379 |
| 873 | 2772441221 | 2772190666 | Bacteria | 5117644 |
| 874 | 2774123123 | 2773857670 | Bacteria | 6407454 |
| 875 | 2774130783 | 2773857672 | Bacteria | 4993178 |
| 876 | 2777021725 | 2775507074 | Bacteria | 5532402 |
| 877 | 2784315471 | 2784132072 | Bacteria | 6596533 |
| 878 | 2785373751 | 2784746768 | Bacteria | 10036182 |
| 879 | 2786673650 | 2786546132 | Bacteria | 10419719 |
| 880 | 2794594726 | 2791355520 | Bacteria | 5948615 |
| 881 | 2805348055 | 2802429420 | Bacteria | 845479 |
| 882 | 2807180278 | 2806310673 | Bacteria | 4801221 |
| 883 | 2808854893 | 2808606361 | Bacteria | 6136259 |
| 884 | 2808926325 | 2808606376 | Bacteria | 6248667 |
| 885 | 2808932738 | 2808606377 | Bacteria | 6646337 |
| 886 | 2808934912 | 2808606378 | Bacteria | 6177535 |
| 887 | 2808948426 | 2808606380 | Bacteria | 6248705 |
| 888 | 2808954872 | 2808606381 | Bacteria | 6646461 |
| 889 | 2808963309 | 2808606383 | Bacteria | 6138645 |
| 890 | 2808978542 | 2808606385 | Bacteria | 6711065 |
| 891 | 2808993931 | 2808606388 | Bacteria | 6706662 |
| 892 | 2808998286 | 2808606389 | Bacteria | 6138126 |
| 893 | 2812353775 | 2811994879 | Bacteria | 9313447 |
| 894 | 2817260735 | 2816332253 | Bacteria | 6764532 |
| 895 | 2817278373 | 2816332256 | Bacteria | 6891714 |
| 896 | 2817456341 | 2816332286 | Bacteria | 6853759 |
| 897 | 2817491541 | 2816332298 | Bacteria | 6852809 |
| 898 | 2819637149 | 2818991452 | Bacteria | 8442785 |
| 899 | 2819705616 | 2818991464 | Bacteria | 6907494 |
| 900 | 2819710244 | 2818991465 | Bacteria | 5388835 |
| 901 | 2825657329 | 2825651385 | Bacteria | 6715909 |
| 902 | 2826585158 | 2826581358 | Bacteria | 5963467 |
| 903 | 2834030243 | 2834028612 | Bacteria | 6354979 |
| 904 | 2842687884 | 2842682962 | Bacteria | 5589973 |
| 905 | 2842818692 | 2842815866 | Bacteria | 5947510 |
| 906 | 2842831856 | 2842826826 | Bacteria | 5974129 |
| 907 | 2842840203 | 2842837860 | Bacteria | 6066181 |
| 908 | 2842853643 | 2842849001 | Bacteria | 5924277 |
| 909 | 2842858382 | 2842854478 | Bacteria | 6143501 |
| 910 | 2842886689 | 2842882022 | Bacteria | 6158489 |
| 911 | 2844529527 | 2844528606 | Bacteria | 4733806 |
| 912 | 2844670102 | 2844665904 | Bacteria | 6817974 |
| 913 | 2849140083 | 2849139964 | Bacteria | 5613304 |
| 914 | 2852617428 | 2852612431 | Bacteria | 6885235 |
| 915 | 2852672453 | 2852667396 | Bacteria | 6885555 |
| 916 | 2857604832 | 2857604169 | Bacteria | 5111450 |
| 917 | 2860342510 | 2860339153 | Bacteria | 6846989 |
| 918 | 2860870375 | 2860867994 | Bacteria | 5645326 |
| 919 | 2863427684 | 2863421361 | Bacteria | 7300805 |
| 920 | 2865014487 | 2865014394 | Bacteria | 4764573 |
| 921 | 2869556846 | 2869551831 | Bacteria | 5474685 |
| 922 | 2870071792 | 2870068957 | Bacteria | 8925310 |
| 923 | 2876604940 | 2876601092 | Bacteria | 5114497 |
| 924 | 2888371346 | 2888366609 | Bacteria | 5155009 |
| 925 | 2888375985 | 2888373701 | Bacteria | 5098052 |
| 926 | 2904515695 | 2904513164 | Bacteria | 5476410 |
| 927 | 2904525592 | 2904524088 | Bacteria | 5887454 |
| 928 | 2904571171 | 2904564687 | Bacteria | 7609577 |
| 929 | 2904578264 | 2904571731 | Bacteria | 7608790 |
| 930 | 2908450188 | 2908446538 | Bacteria | 6829095 |
| 931 | 2908665575 | 2908665501 | Bacteria | 3678115 |
| 932 | 2912716727 | 2912715099 | Bacteria | 9460473 |
| 933 | 2913039290 | 2913036834 | Bacteria | 6704877 |
| 934 | 2917073412 | 2917070673 | Bacteria | 6868303 |
| 935 | 2917833657 | 2917832318 | Bacteria | 5346010 |
| 936 | 2919113678 | 2919108558 | Bacteria | 5897419 |
| 937 | 2919145828 | 2919143609 | Bacteria | 6219228 |
| 938 | 2919456640 | 2919456309 | Bacteria | 6586567 |
| 939 | 2919485290 | 2919481497 | Bacteria | 6907839 |
| 940 | 2919517757 | 2919517244 | Bacteria | 5858162 |
| 941 | 2919700953 | 2919697872 | Bacteria | 6553725 |
| 942 | 2919722113 | 2919720352 | Bacteria | 5986006 |
| 943 | 2923156071 | 2923153595 | Bacteria | 6870622 |
| 944 | 2923586583 | 2923586266 | Bacteria | 6565975 |
| 945 | 2928094114 | 2928093941 | Bacteria | 5965005 |
| 946 | 2928163790 | 2928157003 | Bacteria | 7522202 |
| 947 | 2928164788 | 2928163908 | Bacteria | 7561269 |
| 948 | 2928172968 | 2928170801 | Bacteria | 8785406 |
| 949 | 2928540942 | 2928536128 | Bacteria | 7657547 |
| 950 | 2929007365 | 2929004312 | Bacteria | 5678476 |
| 951 | 2929147883 | 2929144301 | Bacteria | 6622272 |
| 952 | 2929192836 | 2929189879 | Bacteria | 5930554 |
| 953 | 2931369747 | 2931369376 | Bacteria | 6847892 |
| 954 | 2931394360 | 2931390751 | Bacteria | 6273349 |
| 955 | 2931402594 | 2931396565 | Bacteria | 7251677 |
| 956 | 2932409346 | 2932406140 | Bacteria | 5134491 |
| 957 | 2935357590 | 2935353572 | Unclassified | 6955622 |
| 958 | 2937968889 | 2937967321 | Bacteria | 5094075 |
| 959 | 2939581149 | 2939577877 | Bacteria | 5132791 |
| 960 | 2939605413 | 2939602548 | Bacteria | 4950493 |
| 961 | 2945933876 | 2945928738 | Bacteria | 6053221 |
| 962 | 2945956043 | 2945951305 | Bacteria | 4918162 |
| 963 | 2945964223 | 2945961074 | Bacteria | 7342064 |
| 964 | 2946010307 | 2946006987 | Bacteria | 6705746 |
| 965 | 2946030624 | 2946027586 | Bacteria | 6049274 |
| 966 | 2946071922 | 2946064051 | Bacteria | 8957905 |
| 967 | 2947232812 | 2947224130 | Bacteria | 9938529 |
| 968 | 2947237420 | 2947233263 | Bacteria | 6439278 |
| 969 | 2954691508 | 2954682443 | Bacteria | 9862841 |
| 970 | 2954692981 | 2954691527 | Bacteria | 10720516 |
| 971 | 2954708054 | 2954701450 | Bacteria | 10834262 |
| 972 | 2954774328 | 2954773129 | Bacteria | 3741715 |
| 973 | 2960323422 | 2960319331 | Bacteria | 5502575 |
| 974 | 2960380275 | 2960375949 | Bacteria | 5361395 |
| 975 | 2969084395 | 2969079654 | Bacteria | 5439582 |
| 976 | 2971825868 | 2971820967 | Bacteria | 5823634 |
| 977 | 2974298363 | 2974298342 | Bacteria | 4840922 |
| 978 | 2981996355 | 2981990288 | Bacteria | 7590678 |
| 979 | 2984289953 | 2984286254 | Bacteria | 6702062 |
| 980 | 2984504259 | 2984499530 | Bacteria | 5020881 |
| 981 | 2984561510 | 2984559226 | Bacteria | 5683096 |
| 982 | 2984599576 | 2984595703 | Bacteria | 5682994 |
| 983 | 2988729465 | 2988728565 | Bacteria | 6124362 |
| 984 | 3007401601 | 3007395558 | Bacteria | 6755444 |
| 985 | 3007869745 | 3007866637 | Bacteria | 5899198 |
| 986 | 637319930 | 637000220 | Bacteria | 7074893 |
| 987 | 640940224 | 640753048 | Bacteria | 5495657 |
| 988 | 641334326 | 641228493 | Bacteria | 3999591 |
| 989 | 642417901 | 641736154 | Bacteria | 7689995 |
| 990 | 643391940 | 643348555 | Bacteria | 3914947 |
| 991 | 8004593989 | 8004592986 | Bacteria | 5122074 |
| 992 | 8015395168 | 8015394850 | Bacteria | 5064660 |
| 993 | 8015690288 | 8015687852 | Bacteria | 6613826 |
| 994 | 8018845720 | 8018845410 | Bacteria | 8933938 |
| 995 | 8019500276 | 8019499862 | Bacteria | 5169538 |
| 996 | 8019772534 | 8019769354 | Bacteria | 6924660 |
| 997 | 8019778381 | 8019775933 | Bacteria | 6858656 |
| 998 | 8020813692 | 8020807995 | Bacteria | 6801506 |
| 999 | 8020942290 | 8020938398 | Bacteria | 7472757 |
| 1000 | 8020947524 | 8020945358 | Bacteria | 8467355 |
| 1001 | 8020958147 | 8020953355 | Bacteria | 7439080 |
| 1002 | 8021124138 | 8021120328 | Bacteria | 8782274 |
| 1003 | 8022920819 | 8022914991 | Bacteria | 5584517 |
| 1004 | 8022952983 | 8022948649 | Bacteria | 5366783 |
| 1005 | 8022953876 | 8022948649 | Bacteria | 5366783 |
| 1006 | 8033688458 | 8033684223 | Bacteria | 6906479 |
| 1007 | 8039104021 | 8039098773 | Bacteria | 6602928 |
| 1008 | 8040171620 | 8040167225 | Bacteria | 6542727 |
| 1009 | 8040177821 | 8040173305 | Bacteria | 6827067 |
| 1010 | 8052177971 | 8052174270 | Bacteria | 3881265 |
| 1011 | 8054286275 | 8054285046 | Bacteria | 6919322 |
| 1012 | 8054348234 | 8054347763 | Bacteria | 5901107 |
| 1013 | 8054505802 | 8054503363 | Bacteria | 6101651 |
| 1014 | 8055773417 | 8055770955 | Bacteria | 6827675 |
| 1015 | 8055820415 | 8055817908 | Bacteria | 6609162 |
| 1016 | 8056055757 | 8056054917 | Bacteria | 5736694 |
| 1017 | 8056063603 | 8056060235 | Bacteria | 7259403 |
| 1018 | 8056134368 | 8056131705 | Bacteria | 6107031 |
| 1019 | 8056145535 | 8056143049 | Bacteria | 6307666 |
| 1020 | 8056149811 | 8056148874 | Bacteria | 6479865 |
| 1021 | 8056156911 | 8056155041 | Bacteria | 6486948 |
| 1022 | 8056166485 | 8056161164 | Bacteria | 6106669 |
| 1023 | 8057800880 | 8057798959 | Bacteria | 6713499 |
| 1024 | Ga0495682_0000020 | |||
| 1025 | MRS2a_Contig_11 | |||
| 1026 | MRS2a_Contig_9428 | |||
| 1027 | JGI24739J22299_10011364 | |||
| 1028 | JGI24739J22299_10036641 | |||
| 1029 | JGI25162J39368_1000014 | |||
| 1030 | JGI25162J39368_1000060 | |||
| 1031 | JGI25163J39215_1000784 | |||
| 1032 | JGI25163J39215_1000792 | |||
| 1033 | JGI25164J39214_1000037 | |||
| 1034 | JGI25164J39214_1000059 | |||
| 1035 | JGI25151J46595_10022352 | |||
| 1036 | JGI25165J46597_1000027 | |||
| 1037 | JGI25165J46597_1000118 | |||
| 1038 | rootH2_10002244 | |||
| 1039 | rootH2_10154959 | |||
| 1040 | rootL2_10107293 | |||
| 1041 | Ga0055538_1000158 | |||
| 1042 | Ga0055539_1000208 | |||
| 1043 | Ga0055533_1000209 | |||
| 1044 | Ga0055532_1000214 | |||
| 1045 | Ga0055532_1001585 | |||
| 1046 | Ga0055532_1003700 | |||
| 1047 | Ga0055525_1000287 | |||
| 1048 | Ga0055529_1000493 | |||
| 1049 | Ga0055536_1000046 | |||
| 1050 | Ga0055536_1000128 | |||
| 1051 | Ga0055528_1001894 | |||
| 1052 | Ga0055528_1005086 | |||
| 1053 | Ga0055530_10000133 | |||
| 1054 | Ga0055530_10000136 | |||
| 1055 | Ga0055530_10000373 | |||
| 1056 | Ga0055540_1000070 | |||
| 1057 | Ga0055540_1000168 | |||
| 1058 | Ga0055540_1000303 | |||
| 1059 | Ga0055531_10010863 | |||
| 1060 | Ga0055541_1000067 | |||
| 1061 | Ga0058692_1000041 | |||
| 1062 | Ga0058692_1001554 | |||
| 1063 | Ga0065703_1018788 | |||
| 1064 | Ga0065714_10000651 | |||
| 1065 | Ga0065714_10002705 | |||
| 1066 | Ga0065714_10003341 | |||
| 1067 | Ga0065714_10023470 | |||
| 1068 | Ga0065714_10064673 | |||
| 1069 | Ga0065714_10065808 | |||
| 1070 | Ga0065704_10002589 | |||
| 1071 | Ga0065704_10120447 | |||
| 1072 | Ga0065712_10117901 | |||
| 1073 | Ga0070658_10030936 | |||
| 1074 | Ga0070670_100007505 | |||
| 1075 | Ga0070670_100041367 | |||
| 1076 | Ga0070660_100000080 | |||
| 1077 | Ga0070661_100000399 | |||
| 1078 | Ga0070669_100003105 | |||
| 1079 | Ga0070659_100000068 | |||
| 1080 | Ga0070714_100007884 | |||
| 1081 | Ga0070708_100019352 | |||
| 1082 | Ga0070708_100039180 | |||
| 1083 | Ga0070708_100145467 | |||
| 1084 | Ga0070663_100001611 | |||
| 1085 | Ga0070662_100001000 | |||
| 1086 | Ga0070706_100032802 | |||
| 1087 | Ga0070706_100305455 | |||
| 1088 | Ga0070699_100006669 | |||
| 1089 | Ga0070664_100000824 | |||
| 1090 | Ga0068854_100011802 | |||
| 1091 | Ga0068852_100022859 | |||
| 1092 | Ga0068851_10000400 | |||
| 1093 | Ga0081455_10135792 | |||
| 1094 | Ga0075368_10021479 | |||
| 1095 | Ga0075363_100020018 | |||
| 1096 | Ga0075363_100052756 | |||
| 1097 | Ga0075367_10001716 | |||
| 1098 | Ga0079104_1000004 | |||
| 1099 | Ga0079104_1000823 | |||
| 1100 | Ga0079104_1002497 | |||
| 1101 | Ga0079104_1004114 | |||
| 1102 | Ga0099826_10006487 | |||
| 1103 | Ga0099794_10037220 | |||
| 1104 | Ga0105251_10000089 | |||
| 1105 | Ga0105251_10000230 | |||
| 1106 | Ga0105251_10000233 | |||
| 1107 | Ga0105251_10000302 | |||
| 1108 | Ga0105251_10000842 | |||
| 1109 | Ga0105251_10000924 | |||
| 1110 | Ga0105251_10003948 | |||
| 1111 | Ga0105251_10010267 | |||
| 1112 | Ga0105251_10014142 | |||
| 1113 | Ga0105251_10014525 | |||
| 1114 | Ga0105251_10029298 | |||
| 1115 | Ga0105251_10030780 | |||
| 1116 | Ga0105251_10048242 | |||
| 1117 | Ga0105244_10000564 | |||
| 1118 | Ga0105244_10000658 | |||
| 1119 | Ga0105244_10000989 | |||
| 1120 | Ga0105244_10001094 | |||
| 1121 | Ga0105244_10001338 | |||
| 1122 | Ga0105244_10002323 | |||
| 1123 | Ga0105244_10004498 | |||
| 1124 | Ga0105244_10024564 | |||
| 1125 | Ga0105244_10027027 | |||
| 1126 | Ga0105244_10057902 | |||
| 1127 | Ga0105244_10061629 | |||
| 1128 | Ga0105244_10062378 | |||
| 1129 | Ga0105244_10078934 | |||
| 1130 | Ga0105244_10084125 | |||
| 1131 | Ga0105244_10097524 | |||
| 1132 | Ga0105250_10000093 | |||
| 1133 | Ga0105250_10000370 | |||
| 1134 | Ga0105250_10000480 | |||
| 1135 | Ga0105250_10001079 | |||
| 1136 | Ga0105250_10002704 | |||
| 1137 | Ga0105250_10003415 | |||
| 1138 | Ga0105250_10009314 | |||
| 1139 | Ga0105250_10015252 | |||
| 1140 | Ga0105250_10016876 | |||
| 1141 | Ga0105245_10177015 | |||
| 1142 | Ga0105247_10000396 | |||
| 1143 | Ga0114129_10040552 | |||
| 1144 | Ga0105243_10000045 | |||
| 1145 | Ga0105241_10000013 | |||
| 1146 | Ga0105242_10050494 | |||
| 1147 | Ga0105237_10001264 | |||
| 1148 | Ga0105238_10001781 | |||
| 1149 | Ga0105246_10012437 | |||
| 1150 | Ga0105246_10013729 | |||
| 1151 | Ga0105246_10016141 | |||
| 1152 | Ga0105246_10019801 | |||
| 1153 | Ga0105246_10081297 | |||
| 1154 | Ga0157373_10004744 | |||
| 1155 | Ga0157373_10004812 | |||
| 1156 | Ga0157373_10033938 | |||
| 1157 | Ga0157373_10033979 | |||
| 1158 | Ga0157371_10000726 | |||
| 1159 | Ga0157371_10009826 | |||
| 1160 | Ga0157371_10011902 | |||
| 1161 | Ga0157371_10012245 | |||
| 1162 | Ga0157371_10025604 | |||
| 1163 | Ga0157371_10089884 | |||
| 1164 | Ga0157370_10028217 | |||
| 1165 | Ga0157370_10043959 | |||
| 1166 | Ga0157370_10205620 | |||
| 1167 | Ga0157370_10360854 | |||
| 1168 | Ga0157370_10536904 | |||
| 1169 | Ga0157369_10006024 | |||
| 1170 | Ga0157369_10012687 | |||
| 1171 | Ga0157369_10029566 | |||
| 1172 | Ga0157369_10037630 | |||
| 1173 | Ga0163162_10096668 | |||
| 1174 | Ga0163162_10196954 | |||
| 1175 | Ga0157372_10008819 | |||
| 1176 | Ga0157372_10047419 | |||
| 1177 | Ga0157372_10050110 | |||
| 1178 | Ga0157372_10198433 | |||
| 1179 | Ga0157375_10008636 | |||
| 1180 | Ga0157375_10015239 | |||
| 1181 | Ga0182008_10003483 | |||
| 1182 | Ga0182008_10004004 | |||
| 1183 | Ga0182008_10004201 | |||
| 1184 | Ga0182008_10045535 | |||
| 1185 | Ga0182006_1001860 | |||
| 1186 | Ga0182006_1005531 | |||
| 1187 | Ga0182006_1033063 | |||
| 1188 | Ga0182006_1036527 | |||
| 1189 | Ga0182006_1080660 | |||
| 1190 | Ga0182007_10000177 | |||
| 1191 | Ga0182005_1003224 | |||
| 1192 | Ga0183367_1021 | |||
| 1193 | Ga0163161_10000028 | |||
| 1194 | Ga0163161_10154678 | |||
| 1195 | Ga0163161_10186014 | |||
| 1196 | Ga0163161_10278142 | |||
| 1197 | Ga0163161_10360184 | |||
| 1198 | Ga0213872_10110645 | |||
| 1199 | Ga0209435_101168 | |||
| 1200 | Ga0209760_100023 | |||
| 1201 | Ga0209760_100025 | |||
| 1202 | Ga0209784_100058 | |||
| 1203 | Ga0209566_100045 | |||
| 1204 | Ga0209566_100313 | |||
| 1205 | Ga0209674_100096 | |||
| 1206 | Ga0209674_101130 | |||
| 1207 | Ga0209672_100019 | |||
| 1208 | Ga0209672_100065 | |||
| 1209 | Ga0209147_100026 | |||
| 1210 | Ga0209147_100056 | |||
| 1211 | Ga0209147_100180 | |||
| 1212 | Ga0209147_100228 | |||
| 1213 | Ga0209147_102004 | |||
| 1214 | Ga0209563_100064 | |||
| 1215 | Ga0207427_100003 | |||
| 1216 | Ga0207427_100018 | |||
| 1217 | Ga0209437_100002 | |||
| 1218 | Ga0209437_100031 | |||
| 1219 | Ga0209437_100032 | |||
| 1220 | Ga0209437_104633 | |||
| 1221 | Ga0209258_100031 | |||
| 1222 | Ga0209258_100079 | |||
| 1223 | Ga0209258_100446 | |||
| 1224 | Ga0209646_1000147 | |||
| 1225 | Ga0209677_100053 | |||
| 1226 | Ga0209148_1000027 | |||
| 1227 | Ga0209759_1002071 | |||
| 1228 | Ga0209759_1021692 | |||
| 1229 | Ga0209233_1000004 | |||
| 1230 | Ga0209233_1000012 | |||
| 1231 | Ga0209455_1000058 | |||
| 1232 | Ga0209673_1000420 | |||
| 1233 | Ga0209673_1003279 | |||
| 1234 | Ga0209676_1000003 | |||
| 1235 | Ga0209676_1000055 | |||
| 1236 | Ga0209676_1001524 | |||
| 1237 | Ga0209025_1013242 | |||
| 1238 | Ga0209564_1011389 | |||
| 1239 | Ga0209050_1000004 | |||
| 1240 | Ga0209050_1000043 | |||
| 1241 | Ga0209050_1000231 | |||
| 1242 | Ga0209051_1000030 | |||
| 1243 | Ga0209051_1000052 | |||
| 1244 | Ga0209051_1000165 | |||
| 1245 | Ga0209257_1000767 | |||
| 1246 | Ga0207656_10000382 | |||
| 1247 | Ga0207696_1000041 | |||
| 1248 | Ga0207696_1000049 | |||
| 1249 | Ga0207696_1000068 | |||
| 1250 | Ga0207696_1000076 | |||
| 1251 | Ga0207696_1000078 | |||
| 1252 | Ga0207696_1000628 | |||
| 1253 | Ga0207696_1001235 | |||
| 1254 | Ga0207696_1023979 | |||
| 1255 | Ga0207696_1025493 | |||
| 1256 | Ga0207655_1000030 | |||
| 1257 | Ga0207655_1000085 | |||
| 1258 | Ga0207655_1000106 | |||
| 1259 | Ga0207655_1000137 | |||
| 1260 | Ga0207655_1000141 | |||
| 1261 | Ga0207655_1007004 | |||
| 1262 | Ga0207655_1007620 | |||
| 1263 | Ga0207655_1009069 | |||
| 1264 | Ga0207655_1012405 | |||
| 1265 | Ga0207655_1012654 | |||
| 1266 | Ga0207655_1019266 | |||
| 1267 | Ga0207655_1029070 | |||
| 1268 | Ga0207713_1000010 | |||
| 1269 | Ga0207713_1000011 | |||
| 1270 | Ga0207713_1000044 | |||
| 1271 | Ga0207713_1000062 | |||
| 1272 | Ga0207713_1000127 | |||
| 1273 | Ga0207713_1000265 | |||
| 1274 | Ga0207713_1000850 | |||
| 1275 | Ga0207713_1001279 | |||
| 1276 | Ga0207713_1002699 | |||
| 1277 | Ga0207713_1003516 | |||
| 1278 | Ga0207713_1020770 | |||
| 1279 | Ga0207713_1022742 | |||
| 1280 | Ga0207713_1035899 | |||
| 1281 | Ga0207713_1043414 | |||
| 1282 | Ga0207713_1060405 | |||
| 1283 | Ga0207713_1060765 | |||
| 1284 | Ga0207692_10084300 | |||
| 1285 | Ga0207692_10150188 | |||
| 1286 | Ga0207710_10000145 | |||
| 1287 | Ga0207647_10006893 | |||
| 1288 | Ga0207647_10026170 | |||
| 1289 | Ga0207699_10128166 | |||
| 1290 | Ga0207705_10041564 | |||
| 1291 | Ga0207684_10034820 | |||
| 1292 | Ga0207654_10000016 | |||
| 1293 | Ga0207695_10001626 | |||
| 1294 | Ga0207671_10000394 | |||
| 1295 | Ga0207663_10119766 | |||
| 1296 | Ga0207663_10125752 | |||
| 1297 | Ga0207657_10000494 | |||
| 1298 | Ga0207649_10000251 | |||
| 1299 | Ga0207681_10003619 | |||
| 1300 | Ga0207694_10029030 | |||
| 1301 | Ga0207650_10000384 | |||
| 1302 | Ga0207650_10010667 | |||
| 1303 | Ga0207664_10026885 | |||
| 1304 | Ga0207690_10000026 | |||
| 1305 | Ga0207706_10002791 | |||
| 1306 | Ga0207686_10031618 | |||
| 1307 | Ga0207709_10000011 | |||
| 1308 | Ga0207709_10011361 | |||
| 1309 | Ga0207679_10000016 | |||
| 1310 | Ga0207667_10149635 | |||
| 1311 | Ga0207668_10006823 | |||
| 1312 | Ga0207640_10028871 | |||
| 1313 | Ga0207678_10001257 | |||
| 1314 | Ga0207702_10116828 | |||
| 1315 | Ga0207683_10227559 | |||
| 1316 | Ga0207698_10016462 | |||
| 1317 | Ga0209281_1000005 | |||
| 1318 | Ga0209281_1000009 | |||
| 1319 | Ga0209281_1000107 | |||
| 1320 | Ga0209281_1008151 | |||
| 1321 | Ga0209371_1000036 | |||
| 1322 | Ga0209371_1000858 | |||
| 1323 | Ga0209371_1001177 | |||
| 1324 | Ga0209371_1005345 | |||
| 1325 | Ga0209984_1003582 | |||
| 1326 | Ga0209282_1101036 | |||
| 1327 | Ga0209588_1005005 | |||
| 1328 | Ga0209813_10006743 | |||
| 1329 | Ga0209974_10041124 | |||
| 1330 | Ga0207428_10001057 | |||
| 1331 | Ga0307515_10026799 | |||
| 1332 | Ga0268256_1000040 | |||
| 1333 | Ga0268256_1000477 | |||
| 1334 | Ga0268256_1001008 | |||
| 1335 | Ga0268256_1001594 | |||
| 1336 | Ga0307511_10002260 | |||
| 1337 | Ga0307512_10071665 | |||
| 1338 | Ga0307513_10000099 | |||
| 1339 | Ga0307513_10225720 | |||
| 1340 | Ga0307509_10009838 | |||
| 1341 | Ga0307408_100003833 | |||
| 1342 | Ga0307408_100009042 | |||
| 1343 | Ga0307508_10033599 | |||
| 1344 | Ga0307514_10021075 | |||
| 1345 | Ga0307514_10137524 | |||
| 1346 | Ga0307516_10042249 | |||
| 1347 | Ga0307405_10002090 | |||
| 1348 | Ga0307405_10063581 | |||
| 1349 | Ga0307413_10033700 | |||
| 1350 | Ga0307518_10167657 | |||
| 1351 | Ga0307407_10031947 | |||
| 1352 | Ga0307412_10001950 | |||
| 1353 | Ga0307412_10014413 | |||
| 1354 | Ga0307409_100181830 | |||
| 1355 | Ga0307414_10036060 | |||
| 1356 | Ga0307414_10328011 | |||
| 1357 | Ga0307411_10028873 | |||
| 1358 | Ga0307507_10116832 | |||
| 1359 | Ga0307507_10212507 | |||
| 1360 | Ga0307510_10034138 | |||
| 1361 | Ga0307510_10181433 | |||
| 1362 | Ga0373928_0026032 | |||
| 1363 | Ga0373949_0008916 | |||
| 1364 | Ga0373932_0005473 | |||
| 1365 | Ga0373941_0002472 | |||
| 1366 | Ga0373931_0067601 | |||
| 1367 | Ga0436365_0778140 | |||
| 1368 | Ga0436361_0048296 | |||
| 1369 | Ga0436361_0401522 | |||
| 1370 | Ga0439438_004505 | |||
| 1371 | Ga0439438_005931 | |||
| 1372 | Ga0439438_010402 | |||
| 1373 | Ga0439438_014038 | |||
| 1374 | Ga0439438_019883 | |||
| 1375 | Ga0439447_019181 | |||
| 1376 | Ga0439466_0000270 | |||
| 1377 | Ga0439466_0003546 | |||
| 1378 | Ga0439466_0039569 | |||
| 1379 | Ga0439466_0044976 | |||
| 1380 | Ga0439466_0045899 | |||
| 1381 | Ga0451802_0529951 | |||
| 1382 | Ga0451853_1210111 | |||
| 1383 | Ga0439433_0002805 | |||
| 1384 | Ga0439448_0022166 | |||
| 1385 | Ga0439432_001555 | |||
| 1386 | Ga0439432_002562 | |||
| 1387 | Ga0439432_005338 | |||
| 1388 | Ga0439432_043073 | |||
| 1389 | Ga0439449_0000216 | |||
| 1390 | Ga0439449_0000368 | |||
| 1391 | Ga0439449_0008568 | |||
| 1392 | Ga0439449_0018834 | |||
| 1393 | Ga0439451_010560 | |||
| 1394 | Ga0439456_023049 | |||
| 1395 | Ga0439457_000640 | |||
| 1396 | Ga0439457_008039 | |||
| 1397 | Ga0439463_001049 | |||
| 1398 | Ga0450907_000010 | |||
| 1399 | Ga0450907_000818 | |||
| 1400 | Ga0450909_002314 | |||
| 1401 | Ga0439464_0006455 | |||
| 1402 | Ga0466969_0008961 | |||
| 1403 | Ga0466969_0009317 | |||
| 1404 | Ga0466969_0009870 | |||
| 1405 | Ga0466969_0061355 | |||
| 1406 | Ga0466972_0009451 | |||
| 1407 | Ga0466972_0043806 | |||
| 1408 | Ga0466965_0001653 | |||
| 1409 | Ga0466965_0002532 | |||
| 1410 | Ga0466966_0000885 | |||
| 1411 | Ga0466966_0099599 | |||
| 1412 | Ga0466966_0124791 | |||
| 1413 | Ga0466961_0000876 | |||
| 1414 | Ga0466961_0027290 | |||
| 1415 | Ga0466961_0038877 | |||
| 1416 | Ga0466963_0001810 | |||
| 1417 | Ga0466963_0214754 | |||
| 1418 | Ga0466964_0004446 | |||
| 1419 | Ga0466964_0091067 | |||
| 1420 | Ga0466971_0000701 | |||
| 1421 | Ga0466971_0036236 | |||
| 1422 | Ga0466970_0000432 | |||
| 1423 | Ga0466957_0000574 | |||
| 1424 | Ga0466957_0141141 | |||
| 1425 | Ga0466959_0002628 | |||
| 1426 | Ga0466959_0018725 | |||
| 1427 | Ga0466959_0076966 | |||
| 1428 | Ga0466958_0005448 | |||
| 1429 | Ga0466967_0000976 | |||
| 1430 | Ga0466967_0267087 | |||
| 1431 | Ga0495617_000054 | |||
| 1432 | Ga0495617_000144 | |||
| 1433 | Ga0495617_008090 | |||
| 1434 | Ga0495617_020775 | |||
| 1435 | Ga0495627_000100 | |||
| 1436 | Ga0495627_000308 | |||
| 1437 | Ga0495627_002826 | |||
| 1438 | Ga0495592_0000800 | |||
| 1439 | Ga0495603_0001986 | |||
| 1440 | Ga0495603_0021119 | |||
| 1441 | Ga0495603_0021860 | |||
| 1442 | Ga0495603_0041783 | |||
| 1443 | Ga0495590_0001206 | |||
| 1444 | Ga0495590_0004191 | |||
| 1445 | Ga0495591_000315 | |||
| 1446 | Ga0495591_001261 | |||
| 1447 | Ga0495591_023221 | |||
| 1448 | Ga0495629_0022330 | |||
| 1449 | Ga0495629_0154682 | |||
| 1450 | Ga0495651_0021970 | |||
| 1451 | Ga0495653_0001170 | |||
| 1452 | Ga0495653_0037631 | |||
| 1453 | Ga0495650_0000881 | |||
| 1454 | Ga0495650_0005496 | |||
| 1455 | Ga0495650_0060045 | |||
| 1456 | Ga0495580_0025815 | |||
| 1457 | Ga0495580_0067123 | |||
| 1458 | Ga0495605_0000794 | |||
| 1459 | Ga0495605_0001665 | |||
| 1460 | Ga0495605_0010840 | |||
| 1461 | Ga0495605_0039013 | |||
| 1462 | Ga0495639_0000032 | |||
| 1463 | Ga0495662_0002045 | |||
| 1464 | Ga0495664_0154183 | |||
| 1465 | Ga0495584_0000409 | |||
| 1466 | Ga0495584_0000547 | |||
| 1467 | Ga0495584_0001764 | |||
| 1468 | Ga0495584_0002662 | |||
| 1469 | Ga0495585_0004329 | |||
| 1470 | Ga0495585_0018164 | |||
| 1471 | Ga0495585_0075797 | |||
| 1472 | Ga0495585_0096331 | |||
| 1473 | Ga0495594_0050018 | |||
| 1474 | Ga0495607_0000185 | |||
| 1475 | Ga0495607_0000290 | |||
| 1476 | Ga0495607_0000617 | |||
| 1477 | Ga0495607_0018916 | |||
| 1478 | Ga0495607_0026414 | |||
| 1479 | Ga0495607_0048900 | |||
| 1480 | Ga0495583_0003663 | |||
| 1481 | Ga0495583_0011288 | |||
| 1482 | Ga0495583_0021045 | |||
| 1483 | Ga0495606_0000633 | |||
| 1484 | Ga0495606_0003155 | |||
| 1485 | Ga0495606_0025714 | |||
| 1486 | Ga0495608_0004232 | |||
| 1487 | Ga0495610_0002898 | |||
| 1488 | Ga0495610_0039563 | |||
| 1489 | Ga0495616_0000226 | |||
| 1490 | Ga0495616_0000661 | |||
| 1491 | Ga0495616_0008245 | |||
| 1492 | Ga0495616_0027410 | |||
| 1493 | Ga0495616_0032013 | |||
| 1494 | Ga0495618_0224363 | |||
| 1495 | Ga0495620_0001031 | |||
| 1496 | Ga0495620_0002862 | |||
| 1497 | Ga0495620_0056787 | |||
| 1498 | Ga0495628_0046540 | |||
| 1499 | Ga0495630_0047238 | |||
| 1500 | Ga0495632_0000754 | |||
| 1501 | Ga0495632_0001740 | |||
| 1502 | Ga0495637_0007143 | |||
| 1503 | Ga0495637_0007481 | |||
| 1504 | Ga0495637_0076198 | |||
| 1505 | Ga0495643_0031124 | |||
| 1506 | Ga0495643_0051205 | |||
| 1507 | Ga0495643_0066575 | |||
| 1508 | Ga0495648_0001506 | |||
| 1509 | Ga0495648_0002095 | |||
| 1510 | Ga0495648_0005959 | |||
| 1511 | Ga0495648_0035448 | |||
| 1512 | Ga0495648_0057823 | |||
| 1513 | Ga0495666_0010570 | |||
| 1514 | Ga0495642_0000316 | |||
| 1515 | Ga0495642_0004676 | |||
| 1516 | Ga0495652_0067382 | |||
| 1517 | Ga0495654_0000288 | |||
| 1518 | Ga0495654_0000306 | |||
| 1519 | Ga0495654_0000616 | |||
| 1520 | Ga0495654_0002069 | |||
| 1521 | Ga0495654_0011451 | |||
| 1522 | Ga0495654_0048471 | |||
| 1523 | Ga0495665_0005951 | |||
| 1524 | Ga0495640_0007888 | |||
| 1525 | Ga0495640_0076155 | |||
| 1526 | Ga0495586_0004174 | |||
| 1527 | Ga0495587_0004867 | |||
| 1528 | Ga0495609_0007500 | |||
| 1529 | Ga0495609_0008213 | |||
| 1530 | Ga0495609_0043234 | |||
| 1531 | Ga0495597_0018574 | |||
| 1532 | Ga0495597_0047574 | |||
| 1533 | Ga0495622_0002772 | |||
| 1534 | Ga0495622_0007970 | |||
| 1535 | Ga0495622_0008609 | |||
| 1536 | Ga0495633_0124689 | |||
| 1537 | Ga0495667_0038294 | |||
| 1538 | Ga0495656_0001994 | |||
| 1539 | Ga0495634_0000025 | |||
| 1540 | Ga0495634_0191337 | |||
| 1541 | Ga0495611_0021347 | |||
| 1542 | Ga0495625_0000847 | |||
| 1543 | Ga0495625_0030964 | |||
| 1544 | Ga0495635_0032535 | |||
| 1545 | Ga0495635_0034169 | |||
| 1546 | Ga0495635_0083363 | |||
| 1547 | Ga0495659_0001160 | |||
| 1548 | Ga0495659_0003525 | |||
| 1549 | Ga0495661_0000028 | |||
| 1550 | Ga0495661_0000083 | |||
| 1551 | Ga0495661_0004052 | |||
| 1552 | Ga0495588_0012539 | |||
| 1553 | Ga0495657_0024393 | |||
| 1554 | Ga0495599_0147771 | |||
| 1555 | Ga0495623_0063191 | |||
| 1556 | Ga0495623_0135382 | |||
| 1557 | Ga0495646_0074166 | |||
| 1558 | Ga0495646_0092979 | |||
| 1559 | Ga0495669_0001097 | |||
| 1560 | Ga0495624_0016369 | |||
| 1561 | Ga0495670_0013939 | |||
| 1562 | Ga0495671_0000295 | |||
| 1563 | Ga0495671_0001060 | |||
| 1564 | Ga0495671_0031802 | |||
| 1565 | Ga0495649_0000013 | |||
| 1566 | Ga0495649_0000909 | |||
| 1567 | Ga0495649_0005272 | |||
| 1568 | Ga0495649_0066204 | |||
| 1569 | Ga0495589_0000010 | |||
| 1570 | Ga0495589_0000141 | |||
| 1571 | Ga0495589_0050688 | |||
| 1572 | Ga0495600_0076365 | |||
| 1573 | Ga0495600_0231613 | |||
| 1574 | Ga0495660_0043368 | |||
| 1575 | Ga0495604_0000491 | |||
| 1576 | Ga0495604_0002087 | |||
| 1577 | Ga0495636_0036577 | |||
| 1578 | Ga0495636_0042658 | |||
| 1579 | Ga0495674_0013289 | |||
| 1580 | Ga0495672_0000289 | |||
| 1581 | Ga0495672_0001978 | |||
| 1582 | Ga0495672_0006656 | |||
| 1583 | Ga0495672_0016761 | |||
| 1584 | Ga0495672_0056286 | |||
| 1585 | Ga0495676_0031256 | |||
| 1586 | Ga0495676_0046429 | |||
| 1587 | Ga0495680_0010178 | |||
| 1588 | Ga0495683_0005005 | |||
| 1589 | Ga0495683_0006189 | |||
| 1590 | Ga0495683_0087446 | |||
| 1591 | Ga0495683_0139904 | |||
| 1592 | Ga0495687_000715 | |||
| 1593 | Ga0495687_004143 | |||
| 1594 | Ga0495687_008394 | |||
| 1595 | Ga0495687_011525 | |||
| 1596 | Ga0495687_038970 | |||
| 1597 | Ga0495675_0011462 | |||
| 1598 | Ga0495679_000711 | |||
| 1599 | Ga0495679_005752 | |||
| 1600 | Ga0495679_005912 | |||
| 1601 | Ga0495679_007398 | |||
| 1602 | Ga0495679_014366 | |||
| 1603 | Ga0495685_003608 | |||
| 1604 | Ga0495685_007685 | |||
| 1605 | Ga0495673_0000190 | |||
| 1606 | Ga0495673_0000833 | |||
| 1607 | Ga0495673_0002842 | |||
| 1608 | Ga0495673_0027701 | |||
| 1609 | Ga0495681_0000027 | |||
| 1610 | Ga0495681_0000237 | |||
| 1611 | Ga0495684_0080737 | |||
| 1612 | Ga0495686_0135393 | |||
| 1613 | Ga0495593_0006494 | |||
| 1614 | Ga0495602_0017638 | |||
| 1615 | Ga0495614_0020018 | |||
| 1616 | Ga0495614_0020284 | |||
| 1617 | Ga0495626_0000352 | |||
| 1618 | Ga0495626_0005473 | |||
| 1619 | Ga0495626_0129223 | |||
| 1620 | Ga0496100_0000516 | |||
| 1621 | Ga0496100_0051117 | |||
| 1622 | Ga0496101_0000023 | |||
| 1623 | Ga0496101_0004518 | |||
| 1624 | Ga0496102_0000038 | |||
| 1625 | Ga0496102_0007086 | |||
| 1626 | Ga0496102_0026298 | |||
| 1627 | Ga0496103_0005594 | |||
| 1628 | Ga0496103_0096252 | |||
| 1629 | Ga0496104_0001353 | |||
| 1630 | Ga0496105_0000207 | |||
| 1631 | Ga0496105_0026938 | |||
| 1632 | Ga0496106_0002123 | |||
| 1633 | Ga0496107_0002440 | |||
| 1634 | Ga0496108_0001726 | |||
| 1635 | Ga0496109_0002642 | |||
| 1636 | Ga0496109_0221970 | |||
| 1637 | Ga0496110_0052572 | |||
| 1638 | Ga0496111_0000662 | |||
| 1639 | Ga0496111_0125801 | |||
| 1640 | Ga0496111_0508339 | |||
| 1641 | Ga0496112_0002268 | |||
| 1642 | Ga0496112_0060524 | |||
| 1643 | Ga0496113_0011643 | |||
| 1644 | Ga0496113_0169763 | |||
| 1645 | Ga0496115_0028447 | |||
| 1646 | Ga0496116_0000077 | |||
| 1647 | Ga0496116_0000221 | |||
| 1648 | Ga0496116_0000984 | |||
| 1649 | Ga0496116_0001107 | |||
| 1650 | Ga0496116_0003444 | |||
| 1651 | Ga0496116_0047963 | |||
| 1652 | Ga0496116_0107552 | |||
| 1653 | Ga0496117_0000017 | |||
| 1654 | Ga0496117_0000219 | |||
| 1655 | Ga0496117_0001257 | |||
| 1656 | Ga0496117_0001570 | |||
| 1657 | Ga0496117_0002611 | |||
| 1658 | Ga0496117_0031730 | |||
| 1659 | Ga0496117_0032512 | |||
| 1660 | Ga0496117_0036374 | |||
| 1661 | Ga0496117_0092248 | |||
| 1662 | Ga0496117_0135562 | |||
| 1663 | Ga0496118_0000018 | |||
| 1664 | Ga0496118_0000301 | |||
| 1665 | Ga0496118_0008371 | |||
| 1666 | Ga0496118_0024337 | |||
| 1667 | Ga0496118_0038172 | |||
| 1668 | Ga0496118_0051169 | |||
| 1669 | Ga0496118_0067827 | |||
| 1670 | Ga0496118_0102657 | |||
| 1671 | Ga0496118_0103732 | |||
| 1672 | Ga0496118_0110937 | |||
| 1673 | Ga0496119_0000005 | |||
| 1674 | Ga0496119_0001451 | |||
| 1675 | Ga0496119_0001653 | |||
| 1676 | Ga0496119_0002190 | |||
| 1677 | Ga0496119_0006142 | |||
| 1678 | Ga0496119_0012321 | |||
| 1679 | Ga0496119_0014815 | |||
| 1680 | Ga0496119_0025426 | |||
| 1681 | Ga0496119_0067699 | |||
| 1682 | Ga0496120_0000005 | |||
| 1683 | Ga0496120_0000010 | |||
| 1684 | Ga0496120_0000028 | |||
| 1685 | Ga0496120_0000112 | |||
| 1686 | Ga0496120_0000139 | |||
| 1687 | Ga0496120_0001588 | |||
| 1688 | Ga0496120_0006263 | |||
| 1689 | Ga0496121_0000055 | |||
| 1690 | Ga0496121_0000307 | |||
| 1691 | Ga0496121_0004753 | |||
| 1692 | Ga0496121_0007545 | |||
| 1693 | Ga0496122_0001299 | |||
| 1694 | Ga0496122_0009382 | |||
| 1695 | Ga0496122_0011679 | |||
| 1696 | Ga0496122_0025572 | |||
| 1697 | Ga0496123_0001034 | |||
| 1698 | Ga0496123_0004814 | |||
| 1699 | Ga0496123_0017123 | |||
| 1700 | Ga0496123_0078198 | |||
| 1701 | Ga0496124_0000100 | |||
| 1702 | Ga0496124_0000158 | |||
| 1703 | Ga0496124_0003813 | |||
| 1704 | Ga0496124_0003909 | |||
| 1705 | Ga0496124_0004394 | |||
| 1706 | Ga0496124_0007113 | |||
| 1707 | Ga0496124_0029540 | |||
| 1708 | Ga0496124_0098283 | |||
| 1709 | Ga0496124_0172450 | |||
| 1710 | Ga0496125_0002257 | |||
| 1711 | Ga0496125_0003672 | |||
| 1712 | Ga0496125_0011347 | |||
| 1713 | Ga0496125_0012606 | |||
| 1714 | Ga0496125_0138322 | |||
| 1715 | Ga0496126_0002392 | |||
| 1716 | Ga0496126_0029144 | |||
| 1717 | Ga0496126_0035768 | |||
| 1718 | Ga0496126_0057901 | |||
| 1719 | Ga0496126_0167995 | |||
| 1720 | Ga0501305_009082 | |||
| 1721 | Ga0495678_000724 | |||
| 1722 | Ga0495678_002190 | |||
| 1723 | Ga0495678_006568 | |||
| 1724 | Ga0495678_007868 | |||
| 1725 | Ga0495678_012807 | |||
| 1726 | Ga0495678_033179 | |||
| 1727 | Ga0495682_0001677 | |||
| 1728 | Ga0495682_0008178 | |||
| 1729 | Ga0501312_000335 | |||
| 1730 | Ga0501335_000125 | |||
| 1731 | Ga0501336_000511 | |||
| 1732 | Ga0501038_0104816 | |||
| 1733 | nmdc:mga06z11_1188_c1 | |||
| 1734 | nmdc:mga04h51_1659_c1 | |||
| 1735 | nmdc:mga05p37_382408_c1 | |||
| 1736 | Ga0495601_0008947 | |||
| 1737 | Ga0500578_0128023 | |||
| 1738 | Ga0500618_007443 | |||
| 1739 | Ga0500573_0091310 | |||
| 1740 | Ga0466962_0002211 | |||
| 1741 | 2506580856 | |||
| 1742 | 2506585995 | |||
| 1743 | 2508854665 | |||
| 1744 | 2510284536 | |||
| 1745 | 2510295986 | |||
| 1746 | 2510311914 | |||
| 1747 | 2511253802 | |||
| 1748 | 2511255458 | |||
| 1749 | 2511268221 | |||
| 1750 | 2511272546 | |||
| 1751 | 2511290773 | |||
| 1752 | 2511313847 | |||
| 1753 | 2511323318 | |||
| 1754 | 2511327779 | |||
| 1755 | 2511343835 | |||
| 1756 | 2511358631 | |||
| 1757 | 2511362414 | |||
| 1758 | 2511380672 | |||
| 1759 | 2511437281 | |||
| 1760 | 2511824369 | |||
| 1761 | 2512328379 | |||
| 1762 | 2512731739 | |||
| 1763 | 2519458511 | |||
| 1764 | 2555262202 | |||
| 1765 | 2555669599 | |||
| 1766 | 2583792851 | |||
| 1767 | 2585292917 | |||
| 1768 | 2585320302 | |||
| 1769 | 2597857604 | |||
| 1770 | 2597864244 | |||
| 1771 | 2597869501 | |||
| 1772 | 2599330607 | |||
| 1773 | 2599353404 | |||
| 1774 | 2599363797 | |||
| 1775 | 2599370117 | |||
| 1776 | 2599372424 | |||
| 1777 | 2599378512 | |||
| 1778 | 2599384111 | |||
| 1779 | 2599391283 | |||
| 1780 | 2599399233 | |||
| 1781 | 2599407528 | |||
| 1782 | 2599412358 | |||
| 1783 | 2599453666 | |||
| 1784 | 2599460238 | |||
| 1785 | 2599470630 | |||
| 1786 | 2599484461 | |||
| 1787 | 2599489259 | |||
| 1788 | 2599502202 | |||
| 1789 | 2599509112 | |||
| 1790 | 2599513725 | |||
| 1791 | 2599518905 | |||
| 1792 | 2599616067 | |||
| 1793 | 2599737435 | |||
| 1794 | 2599748704 | |||
| 1795 | 2599772658 | |||
| 1796 | 2599802267 | |||
| 1797 | 2599881042 | |||
| 1798 | 2599885068 | |||
| 1799 | 2599892782 | |||
| 1800 | 2599899793 | |||
| 1801 | 2599932738 | |||
| 1802 | 2599945254 | |||
| 1803 | 2599949676 | |||
| 1804 | 2599955394 | |||
| 1805 | 2599960884 | |||
| 1806 | 2599965489 | |||
| 1807 | 2599976604 | |||
| 1808 | 2599984429 | |||
| 1809 | 2599990400 | |||
| 1810 | 2599992829 | |||
| 1811 | 2600001658 | |||
| 1812 | 2600008912 | |||
| 1813 | 2600010651 | |||
| 1814 | 2600018378 | |||
| 1815 | 2600023308 | |||
| 1816 | 2600028221 | |||
| 1817 | 2600034158 | |||
| 1818 | 2600040329 | |||
| 1819 | 2600049238 | |||
| 1820 | 2600052898 | |||
| 1821 | 2600056979 | |||
| 1822 | 2600066806 | |||
| 1823 | 2600074058 | |||
| 1824 | 2600077535 | |||
| 1825 | 2600210615 | |||
| 1826 | 2600212847 | |||
| 1827 | 2600357330 | |||
| 1828 | 2600366910 | |||
| 1829 | 2601526248 | |||
| 1830 | 2601530219 | |||
| 1831 | 2601617177 | |||
| 1832 | 2601622136 | |||
| 1833 | 2601645681 | |||
| 1834 | 2601649933 | |||
| 1835 | 2601655223 | |||
| 1836 | 2601661559 | |||
| 1837 | 2601665820 | |||
| 1838 | 2601690402 | |||
| 1839 | 2601698678 | |||
| 1840 | 2601703829 | |||
| 1841 | 2601709388 | |||
| 1842 | 2601712923 | |||
| 1843 | 2601718359 | |||
| 1844 | 2601723765 | |||
| 1845 | 2601728646 | |||
| 1846 | 2601733307 | |||
| 1847 | 2601737581 | |||
| 1848 | 2601744419 | |||
| 1849 | 2601752900 | |||
| 1850 | 2601773015 | |||
| 1851 | 2602019386 | |||
| 1852 | 2603663355 | |||
| 1853 | 2603668557 | |||
| 1854 | 2603840851 | |||
| 1855 | 2603846162 | |||
| 1856 | 2603850998 | |||
| 1857 | 2603856304 | |||
| 1858 | 2603869109 | |||
| 1859 | 2603873883 | |||
| 1860 | 2603879048 | |||
| 1861 | 2606051063 | |||
| 1862 | 2606072980 | |||
| 1863 | 2606148512 | |||
| 1864 | 2606178955 | |||
| 1865 | 2621300196 | |||
| 1866 | 2624491488 | |||
| 1867 | 2637227357 | |||
| 1868 | 2643871068 | |||
| 1869 | 2644190361 | |||
| 1870 | 2644270631 | |||
| 1871 | 2644284920 | |||
| 1872 | 2644622519 | |||
| 1873 | 2644630566 | |||
| 1874 | 2644716823 | |||
| 1875 | 2644725626 | |||
| 1876 | 2652547173 | |||
| 1877 | 2656276696 | |||
| 1878 | 2671094656 | |||
| 1879 | 2671095029 | |||
| 1880 | 2671124822 | |||
| 1881 | 2671770114 | |||
| 1882 | 2676409336 | |||
| 1883 | 2676746865 | |||
| 1884 | 2677901165 | |||
| 1885 | 2678263884 | |||
| 1886 | 2689447413 | |||
| 1887 | 2723249072 | |||
| 1888 | 2738675108 | |||
| 1889 | 2738753398 | |||
| 1890 | 2738810539 | |||
| 1891 | 2738862310 | |||
| 1892 | 2738897899 | |||
| 1893 | 2739257986 | |||
| 1894 | 2743737039 | |||
| 1895 | 2745004337 | |||
| 1896 | 2772441221 | |||
| 1897 | 2774123123 | |||
| 1898 | 2774130783 | |||
| 1899 | 2777021725 | |||
| 1900 | 2784315471 | |||
| 1901 | 2785373751 | |||
| 1902 | 2786673650 | |||
| 1903 | 2794594726 | |||
| 1904 | 2805348055 | |||
| 1905 | 2807180278 | |||
| 1906 | 2808854893 | |||
| 1907 | 2808926325 | |||
| 1908 | 2808932738 | |||
| 1909 | 2808934912 | |||
| 1910 | 2808948426 | |||
| 1911 | 2808954872 | |||
| 1912 | 2808963309 | |||
| 1913 | 2808978542 | |||
| 1914 | 2808993931 | |||
| 1915 | 2808998286 | |||
| 1916 | 2812353775 | |||
| 1917 | 2817260735 | |||
| 1918 | 2817278373 | |||
| 1919 | 2817456341 | |||
| 1920 | 2817491541 | |||
| 1921 | 2819637149 | |||
| 1922 | 2819705616 | |||
| 1923 | 2819710244 | |||
| 1924 | 2825657329 | |||
| 1925 | 2826585158 | |||
| 1926 | 2834030243 | |||
| 1927 | 2842687884 | |||
| 1928 | 2842818692 | |||
| 1929 | 2842831856 | |||
| 1930 | 2842840203 | |||
| 1931 | 2842853643 | |||
| 1932 | 2842858382 | |||
| 1933 | 2842886689 | |||
| 1934 | 2844529527 | |||
| 1935 | 2844670102 | |||
| 1936 | 2849140083 | |||
| 1937 | 2852617428 | |||
| 1938 | 2852672453 | |||
| 1939 | 2857604832 | |||
| 1940 | 2860342510 | |||
| 1941 | 2860870375 | |||
| 1942 | 2863427684 | |||
| 1943 | 2865014487 | |||
| 1944 | 2869556846 | |||
| 1945 | 2870071792 | |||
| 1946 | 2876604940 | |||
| 1947 | 2888371346 | |||
| 1948 | 2888375985 | |||
| 1949 | 2904515695 | |||
| 1950 | 2904525592 | |||
| 1951 | 2904571171 | |||
| 1952 | 2904578264 | |||
| 1953 | 2908450188 | |||
| 1954 | 2908665575 | |||
| 1955 | 2912716727 | |||
| 1956 | 2913039290 | |||
| 1957 | 2917073412 | |||
| 1958 | 2917833657 | |||
| 1959 | 2919113678 | |||
| 1960 | 2919145828 | |||
| 1961 | 2919456640 | |||
| 1962 | 2919485290 | |||
| 1963 | 2919517757 | |||
| 1964 | 2919700953 | |||
| 1965 | 2919722113 | |||
| 1966 | 2923156071 | |||
| 1967 | 2923586583 | |||
| 1968 | 2928094114 | |||
| 1969 | 2928163790 | |||
| 1970 | 2928164788 | |||
| 1971 | 2928172968 | |||
| 1972 | 2928540942 | |||
| 1973 | 2929007365 | |||
| 1974 | 2929147883 | |||
| 1975 | 2929192836 | |||
| 1976 | 2931369747 | |||
| 1977 | 2931394360 | |||
| 1978 | 2931402594 | |||
| 1979 | 2932409346 | |||
| 1980 | 2935357590 | |||
| 1981 | 2937968889 | |||
| 1982 | 2939581149 | |||
| 1983 | 2939605413 | |||
| 1984 | 2945933876 | |||
| 1985 | 2945956043 | |||
| 1986 | 2945964223 | |||
| 1987 | 2946010307 | |||
| 1988 | 2946030624 | |||
| 1989 | 2946071922 | |||
| 1990 | 2947232812 | |||
| 1991 | 2947237420 | |||
| 1992 | 2954691508 | |||
| 1993 | 2954692981 | |||
| 1994 | 2954708054 | |||
| 1995 | 2954774328 | |||
| 1996 | 2960323422 | |||
| 1997 | 2960380275 | |||
| 1998 | 2969084395 | |||
| 1999 | 2971825868 | |||
| 2000 | 2974298363 | |||
| 2001 | 2981996355 | |||
| 2002 | 2984289953 | |||
| 2003 | 2984504259 | |||
| 2004 | 2984561510 | |||
| 2005 | 2984599576 | |||
| 2006 | 2988729465 | |||
| 2007 | 3007401601 | |||
| 2008 | 3007869745 | |||
| 2009 | 637319930 | |||
| 2010 | 640940224 | |||
| 2011 | 641334326 | |||
| 2012 | 642417901 | |||
| 2013 | 643391940 | |||
| 2014 | 8004593989 | |||
| 2015 | 8015395168 | |||
| 2016 | 8015690288 | |||
| 2017 | 8018845720 | |||
| 2018 | 8019500276 | |||
| 2019 | 8019772534 | |||
| 2020 | 8019778381 | |||
| 2021 | 8020813692 | |||
| 2022 | 8020942290 | |||
| 2023 | 8020947524 | |||
| 2024 | 8020958147 | |||
| 2025 | 8021124138 | |||
| 2026 | 8022920819 | |||
| 2027 | 8022952983 | |||
| 2028 | 8022953876 | |||
| 2029 | 8033688458 | |||
| 2030 | 8039104021 | |||
| 2031 | 8040171620 | |||
| 2032 | 8040177821 | |||
| 2033 | 8052177971 | |||
| 2034 | 8054286275 | |||
| 2035 | 8054348234 | |||
| 2036 | 8054505802 | |||
| 2037 | 8055773417 | |||
| 2038 | 8055820415 | |||
| 2039 | 8056055757 | |||
| 2040 | 8056063603 | |||
| 2041 | 8056134368 | |||
| 2042 | 8056145535 | |||
| 2043 | 8056149811 | |||
| 2044 | 8056156911 | |||
| 2045 | 8056166485 | |||
| 2046 | 8057800880 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4l8v-assembly1.cif.gz_C | crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadp | 0.987 | 1 | 329 |
| 3mz0-assembly1.cif.gz_A-4 | crystal structure of apo myo-inositol dehydrogenase from bacillus subtilis | 0.9863 | 1 | 329 |
| 3nto-assembly1.cif.gz_A | crystal structure of k97v mutant myo-inositol dehydrogenase from bacillus subtilis | 0.9852 | 1 | 329 |
| 4l8v-assembly1.cif.gz_C | crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadp | 0.9841 | 1 | 329 |
| 3mz0-assembly1.cif.gz_A-4 | crystal structure of apo myo-inositol dehydrogenase from bacillus subtilis | 0.9833 | 1 | 329 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mz0A02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9615 | 143 | 259 | 3.30.360.10 |
| 4mieB02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9586 | 143 | 259 | 3.30.360.10 |
| 3mz0A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9579 | 2 | 329 | 3.40.50.720 |
| 3mz0A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9535 | 2 | 329 | 3.40.50.720 |
| 3ec7A02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9509 | 143 | 259 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A417F3Q8-F1-model_v4 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase (EC 1.1.1.18) (EC 1.1.1.369) (Myo-inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase) (MI 2-dehydrogenase/DCI 3-dehydrogenase) | 0.9746 | 2 | 329 |
GO:0000166
GO:0019310 GO:0050112 |
| AF-A0A535X8S5-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9745 | 153 | 329 |
|
| AF-A0A1I6QWG9-F1-model_v4 | Inositol 2-dehydrogenase (EC 1.1.1.18) (Myo-inositol 2-dehydrogenase) (MI 2-dehydrogenase) | 0.9723 | 1 | 328 |
GO:0000166
GO:0019310 GO:0050112 |
| AF-A0A7X9XKM1-F1-model_v4 | deleted | 0.9709 | 2 | 329 |
|
| AF-A0A417F3Q8-F1-model_v4 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase (EC 1.1.1.18) (EC 1.1.1.369) (Myo-inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase) (MI 2-dehydrogenase/DCI 3-dehydrogenase) | 0.9687 | 2 | 329 |
GO:0000166
GO:0019310 GO:0050112 |