F488451

General Info

Members Datasets Scaffolds Average Seq Length
1023 624 2046 335

Family's Representative Sequence

Representative Sequence 3300049460|Ga0495682_0000020|Ga0495682_0000020_196776_197873
Length 365
Sequence MNDWPRPVSTDCFATNNNMHFNRSLYMSSHALKLGVIGTGAIGQDHIRRCSQTLLNSQVVAVTDINLQQAAKVVADLKLSAEVYADGHALIKSPEVEAILVTSWGPSHEAFVLAAIAAGKPVFCEKPLAVTAEGCRKIVEAEVAHGKRLVQVGFMRPYDQGYRALKAVIDSGQIGEPLMLHCAHRNPSVGENYKTDMAITDTLIHELDVLRWLLADDYVSVQVVFPRKTSKAHAHLKDPQIVLLETAKGTRIDVEVFVNCQYGYDIQCEVVGESGIAKLPEPSQVQMRSGAKLSNAILMDWKDRFIAAYDVELQAFIDGVRAGQVGGPSAWDGFAAAVAADACVEAQQSGAIVKVALPERPRFYG

Samples

Sample ID Description Type Environment
1 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
49 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
78 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
134 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
169 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
170 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
176 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
177 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
178 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
179 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
182 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
183 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
238 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
259 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
272 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
273 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
280 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
300 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
309 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
318 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
319 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
321 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
322 2506520008 Serratia plymuthica AS12 Isolate Unclassified
323 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
324 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
325 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
326 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
327 2511231004 Pseudomonas sp. GM102 Isolate Nodule
328 2511231006 Pseudomonas sp. GM17 Isolate Nodule
329 2511231007 Pseudomonas sp. GM18 Isolate Nodule
330 2511231010 Pseudomonas sp. GM25 Isolate Nodule
331 2511231014 Pseudomonas sp. GM48 Isolate Nodule
332 2511231015 Pseudomonas sp. GM49 Isolate Nodule
333 2511231016 Pseudomonas sp. GM50 Isolate Nodule
334 2511231019 Pseudomonas sp. GM67 Isolate Nodule
335 2511231021 Pseudomonas sp. GM78 Isolate Nodule
336 2511231022 Pseudomonas sp. GM79 Isolate Nodule
337 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
338 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
339 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
340 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
341 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
342 2519103095 Burkholderia sp. KJ006 Isolate Nodule
343 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
344 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
345 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
346 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
347 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
348 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
349 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
350 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
351 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
352 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
353 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
354 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
355 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
356 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
357 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
358 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
359 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
360 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
361 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
362 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
363 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
364 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
365 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
366 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
367 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
368 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
369 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
370 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
371 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
372 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
373 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
374 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
375 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
376 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
377 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
378 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
379 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
380 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
381 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
382 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
383 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
384 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
385 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
386 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
387 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
388 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
389 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
390 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
391 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
392 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
393 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
394 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
395 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
396 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
397 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
398 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
399 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
400 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
401 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
402 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
403 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
404 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
405 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
406 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
407 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
408 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
409 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
410 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
411 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
412 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
413 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
414 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
415 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
416 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
417 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
418 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
419 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
420 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
421 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
422 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
423 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
424 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
425 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
426 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
427 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
428 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
429 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
430 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
431 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
432 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
433 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
434 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
435 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
436 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
437 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
438 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
439 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
440 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
441 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
442 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
443 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
444 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
445 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
446 2636415599 Klebsiella variicola DX120E Isolate Unclassified
447 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
448 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
449 2643221647 Streptomyces sp. Root369 Isolate Unclassified
450 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
451 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
452 2643221714 Streptomyces sp. Root264 Isolate Unclassified
453 2643221731 Bacillus sp. Root147 Isolate Unclassified
454 2643221732 Bacillus sp. Root239 Isolate Unclassified
455 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
456 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
457 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
458 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
459 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
460 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
461 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
462 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
463 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
464 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
465 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
466 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
467 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
468 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
469 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
470 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
471 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
472 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
473 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
474 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
475 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
476 2773857670 Pseudomonas sp. 478 Isolate Unclassified
477 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
478 2775507074 Klebsiella sp. D5A Isolate Unclassified
479 2784132072 Pseudomonas sp. 460 Isolate Unclassified
480 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
481 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
482 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
483 2802429420 Priestia filamentosa HL2HP6 Isolate Unclassified
484 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
485 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
486 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
487 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
488 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
489 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
490 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
491 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
492 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
493 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
494 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
495 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
496 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
497 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
498 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
499 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
500 2818991452 Burkholderia cepacia 561 Isolate Unclassified
501 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
502 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
503 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
504 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
505 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
506 2842682962 Bacillus sp. R-72492 Isolate Unclassified
507 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
508 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
509 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
510 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
511 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
512 2842882022 Bacillus sp. R-71893 Isolate Unclassified
513 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
514 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
515 2849139964 Bacillus sp. R-71875 Isolate Unclassified
516 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
517 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
518 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
519 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
520 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
521 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
522 2865014394 Pantoea sp. R-71966 Isolate Unclassified
523 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
524 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
525 2876601092 Pantoea endophytica 596 Isolate Unclassified
526 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
527 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
528 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
529 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
530 2904564687 Burkholderia sp. 571 Isolate Unclassified
531 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
532 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
533 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
534 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
535 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
536 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
537 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
538 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
539 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
540 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
541 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
542 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
543 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
544 2919720352 Priestia megaterium 4340 Isolate Unclassified
545 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
546 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
547 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
548 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
549 2928163908 Burkholderia sp. 567 Isolate Unclassified
550 2928170801 Burkholderia sp. 572 Isolate Unclassified
551 2928536128 Burkholderia sola 565 Isolate Unclassified
552 2929004312 Priestia megaterium 1104 Isolate Unclassified
553 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
554 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
555 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
556 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
557 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
558 2932406140 Serratia sp. 2723 Isolate Rhizosphere
559 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
560 2937967321 Serratia sp. YC16 Isolate Unclassified
561 2939577877 Serratia sp. 509 Isolate Rhizosphere
562 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
563 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
564 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
565 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
566 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
567 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
568 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
569 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
570 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
571 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
572 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
573 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
574 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
575 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
576 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
577 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
578 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
579 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
580 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
581 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
582 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
583 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
584 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
585 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
586 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
587 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
588 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
589 640753048 Serratia proteamaculans 568 Isolate Endosphere
590 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
591 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
592 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
593 8004592986 Serratia sp. S119 Isolate Unclassified
594 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
595 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
596 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
597 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
598 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
599 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
600 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
601 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
602 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
603 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
604 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
605 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
606 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
607 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
608 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
609 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
610 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
611 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
612 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
613 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
614 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
615 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
616 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
617 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
618 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
619 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
620 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
621 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
622 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
623 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
624 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.7
Metatranscriptomes 0.39
Isolates 29.91

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 8.11
Nodule 2.25
Rhizoplane 12.41
Rhizosphere 59.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495682_0000020 3300049460 Bacteria 210849
2 MRS2a_Contig_11 2124908027 Bacteria 54720
3 MRS2a_Contig_9428 2124908027 Bacteria 2296
4 JGI24739J22299_10011364 3300001989 Bacteria 3288
5 JGI24739J22299_10036641 3300001989 Bacteria 1656
6 JGI25162J39368_1000014 3300002737 Bacteria 328873
7 JGI25162J39368_1000060 3300002737 Bacteria 137745
8 JGI25163J39215_1000784 3300002771 Bacteria 7761
9 JGI25163J39215_1000792 3300002771 Bacteria 7675
10 JGI25164J39214_1000037 3300002772 Bacteria 137530
11 JGI25164J39214_1000059 3300002772 Bacteria 111483
12 JGI25151J46595_10022352 3300003187 Bacteria 2627
13 JGI25165J46597_1000027 3300003214 Bacteria 328873
14 JGI25165J46597_1000118 3300003214 Bacteria 137530
15 rootH2_10002244 3300003320 Bacteria 2298
16 rootH2_10154959 3300003320 Bacteria 1993
17 rootL2_10107293 3300003322 Bacteria 7020
18 Ga0055538_1000158 3300003751 Bacteria 45679
19 Ga0055539_1000208 3300003752 Bacteria 45679
20 Ga0055533_1000209 3300003756 Bacteria 45679
21 Ga0055532_1000214 3300003758 Bacteria 45671
22 Ga0055532_1001585 3300003758 Bacteria 6045
23 Ga0055532_1003700 3300003758 Bacteria 2513
24 Ga0055525_1000287 3300003759 Bacteria 45679
25 Ga0055529_1000493 3300003763 Bacteria 35995
26 Ga0055536_1000046 3300003781 Bacteria 118284
27 Ga0055536_1000128 3300003781 Bacteria 64931
28 Ga0055528_1001894 3300003790 Bacteria 11896
29 Ga0055528_1005086 3300003790 Bacteria 6202
30 Ga0055530_10000133 3300003791 Bacteria 65211
31 Ga0055530_10000136 3300003791 Bacteria 64931
32 Ga0055530_10000373 3300003791 Bacteria 40491
33 Ga0055540_1000070 3300003792 Bacteria 118483
34 Ga0055540_1000168 3300003792 Bacteria 65211
35 Ga0055540_1000303 3300003792 Bacteria 43632
36 Ga0055531_10010863 3300003794 Bacteria 4470
37 Ga0055541_1000067 3300003841 Bacteria 99013
38 Ga0058692_1000041 3300003856 Bacteria 129687
39 Ga0058692_1001554 3300003856 Bacteria 8318
40 Ga0065703_1018788 3300005272 Bacteria 7981
41 Ga0065714_10000651 3300005288 Bacteria 3160
42 Ga0065714_10002705 3300005288 Bacteria 16648
43 Ga0065714_10003341 3300005288 Bacteria 8043
44 Ga0065714_10023470 3300005288 Bacteria 2893
45 Ga0065714_10064673 3300005288 Bacteria 24513
46 Ga0065714_10065808 3300005288 Bacteria 8446
47 Ga0065704_10002589 3300005289 Bacteria 8396
48 Ga0065704_10120447 3300005289 Bacteria 1782
49 Ga0065712_10117901 3300005290 Bacteria 1714
50 Ga0070658_10030936 3300005327 Bacteria 4299
51 Ga0070670_100007505 3300005331 Bacteria 9259
52 Ga0070670_100041367 3300005331 Bacteria 3962
53 Ga0070660_100000080 3300005339 Bacteria 57858
54 Ga0070661_100000399 3300005344 Bacteria 33668
55 Ga0070669_100003105 3300005353 Bacteria 11955
56 Ga0070659_100000068 3300005366 Bacteria 81455
57 Ga0070714_100007884 3300005435 Bacteria 8295
58 Ga0070708_100019352 3300005445 Bacteria 5719
59 Ga0070708_100039180 3300005445 Bacteria 4145
60 Ga0070708_100145467 3300005445 Bacteria 2201
61 Ga0070663_100001611 3300005455 Bacteria 12453
62 Ga0070662_100001000 3300005457 Bacteria 17295
63 Ga0070706_100032802 3300005467 Bacteria 4791
64 Ga0070706_100305455 3300005467 Bacteria 1484
65 Ga0070699_100006669 3300005518 Bacteria 10039
66 Ga0070664_100000824 3300005564 Bacteria 23877
67 Ga0068854_100011802 3300005578 Bacteria 5705
68 Ga0068852_100022859 3300005616 Bacteria 5023
69 Ga0068851_10000400 3300005834 Bacteria 19656
70 Ga0081455_10135792 3300005937 Bacteria 1917
71 Ga0075368_10021479 3300006042 Bacteria 2452
72 Ga0075363_100020018 3300006048 Bacteria 3352
73 Ga0075363_100052756 3300006048 Bacteria 2171
74 Ga0075367_10001716 3300006178 Bacteria 9597
75 Ga0079104_1000004 3300006946 Bacteria 444549
76 Ga0079104_1000823 3300006946 Bacteria 25811
77 Ga0079104_1002497 3300006946 Bacteria 9789
78 Ga0079104_1004114 3300006946 Bacteria 6388
79 Ga0099826_10006487 3300006948 Bacteria 8530
80 Ga0099794_10037220 3300007265 Bacteria 2303
81 Ga0105251_10000089 3300009011 Bacteria 88101
82 Ga0105251_10000230 3300009011 Bacteria 56255
83 Ga0105251_10000233 3300009011 Bacteria 55865
84 Ga0105251_10000302 3300009011 Bacteria 49476
85 Ga0105251_10000842 3300009011 Bacteria 27494
86 Ga0105251_10000924 3300009011 Bacteria 26310
87 Ga0105251_10003948 3300009011 Bacteria 10517
88 Ga0105251_10010267 3300009011 Bacteria 5448
89 Ga0105251_10014142 3300009011 Bacteria 4429
90 Ga0105251_10014525 3300009011 Bacteria 4347
91 Ga0105251_10029298 3300009011 Bacteria 2773
92 Ga0105251_10030780 3300009011 Bacteria 2691
93 Ga0105251_10048242 3300009011 Bacteria 2042
94 Ga0105244_10000564 3300009036 Bacteria 33108
95 Ga0105244_10000658 3300009036 Bacteria 30291
96 Ga0105244_10000989 3300009036 Bacteria 23885
97 Ga0105244_10001094 3300009036 Bacteria 22555
98 Ga0105244_10001338 3300009036 Bacteria 20125
99 Ga0105244_10002323 3300009036 Bacteria 14461
100 Ga0105244_10004498 3300009036 Bacteria 9575
101 Ga0105244_10024564 3300009036 Bacteria 3287
102 Ga0105244_10027027 3300009036 Bacteria 3098
103 Ga0105244_10057902 3300009036 Bacteria 1958
104 Ga0105244_10061629 3300009036 Bacteria 1887
105 Ga0105244_10062378 3300009036 Bacteria 1874
106 Ga0105244_10078934 3300009036 Bacteria 1632
107 Ga0105244_10084125 3300009036 Bacteria 1572
108 Ga0105244_10097524 3300009036 Bacteria 1440
109 Ga0105250_10000093 3300009092 Bacteria 79800
110 Ga0105250_10000370 3300009092 Bacteria 33590
111 Ga0105250_10000480 3300009092 Bacteria 28082
112 Ga0105250_10001079 3300009092 Bacteria 15444
113 Ga0105250_10002704 3300009092 Bacteria 8767
114 Ga0105250_10003415 3300009092 Bacteria 7530
115 Ga0105250_10009314 3300009092 Bacteria 4141
116 Ga0105250_10015252 3300009092 Bacteria 3148
117 Ga0105250_10016876 3300009092 Bacteria 2971
118 Ga0105245_10177015 3300009098 Bacteria 2035
119 Ga0105247_10000396 3300009101 Bacteria 36915
120 Ga0114129_10040552 3300009147 Bacteria 6564
121 Ga0105243_10000045 3300009148 Bacteria 156620
122 Ga0105241_10000013 3300009174 Bacteria 172249
123 Ga0105242_10050494 3300009176 Bacteria 3386
124 Ga0105237_10001264 3300009545 Bacteria 33746
125 Ga0105238_10001781 3300009551 Bacteria 21549
126 Ga0105246_10012437 3300011119 Bacteria 5312
127 Ga0105246_10013729 3300011119 Bacteria 5081
128 Ga0105246_10016141 3300011119 Bacteria 4726
129 Ga0105246_10019801 3300011119 Bacteria 4309
130 Ga0105246_10081297 3300011119 Bacteria 2309
131 Ga0157373_10004744 3300013100 Bacteria 10228
132 Ga0157373_10004812 3300013100 Bacteria 10159
133 Ga0157373_10033938 3300013100 Bacteria 3666
134 Ga0157373_10033979 3300013100 Bacteria 3664
135 Ga0157371_10000726 3300013102 Bacteria 38632
136 Ga0157371_10009826 3300013102 Bacteria 7500
137 Ga0157371_10011902 3300013102 Bacteria 6675
138 Ga0157371_10012245 3300013102 Bacteria 6567
139 Ga0157371_10025604 3300013102 Bacteria 4297
140 Ga0157371_10089884 3300013102 Bacteria 2175
141 Ga0157370_10028217 3300013104 Bacteria 5524
142 Ga0157370_10043959 3300013104 Bacteria 4297
143 Ga0157370_10205620 3300013104 Bacteria 1826
144 Ga0157370_10360854 3300013104 Bacteria 1339
145 Ga0157370_10536904 3300013104 Bacteria 1073
146 Ga0157369_10006024 3300013105 Bacteria 14079
147 Ga0157369_10012687 3300013105 Bacteria 9556
148 Ga0157369_10029566 3300013105 Bacteria 6054
149 Ga0157369_10037630 3300013105 Bacteria 5297
150 Ga0163162_10096668 3300013306 Bacteria 3042
151 Ga0163162_10196954 3300013306 Bacteria 2143
152 Ga0157372_10008819 3300013307 Bacteria 10711
153 Ga0157372_10047419 3300013307 Bacteria 4775
154 Ga0157372_10050110 3300013307 Bacteria 4645
155 Ga0157372_10198433 3300013307 Bacteria 2324
156 Ga0157375_10008636 3300013308 Bacteria 8923
157 Ga0157375_10015239 3300013308 Bacteria 6878
158 Ga0182008_10003483 3300014497 Bacteria 9496
159 Ga0182008_10004004 3300014497 Bacteria 8711
160 Ga0182008_10004201 3300014497 Bacteria 8466
161 Ga0182008_10045535 3300014497 Bacteria 2181
162 Ga0182006_1001860 3300015261 Bacteria 12091
163 Ga0182006_1005531 3300015261 Bacteria 6001
164 Ga0182006_1033063 3300015261 Bacteria 2074
165 Ga0182006_1036527 3300015261 Bacteria 1953
166 Ga0182006_1080660 3300015261 Bacteria 1188
167 Ga0182007_10000177 3300015262 Bacteria 43427
168 Ga0182005_1003224 3300015265 Bacteria 5579
169 Ga0183367_1021 3300015688 Bacteria 82913
170 Ga0163161_10000028 3300017792 Bacteria 197151
171 Ga0163161_10154678 3300017792 Bacteria 1745
172 Ga0163161_10186014 3300017792 Bacteria 1594
173 Ga0163161_10278142 3300017792 Bacteria 1312
174 Ga0163161_10360184 3300017792 Bacteria 1158
175 Ga0213872_10110645 3300021361 Bacteria 1220
176 Ga0209435_101168 3300025206 Bacteria 3590
177 Ga0209760_100023 3300025207 Bacteria 159144
178 Ga0209760_100025 3300025207 Bacteria 156628
179 Ga0209784_100058 3300025224 Bacteria 167327
180 Ga0209566_100045 3300025225 Bacteria 258557
181 Ga0209566_100313 3300025225 Bacteria 43940
182 Ga0209674_100096 3300025226 Bacteria 167418
183 Ga0209674_101130 3300025226 Bacteria 7786
184 Ga0209672_100019 3300025228 Bacteria 432215
185 Ga0209672_100065 3300025228 Bacteria 198168
186 Ga0209147_100026 3300025229 Bacteria 421622
187 Ga0209147_100056 3300025229 Bacteria 258557
188 Ga0209147_100180 3300025229 Bacteria 78654
189 Ga0209147_100228 3300025229 Bacteria 55836
190 Ga0209147_102004 3300025229 Bacteria 5888
191 Ga0209563_100064 3300025230 Bacteria 258557
192 Ga0207427_100003 3300025231 Bacteria 1035004
193 Ga0207427_100018 3300025231 Bacteria 530735
194 Ga0209437_100002 3300025233 Bacteria 1574801
195 Ga0209437_100031 3300025233 Bacteria 530871
196 Ga0209437_100032 3300025233 Bacteria 520075
197 Ga0209437_104633 3300025233 Bacteria 2400
198 Ga0209258_100031 3300025242 Bacteria 463572
199 Ga0209258_100079 3300025242 Bacteria 263132
200 Ga0209258_100446 3300025242 Bacteria 45941
201 Ga0209646_1000147 3300025246 Bacteria 103287
202 Ga0209677_100053 3300025253 Bacteria 167537
203 Ga0209148_1000027 3300025254 Bacteria 616374
204 Ga0209759_1002071 3300025256 Bacteria 9392
205 Ga0209759_1021692 3300025256 Bacteria 1454
206 Ga0209233_1000004 3300025261 Bacteria 1574798
207 Ga0209233_1000012 3300025261 Bacteria 1019519
208 Ga0209455_1000058 3300025272 Bacteria 342028
209 Ga0209673_1000420 3300025273 Bacteria 74545
210 Ga0209673_1003279 3300025273 Bacteria 9749
211 Ga0209676_1000003 3300025292 Bacteria 1454178
212 Ga0209676_1000055 3300025292 Bacteria 361565
213 Ga0209676_1001524 3300025292 Bacteria 21049
214 Ga0209025_1013242 3300025294 Bacteria 5203
215 Ga0209564_1011389 3300025295 Bacteria 3991
216 Ga0209050_1000004 3300025298 Bacteria 1600040
217 Ga0209050_1000043 3300025298 Bacteria 398654
218 Ga0209050_1000231 3300025298 Bacteria 122373
219 Ga0209051_1000030 3300025303 Bacteria 398654
220 Ga0209051_1000052 3300025303 Bacteria 283346
221 Ga0209051_1000165 3300025303 Bacteria 122373
222 Ga0209257_1000767 3300025304 Bacteria 47879
223 Ga0207656_10000382 3300025321 Bacteria 14888
224 Ga0207696_1000041 3300025711 Bacteria 311695
225 Ga0207696_1000049 3300025711 Bacteria 281296
226 Ga0207696_1000068 3300025711 Bacteria 228017
227 Ga0207696_1000076 3300025711 Bacteria 210418
228 Ga0207696_1000078 3300025711 Bacteria 207623
229 Ga0207696_1000628 3300025711 Bacteria 25903
230 Ga0207696_1001235 3300025711 Bacteria 14456
231 Ga0207696_1023979 3300025711 Bacteria 1917
232 Ga0207696_1025493 3300025711 Bacteria 1843
233 Ga0207655_1000030 3300025728 Bacteria 413221
234 Ga0207655_1000085 3300025728 Bacteria 206425
235 Ga0207655_1000106 3300025728 Bacteria 181416
236 Ga0207655_1000137 3300025728 Bacteria 140084
237 Ga0207655_1000141 3300025728 Bacteria 138956
238 Ga0207655_1007004 3300025728 Bacteria 7381
239 Ga0207655_1007620 3300025728 Bacteria 6992
240 Ga0207655_1009069 3300025728 Bacteria 6226
241 Ga0207655_1012405 3300025728 Bacteria 4983
242 Ga0207655_1012654 3300025728 Bacteria 4908
243 Ga0207655_1019266 3300025728 Bacteria 3576
244 Ga0207655_1029070 3300025728 Bacteria 2595
245 Ga0207713_1000010 3300025735 Bacteria 528374
246 Ga0207713_1000011 3300025735 Bacteria 507224
247 Ga0207713_1000044 3300025735 Bacteria 238074
248 Ga0207713_1000062 3300025735 Bacteria 208832
249 Ga0207713_1000127 3300025735 Bacteria 118502
250 Ga0207713_1000265 3300025735 Bacteria 64796
251 Ga0207713_1000850 3300025735 Bacteria 28055
252 Ga0207713_1001279 3300025735 Bacteria 20735
253 Ga0207713_1002699 3300025735 Bacteria 12673
254 Ga0207713_1003516 3300025735 Bacteria 10623
255 Ga0207713_1020770 3300025735 Bacteria 3169
256 Ga0207713_1022742 3300025735 Bacteria 2966
257 Ga0207713_1035899 3300025735 Bacteria 2134
258 Ga0207713_1043414 3300025735 Bacteria 1858
259 Ga0207713_1060405 3300025735 Bacteria 1449
260 Ga0207713_1060765 3300025735 Bacteria 1442
261 Ga0207692_10084300 3300025898 Bacteria 1707
262 Ga0207692_10150188 3300025898 Bacteria 1334
263 Ga0207710_10000145 3300025900 Bacteria 80941
264 Ga0207647_10006893 3300025904 Bacteria 8234
265 Ga0207647_10026170 3300025904 Bacteria 3820
266 Ga0207699_10128166 3300025906 Bacteria 1651
267 Ga0207705_10041564 3300025909 Bacteria 3298
268 Ga0207684_10034820 3300025910 Bacteria 4277
269 Ga0207654_10000016 3300025911 Bacteria 211550
270 Ga0207695_10001626 3300025913 Bacteria 36374
271 Ga0207671_10000394 3300025914 Bacteria 61087
272 Ga0207663_10119766 3300025916 Bacteria 1800
273 Ga0207663_10125752 3300025916 Bacteria 1763
274 Ga0207657_10000494 3300025919 Bacteria 41647
275 Ga0207649_10000251 3300025920 Bacteria 43152
276 Ga0207681_10003619 3300025923 Bacteria 9608
277 Ga0207694_10029030 3300025924 Bacteria 4218
278 Ga0207650_10000384 3300025925 Bacteria 40899
279 Ga0207650_10010667 3300025925 Bacteria 6311
280 Ga0207664_10026885 3300025929 Bacteria 4355
281 Ga0207690_10000026 3300025932 Bacteria 175904
282 Ga0207706_10002791 3300025933 Bacteria 16966
283 Ga0207686_10031618 3300025934 Bacteria 3144
284 Ga0207709_10000011 3300025935 Bacteria 552881
285 Ga0207709_10011361 3300025935 Bacteria 4910
286 Ga0207679_10000016 3300025945 Bacteria 253494
287 Ga0207667_10149635 3300025949 Bacteria 2403
288 Ga0207668_10006823 3300025972 Bacteria 6767
289 Ga0207640_10028871 3300025981 Bacteria 3398
290 Ga0207678_10001257 3300026067 Bacteria 23391
291 Ga0207702_10116828 3300026078 Bacteria 2381
292 Ga0207683_10227559 3300026121 Bacteria 1700
293 Ga0207698_10016462 3300026142 Bacteria 4985
294 Ga0209281_1000005 3300027111 Bacteria 1242284
295 Ga0209281_1000009 3300027111 Bacteria 771717
296 Ga0209281_1000107 3300027111 Bacteria 218397
297 Ga0209281_1008151 3300027111 Bacteria 2568
298 Ga0209371_1000036 3300027312 Bacteria 367250
299 Ga0209371_1000858 3300027312 Bacteria 24618
300 Ga0209371_1001177 3300027312 Bacteria 19097
301 Ga0209371_1005345 3300027312 Bacteria 5146
302 Ga0209984_1003582 3300027424 Bacteria 1785
303 Ga0209282_1101036 3300027666 Bacteria 1485
304 Ga0209588_1005005 3300027671 Bacteria 3772
305 Ga0209813_10006743 3300027866 Bacteria 2845
306 Ga0209974_10041124 3300027876 Bacteria 1539
307 Ga0207428_10001057 3300027907 Bacteria 30209
308 Ga0307515_10026799 3300028794 Bacteria 9892
309 Ga0268256_1000040 3300030500 Bacteria 348002
310 Ga0268256_1000477 3300030500 Bacteria 34416
311 Ga0268256_1001008 3300030500 Bacteria 19097
312 Ga0268256_1001594 3300030500 Bacteria 13219
313 Ga0307511_10002260 3300030521 Bacteria 20135
314 Ga0307512_10071665 3300030522 Bacteria 2570
315 Ga0307513_10000099 3300031456 Bacteria 125847
316 Ga0307513_10225720 3300031456 Bacteria 1690
317 Ga0307509_10009838 3300031507 Bacteria 11836
318 Ga0307408_100003833 3300031548 Bacteria 10233
319 Ga0307408_100009042 3300031548 Bacteria 6579
320 Ga0307508_10033599 3300031616 Bacteria 4630
321 Ga0307514_10021075 3300031649 Bacteria 5312
322 Ga0307514_10137524 3300031649 Bacteria 1668
323 Ga0307516_10042249 3300031730 Bacteria 4524
324 Ga0307405_10002090 3300031731 Bacteria 8705
325 Ga0307405_10063581 3300031731 Bacteria 2341
326 Ga0307413_10033700 3300031824 Bacteria 2919
327 Ga0307518_10167657 3300031838 Bacteria 1501
328 Ga0307407_10031947 3300031903 Bacteria 2856
329 Ga0307412_10001950 3300031911 Bacteria 11412
330 Ga0307412_10014413 3300031911 Bacteria 4661
331 Ga0307409_100181830 3300031995 Bacteria 1862
332 Ga0307414_10036060 3300032004 Bacteria 3297
333 Ga0307414_10328011 3300032004 Bacteria 1305
334 Ga0307411_10028873 3300032005 Bacteria 3378
335 Ga0307507_10116832 3300033179 Bacteria 2153
336 Ga0307507_10212507 3300033179 Bacteria 1316
337 Ga0307510_10034138 3300033180 Bacteria 5700
338 Ga0307510_10181433 3300033180 Bacteria 1667
339 Ga0373928_0026032 3300035084 Bacteria 1265
340 Ga0373949_0008916 3300035090 Bacteria 2196
341 Ga0373932_0005473 3300035112 Bacteria 2988
342 Ga0373941_0002472 3300035115 Bacteria 4075
343 Ga0373931_0067601 3300035691 Bacteria 1943
344 Ga0436365_0778140 3300039437 Bacteria 3964
345 Ga0436361_0048296 3300039447 Bacteria 2699
346 Ga0436361_0401522 3300039447 Bacteria 1430
347 Ga0439438_004505 3300041405 Bacteria 5318
348 Ga0439438_005931 3300041405 Bacteria 4409
349 Ga0439438_010402 3300041405 Bacteria 2942
350 Ga0439438_014038 3300041405 Bacteria 2394
351 Ga0439438_019883 3300041405 Bacteria 1891
352 Ga0439447_019181 3300041407 Bacteria 1826
353 Ga0439466_0000270 3300041411 Bacteria 20132
354 Ga0439466_0003546 3300041411 Bacteria 6034
355 Ga0439466_0039569 3300041411 Bacteria 1579
356 Ga0439466_0044976 3300041411 Bacteria 1460
357 Ga0439466_0045899 3300041411 Bacteria 1444
358 Ga0451802_0529951 3300041460 Bacteria 1183
359 Ga0451853_1210111 3300041512 Bacteria 6555
360 Ga0439433_0002805 3300041999 Bacteria 3718
361 Ga0439448_0022166 3300042005 Bacteria 1972
362 Ga0439432_001555 3300042006 Bacteria 8614
363 Ga0439432_002562 3300042006 Bacteria 6852
364 Ga0439432_005338 3300042006 Bacteria 4638
365 Ga0439432_043073 3300042006 Bacteria 1425
366 Ga0439449_0000216 3300042007 Bacteria 20485
367 Ga0439449_0000368 3300042007 Bacteria 16559
368 Ga0439449_0008568 3300042007 Bacteria 3883
369 Ga0439449_0018834 3300042007 Bacteria 2588
370 Ga0439451_010560 3300042009 Bacteria 1861
371 Ga0439456_023049 3300042013 Bacteria 1319
372 Ga0439457_000640 3300042014 Bacteria 10343
373 Ga0439457_008039 3300042014 Bacteria 2502
374 Ga0439463_001049 3300042016 Bacteria 7480
375 Ga0450907_000010 3300042146 Bacteria 95376
376 Ga0450907_000818 3300042146 Bacteria 7673
377 Ga0450909_002314 3300042185 Bacteria 2699
378 Ga0439464_0006455 3300042439 Bacteria 3054
379 Ga0466969_0008961 3300044656 Bacteria 5305
380 Ga0466969_0009317 3300044656 Bacteria 5204
381 Ga0466969_0009870 3300044656 Bacteria 5061
382 Ga0466969_0061355 3300044656 Bacteria 1826
383 Ga0466972_0009451 3300044658 Bacteria 4896
384 Ga0466972_0043806 3300044658 Bacteria 2172
385 Ga0466965_0001653 3300044683 Bacteria 9138
386 Ga0466965_0002532 3300044683 Bacteria 7799
387 Ga0466966_0000885 3300044684 Bacteria 19103
388 Ga0466966_0099599 3300044684 Bacteria 1798
389 Ga0466966_0124791 3300044684 Bacteria 1579
390 Ga0466961_0000876 3300044693 Bacteria 18697
391 Ga0466961_0027290 3300044693 Bacteria 3671
392 Ga0466961_0038877 3300044693 Bacteria 3051
393 Ga0466963_0001810 3300044694 Bacteria 11642
394 Ga0466963_0214754 3300044694 Bacteria 1346
395 Ga0466964_0004446 3300044706 Bacteria 5180
396 Ga0466964_0091067 3300044706 Bacteria 1327
397 Ga0466971_0000701 3300044719 Bacteria 13393
398 Ga0466971_0036236 3300044719 Bacteria 2212
399 Ga0466970_0000432 3300044765 Bacteria 20530
400 Ga0466957_0000574 3300044842 Bacteria 18531
401 Ga0466957_0141141 3300044842 Bacteria 1552
402 Ga0466959_0002628 3300045049 Bacteria 11537
403 Ga0466959_0018725 3300045049 Bacteria 5085
404 Ga0466959_0076966 3300045049 Bacteria 2408
405 Ga0466958_0005448 3300045836 Bacteria 6852
406 Ga0466967_0000976 3300045976 Bacteria 15525
407 Ga0466967_0267087 3300045976 Bacteria 1638
408 Ga0495617_000054 3300046452 Bacteria 102256
409 Ga0495617_000144 3300046452 Bacteria 46606
410 Ga0495617_008090 3300046452 Bacteria 3634
411 Ga0495617_020775 3300046452 Bacteria 2219
412 Ga0495627_000100 3300046453 Bacteria 106276
413 Ga0495627_000308 3300046453 Bacteria 48367
414 Ga0495627_002826 3300046453 Bacteria 8036
415 Ga0495592_0000800 3300046454 Bacteria 21805
416 Ga0495603_0001986 3300046455 Bacteria 12045
417 Ga0495603_0021119 3300046455 Bacteria 3942
418 Ga0495603_0021860 3300046455 Bacteria 3873
419 Ga0495603_0041783 3300046455 Bacteria 2741
420 Ga0495590_0001206 3300046457 Bacteria 11305
421 Ga0495590_0004191 3300046457 Bacteria 5835
422 Ga0495591_000315 3300046458 Bacteria 43798
423 Ga0495591_001261 3300046458 Bacteria 16235
424 Ga0495591_023221 3300046458 Bacteria 1992
425 Ga0495629_0022330 3300046459 Bacteria 4512
426 Ga0495629_0154682 3300046459 Bacteria 1594
427 Ga0495651_0021970 3300046462 Bacteria 4963
428 Ga0495653_0001170 3300046463 Bacteria 20256
429 Ga0495653_0037631 3300046463 Bacteria 3799
430 Ga0495650_0000881 3300046471 Bacteria 35559
431 Ga0495650_0005496 3300046471 Bacteria 8193
432 Ga0495650_0060045 3300046471 Bacteria 1528
433 Ga0495580_0025815 3300046472 Bacteria 4290
434 Ga0495580_0067123 3300046472 Bacteria 2510
435 Ga0495605_0000794 3300046474 Bacteria 22656
436 Ga0495605_0001665 3300046474 Bacteria 14288
437 Ga0495605_0010840 3300046474 Bacteria 5090
438 Ga0495605_0039013 3300046474 Bacteria 2380
439 Ga0495639_0000032 3300046475 Bacteria 64548
440 Ga0495662_0002045 3300046476 Bacteria 10107
441 Ga0495664_0154183 3300046477 Bacteria 1393
442 Ga0495584_0000409 3300046491 Bacteria 29687
443 Ga0495584_0000547 3300046491 Bacteria 25497
444 Ga0495584_0001764 3300046491 Bacteria 12598
445 Ga0495584_0002662 3300046491 Bacteria 10055
446 Ga0495585_0004329 3300046492 Bacteria 9231
447 Ga0495585_0018164 3300046492 Bacteria 4057
448 Ga0495585_0075797 3300046492 Bacteria 1828
449 Ga0495585_0096331 3300046492 Bacteria 1588
450 Ga0495594_0050018 3300046499 Bacteria 2298
451 Ga0495607_0000185 3300046501 Bacteria 66759
452 Ga0495607_0000290 3300046501 Bacteria 53251
453 Ga0495607_0000617 3300046501 Bacteria 34500
454 Ga0495607_0018916 3300046501 Bacteria 4381
455 Ga0495607_0026414 3300046501 Bacteria 3603
456 Ga0495607_0048900 3300046501 Bacteria 2469
457 Ga0495583_0003663 3300046506 Bacteria 11448
458 Ga0495583_0011288 3300046506 Bacteria 5139
459 Ga0495583_0021045 3300046506 Bacteria 3360
460 Ga0495606_0000633 3300046507 Bacteria 55270
461 Ga0495606_0003155 3300046507 Bacteria 17833
462 Ga0495606_0025714 3300046507 Bacteria 4209
463 Ga0495608_0004232 3300046511 Bacteria 10289
464 Ga0495610_0002898 3300046512 Bacteria 13883
465 Ga0495610_0039563 3300046512 Bacteria 2383
466 Ga0495616_0000226 3300046513 Bacteria 46396
467 Ga0495616_0000661 3300046513 Bacteria 25616
468 Ga0495616_0008245 3300046513 Bacteria 6185
469 Ga0495616_0027410 3300046513 Bacteria 3022
470 Ga0495616_0032013 3300046513 Bacteria 2750
471 Ga0495618_0224363 3300046514 Bacteria 1184
472 Ga0495620_0001031 3300046515 Bacteria 17120
473 Ga0495620_0002862 3300046515 Bacteria 9918
474 Ga0495620_0056787 3300046515 Bacteria 1645
475 Ga0495628_0046540 3300046516 Bacteria 3444
476 Ga0495630_0047238 3300046517 Bacteria 3219
477 Ga0495632_0000754 3300046519 Bacteria 29135
478 Ga0495632_0001740 3300046519 Bacteria 17652
479 Ga0495637_0007143 3300046520 Bacteria 5560
480 Ga0495637_0007481 3300046520 Bacteria 5410
481 Ga0495637_0076198 3300046520 Bacteria 1344
482 Ga0495643_0031124 3300046522 Bacteria 2972
483 Ga0495643_0051205 3300046522 Bacteria 2221
484 Ga0495643_0066575 3300046522 Bacteria 1900
485 Ga0495648_0001506 3300046524 Bacteria 22801
486 Ga0495648_0002095 3300046524 Bacteria 18834
487 Ga0495648_0005959 3300046524 Bacteria 10028
488 Ga0495648_0035448 3300046524 Bacteria 3234
489 Ga0495648_0057823 3300046524 Bacteria 2322
490 Ga0495666_0010570 3300046526 Bacteria 4600
491 Ga0495642_0000316 3300046528 Bacteria 26656
492 Ga0495642_0004676 3300046528 Bacteria 5303
493 Ga0495652_0067382 3300046529 Bacteria 3001
494 Ga0495654_0000288 3300046530 Bacteria 45799
495 Ga0495654_0000306 3300046530 Bacteria 43427
496 Ga0495654_0000616 3300046530 Bacteria 28330
497 Ga0495654_0002069 3300046530 Bacteria 13171
498 Ga0495654_0011451 3300046530 Bacteria 4799
499 Ga0495654_0048471 3300046530 Bacteria 2084
500 Ga0495665_0005951 3300046531 Bacteria 6570
501 Ga0495640_0007888 3300046533 Bacteria 8371
502 Ga0495640_0076155 3300046533 Bacteria 2239
503 Ga0495586_0004174 3300046535 Bacteria 7739
504 Ga0495587_0004867 3300046536 Bacteria 8808
505 Ga0495609_0007500 3300046538 Bacteria 5440
506 Ga0495609_0008213 3300046538 Bacteria 5123
507 Ga0495609_0043234 3300046538 Bacteria 2023
508 Ga0495597_0018574 3300046542 Bacteria 3262
509 Ga0495597_0047574 3300046542 Bacteria 1898
510 Ga0495622_0002772 3300046557 Bacteria 8372
511 Ga0495622_0007970 3300046557 Bacteria 4911
512 Ga0495622_0008609 3300046557 Bacteria 4729
513 Ga0495633_0124689 3300046558 Bacteria 1192
514 Ga0495667_0038294 3300046559 Bacteria 3193
515 Ga0495656_0001994 3300046615 Bacteria 6722
516 Ga0495634_0000025 3300046642 Bacteria 115964
517 Ga0495634_0191337 3300046642 Bacteria 1276
518 Ga0495611_0021347 3300046648 Bacteria 2797
519 Ga0495625_0000847 3300046660 Bacteria 41784
520 Ga0495625_0030964 3300046660 Bacteria 3984
521 Ga0495635_0032535 3300046663 Bacteria 3618
522 Ga0495635_0034169 3300046663 Bacteria 3527
523 Ga0495635_0083363 3300046663 Bacteria 2187
524 Ga0495659_0001160 3300046664 Bacteria 9145
525 Ga0495659_0003525 3300046664 Bacteria 4987
526 Ga0495661_0000028 3300046665 Bacteria 182191
527 Ga0495661_0000083 3300046665 Bacteria 116027
528 Ga0495661_0004052 3300046665 Bacteria 10673
529 Ga0495588_0012539 3300046674 Bacteria 4009
530 Ga0495657_0024393 3300046675 Bacteria 4308
531 Ga0495599_0147771 3300046678 Bacteria 1456
532 Ga0495623_0063191 3300046679 Bacteria 2318
533 Ga0495623_0135382 3300046679 Bacteria 1471
534 Ga0495646_0074166 3300046680 Bacteria 1997
535 Ga0495646_0092979 3300046680 Bacteria 1738
536 Ga0495669_0001097 3300046684 Bacteria 11202
537 Ga0495624_0016369 3300046690 Bacteria 4991
538 Ga0495670_0013939 3300046691 Bacteria 3954
539 Ga0495671_0000295 3300046692 Bacteria 41756
540 Ga0495671_0001060 3300046692 Bacteria 19054
541 Ga0495671_0031802 3300046692 Bacteria 2696
542 Ga0495649_0000013 3300046694 Bacteria 316013
543 Ga0495649_0000909 3300046694 Bacteria 23449
544 Ga0495649_0005272 3300046694 Bacteria 8264
545 Ga0495649_0066204 3300046694 Bacteria 1939
546 Ga0495589_0000010 3300046794 Bacteria 250407
547 Ga0495589_0000141 3300046794 Bacteria 66457
548 Ga0495589_0050688 3300046794 Bacteria 2052
549 Ga0495600_0076365 3300046809 Bacteria 2187
550 Ga0495600_0231613 3300046809 Bacteria 1179
551 Ga0495660_0043368 3300046810 Bacteria 2482
552 Ga0495604_0000491 3300047317 Bacteria 34687
553 Ga0495604_0002087 3300047317 Bacteria 16085
554 Ga0495636_0036577 3300047318 Bacteria 2025
555 Ga0495636_0042658 3300047318 Bacteria 1886
556 Ga0495674_0013289 3300047319 Bacteria 7742
557 Ga0495672_0000289 3300047320 Bacteria 69285
558 Ga0495672_0001978 3300047320 Bacteria 19360
559 Ga0495672_0006656 3300047320 Bacteria 8875
560 Ga0495672_0016761 3300047320 Bacteria 4918
561 Ga0495672_0056286 3300047320 Bacteria 2289
562 Ga0495676_0031256 3300047321 Bacteria 4505
563 Ga0495676_0046429 3300047321 Bacteria 3524
564 Ga0495680_0010178 3300047322 Bacteria 8403
565 Ga0495683_0005005 3300047323 Bacteria 7421
566 Ga0495683_0006189 3300047323 Bacteria 6552
567 Ga0495683_0087446 3300047323 Bacteria 1513
568 Ga0495683_0139904 3300047323 Bacteria 1135
569 Ga0495687_000715 3300047443 Bacteria 36786
570 Ga0495687_004143 3300047443 Bacteria 9986
571 Ga0495687_008394 3300047443 Bacteria 5915
572 Ga0495687_011525 3300047443 Bacteria 4747
573 Ga0495687_038970 3300047443 Bacteria 2105
574 Ga0495675_0011462 3300047444 Bacteria 5565
575 Ga0495679_000711 3300047446 Bacteria 21533
576 Ga0495679_005752 3300047446 Bacteria 5460
577 Ga0495679_005912 3300047446 Bacteria 5361
578 Ga0495679_007398 3300047446 Bacteria 4579
579 Ga0495679_014366 3300047446 Bacteria 2937
580 Ga0495685_003608 3300047447 Bacteria 4949
581 Ga0495685_007685 3300047447 Bacteria 3564
582 Ga0495673_0000190 3300047469 Bacteria 97539
583 Ga0495673_0000833 3300047469 Bacteria 28784
584 Ga0495673_0002842 3300047469 Bacteria 11791
585 Ga0495673_0027701 3300047469 Bacteria 2692
586 Ga0495681_0000027 3300047470 Bacteria 141884
587 Ga0495681_0000237 3300047470 Bacteria 45823
588 Ga0495684_0080737 3300047471 Bacteria 2468
589 Ga0495686_0135393 3300047472 Bacteria 1457
590 Ga0495593_0006494 3300047673 Bacteria 6853
591 Ga0495602_0017638 3300048088 Bacteria 7152
592 Ga0495614_0020018 3300048089 Bacteria 2894
593 Ga0495614_0020284 3300048089 Bacteria 2875
594 Ga0495626_0000352 3300048091 Bacteria 48007
595 Ga0495626_0005473 3300048091 Bacteria 7412
596 Ga0495626_0129223 3300048091 Bacteria 1080
597 Ga0496100_0000516 3300048903 Bacteria 18505
598 Ga0496100_0051117 3300048903 Bacteria 2681
599 Ga0496101_0000023 3300048904 Bacteria 209923
600 Ga0496101_0004518 3300048904 Bacteria 8779
601 Ga0496102_0000038 3300048905 Bacteria 198844
602 Ga0496102_0007086 3300048905 Bacteria 9568
603 Ga0496102_0026298 3300048905 Bacteria 5189
604 Ga0496103_0005594 3300048906 Bacteria 7516
605 Ga0496103_0096252 3300048906 Bacteria 1871
606 Ga0496104_0001353 3300048907 Bacteria 21218
607 Ga0496105_0000207 3300048908 Bacteria 39354
608 Ga0496105_0026938 3300048908 Bacteria 4691
609 Ga0496106_0002123 3300048909 Bacteria 14835
610 Ga0496107_0002440 3300048910 Bacteria 12045
611 Ga0496108_0001726 3300048911 Bacteria 17345
612 Ga0496109_0002642 3300048912 Bacteria 15026
613 Ga0496109_0221970 3300048912 Bacteria 1777
614 Ga0496110_0052572 3300048913 Bacteria 3579
615 Ga0496111_0000662 3300048914 Bacteria 18077
616 Ga0496111_0125801 3300048914 Bacteria 1895
617 Ga0496111_0508339 3300048914 Bacteria 886
618 Ga0496112_0002268 3300048915 Bacteria 15382
619 Ga0496112_0060524 3300048915 Bacteria 3732
620 Ga0496113_0011643 3300048916 Bacteria 5881
621 Ga0496113_0169763 3300048916 Bacteria 1727
622 Ga0496115_0028447 3300048918 Bacteria 4381
623 Ga0496116_0000077 3300048919 Bacteria 227959
624 Ga0496116_0000221 3300048919 Bacteria 106314
625 Ga0496116_0000984 3300048919 Bacteria 34981
626 Ga0496116_0001107 3300048919 Bacteria 32303
627 Ga0496116_0003444 3300048919 Bacteria 15629
628 Ga0496116_0047963 3300048919 Bacteria 2870
629 Ga0496116_0107552 3300048919 Bacteria 1648
630 Ga0496117_0000017 3300048920 Bacteria 490421
631 Ga0496117_0000219 3300048920 Bacteria 109688
632 Ga0496117_0001257 3300048920 Bacteria 37760
633 Ga0496117_0001570 3300048920 Bacteria 32425
634 Ga0496117_0002611 3300048920 Bacteria 22395
635 Ga0496117_0031730 3300048920 Bacteria 4028
636 Ga0496117_0032512 3300048920 Bacteria 3962
637 Ga0496117_0036374 3300048920 Bacteria 3684
638 Ga0496117_0092248 3300048920 Bacteria 1946
639 Ga0496117_0135562 3300048920 Bacteria 1484
640 Ga0496118_0000018 3300048921 Bacteria 490421
641 Ga0496118_0000301 3300048921 Bacteria 85827
642 Ga0496118_0008371 3300048921 Bacteria 10697
643 Ga0496118_0024337 3300048921 Bacteria 5228
644 Ga0496118_0038172 3300048921 Bacteria 3853
645 Ga0496118_0051169 3300048921 Bacteria 3162
646 Ga0496118_0067827 3300048921 Bacteria 2594
647 Ga0496118_0102657 3300048921 Bacteria 1926
648 Ga0496118_0103732 3300048921 Bacteria 1911
649 Ga0496118_0110937 3300048921 Bacteria 1820
650 Ga0496119_0000005 3300048922 Bacteria 529799
651 Ga0496119_0001451 3300048922 Bacteria 28525
652 Ga0496119_0001653 3300048922 Bacteria 26225
653 Ga0496119_0002190 3300048922 Bacteria 21858
654 Ga0496119_0006142 3300048922 Bacteria 11245
655 Ga0496119_0012321 3300048922 Bacteria 6959
656 Ga0496119_0014815 3300048922 Bacteria 6067
657 Ga0496119_0025426 3300048922 Bacteria 4136
658 Ga0496119_0067699 3300048922 Bacteria 2105
659 Ga0496120_0000005 3300048923 Bacteria 529797
660 Ga0496120_0000010 3300048923 Bacteria 385791
661 Ga0496120_0000028 3300048923 Bacteria 230249
662 Ga0496120_0000112 3300048923 Bacteria 136735
663 Ga0496120_0000139 3300048923 Bacteria 120489
664 Ga0496120_0001588 3300048923 Bacteria 26426
665 Ga0496120_0006263 3300048923 Bacteria 9182
666 Ga0496121_0000055 3300048924 Bacteria 304572
667 Ga0496121_0000307 3300048924 Bacteria 101849
668 Ga0496121_0004753 3300048924 Bacteria 17930
669 Ga0496121_0007545 3300048924 Bacteria 13107
670 Ga0496122_0001299 3300048925 Bacteria 41264
671 Ga0496122_0009382 3300048925 Bacteria 10326
672 Ga0496122_0011679 3300048925 Bacteria 8850
673 Ga0496122_0025572 3300048925 Bacteria 5122
674 Ga0496123_0001034 3300048926 Bacteria 42222
675 Ga0496123_0004814 3300048926 Bacteria 13927
676 Ga0496123_0017123 3300048926 Bacteria 5847
677 Ga0496123_0078198 3300048926 Bacteria 2027
678 Ga0496124_0000100 3300048927 Bacteria 181404
679 Ga0496124_0000158 3300048927 Bacteria 137433
680 Ga0496124_0003813 3300048927 Bacteria 18088
681 Ga0496124_0003909 3300048927 Bacteria 17810
682 Ga0496124_0004394 3300048927 Bacteria 16469
683 Ga0496124_0007113 3300048927 Bacteria 11983
684 Ga0496124_0029540 3300048927 Bacteria 4882
685 Ga0496124_0098283 3300048927 Bacteria 2376
686 Ga0496124_0172450 3300048927 Bacteria 1673
687 Ga0496125_0002257 3300048928 Bacteria 25575
688 Ga0496125_0003672 3300048928 Bacteria 18339
689 Ga0496125_0011347 3300048928 Bacteria 8921
690 Ga0496125_0012606 3300048928 Bacteria 8375
691 Ga0496125_0138322 3300048928 Bacteria 1698
692 Ga0496126_0002392 3300048929 Bacteria 25512
693 Ga0496126_0029144 3300048929 Bacteria 5247
694 Ga0496126_0035768 3300048929 Bacteria 4650
695 Ga0496126_0057901 3300048929 Bacteria 3495
696 Ga0496126_0167995 3300048929 Bacteria 1871
697 Ga0501305_009082 3300049161 Bacteria 1299
698 Ga0495678_000724 3300049459 Bacteria 29966
699 Ga0495678_002190 3300049459 Bacteria 13698
700 Ga0495678_006568 3300049459 Bacteria 6168
701 Ga0495678_007868 3300049459 Bacteria 5475
702 Ga0495678_012807 3300049459 Bacteria 3961
703 Ga0495678_033179 3300049459 Bacteria 2133
704 Ga0495682_0001677 3300049460 Bacteria 11299
705 Ga0495682_0008178 3300049460 Bacteria 4131
706 Ga0501312_000335 3300049528 Bacteria 3576
707 Ga0501335_000125 3300049551 Bacteria 3752
708 Ga0501336_000511 3300049552 Bacteria 1951
709 Ga0501038_0104816 3300049574 Bacteria 2350
710 nmdc:mga06z11_1188_c1 3300050494 Bacteria 9582
711 nmdc:mga04h51_1659_c1 3300050495 Bacteria 5200
712 nmdc:mga05p37_382408_c1 3300050507 Bacteria 1649
713 Ga0495601_0008947 3300053077 Bacteria 5911
714 Ga0500578_0128023 3300053086 Bacteria 1594
715 Ga0500618_007443 3300053125 Bacteria 3125
716 Ga0500573_0091310 3300053140 Bacteria 1720
717 Ga0466962_0002211 3300061719 Bacteria 9192
718 2506580856 2506520007 Bacteria 5442880
719 2506585995 2506520008 Bacteria 5443009
720 2508854665 2508501071 Bacteria 5454741
721 2510284536 2510065053 Bacteria 5005518
722 2510295986 2510065055 Bacteria 5037935
723 2510311914 2510065058 Bacteria 5005894
724 2511253802 2511231004 Bacteria 6669789
725 2511255458 2511231004 Bacteria 6669789
726 2511268221 2511231006 Bacteria 6794709
727 2511272546 2511231007 Bacteria 6306603
728 2511290773 2511231010 Bacteria 6373152
729 2511313847 2511231014 Bacteria 6462302
730 2511323318 2511231015 Bacteria 6598026
731 2511327779 2511231016 Bacteria 6704427
732 2511343835 2511231019 Bacteria 6520662
733 2511358631 2511231021 Bacteria 7302637
734 2511362414 2511231022 Bacteria 6719296
735 2511380672 2511231025 Bacteria 5324661
736 2511437281 2511231035 Bacteria 5341610
737 2511824369 2511231156 Bacteria 6845832
738 2512328379 2512047018 Bacteria 6663241
739 2512731739 2512564039 Bacteria 8739048
740 2519458511 2519103095 Bacteria 6629912
741 2555262202 2554235234 Bacteria 5762085
742 2555669599 2554235341 Bacteria 6867980
743 2583792851 2582580891 Bacteria 6800976
744 2585292917 2582581311 Bacteria 6763856
745 2585320302 2582581314 Bacteria 11452267
746 2597857604 2597489887 Bacteria 6666321
747 2597864244 2597489888 Bacteria 6179543
748 2597869501 2597489889 Bacteria 6297495
749 2599330607 2599185155 Bacteria 5827168
750 2599353404 2599185160 Bacteria 6844013
751 2599363797 2599185161 Bacteria 6960462
752 2599370117 2599185162 Bacteria 6957254
753 2599372424 2599185163 Bacteria 6995158
754 2599378512 2599185164 Bacteria 6841688
755 2599384111 2599185165 Bacteria 6843250
756 2599391283 2599185166 Bacteria 6959206
757 2599399233 2599185167 Bacteria 6353609
758 2599407528 2599185168 Bacteria 6997636
759 2599412358 2599185169 Bacteria 5441380
760 2599453666 2599185179 Bacteria 6611171
761 2599460238 2599185181 Bacteria 6844519
762 2599470630 2599185182 Bacteria 6883168
763 2599484461 2599185185 Bacteria 6652270
764 2599489259 2599185186 Bacteria 6831633
765 2599502202 2599185188 Bacteria 6164180
766 2599509112 2599185189 Bacteria 5862825
767 2599513725 2599185190 Bacteria 6285678
768 2599518905 2599185191 Bacteria 6297582
769 2599616067 2599185212 Bacteria 6765997
770 2599737435 2599185239 Bacteria 8686614
771 2599748704 2599185240 Bacteria 7968121
772 2599772658 2599185248 Bacteria 6696816
773 2599802267 2599185257 Bacteria 6492581
774 2599881042 2599185288 Bacteria 6666191
775 2599885068 2599185289 Bacteria 6778765
776 2599892782 2599185290 Bacteria 6289611
777 2599899793 2599185291 Bacteria 6775623
778 2599932738 2599185300 Bacteria 6062622
779 2599945254 2599185302 Bacteria 5954930
780 2599949676 2599185303 Bacteria 6512725
781 2599955394 2599185304 Bacteria 5951361
782 2599960884 2599185305 Bacteria 6748700
783 2599965489 2599185306 Bacteria 6637356
784 2599976604 2599185308 Bacteria 6621546
785 2599984429 2599185309 Bacteria 5969593
786 2599990400 2599185310 Bacteria 6014457
787 2599992829 2599185311 Bacteria 6354990
788 2600001658 2599185312 Bacteria 5912071
789 2600008912 2599185313 Bacteria 6658188
790 2600010651 2599185314 Bacteria 6621749
791 2600018378 2599185315 Bacteria 6771107
792 2600023308 2599185316 Bacteria 6320029
793 2600028221 2599185317 Bacteria 6435722
794 2600034158 2599185318 Bacteria 6961590
795 2600040329 2599185319 Bacteria 6637840
796 2600049238 2599185320 Bacteria 5963263
797 2600052898 2599185321 Bacteria 6764560
798 2600056979 2599185322 Bacteria 6763055
799 2600066806 2599185323 Bacteria 6688755
800 2600074058 2599185324 Bacteria 6590677
801 2600077535 2599185325 Bacteria 6324919
802 2600210615 2599185355 Bacteria 7968906
803 2600212847 2599185356 Bacteria 6843884
804 2600357330 2600254930 Bacteria 6431253
805 2600366910 2600254931 Bacteria 6734225
806 2601526248 2600255254 Bacteria 5281859
807 2601530219 2600255255 Bacteria 5282785
808 2601617177 2600255280 Bacteria 5292309
809 2601622136 2600255281 Bacteria 5288753
810 2601645681 2600255287 Bacteria 5210468
811 2601649933 2600255288 Bacteria 5282738
812 2601655223 2600255289 Bacteria 5281907
813 2601661559 2600255290 Bacteria 5282218
814 2601665820 2600255291 Bacteria 5217298
815 2601690402 2600255296 Bacteria 5784754
816 2601698678 2600255298 Bacteria 5215185
817 2601703829 2600255299 Bacteria 5218662
818 2601709388 2600255300 Bacteria 5287774
819 2601712923 2600255301 Bacteria 5280532
820 2601718359 2600255302 Bacteria 5288235
821 2601723765 2600255303 Bacteria 5219315
822 2601728646 2600255304 Bacteria 5283973
823 2601733307 2600255305 Bacteria 5282329
824 2601737581 2600255306 Bacteria 5281613
825 2601744419 2600255307 Bacteria 5439064
826 2601752900 2600255309 Bacteria 5431045
827 2601773015 2600255313 Bacteria 6842543
828 2602019386 2600255392 Bacteria 5437392
829 2603663355 2602042052 Bacteria 5215873
830 2603668557 2602042053 Bacteria 5214361
831 2603840851 2602042103 Bacteria 5284714
832 2603846162 2602042104 Bacteria 5281639
833 2603850998 2602042105 Bacteria 5282303
834 2603856304 2602042106 Bacteria 5282744
835 2603869109 2602042109 Bacteria 5152801
836 2603873883 2602042110 Bacteria 5283285
837 2603879048 2602042111 Bacteria 5212080
838 2606051063 2603880178 Bacteria 5283018
839 2606072980 2603880184 Bacteria 5217896
840 2606148512 2603880202 Bacteria 5284684
841 2606178955 2603880211 Bacteria 5284226
842 2621300196 2619619299 Bacteria 6649820
843 2624491488 2623620446 Bacteria 6500345
844 2637227357 2636415599 Bacteria 5718434
845 2643871068 2643221571 Bacteria 6228673
846 2644190361 2643221633 Bacteria 6733554
847 2644270631 2643221647 Bacteria 10741251
848 2644284920 2643221650 Bacteria 7029547
849 2644622519 2643221713 Bacteria 6554480
850 2644630566 2643221714 Bacteria 9015452
851 2644716823 2643221731 Bacteria 5623886
852 2644725626 2643221732 Bacteria 5756404
853 2652547173 2651869719 Bacteria 6047974
854 2656276696 2654587920 Bacteria 5475511
855 2671094656 2667528170 Bacteria 6786960
856 2671095029 2667528171 Bacteria 6900659
857 2671124822 2667528176 Bacteria 6724917
858 2671770114 2671180172 Bacteria 6495783
859 2676409336 2675903046 Bacteria 5451247
860 2676746865 2675903129 Bacteria 7964495
861 2677901165 2675903420 Bacteria 6247433
862 2678263884 2675903515 Bacteria 6580491
863 2689447413 2687453601 Bacteria 5546041
864 2723249072 2721755607 Bacteria 5841722
865 2738675108 2738541265 Bacteria 6594665
866 2738753398 2738541282 Bacteria 6593925
867 2738810539 2738541294 Bacteria 6925949
868 2738862310 2738541303 Bacteria 6591772
869 2738897899 2738541309 Bacteria 6926455
870 2739257986 2738543015 Bacteria 6750701
871 2743737039 2740892503 Bacteria 6855563
872 2745004337 2744054620 Bacteria 6551379
873 2772441221 2772190666 Bacteria 5117644
874 2774123123 2773857670 Bacteria 6407454
875 2774130783 2773857672 Bacteria 4993178
876 2777021725 2775507074 Bacteria 5532402
877 2784315471 2784132072 Bacteria 6596533
878 2785373751 2784746768 Bacteria 10036182
879 2786673650 2786546132 Bacteria 10419719
880 2794594726 2791355520 Bacteria 5948615
881 2805348055 2802429420 Bacteria 845479
882 2807180278 2806310673 Bacteria 4801221
883 2808854893 2808606361 Bacteria 6136259
884 2808926325 2808606376 Bacteria 6248667
885 2808932738 2808606377 Bacteria 6646337
886 2808934912 2808606378 Bacteria 6177535
887 2808948426 2808606380 Bacteria 6248705
888 2808954872 2808606381 Bacteria 6646461
889 2808963309 2808606383 Bacteria 6138645
890 2808978542 2808606385 Bacteria 6711065
891 2808993931 2808606388 Bacteria 6706662
892 2808998286 2808606389 Bacteria 6138126
893 2812353775 2811994879 Bacteria 9313447
894 2817260735 2816332253 Bacteria 6764532
895 2817278373 2816332256 Bacteria 6891714
896 2817456341 2816332286 Bacteria 6853759
897 2817491541 2816332298 Bacteria 6852809
898 2819637149 2818991452 Bacteria 8442785
899 2819705616 2818991464 Bacteria 6907494
900 2819710244 2818991465 Bacteria 5388835
901 2825657329 2825651385 Bacteria 6715909
902 2826585158 2826581358 Bacteria 5963467
903 2834030243 2834028612 Bacteria 6354979
904 2842687884 2842682962 Bacteria 5589973
905 2842818692 2842815866 Bacteria 5947510
906 2842831856 2842826826 Bacteria 5974129
907 2842840203 2842837860 Bacteria 6066181
908 2842853643 2842849001 Bacteria 5924277
909 2842858382 2842854478 Bacteria 6143501
910 2842886689 2842882022 Bacteria 6158489
911 2844529527 2844528606 Bacteria 4733806
912 2844670102 2844665904 Bacteria 6817974
913 2849140083 2849139964 Bacteria 5613304
914 2852617428 2852612431 Bacteria 6885235
915 2852672453 2852667396 Bacteria 6885555
916 2857604832 2857604169 Bacteria 5111450
917 2860342510 2860339153 Bacteria 6846989
918 2860870375 2860867994 Bacteria 5645326
919 2863427684 2863421361 Bacteria 7300805
920 2865014487 2865014394 Bacteria 4764573
921 2869556846 2869551831 Bacteria 5474685
922 2870071792 2870068957 Bacteria 8925310
923 2876604940 2876601092 Bacteria 5114497
924 2888371346 2888366609 Bacteria 5155009
925 2888375985 2888373701 Bacteria 5098052
926 2904515695 2904513164 Bacteria 5476410
927 2904525592 2904524088 Bacteria 5887454
928 2904571171 2904564687 Bacteria 7609577
929 2904578264 2904571731 Bacteria 7608790
930 2908450188 2908446538 Bacteria 6829095
931 2908665575 2908665501 Bacteria 3678115
932 2912716727 2912715099 Bacteria 9460473
933 2913039290 2913036834 Bacteria 6704877
934 2917073412 2917070673 Bacteria 6868303
935 2917833657 2917832318 Bacteria 5346010
936 2919113678 2919108558 Bacteria 5897419
937 2919145828 2919143609 Bacteria 6219228
938 2919456640 2919456309 Bacteria 6586567
939 2919485290 2919481497 Bacteria 6907839
940 2919517757 2919517244 Bacteria 5858162
941 2919700953 2919697872 Bacteria 6553725
942 2919722113 2919720352 Bacteria 5986006
943 2923156071 2923153595 Bacteria 6870622
944 2923586583 2923586266 Bacteria 6565975
945 2928094114 2928093941 Bacteria 5965005
946 2928163790 2928157003 Bacteria 7522202
947 2928164788 2928163908 Bacteria 7561269
948 2928172968 2928170801 Bacteria 8785406
949 2928540942 2928536128 Bacteria 7657547
950 2929007365 2929004312 Bacteria 5678476
951 2929147883 2929144301 Bacteria 6622272
952 2929192836 2929189879 Bacteria 5930554
953 2931369747 2931369376 Bacteria 6847892
954 2931394360 2931390751 Bacteria 6273349
955 2931402594 2931396565 Bacteria 7251677
956 2932409346 2932406140 Bacteria 5134491
957 2935357590 2935353572 Unclassified 6955622
958 2937968889 2937967321 Bacteria 5094075
959 2939581149 2939577877 Bacteria 5132791
960 2939605413 2939602548 Bacteria 4950493
961 2945933876 2945928738 Bacteria 6053221
962 2945956043 2945951305 Bacteria 4918162
963 2945964223 2945961074 Bacteria 7342064
964 2946010307 2946006987 Bacteria 6705746
965 2946030624 2946027586 Bacteria 6049274
966 2946071922 2946064051 Bacteria 8957905
967 2947232812 2947224130 Bacteria 9938529
968 2947237420 2947233263 Bacteria 6439278
969 2954691508 2954682443 Bacteria 9862841
970 2954692981 2954691527 Bacteria 10720516
971 2954708054 2954701450 Bacteria 10834262
972 2954774328 2954773129 Bacteria 3741715
973 2960323422 2960319331 Bacteria 5502575
974 2960380275 2960375949 Bacteria 5361395
975 2969084395 2969079654 Bacteria 5439582
976 2971825868 2971820967 Bacteria 5823634
977 2974298363 2974298342 Bacteria 4840922
978 2981996355 2981990288 Bacteria 7590678
979 2984289953 2984286254 Bacteria 6702062
980 2984504259 2984499530 Bacteria 5020881
981 2984561510 2984559226 Bacteria 5683096
982 2984599576 2984595703 Bacteria 5682994
983 2988729465 2988728565 Bacteria 6124362
984 3007401601 3007395558 Bacteria 6755444
985 3007869745 3007866637 Bacteria 5899198
986 637319930 637000220 Bacteria 7074893
987 640940224 640753048 Bacteria 5495657
988 641334326 641228493 Bacteria 3999591
989 642417901 641736154 Bacteria 7689995
990 643391940 643348555 Bacteria 3914947
991 8004593989 8004592986 Bacteria 5122074
992 8015395168 8015394850 Bacteria 5064660
993 8015690288 8015687852 Bacteria 6613826
994 8018845720 8018845410 Bacteria 8933938
995 8019500276 8019499862 Bacteria 5169538
996 8019772534 8019769354 Bacteria 6924660
997 8019778381 8019775933 Bacteria 6858656
998 8020813692 8020807995 Bacteria 6801506
999 8020942290 8020938398 Bacteria 7472757
1000 8020947524 8020945358 Bacteria 8467355
1001 8020958147 8020953355 Bacteria 7439080
1002 8021124138 8021120328 Bacteria 8782274
1003 8022920819 8022914991 Bacteria 5584517
1004 8022952983 8022948649 Bacteria 5366783
1005 8022953876 8022948649 Bacteria 5366783
1006 8033688458 8033684223 Bacteria 6906479
1007 8039104021 8039098773 Bacteria 6602928
1008 8040171620 8040167225 Bacteria 6542727
1009 8040177821 8040173305 Bacteria 6827067
1010 8052177971 8052174270 Bacteria 3881265
1011 8054286275 8054285046 Bacteria 6919322
1012 8054348234 8054347763 Bacteria 5901107
1013 8054505802 8054503363 Bacteria 6101651
1014 8055773417 8055770955 Bacteria 6827675
1015 8055820415 8055817908 Bacteria 6609162
1016 8056055757 8056054917 Bacteria 5736694
1017 8056063603 8056060235 Bacteria 7259403
1018 8056134368 8056131705 Bacteria 6107031
1019 8056145535 8056143049 Bacteria 6307666
1020 8056149811 8056148874 Bacteria 6479865
1021 8056156911 8056155041 Bacteria 6486948
1022 8056166485 8056161164 Bacteria 6106669
1023 8057800880 8057798959 Bacteria 6713499
1024 Ga0495682_0000020
1025 MRS2a_Contig_11
1026 MRS2a_Contig_9428
1027 JGI24739J22299_10011364
1028 JGI24739J22299_10036641
1029 JGI25162J39368_1000014
1030 JGI25162J39368_1000060
1031 JGI25163J39215_1000784
1032 JGI25163J39215_1000792
1033 JGI25164J39214_1000037
1034 JGI25164J39214_1000059
1035 JGI25151J46595_10022352
1036 JGI25165J46597_1000027
1037 JGI25165J46597_1000118
1038 rootH2_10002244
1039 rootH2_10154959
1040 rootL2_10107293
1041 Ga0055538_1000158
1042 Ga0055539_1000208
1043 Ga0055533_1000209
1044 Ga0055532_1000214
1045 Ga0055532_1001585
1046 Ga0055532_1003700
1047 Ga0055525_1000287
1048 Ga0055529_1000493
1049 Ga0055536_1000046
1050 Ga0055536_1000128
1051 Ga0055528_1001894
1052 Ga0055528_1005086
1053 Ga0055530_10000133
1054 Ga0055530_10000136
1055 Ga0055530_10000373
1056 Ga0055540_1000070
1057 Ga0055540_1000168
1058 Ga0055540_1000303
1059 Ga0055531_10010863
1060 Ga0055541_1000067
1061 Ga0058692_1000041
1062 Ga0058692_1001554
1063 Ga0065703_1018788
1064 Ga0065714_10000651
1065 Ga0065714_10002705
1066 Ga0065714_10003341
1067 Ga0065714_10023470
1068 Ga0065714_10064673
1069 Ga0065714_10065808
1070 Ga0065704_10002589
1071 Ga0065704_10120447
1072 Ga0065712_10117901
1073 Ga0070658_10030936
1074 Ga0070670_100007505
1075 Ga0070670_100041367
1076 Ga0070660_100000080
1077 Ga0070661_100000399
1078 Ga0070669_100003105
1079 Ga0070659_100000068
1080 Ga0070714_100007884
1081 Ga0070708_100019352
1082 Ga0070708_100039180
1083 Ga0070708_100145467
1084 Ga0070663_100001611
1085 Ga0070662_100001000
1086 Ga0070706_100032802
1087 Ga0070706_100305455
1088 Ga0070699_100006669
1089 Ga0070664_100000824
1090 Ga0068854_100011802
1091 Ga0068852_100022859
1092 Ga0068851_10000400
1093 Ga0081455_10135792
1094 Ga0075368_10021479
1095 Ga0075363_100020018
1096 Ga0075363_100052756
1097 Ga0075367_10001716
1098 Ga0079104_1000004
1099 Ga0079104_1000823
1100 Ga0079104_1002497
1101 Ga0079104_1004114
1102 Ga0099826_10006487
1103 Ga0099794_10037220
1104 Ga0105251_10000089
1105 Ga0105251_10000230
1106 Ga0105251_10000233
1107 Ga0105251_10000302
1108 Ga0105251_10000842
1109 Ga0105251_10000924
1110 Ga0105251_10003948
1111 Ga0105251_10010267
1112 Ga0105251_10014142
1113 Ga0105251_10014525
1114 Ga0105251_10029298
1115 Ga0105251_10030780
1116 Ga0105251_10048242
1117 Ga0105244_10000564
1118 Ga0105244_10000658
1119 Ga0105244_10000989
1120 Ga0105244_10001094
1121 Ga0105244_10001338
1122 Ga0105244_10002323
1123 Ga0105244_10004498
1124 Ga0105244_10024564
1125 Ga0105244_10027027
1126 Ga0105244_10057902
1127 Ga0105244_10061629
1128 Ga0105244_10062378
1129 Ga0105244_10078934
1130 Ga0105244_10084125
1131 Ga0105244_10097524
1132 Ga0105250_10000093
1133 Ga0105250_10000370
1134 Ga0105250_10000480
1135 Ga0105250_10001079
1136 Ga0105250_10002704
1137 Ga0105250_10003415
1138 Ga0105250_10009314
1139 Ga0105250_10015252
1140 Ga0105250_10016876
1141 Ga0105245_10177015
1142 Ga0105247_10000396
1143 Ga0114129_10040552
1144 Ga0105243_10000045
1145 Ga0105241_10000013
1146 Ga0105242_10050494
1147 Ga0105237_10001264
1148 Ga0105238_10001781
1149 Ga0105246_10012437
1150 Ga0105246_10013729
1151 Ga0105246_10016141
1152 Ga0105246_10019801
1153 Ga0105246_10081297
1154 Ga0157373_10004744
1155 Ga0157373_10004812
1156 Ga0157373_10033938
1157 Ga0157373_10033979
1158 Ga0157371_10000726
1159 Ga0157371_10009826
1160 Ga0157371_10011902
1161 Ga0157371_10012245
1162 Ga0157371_10025604
1163 Ga0157371_10089884
1164 Ga0157370_10028217
1165 Ga0157370_10043959
1166 Ga0157370_10205620
1167 Ga0157370_10360854
1168 Ga0157370_10536904
1169 Ga0157369_10006024
1170 Ga0157369_10012687
1171 Ga0157369_10029566
1172 Ga0157369_10037630
1173 Ga0163162_10096668
1174 Ga0163162_10196954
1175 Ga0157372_10008819
1176 Ga0157372_10047419
1177 Ga0157372_10050110
1178 Ga0157372_10198433
1179 Ga0157375_10008636
1180 Ga0157375_10015239
1181 Ga0182008_10003483
1182 Ga0182008_10004004
1183 Ga0182008_10004201
1184 Ga0182008_10045535
1185 Ga0182006_1001860
1186 Ga0182006_1005531
1187 Ga0182006_1033063
1188 Ga0182006_1036527
1189 Ga0182006_1080660
1190 Ga0182007_10000177
1191 Ga0182005_1003224
1192 Ga0183367_1021
1193 Ga0163161_10000028
1194 Ga0163161_10154678
1195 Ga0163161_10186014
1196 Ga0163161_10278142
1197 Ga0163161_10360184
1198 Ga0213872_10110645
1199 Ga0209435_101168
1200 Ga0209760_100023
1201 Ga0209760_100025
1202 Ga0209784_100058
1203 Ga0209566_100045
1204 Ga0209566_100313
1205 Ga0209674_100096
1206 Ga0209674_101130
1207 Ga0209672_100019
1208 Ga0209672_100065
1209 Ga0209147_100026
1210 Ga0209147_100056
1211 Ga0209147_100180
1212 Ga0209147_100228
1213 Ga0209147_102004
1214 Ga0209563_100064
1215 Ga0207427_100003
1216 Ga0207427_100018
1217 Ga0209437_100002
1218 Ga0209437_100031
1219 Ga0209437_100032
1220 Ga0209437_104633
1221 Ga0209258_100031
1222 Ga0209258_100079
1223 Ga0209258_100446
1224 Ga0209646_1000147
1225 Ga0209677_100053
1226 Ga0209148_1000027
1227 Ga0209759_1002071
1228 Ga0209759_1021692
1229 Ga0209233_1000004
1230 Ga0209233_1000012
1231 Ga0209455_1000058
1232 Ga0209673_1000420
1233 Ga0209673_1003279
1234 Ga0209676_1000003
1235 Ga0209676_1000055
1236 Ga0209676_1001524
1237 Ga0209025_1013242
1238 Ga0209564_1011389
1239 Ga0209050_1000004
1240 Ga0209050_1000043
1241 Ga0209050_1000231
1242 Ga0209051_1000030
1243 Ga0209051_1000052
1244 Ga0209051_1000165
1245 Ga0209257_1000767
1246 Ga0207656_10000382
1247 Ga0207696_1000041
1248 Ga0207696_1000049
1249 Ga0207696_1000068
1250 Ga0207696_1000076
1251 Ga0207696_1000078
1252 Ga0207696_1000628
1253 Ga0207696_1001235
1254 Ga0207696_1023979
1255 Ga0207696_1025493
1256 Ga0207655_1000030
1257 Ga0207655_1000085
1258 Ga0207655_1000106
1259 Ga0207655_1000137
1260 Ga0207655_1000141
1261 Ga0207655_1007004
1262 Ga0207655_1007620
1263 Ga0207655_1009069
1264 Ga0207655_1012405
1265 Ga0207655_1012654
1266 Ga0207655_1019266
1267 Ga0207655_1029070
1268 Ga0207713_1000010
1269 Ga0207713_1000011
1270 Ga0207713_1000044
1271 Ga0207713_1000062
1272 Ga0207713_1000127
1273 Ga0207713_1000265
1274 Ga0207713_1000850
1275 Ga0207713_1001279
1276 Ga0207713_1002699
1277 Ga0207713_1003516
1278 Ga0207713_1020770
1279 Ga0207713_1022742
1280 Ga0207713_1035899
1281 Ga0207713_1043414
1282 Ga0207713_1060405
1283 Ga0207713_1060765
1284 Ga0207692_10084300
1285 Ga0207692_10150188
1286 Ga0207710_10000145
1287 Ga0207647_10006893
1288 Ga0207647_10026170
1289 Ga0207699_10128166
1290 Ga0207705_10041564
1291 Ga0207684_10034820
1292 Ga0207654_10000016
1293 Ga0207695_10001626
1294 Ga0207671_10000394
1295 Ga0207663_10119766
1296 Ga0207663_10125752
1297 Ga0207657_10000494
1298 Ga0207649_10000251
1299 Ga0207681_10003619
1300 Ga0207694_10029030
1301 Ga0207650_10000384
1302 Ga0207650_10010667
1303 Ga0207664_10026885
1304 Ga0207690_10000026
1305 Ga0207706_10002791
1306 Ga0207686_10031618
1307 Ga0207709_10000011
1308 Ga0207709_10011361
1309 Ga0207679_10000016
1310 Ga0207667_10149635
1311 Ga0207668_10006823
1312 Ga0207640_10028871
1313 Ga0207678_10001257
1314 Ga0207702_10116828
1315 Ga0207683_10227559
1316 Ga0207698_10016462
1317 Ga0209281_1000005
1318 Ga0209281_1000009
1319 Ga0209281_1000107
1320 Ga0209281_1008151
1321 Ga0209371_1000036
1322 Ga0209371_1000858
1323 Ga0209371_1001177
1324 Ga0209371_1005345
1325 Ga0209984_1003582
1326 Ga0209282_1101036
1327 Ga0209588_1005005
1328 Ga0209813_10006743
1329 Ga0209974_10041124
1330 Ga0207428_10001057
1331 Ga0307515_10026799
1332 Ga0268256_1000040
1333 Ga0268256_1000477
1334 Ga0268256_1001008
1335 Ga0268256_1001594
1336 Ga0307511_10002260
1337 Ga0307512_10071665
1338 Ga0307513_10000099
1339 Ga0307513_10225720
1340 Ga0307509_10009838
1341 Ga0307408_100003833
1342 Ga0307408_100009042
1343 Ga0307508_10033599
1344 Ga0307514_10021075
1345 Ga0307514_10137524
1346 Ga0307516_10042249
1347 Ga0307405_10002090
1348 Ga0307405_10063581
1349 Ga0307413_10033700
1350 Ga0307518_10167657
1351 Ga0307407_10031947
1352 Ga0307412_10001950
1353 Ga0307412_10014413
1354 Ga0307409_100181830
1355 Ga0307414_10036060
1356 Ga0307414_10328011
1357 Ga0307411_10028873
1358 Ga0307507_10116832
1359 Ga0307507_10212507
1360 Ga0307510_10034138
1361 Ga0307510_10181433
1362 Ga0373928_0026032
1363 Ga0373949_0008916
1364 Ga0373932_0005473
1365 Ga0373941_0002472
1366 Ga0373931_0067601
1367 Ga0436365_0778140
1368 Ga0436361_0048296
1369 Ga0436361_0401522
1370 Ga0439438_004505
1371 Ga0439438_005931
1372 Ga0439438_010402
1373 Ga0439438_014038
1374 Ga0439438_019883
1375 Ga0439447_019181
1376 Ga0439466_0000270
1377 Ga0439466_0003546
1378 Ga0439466_0039569
1379 Ga0439466_0044976
1380 Ga0439466_0045899
1381 Ga0451802_0529951
1382 Ga0451853_1210111
1383 Ga0439433_0002805
1384 Ga0439448_0022166
1385 Ga0439432_001555
1386 Ga0439432_002562
1387 Ga0439432_005338
1388 Ga0439432_043073
1389 Ga0439449_0000216
1390 Ga0439449_0000368
1391 Ga0439449_0008568
1392 Ga0439449_0018834
1393 Ga0439451_010560
1394 Ga0439456_023049
1395 Ga0439457_000640
1396 Ga0439457_008039
1397 Ga0439463_001049
1398 Ga0450907_000010
1399 Ga0450907_000818
1400 Ga0450909_002314
1401 Ga0439464_0006455
1402 Ga0466969_0008961
1403 Ga0466969_0009317
1404 Ga0466969_0009870
1405 Ga0466969_0061355
1406 Ga0466972_0009451
1407 Ga0466972_0043806
1408 Ga0466965_0001653
1409 Ga0466965_0002532
1410 Ga0466966_0000885
1411 Ga0466966_0099599
1412 Ga0466966_0124791
1413 Ga0466961_0000876
1414 Ga0466961_0027290
1415 Ga0466961_0038877
1416 Ga0466963_0001810
1417 Ga0466963_0214754
1418 Ga0466964_0004446
1419 Ga0466964_0091067
1420 Ga0466971_0000701
1421 Ga0466971_0036236
1422 Ga0466970_0000432
1423 Ga0466957_0000574
1424 Ga0466957_0141141
1425 Ga0466959_0002628
1426 Ga0466959_0018725
1427 Ga0466959_0076966
1428 Ga0466958_0005448
1429 Ga0466967_0000976
1430 Ga0466967_0267087
1431 Ga0495617_000054
1432 Ga0495617_000144
1433 Ga0495617_008090
1434 Ga0495617_020775
1435 Ga0495627_000100
1436 Ga0495627_000308
1437 Ga0495627_002826
1438 Ga0495592_0000800
1439 Ga0495603_0001986
1440 Ga0495603_0021119
1441 Ga0495603_0021860
1442 Ga0495603_0041783
1443 Ga0495590_0001206
1444 Ga0495590_0004191
1445 Ga0495591_000315
1446 Ga0495591_001261
1447 Ga0495591_023221
1448 Ga0495629_0022330
1449 Ga0495629_0154682
1450 Ga0495651_0021970
1451 Ga0495653_0001170
1452 Ga0495653_0037631
1453 Ga0495650_0000881
1454 Ga0495650_0005496
1455 Ga0495650_0060045
1456 Ga0495580_0025815
1457 Ga0495580_0067123
1458 Ga0495605_0000794
1459 Ga0495605_0001665
1460 Ga0495605_0010840
1461 Ga0495605_0039013
1462 Ga0495639_0000032
1463 Ga0495662_0002045
1464 Ga0495664_0154183
1465 Ga0495584_0000409
1466 Ga0495584_0000547
1467 Ga0495584_0001764
1468 Ga0495584_0002662
1469 Ga0495585_0004329
1470 Ga0495585_0018164
1471 Ga0495585_0075797
1472 Ga0495585_0096331
1473 Ga0495594_0050018
1474 Ga0495607_0000185
1475 Ga0495607_0000290
1476 Ga0495607_0000617
1477 Ga0495607_0018916
1478 Ga0495607_0026414
1479 Ga0495607_0048900
1480 Ga0495583_0003663
1481 Ga0495583_0011288
1482 Ga0495583_0021045
1483 Ga0495606_0000633
1484 Ga0495606_0003155
1485 Ga0495606_0025714
1486 Ga0495608_0004232
1487 Ga0495610_0002898
1488 Ga0495610_0039563
1489 Ga0495616_0000226
1490 Ga0495616_0000661
1491 Ga0495616_0008245
1492 Ga0495616_0027410
1493 Ga0495616_0032013
1494 Ga0495618_0224363
1495 Ga0495620_0001031
1496 Ga0495620_0002862
1497 Ga0495620_0056787
1498 Ga0495628_0046540
1499 Ga0495630_0047238
1500 Ga0495632_0000754
1501 Ga0495632_0001740
1502 Ga0495637_0007143
1503 Ga0495637_0007481
1504 Ga0495637_0076198
1505 Ga0495643_0031124
1506 Ga0495643_0051205
1507 Ga0495643_0066575
1508 Ga0495648_0001506
1509 Ga0495648_0002095
1510 Ga0495648_0005959
1511 Ga0495648_0035448
1512 Ga0495648_0057823
1513 Ga0495666_0010570
1514 Ga0495642_0000316
1515 Ga0495642_0004676
1516 Ga0495652_0067382
1517 Ga0495654_0000288
1518 Ga0495654_0000306
1519 Ga0495654_0000616
1520 Ga0495654_0002069
1521 Ga0495654_0011451
1522 Ga0495654_0048471
1523 Ga0495665_0005951
1524 Ga0495640_0007888
1525 Ga0495640_0076155
1526 Ga0495586_0004174
1527 Ga0495587_0004867
1528 Ga0495609_0007500
1529 Ga0495609_0008213
1530 Ga0495609_0043234
1531 Ga0495597_0018574
1532 Ga0495597_0047574
1533 Ga0495622_0002772
1534 Ga0495622_0007970
1535 Ga0495622_0008609
1536 Ga0495633_0124689
1537 Ga0495667_0038294
1538 Ga0495656_0001994
1539 Ga0495634_0000025
1540 Ga0495634_0191337
1541 Ga0495611_0021347
1542 Ga0495625_0000847
1543 Ga0495625_0030964
1544 Ga0495635_0032535
1545 Ga0495635_0034169
1546 Ga0495635_0083363
1547 Ga0495659_0001160
1548 Ga0495659_0003525
1549 Ga0495661_0000028
1550 Ga0495661_0000083
1551 Ga0495661_0004052
1552 Ga0495588_0012539
1553 Ga0495657_0024393
1554 Ga0495599_0147771
1555 Ga0495623_0063191
1556 Ga0495623_0135382
1557 Ga0495646_0074166
1558 Ga0495646_0092979
1559 Ga0495669_0001097
1560 Ga0495624_0016369
1561 Ga0495670_0013939
1562 Ga0495671_0000295
1563 Ga0495671_0001060
1564 Ga0495671_0031802
1565 Ga0495649_0000013
1566 Ga0495649_0000909
1567 Ga0495649_0005272
1568 Ga0495649_0066204
1569 Ga0495589_0000010
1570 Ga0495589_0000141
1571 Ga0495589_0050688
1572 Ga0495600_0076365
1573 Ga0495600_0231613
1574 Ga0495660_0043368
1575 Ga0495604_0000491
1576 Ga0495604_0002087
1577 Ga0495636_0036577
1578 Ga0495636_0042658
1579 Ga0495674_0013289
1580 Ga0495672_0000289
1581 Ga0495672_0001978
1582 Ga0495672_0006656
1583 Ga0495672_0016761
1584 Ga0495672_0056286
1585 Ga0495676_0031256
1586 Ga0495676_0046429
1587 Ga0495680_0010178
1588 Ga0495683_0005005
1589 Ga0495683_0006189
1590 Ga0495683_0087446
1591 Ga0495683_0139904
1592 Ga0495687_000715
1593 Ga0495687_004143
1594 Ga0495687_008394
1595 Ga0495687_011525
1596 Ga0495687_038970
1597 Ga0495675_0011462
1598 Ga0495679_000711
1599 Ga0495679_005752
1600 Ga0495679_005912
1601 Ga0495679_007398
1602 Ga0495679_014366
1603 Ga0495685_003608
1604 Ga0495685_007685
1605 Ga0495673_0000190
1606 Ga0495673_0000833
1607 Ga0495673_0002842
1608 Ga0495673_0027701
1609 Ga0495681_0000027
1610 Ga0495681_0000237
1611 Ga0495684_0080737
1612 Ga0495686_0135393
1613 Ga0495593_0006494
1614 Ga0495602_0017638
1615 Ga0495614_0020018
1616 Ga0495614_0020284
1617 Ga0495626_0000352
1618 Ga0495626_0005473
1619 Ga0495626_0129223
1620 Ga0496100_0000516
1621 Ga0496100_0051117
1622 Ga0496101_0000023
1623 Ga0496101_0004518
1624 Ga0496102_0000038
1625 Ga0496102_0007086
1626 Ga0496102_0026298
1627 Ga0496103_0005594
1628 Ga0496103_0096252
1629 Ga0496104_0001353
1630 Ga0496105_0000207
1631 Ga0496105_0026938
1632 Ga0496106_0002123
1633 Ga0496107_0002440
1634 Ga0496108_0001726
1635 Ga0496109_0002642
1636 Ga0496109_0221970
1637 Ga0496110_0052572
1638 Ga0496111_0000662
1639 Ga0496111_0125801
1640 Ga0496111_0508339
1641 Ga0496112_0002268
1642 Ga0496112_0060524
1643 Ga0496113_0011643
1644 Ga0496113_0169763
1645 Ga0496115_0028447
1646 Ga0496116_0000077
1647 Ga0496116_0000221
1648 Ga0496116_0000984
1649 Ga0496116_0001107
1650 Ga0496116_0003444
1651 Ga0496116_0047963
1652 Ga0496116_0107552
1653 Ga0496117_0000017
1654 Ga0496117_0000219
1655 Ga0496117_0001257
1656 Ga0496117_0001570
1657 Ga0496117_0002611
1658 Ga0496117_0031730
1659 Ga0496117_0032512
1660 Ga0496117_0036374
1661 Ga0496117_0092248
1662 Ga0496117_0135562
1663 Ga0496118_0000018
1664 Ga0496118_0000301
1665 Ga0496118_0008371
1666 Ga0496118_0024337
1667 Ga0496118_0038172
1668 Ga0496118_0051169
1669 Ga0496118_0067827
1670 Ga0496118_0102657
1671 Ga0496118_0103732
1672 Ga0496118_0110937
1673 Ga0496119_0000005
1674 Ga0496119_0001451
1675 Ga0496119_0001653
1676 Ga0496119_0002190
1677 Ga0496119_0006142
1678 Ga0496119_0012321
1679 Ga0496119_0014815
1680 Ga0496119_0025426
1681 Ga0496119_0067699
1682 Ga0496120_0000005
1683 Ga0496120_0000010
1684 Ga0496120_0000028
1685 Ga0496120_0000112
1686 Ga0496120_0000139
1687 Ga0496120_0001588
1688 Ga0496120_0006263
1689 Ga0496121_0000055
1690 Ga0496121_0000307
1691 Ga0496121_0004753
1692 Ga0496121_0007545
1693 Ga0496122_0001299
1694 Ga0496122_0009382
1695 Ga0496122_0011679
1696 Ga0496122_0025572
1697 Ga0496123_0001034
1698 Ga0496123_0004814
1699 Ga0496123_0017123
1700 Ga0496123_0078198
1701 Ga0496124_0000100
1702 Ga0496124_0000158
1703 Ga0496124_0003813
1704 Ga0496124_0003909
1705 Ga0496124_0004394
1706 Ga0496124_0007113
1707 Ga0496124_0029540
1708 Ga0496124_0098283
1709 Ga0496124_0172450
1710 Ga0496125_0002257
1711 Ga0496125_0003672
1712 Ga0496125_0011347
1713 Ga0496125_0012606
1714 Ga0496125_0138322
1715 Ga0496126_0002392
1716 Ga0496126_0029144
1717 Ga0496126_0035768
1718 Ga0496126_0057901
1719 Ga0496126_0167995
1720 Ga0501305_009082
1721 Ga0495678_000724
1722 Ga0495678_002190
1723 Ga0495678_006568
1724 Ga0495678_007868
1725 Ga0495678_012807
1726 Ga0495678_033179
1727 Ga0495682_0001677
1728 Ga0495682_0008178
1729 Ga0501312_000335
1730 Ga0501335_000125
1731 Ga0501336_000511
1732 Ga0501038_0104816
1733 nmdc:mga06z11_1188_c1
1734 nmdc:mga04h51_1659_c1
1735 nmdc:mga05p37_382408_c1
1736 Ga0495601_0008947
1737 Ga0500578_0128023
1738 Ga0500618_007443
1739 Ga0500573_0091310
1740 Ga0466962_0002211
1741 2506580856
1742 2506585995
1743 2508854665
1744 2510284536
1745 2510295986
1746 2510311914
1747 2511253802
1748 2511255458
1749 2511268221
1750 2511272546
1751 2511290773
1752 2511313847
1753 2511323318
1754 2511327779
1755 2511343835
1756 2511358631
1757 2511362414
1758 2511380672
1759 2511437281
1760 2511824369
1761 2512328379
1762 2512731739
1763 2519458511
1764 2555262202
1765 2555669599
1766 2583792851
1767 2585292917
1768 2585320302
1769 2597857604
1770 2597864244
1771 2597869501
1772 2599330607
1773 2599353404
1774 2599363797
1775 2599370117
1776 2599372424
1777 2599378512
1778 2599384111
1779 2599391283
1780 2599399233
1781 2599407528
1782 2599412358
1783 2599453666
1784 2599460238
1785 2599470630
1786 2599484461
1787 2599489259
1788 2599502202
1789 2599509112
1790 2599513725
1791 2599518905
1792 2599616067
1793 2599737435
1794 2599748704
1795 2599772658
1796 2599802267
1797 2599881042
1798 2599885068
1799 2599892782
1800 2599899793
1801 2599932738
1802 2599945254
1803 2599949676
1804 2599955394
1805 2599960884
1806 2599965489
1807 2599976604
1808 2599984429
1809 2599990400
1810 2599992829
1811 2600001658
1812 2600008912
1813 2600010651
1814 2600018378
1815 2600023308
1816 2600028221
1817 2600034158
1818 2600040329
1819 2600049238
1820 2600052898
1821 2600056979
1822 2600066806
1823 2600074058
1824 2600077535
1825 2600210615
1826 2600212847
1827 2600357330
1828 2600366910
1829 2601526248
1830 2601530219
1831 2601617177
1832 2601622136
1833 2601645681
1834 2601649933
1835 2601655223
1836 2601661559
1837 2601665820
1838 2601690402
1839 2601698678
1840 2601703829
1841 2601709388
1842 2601712923
1843 2601718359
1844 2601723765
1845 2601728646
1846 2601733307
1847 2601737581
1848 2601744419
1849 2601752900
1850 2601773015
1851 2602019386
1852 2603663355
1853 2603668557
1854 2603840851
1855 2603846162
1856 2603850998
1857 2603856304
1858 2603869109
1859 2603873883
1860 2603879048
1861 2606051063
1862 2606072980
1863 2606148512
1864 2606178955
1865 2621300196
1866 2624491488
1867 2637227357
1868 2643871068
1869 2644190361
1870 2644270631
1871 2644284920
1872 2644622519
1873 2644630566
1874 2644716823
1875 2644725626
1876 2652547173
1877 2656276696
1878 2671094656
1879 2671095029
1880 2671124822
1881 2671770114
1882 2676409336
1883 2676746865
1884 2677901165
1885 2678263884
1886 2689447413
1887 2723249072
1888 2738675108
1889 2738753398
1890 2738810539
1891 2738862310
1892 2738897899
1893 2739257986
1894 2743737039
1895 2745004337
1896 2772441221
1897 2774123123
1898 2774130783
1899 2777021725
1900 2784315471
1901 2785373751
1902 2786673650
1903 2794594726
1904 2805348055
1905 2807180278
1906 2808854893
1907 2808926325
1908 2808932738
1909 2808934912
1910 2808948426
1911 2808954872
1912 2808963309
1913 2808978542
1914 2808993931
1915 2808998286
1916 2812353775
1917 2817260735
1918 2817278373
1919 2817456341
1920 2817491541
1921 2819637149
1922 2819705616
1923 2819710244
1924 2825657329
1925 2826585158
1926 2834030243
1927 2842687884
1928 2842818692
1929 2842831856
1930 2842840203
1931 2842853643
1932 2842858382
1933 2842886689
1934 2844529527
1935 2844670102
1936 2849140083
1937 2852617428
1938 2852672453
1939 2857604832
1940 2860342510
1941 2860870375
1942 2863427684
1943 2865014487
1944 2869556846
1945 2870071792
1946 2876604940
1947 2888371346
1948 2888375985
1949 2904515695
1950 2904525592
1951 2904571171
1952 2904578264
1953 2908450188
1954 2908665575
1955 2912716727
1956 2913039290
1957 2917073412
1958 2917833657
1959 2919113678
1960 2919145828
1961 2919456640
1962 2919485290
1963 2919517757
1964 2919700953
1965 2919722113
1966 2923156071
1967 2923586583
1968 2928094114
1969 2928163790
1970 2928164788
1971 2928172968
1972 2928540942
1973 2929007365
1974 2929147883
1975 2929192836
1976 2931369747
1977 2931394360
1978 2931402594
1979 2932409346
1980 2935357590
1981 2937968889
1982 2939581149
1983 2939605413
1984 2945933876
1985 2945956043
1986 2945964223
1987 2946010307
1988 2946030624
1989 2946071922
1990 2947232812
1991 2947237420
1992 2954691508
1993 2954692981
1994 2954708054
1995 2954774328
1996 2960323422
1997 2960380275
1998 2969084395
1999 2971825868
2000 2974298363
2001 2981996355
2002 2984289953
2003 2984504259
2004 2984561510
2005 2984599576
2006 2988729465
2007 3007401601
2008 3007869745
2009 637319930
2010 640940224
2011 641334326
2012 642417901
2013 643391940
2014 8004593989
2015 8015395168
2016 8015690288
2017 8018845720
2018 8019500276
2019 8019772534
2020 8019778381
2021 8020813692
2022 8020942290
2023 8020947524
2024 8020958147
2025 8021124138
2026 8022920819
2027 8022952983
2028 8022953876
2029 8033688458
2030 8039104021
2031 8040171620
2032 8040177821
2033 8052177971
2034 8054286275
2035 8054348234
2036 8054505802
2037 8055773417
2038 8055820415
2039 8056055757
2040 8056063603
2041 8056134368
2042 8056145535
2043 8056149811
2044 8056156911
2045 8056166485
2046 8057800880

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

32

154

0.95

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

162

278

0.94

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

166

357

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l8v-assembly1.cif.gz_C crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadp 0.987 1 329
3mz0-assembly1.cif.gz_A-4 crystal structure of apo myo-inositol dehydrogenase from bacillus subtilis 0.9863 1 329
3nto-assembly1.cif.gz_A crystal structure of k97v mutant myo-inositol dehydrogenase from bacillus subtilis 0.9852 1 329
4l8v-assembly1.cif.gz_C crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadp 0.9841 1 329
3mz0-assembly1.cif.gz_A-4 crystal structure of apo myo-inositol dehydrogenase from bacillus subtilis 0.9833 1 329
ID Description Score Start End Superfamily
3mz0A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9615 143 259 3.30.360.10
4mieB02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9586 143 259 3.30.360.10
3mz0A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9579 2 329 3.40.50.720
3mz0A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9535 2 329 3.40.50.720
3ec7A02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9509 143 259 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A417F3Q8-F1-model_v4 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase (EC 1.1.1.18) (EC 1.1.1.369) (Myo-inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase) (MI 2-dehydrogenase/DCI 3-dehydrogenase) 0.9746 2 329 GO:0000166
GO:0019310
GO:0050112
AF-A0A535X8S5-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9745 153 329
AF-A0A1I6QWG9-F1-model_v4 Inositol 2-dehydrogenase (EC 1.1.1.18) (Myo-inositol 2-dehydrogenase) (MI 2-dehydrogenase) 0.9723 1 328 GO:0000166
GO:0019310
GO:0050112
AF-A0A7X9XKM1-F1-model_v4 deleted 0.9709 2 329
AF-A0A417F3Q8-F1-model_v4 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase (EC 1.1.1.18) (EC 1.1.1.369) (Myo-inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase) (MI 2-dehydrogenase/DCI 3-dehydrogenase) 0.9687 2 329 GO:0000166
GO:0019310
GO:0050112

Map