F488474
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1024 | 306 | 2002 | 193 |
Family's Representative Sequence
| Representative Sequence | 3300046491|Ga0495584_0066478|Ga0495584_0066478_292_1002 |
| Length | 226 |
| Sequence | MVRPAATPGCRRTEPTAQREAEHQLAARDNPGVHNSDIYSQENQIMAITLQKGGNVNLSKEAPGLSKMMVGLGWDVRATDGAAFDLDGVVFMVNQSAKVRSDNDFIFYNNLKSSDGSVTHSGDNRTGADLTRVPADVDRIVVAVTIHDADARRQNFGMIGKAFIRCVNAANNGEIARYDLSEDSSTETAMVFGEVYRNGADWKFRAIGQGFAGGLAPLARNYGVNV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 28 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 31 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 32 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 33 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 34 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 50 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 51 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 55 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 59 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 60 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 61 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 62 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 67 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 101 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 104 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 105 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 106 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 107 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 108 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 109 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 110 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 111 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 112 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 113 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 114 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 115 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 116 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 117 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 122 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 123 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 124 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 125 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 126 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 127 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 128 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 129 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 130 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 131 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 132 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 133 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 134 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 135 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 136 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 137 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 138 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 139 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 140 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 269 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 270 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 273 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 274 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 277 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 279 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 280 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 281 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 282 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.14 |
| Metatranscriptomes | 5.86 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.61 |
| Nodule | 0.2 |
| Rhizoplane | 2.83 |
| Rhizosphere | 85.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495584_0066478 | 3300046491 | Bacteria | 1813 |
| 2 | MRS1b_contig_4452190 | 2162886011 | Bacteria | 3508 |
| 3 | JGI25152J39213_1000269 | 3300002773 | Bacteria | 34860 |
| 4 | rootH2_10190752 | 3300003320 | Bacteria | 1089 |
| 5 | Ga0007410J51695_1031617 | 3300003574 | Bacteria | 1084 |
| 6 | Ga0007409J51694_1009621 | 3300003575 | Bacteria | 1654 |
| 7 | Ga0055525_1000006 | 3300003759 | Bacteria | 642912 |
| 8 | Ga0055529_1000027 | 3300003763 | Bacteria | 292744 |
| 9 | Ga0055526_1000255 | 3300003771 | Bacteria | 45019 |
| 10 | Ga0055526_1002817 | 3300003771 | Bacteria | 11512 |
| 11 | Ga0055537_1000103 | 3300003773 | Bacteria | 63399 |
| 12 | Ga0055534_1000317 | 3300003784 | Bacteria | 32025 |
| 13 | Ga0055528_1000031 | 3300003790 | Bacteria | 120960 |
| 14 | Ga0058692_1006105 | 3300003856 | Bacteria | 3347 |
| 15 | Ga0065165_1001722 | 3300005262 | Bacteria | 21921 |
| 16 | Ga0065165_1032128 | 3300005262 | Bacteria | 1649 |
| 17 | Ga0070658_10314973 | 3300005327 | Bacteria | 1335 |
| 18 | Ga0070658_10548397 | 3300005327 | Bacteria | 1000 |
| 19 | Ga0070676_10088511 | 3300005328 | Bacteria | 1892 |
| 20 | Ga0070660_100207444 | 3300005339 | Bacteria | 1590 |
| 21 | Ga0070675_101011507 | 3300005354 | Bacteria | 763 |
| 22 | Ga0070700_100000075 | 3300005441 | Bacteria | 68207 |
| 23 | Ga0070663_100231512 | 3300005455 | Bacteria | 1455 |
| 24 | Ga0070678_101094212 | 3300005456 | Bacteria | 736 |
| 25 | Ga0070684_101166624 | 3300005535 | Bacteria | 724 |
| 26 | Ga0068853_100130090 | 3300005539 | Bacteria | 2253 |
| 27 | Ga0068855_100041266 | 3300005563 | Bacteria | 5470 |
| 28 | Ga0068856_101449653 | 3300005614 | Bacteria | 701 |
| 29 | Ga0068852_100727862 | 3300005616 | Bacteria | 1003 |
| 30 | Ga0068851_10625461 | 3300005834 | Bacteria | 657 |
| 31 | Ga0075367_10569162 | 3300006178 | Bacteria | 720 |
| 32 | Ga0097621_100288182 | 3300006237 | Bacteria | 1447 |
| 33 | Ga0068871_100800850 | 3300006358 | Bacteria | 868 |
| 34 | Ga0068865_100091524 | 3300006881 | Bacteria | 2208 |
| 35 | Ga0075436_100001369 | 3300006914 | Bacteria | 16605 |
| 36 | Ga0079104_1001753 | 3300006946 | Bacteria | 13718 |
| 37 | Ga0105251_10013378 | 3300009011 | Bacteria | 4593 |
| 38 | Ga0105251_10029677 | 3300009011 | Bacteria | 2752 |
| 39 | Ga0105244_10000413 | 3300009036 | Bacteria | 39748 |
| 40 | Ga0105244_10009929 | 3300009036 | Bacteria | 5806 |
| 41 | Ga0105244_10041153 | 3300009036 | Bacteria | 2395 |
| 42 | Ga0105244_10066709 | 3300009036 | Bacteria | 1801 |
| 43 | Ga0105244_10120120 | 3300009036 | Bacteria | 1273 |
| 44 | Ga0105250_10014054 | 3300009092 | Bacteria | 3296 |
| 45 | Ga0105241_10008918 | 3300009174 | Bacteria | 7373 |
| 46 | Ga0105242_10032034 | 3300009176 | Bacteria | 4202 |
| 47 | Ga0105237_10089852 | 3300009545 | Bacteria | 3061 |
| 48 | Ga0105238_10091890 | 3300009551 | Bacteria | 3022 |
| 49 | Ga0105239_10274105 | 3300010375 | Bacteria | 1898 |
| 50 | Ga0105246_10341772 | 3300011119 | Bacteria | 1223 |
| 51 | Ga0157373_10000104 | 3300013100 | Bacteria | 66432 |
| 52 | Ga0157373_10002311 | 3300013100 | Bacteria | 14460 |
| 53 | Ga0157371_10000077 | 3300013102 | Bacteria | 157429 |
| 54 | Ga0157371_10000287 | 3300013102 | Bacteria | 68420 |
| 55 | Ga0157371_10002111 | 3300013102 | Bacteria | 19371 |
| 56 | Ga0157371_10108123 | 3300013102 | Bacteria | 1973 |
| 57 | Ga0157369_10001457 | 3300013105 | Bacteria | 29016 |
| 58 | Ga0157369_10506610 | 3300013105 | Bacteria | 1249 |
| 59 | Ga0157374_11021460 | 3300013296 | Bacteria | 846 |
| 60 | Ga0157378_10363044 | 3300013297 | Bacteria | 1418 |
| 61 | Ga0157372_10009448 | 3300013307 | Bacteria | 10374 |
| 62 | Ga0157372_10370228 | 3300013307 | Bacteria | 1669 |
| 63 | Ga0182008_10000119 | 3300014497 | Bacteria | 59427 |
| 64 | Ga0182008_10054949 | 3300014497 | Bacteria | 1969 |
| 65 | Ga0182006_1000067 | 3300015261 | Bacteria | 147932 |
| 66 | Ga0182007_10000123 | 3300015262 | Bacteria | 53953 |
| 67 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 68 | Ga0163161_10052490 | 3300017792 | Bacteria | 2955 |
| 69 | Ga0206351_10121764 | 3300020077 | Bacteria | 1112 |
| 70 | Ga0206351_10175741 | 3300020077 | Bacteria | 2074 |
| 71 | Ga0206352_11130243 | 3300020078 | Bacteria | 880 |
| 72 | Ga0206350_10126696 | 3300020080 | Bacteria | 1191 |
| 73 | Ga0206350_10466205 | 3300020080 | Bacteria | 1135 |
| 74 | Ga0206354_11461571 | 3300020081 | Bacteria | 1295 |
| 75 | Ga0154015_1164890 | 3300020610 | Bacteria | 2262 |
| 76 | Ga0213872_10000817 | 3300021361 | Bacteria | 22567 |
| 77 | Ga0213872_10084916 | 3300021361 | Bacteria | 1419 |
| 78 | Ga0213876_10000739 | 3300021384 | Bacteria | 22677 |
| 79 | Ga0213875_10054315 | 3300021388 | Bacteria | 1876 |
| 80 | Ga0224712_10035881 | 3300022467 | Bacteria | 1833 |
| 81 | Ga0209563_100022 | 3300025230 | Bacteria | 643318 |
| 82 | Ga0209437_102183 | 3300025233 | Bacteria | 3911 |
| 83 | Ga0207425_1000212 | 3300025245 | Bacteria | 46073 |
| 84 | Ga0207425_1017463 | 3300025245 | Bacteria | 1575 |
| 85 | Ga0209646_1000126 | 3300025246 | Bacteria | 132815 |
| 86 | Ga0209677_103931 | 3300025253 | Bacteria | 4533 |
| 87 | Ga0209148_1008351 | 3300025254 | Bacteria | 2086 |
| 88 | Ga0209759_1008072 | 3300025256 | Bacteria | 3316 |
| 89 | Ga0209129_1000004 | 3300025258 | Bacteria | 884499 |
| 90 | Ga0209565_1000035 | 3300025263 | Bacteria | 298125 |
| 91 | Ga0209455_1000033 | 3300025272 | Bacteria | 504606 |
| 92 | Ga0209673_1000006 | 3300025273 | Bacteria | 650600 |
| 93 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 94 | Ga0209025_1011901 | 3300025294 | Bacteria | 5663 |
| 95 | Ga0209564_1000028 | 3300025295 | Bacteria | 510986 |
| 96 | Ga0209564_1000032 | 3300025295 | Bacteria | 464041 |
| 97 | Ga0209564_1000083 | 3300025295 | Bacteria | 259272 |
| 98 | Ga0209758_1003060 | 3300025297 | Bacteria | 15899 |
| 99 | Ga0209256_1000141 | 3300025299 | Bacteria | 152280 |
| 100 | Ga0207656_10167613 | 3300025321 | Bacteria | 1048 |
| 101 | Ga0207696_1000525 | 3300025711 | Bacteria | 31632 |
| 102 | Ga0207655_1000075 | 3300025728 | Bacteria | 226658 |
| 103 | Ga0207655_1000211 | 3300025728 | Bacteria | 102245 |
| 104 | Ga0207655_1001333 | 3300025728 | Bacteria | 23271 |
| 105 | Ga0207655_1008337 | 3300025728 | Bacteria | 6592 |
| 106 | Ga0207655_1019685 | 3300025728 | Bacteria | 3512 |
| 107 | Ga0207655_1051392 | 3300025728 | Bacteria | 1667 |
| 108 | Ga0207713_1021905 | 3300025735 | Bacteria | 3051 |
| 109 | Ga0207713_1057471 | 3300025735 | Bacteria | 1503 |
| 110 | Ga0207713_1080751 | 3300025735 | Bacteria | 1171 |
| 111 | Ga0207645_10231082 | 3300025907 | Bacteria | 1221 |
| 112 | Ga0207705_10003242 | 3300025909 | Bacteria | 12393 |
| 113 | Ga0207705_10294203 | 3300025909 | Bacteria | 1244 |
| 114 | Ga0207705_10430677 | 3300025909 | Bacteria | 1022 |
| 115 | Ga0207654_10273865 | 3300025911 | Bacteria | 1139 |
| 116 | Ga0207695_10421815 | 3300025913 | Bacteria | 1218 |
| 117 | Ga0207671_10000532 | 3300025914 | Bacteria | 51370 |
| 118 | Ga0207671_10188671 | 3300025914 | Bacteria | 1607 |
| 119 | Ga0207660_10350672 | 3300025917 | Bacteria | 1183 |
| 120 | Ga0207657_10177183 | 3300025919 | Bacteria | 1725 |
| 121 | Ga0207657_10407549 | 3300025919 | Bacteria | 1069 |
| 122 | Ga0207690_10059576 | 3300025932 | Bacteria | 2587 |
| 123 | Ga0207690_10086663 | 3300025932 | Bacteria | 2201 |
| 124 | Ga0207706_10400674 | 3300025933 | Bacteria | 1190 |
| 125 | Ga0207709_10023315 | 3300025935 | Bacteria | 3521 |
| 126 | Ga0207704_10091230 | 3300025938 | Bacteria | 2002 |
| 127 | Ga0207667_10071743 | 3300025949 | Bacteria | 3600 |
| 128 | Ga0207639_10677875 | 3300026041 | Bacteria | 955 |
| 129 | Ga0207678_10238821 | 3300026067 | Bacteria | 1556 |
| 130 | Ga0207678_10249836 | 3300026067 | Bacteria | 1519 |
| 131 | Ga0207708_10000097 | 3300026075 | Bacteria | 67533 |
| 132 | Ga0207702_10568292 | 3300026078 | Bacteria | 1110 |
| 133 | Ga0207698_11048266 | 3300026142 | Bacteria | 827 |
| 134 | Ga0209281_1000945 | 3300027111 | Bacteria | 23697 |
| 135 | Ga0209371_1000247 | 3300027312 | Bacteria | 67016 |
| 136 | Ga0209371_1001309 | 3300027312 | Bacteria | 17426 |
| 137 | Ga0209371_1010092 | 3300027312 | Bacteria | 2939 |
| 138 | Ga0268266_10338620 | 3300028379 | Bacteria | 1412 |
| 139 | Ga0268256_1000129 | 3300030500 | Bacteria | 107626 |
| 140 | Ga0268256_1001109 | 3300030500 | Bacteria | 17529 |
| 141 | Ga0268256_1011519 | 3300030500 | Bacteria | 2790 |
| 142 | Ga0316177_1024763 | 3300030731 | Bacteria | 2683 |
| 143 | Ga0314311_1205692 | 3300030733 | Bacteria | 708 |
| 144 | Ga0316178_1068594 | 3300030735 | Bacteria | 989 |
| 145 | Ga0316178_1165183 | 3300030735 | Bacteria | 1063 |
| 146 | Ga0316180_1077983 | 3300030736 | Bacteria | 2222 |
| 147 | Ga0316180_1158392 | 3300030736 | Bacteria | 2849 |
| 148 | Ga0316181_1251613 | 3300030744 | Bacteria | 1580 |
| 149 | Ga0316182_1009132 | 3300030745 | Bacteria | 894 |
| 150 | Ga0316182_1163827 | 3300030745 | Bacteria | 659 |
| 151 | Ga0316182_1211468 | 3300030745 | Bacteria | 1556 |
| 152 | Ga0307513_10017979 | 3300031456 | Bacteria | 8464 |
| 153 | Ga0307518_10010347 | 3300031838 | Bacteria | 6661 |
| 154 | Ga0307406_10263812 | 3300031901 | Bacteria | 1305 |
| 155 | Ga0307412_11136770 | 3300031911 | Bacteria | 697 |
| 156 | Ga0307415_100373660 | 3300032126 | Bacteria | 1208 |
| 157 | Ga0307415_101367374 | 3300032126 | Bacteria | 673 |
| 158 | Ga0395899_0000123 | 3300037312 | Bacteria | 123390 |
| 159 | Ga0395899_0013530 | 3300037312 | Bacteria | 6238 |
| 160 | Ga0395899_0080946 | 3300037312 | Bacteria | 2364 |
| 161 | Ga0395899_0346559 | 3300037312 | Bacteria | 995 |
| 162 | Ga0395900_0000091 | 3300037418 | Bacteria | 167089 |
| 163 | Ga0395900_0000412 | 3300037418 | Bacteria | 61636 |
| 164 | Ga0395900_0026912 | 3300037418 | Bacteria | 5886 |
| 165 | Ga0395900_0027894 | 3300037418 | Bacteria | 5783 |
| 166 | Ga0395900_0176908 | 3300037418 | Bacteria | 2170 |
| 167 | Ga0395900_0265766 | 3300037418 | Bacteria | 1711 |
| 168 | Ga0395900_0380124 | 3300037418 | Bacteria | 1380 |
| 169 | Ga0395900_0399178 | 3300037418 | Bacteria | 1340 |
| 170 | Ga0395900_0436178 | 3300037418 | Bacteria | 1268 |
| 171 | Ga0395900_0482062 | 3300037418 | Bacteria | 1192 |
| 172 | Ga0395898_0193089 | 3300037466 | Bacteria | 1945 |
| 173 | Ga0395898_0400580 | 3300037466 | Bacteria | 1308 |
| 174 | Ga0395898_0524882 | 3300037466 | Bacteria | 1125 |
| 175 | Ga0395898_0657461 | 3300037466 | Bacteria | 990 |
| 176 | Ga0395898_0826800 | 3300037466 | Bacteria | 866 |
| 177 | Ga0395905_0032094 | 3300037471 | Bacteria | 4940 |
| 178 | Ga0395905_0459494 | 3300037471 | Bacteria | 1171 |
| 179 | Ga0395905_0508788 | 3300037471 | Bacteria | 1104 |
| 180 | Ga0436364_0389133 | 3300037853 | Bacteria | 1981 |
| 181 | Ga0395901_0000629 | 3300038443 | Bacteria | 40960 |
| 182 | Ga0395901_0000959 | 3300038443 | Bacteria | 31405 |
| 183 | Ga0395901_0004830 | 3300038443 | Bacteria | 13599 |
| 184 | Ga0395901_0353822 | 3300038443 | Bacteria | 1515 |
| 185 | Ga0395901_0543195 | 3300038443 | Bacteria | 1178 |
| 186 | Ga0395901_1164575 | 3300038443 | Bacteria | 738 |
| 187 | Ga0436365_0876968 | 3300039437 | Bacteria | 38690 |
| 188 | Ga0436361_0399914 | 3300039447 | Bacteria | 3777 |
| 189 | Ga0436361_0693625 | 3300039447 | Bacteria | 14026 |
| 190 | Ga0451843_0173729 | 3300041509 | Bacteria | 669 |
| 191 | Ga0439448_0000386 | 3300042005 | Bacteria | 9983 |
| 192 | Ga0439432_006025 | 3300042006 | Bacteria | 4351 |
| 193 | Ga0439432_074723 | 3300042006 | Bacteria | 1031 |
| 194 | Ga0439449_0045194 | 3300042007 | Bacteria | 1632 |
| 195 | Ga0439452_000016 | 3300042010 | Bacteria | 338131 |
| 196 | Ga0439455_0032758 | 3300042012 | Bacteria | 1300 |
| 197 | Ga0450904_000390 | 3300042139 | Bacteria | 9118 |
| 198 | Ga0439458_0004986 | 3300042157 | Bacteria | 3004 |
| 199 | Ga0439458_0035767 | 3300042157 | Bacteria | 1194 |
| 200 | Ga0466969_0138920 | 3300044656 | Bacteria | 1123 |
| 201 | Ga0466969_0199319 | 3300044656 | Bacteria | 913 |
| 202 | Ga0466965_0008261 | 3300044683 | Bacteria | 4809 |
| 203 | Ga0466965_0093983 | 3300044683 | Bacteria | 1527 |
| 204 | Ga0466965_0187611 | 3300044683 | Bacteria | 1092 |
| 205 | Ga0466965_0345959 | 3300044683 | Bacteria | 813 |
| 206 | Ga0466966_0059326 | 3300044684 | Bacteria | 2416 |
| 207 | Ga0466966_0174024 | 3300044684 | Bacteria | 1307 |
| 208 | Ga0466961_0235792 | 3300044693 | Bacteria | 1125 |
| 209 | Ga0466964_0002105 | 3300044706 | Bacteria | 7009 |
| 210 | Ga0466964_0026785 | 3300044706 | Bacteria | 2258 |
| 211 | Ga0453684_0076776 | 3300044712 | Bacteria | 4192 |
| 212 | Ga0466968_0000110 | 3300044735 | Bacteria | 24539 |
| 213 | Ga0466968_0005851 | 3300044735 | Bacteria | 4616 |
| 214 | Ga0466968_0219917 | 3300044735 | Bacteria | 894 |
| 215 | Ga0466970_0345217 | 3300044765 | Bacteria | 844 |
| 216 | Ga0466957_0000031 | 3300044842 | Bacteria | 51411 |
| 217 | Ga0466957_0280342 | 3300044842 | Bacteria | 1115 |
| 218 | Ga0466959_0015944 | 3300045049 | Bacteria | 5482 |
| 219 | Ga0466959_0240201 | 3300045049 | Bacteria | 1251 |
| 220 | Ga0466959_0272733 | 3300045049 | Bacteria | 1162 |
| 221 | Ga0466959_0333487 | 3300045049 | Bacteria | 1035 |
| 222 | Ga0466959_0346940 | 3300045049 | Bacteria | 1012 |
| 223 | Ga0466959_0756348 | 3300045049 | Bacteria | 650 |
| 224 | Ga0451576_0000200 | 3300045051 | Bacteria | 150230 |
| 225 | Ga0466958_0245988 | 3300045836 | Bacteria | 1143 |
| 226 | Ga0466958_0805424 | 3300045836 | Bacteria | 612 |
| 227 | Ga0466967_0089730 | 3300045976 | Bacteria | 2791 |
| 228 | Ga0466967_0228059 | 3300045976 | Bacteria | 1772 |
| 229 | Ga0466967_0313197 | 3300045976 | Bacteria | 1512 |
| 230 | Ga0495617_000108 | 3300046452 | Bacteria | 60724 |
| 231 | Ga0495617_001398 | 3300046452 | Bacteria | 10633 |
| 232 | Ga0495617_011543 | 3300046452 | Bacteria | 3013 |
| 233 | Ga0495627_000140 | 3300046453 | Bacteria | 86227 |
| 234 | Ga0495627_000249 | 3300046453 | Bacteria | 55885 |
| 235 | Ga0495627_001076 | 3300046453 | Bacteria | 17964 |
| 236 | Ga0495627_003674 | 3300046453 | Bacteria | 6659 |
| 237 | Ga0495627_003968 | 3300046453 | Bacteria | 6316 |
| 238 | Ga0495603_0023473 | 3300046455 | Bacteria | 3731 |
| 239 | Ga0495603_0069635 | 3300046455 | Bacteria | 2069 |
| 240 | Ga0495590_0000058 | 3300046457 | Bacteria | 93362 |
| 241 | Ga0495590_0000263 | 3300046457 | Bacteria | 28597 |
| 242 | Ga0495590_0001394 | 3300046457 | Bacteria | 10493 |
| 243 | Ga0495590_0001595 | 3300046457 | Bacteria | 9715 |
| 244 | Ga0495590_0012621 | 3300046457 | Bacteria | 3131 |
| 245 | Ga0495590_0047872 | 3300046457 | Bacteria | 1491 |
| 246 | Ga0495591_000017 | 3300046458 | Bacteria | 238400 |
| 247 | Ga0495591_000132 | 3300046458 | Bacteria | 81947 |
| 248 | Ga0495591_004768 | 3300046458 | Bacteria | 6488 |
| 249 | Ga0495629_0005404 | 3300046459 | Bacteria | 9525 |
| 250 | Ga0495629_0007599 | 3300046459 | Bacteria | 7987 |
| 251 | Ga0495629_0382847 | 3300046459 | Bacteria | 957 |
| 252 | Ga0495638_0000229 | 3300046460 | Bacteria | 76824 |
| 253 | Ga0495638_0001259 | 3300046460 | Bacteria | 23718 |
| 254 | Ga0495638_0004201 | 3300046460 | Bacteria | 10972 |
| 255 | Ga0495638_0005840 | 3300046460 | Bacteria | 9052 |
| 256 | Ga0495638_0030750 | 3300046460 | Bacteria | 3453 |
| 257 | Ga0495638_0196462 | 3300046460 | Bacteria | 1142 |
| 258 | Ga0495653_0000029 | 3300046463 | Bacteria | 145049 |
| 259 | Ga0495653_0048085 | 3300046463 | Bacteria | 3295 |
| 260 | Ga0495653_0179681 | 3300046463 | Bacteria | 1453 |
| 261 | Ga0495650_0000146 | 3300046471 | Bacteria | 163598 |
| 262 | Ga0495650_0000359 | 3300046471 | Bacteria | 80406 |
| 263 | Ga0495650_0000460 | 3300046471 | Bacteria | 63424 |
| 264 | Ga0495650_0000463 | 3300046471 | Bacteria | 63012 |
| 265 | Ga0495650_0001164 | 3300046471 | Bacteria | 28080 |
| 266 | Ga0495650_0001990 | 3300046471 | Bacteria | 17944 |
| 267 | Ga0495650_0002128 | 3300046471 | Bacteria | 16893 |
| 268 | Ga0495650_0004597 | 3300046471 | Bacteria | 9380 |
| 269 | Ga0495650_0022009 | 3300046471 | Bacteria | 3065 |
| 270 | Ga0495650_0029661 | 3300046471 | Bacteria | 2490 |
| 271 | Ga0495580_0020170 | 3300046472 | Bacteria | 4939 |
| 272 | Ga0495582_0006434 | 3300046473 | Bacteria | 6524 |
| 273 | Ga0495605_0000036 | 3300046474 | Bacteria | 203902 |
| 274 | Ga0495605_0000039 | 3300046474 | Bacteria | 196802 |
| 275 | Ga0495605_0000407 | 3300046474 | Bacteria | 39381 |
| 276 | Ga0495605_0032512 | 3300046474 | Bacteria | 2655 |
| 277 | Ga0495605_0036355 | 3300046474 | Bacteria | 2483 |
| 278 | Ga0495605_0097662 | 3300046474 | Bacteria | 1353 |
| 279 | Ga0495605_0122966 | 3300046474 | Bacteria | 1175 |
| 280 | Ga0495639_0007677 | 3300046475 | Bacteria | 4638 |
| 281 | Ga0495639_0025849 | 3300046475 | Bacteria | 2591 |
| 282 | Ga0495639_0397370 | 3300046475 | Bacteria | 696 |
| 283 | Ga0495664_0381246 | 3300046477 | Bacteria | 848 |
| 284 | Ga0495584_0000013 | 3300046491 | Bacteria | 185735 |
| 285 | Ga0495584_0000135 | 3300046491 | Bacteria | 50619 |
| 286 | Ga0495584_0000487 | 3300046491 | Bacteria | 27306 |
| 287 | Ga0495584_0001436 | 3300046491 | Bacteria | 14346 |
| 288 | Ga0495584_0002431 | 3300046491 | Bacteria | 10560 |
| 289 | Ga0495584_0024821 | 3300046491 | Bacteria | 3039 |
| 290 | Ga0495584_0036425 | 3300046491 | Bacteria | 2486 |
| 291 | Ga0495584_0052298 | 3300046491 | Bacteria | 2056 |
| 292 | Ga0495584_0062743 | 3300046491 | Bacteria | 1867 |
| 293 | Ga0495584_0086963 | 3300046491 | Bacteria | 1575 |
| 294 | Ga0495584_0087108 | 3300046491 | Bacteria | 1574 |
| 295 | Ga0495584_0116271 | 3300046491 | Bacteria | 1354 |
| 296 | Ga0495584_0130945 | 3300046491 | Bacteria | 1272 |
| 297 | Ga0495584_0157683 | 3300046491 | Bacteria | 1153 |
| 298 | Ga0495584_0157935 | 3300046491 | Bacteria | 1152 |
| 299 | Ga0495584_0183357 | 3300046491 | Bacteria | 1063 |
| 300 | Ga0495585_0000022 | 3300046492 | Bacteria | 153475 |
| 301 | Ga0495585_0000113 | 3300046492 | Bacteria | 86842 |
| 302 | Ga0495585_0000829 | 3300046492 | Bacteria | 26694 |
| 303 | Ga0495585_0001132 | 3300046492 | Bacteria | 21882 |
| 304 | Ga0495585_0002488 | 3300046492 | Bacteria | 13140 |
| 305 | Ga0495585_0016324 | 3300046492 | Bacteria | 4302 |
| 306 | Ga0495585_0018215 | 3300046492 | Bacteria | 4052 |
| 307 | Ga0495585_0043270 | 3300046492 | Bacteria | 2519 |
| 308 | Ga0495585_0051576 | 3300046492 | Bacteria | 2279 |
| 309 | Ga0495585_0080646 | 3300046492 | Bacteria | 1763 |
| 310 | Ga0495585_0108734 | 3300046492 | Bacteria | 1476 |
| 311 | Ga0495585_0123270 | 3300046492 | Bacteria | 1369 |
| 312 | Ga0495585_0146506 | 3300046492 | Bacteria | 1233 |
| 313 | Ga0495585_0153240 | 3300046492 | Bacteria | 1200 |
| 314 | Ga0495585_0209286 | 3300046492 | Bacteria | 989 |
| 315 | Ga0495585_0227978 | 3300046492 | Bacteria | 937 |
| 316 | Ga0495594_0000535 | 3300046499 | Bacteria | 19462 |
| 317 | Ga0495594_0006275 | 3300046499 | Bacteria | 6113 |
| 318 | Ga0495594_0018653 | 3300046499 | Bacteria | 3677 |
| 319 | Ga0495594_0030616 | 3300046499 | Bacteria | 2913 |
| 320 | Ga0495594_0067170 | 3300046499 | Bacteria | 1989 |
| 321 | Ga0495594_0071061 | 3300046499 | Bacteria | 1935 |
| 322 | Ga0495594_0099492 | 3300046499 | Bacteria | 1635 |
| 323 | Ga0495594_0133347 | 3300046499 | Bacteria | 1407 |
| 324 | Ga0495596_0001491 | 3300046500 | Bacteria | 13383 |
| 325 | Ga0495596_0001943 | 3300046500 | Bacteria | 11427 |
| 326 | Ga0495596_0002010 | 3300046500 | Bacteria | 11198 |
| 327 | Ga0495596_0003257 | 3300046500 | Bacteria | 8297 |
| 328 | Ga0495596_0003642 | 3300046500 | Bacteria | 7737 |
| 329 | Ga0495596_0005788 | 3300046500 | Bacteria | 5790 |
| 330 | Ga0495596_0007607 | 3300046500 | Bacteria | 4879 |
| 331 | Ga0495596_0043370 | 3300046500 | Bacteria | 1772 |
| 332 | Ga0495596_0051759 | 3300046500 | Bacteria | 1608 |
| 333 | Ga0495596_0057970 | 3300046500 | Bacteria | 1510 |
| 334 | Ga0495596_0109913 | 3300046500 | Bacteria | 1070 |
| 335 | Ga0495596_0136651 | 3300046500 | Bacteria | 951 |
| 336 | Ga0495596_0210332 | 3300046500 | Bacteria | 755 |
| 337 | Ga0495596_0238231 | 3300046500 | Bacteria | 706 |
| 338 | Ga0495607_0001566 | 3300046501 | Bacteria | 19993 |
| 339 | Ga0495607_0001994 | 3300046501 | Bacteria | 17177 |
| 340 | Ga0495607_0002732 | 3300046501 | Bacteria | 14075 |
| 341 | Ga0495607_0006080 | 3300046501 | Bacteria | 8535 |
| 342 | Ga0495607_0024544 | 3300046501 | Bacteria | 3757 |
| 343 | Ga0495607_0028855 | 3300046501 | Bacteria | 3417 |
| 344 | Ga0495607_0042553 | 3300046501 | Bacteria | 2691 |
| 345 | Ga0495607_0069425 | 3300046501 | Bacteria | 1972 |
| 346 | Ga0495607_0101926 | 3300046501 | Bacteria | 1536 |
| 347 | Ga0495607_0103940 | 3300046501 | Bacteria | 1516 |
| 348 | Ga0495607_0122235 | 3300046501 | Bacteria | 1365 |
| 349 | Ga0495607_0165218 | 3300046501 | Bacteria | 1121 |
| 350 | Ga0495607_0270492 | 3300046501 | Bacteria | 810 |
| 351 | Ga0495607_0358579 | 3300046501 | Bacteria | 671 |
| 352 | Ga0495583_0000028 | 3300046506 | Bacteria | 255787 |
| 353 | Ga0495583_0000346 | 3300046506 | Bacteria | 73089 |
| 354 | Ga0495583_0000907 | 3300046506 | Bacteria | 35148 |
| 355 | Ga0495583_0001433 | 3300046506 | Bacteria | 24228 |
| 356 | Ga0495583_0003983 | 3300046506 | Bacteria | 10905 |
| 357 | Ga0495583_0008293 | 3300046506 | Bacteria | 6369 |
| 358 | Ga0495583_0034576 | 3300046506 | Bacteria | 2419 |
| 359 | Ga0495583_0044249 | 3300046506 | Bacteria | 2066 |
| 360 | Ga0495583_0075561 | 3300046506 | Bacteria | 1473 |
| 361 | Ga0495606_0000004 | 3300046507 | Bacteria | 406209 |
| 362 | Ga0495606_0000542 | 3300046507 | Bacteria | 60618 |
| 363 | Ga0495606_0000618 | 3300046507 | Bacteria | 55944 |
| 364 | Ga0495606_0031660 | 3300046507 | Bacteria | 3673 |
| 365 | Ga0495606_0035520 | 3300046507 | Bacteria | 3405 |
| 366 | Ga0495606_0054269 | 3300046507 | Bacteria | 2595 |
| 367 | Ga0495606_0060129 | 3300046507 | Bacteria | 2435 |
| 368 | Ga0495606_0074428 | 3300046507 | Bacteria | 2127 |
| 369 | Ga0495606_0092394 | 3300046507 | Bacteria | 1858 |
| 370 | Ga0495606_0131891 | 3300046507 | Bacteria | 1484 |
| 371 | Ga0495606_0167733 | 3300046507 | Bacteria | 1276 |
| 372 | Ga0495606_0293827 | 3300046507 | Bacteria | 883 |
| 373 | Ga0495610_0000007 | 3300046512 | Bacteria | 820919 |
| 374 | Ga0495610_0001009 | 3300046512 | Bacteria | 25934 |
| 375 | Ga0495610_0002648 | 3300046512 | Bacteria | 14793 |
| 376 | Ga0495610_0004527 | 3300046512 | Bacteria | 10237 |
| 377 | Ga0495610_0005845 | 3300046512 | Bacteria | 8641 |
| 378 | Ga0495610_0010045 | 3300046512 | Bacteria | 5912 |
| 379 | Ga0495610_0051531 | 3300046512 | Bacteria | 2002 |
| 380 | Ga0495616_0000376 | 3300046513 | Bacteria | 34758 |
| 381 | Ga0495616_0000611 | 3300046513 | Bacteria | 26961 |
| 382 | Ga0495616_0000659 | 3300046513 | Bacteria | 25628 |
| 383 | Ga0495616_0000686 | 3300046513 | Bacteria | 25053 |
| 384 | Ga0495616_0000689 | 3300046513 | Bacteria | 24989 |
| 385 | Ga0495616_0005181 | 3300046513 | Bacteria | 8075 |
| 386 | Ga0495616_0005223 | 3300046513 | Bacteria | 8026 |
| 387 | Ga0495616_0007856 | 3300046513 | Bacteria | 6362 |
| 388 | Ga0495616_0010942 | 3300046513 | Bacteria | 5222 |
| 389 | Ga0495616_0027443 | 3300046513 | Bacteria | 3020 |
| 390 | Ga0495616_0037642 | 3300046513 | Bacteria | 2487 |
| 391 | Ga0495616_0039267 | 3300046513 | Bacteria | 2425 |
| 392 | Ga0495616_0054746 | 3300046513 | Bacteria | 1977 |
| 393 | Ga0495616_0090556 | 3300046513 | Bacteria | 1449 |
| 394 | Ga0495616_0096630 | 3300046513 | Bacteria | 1390 |
| 395 | Ga0495620_0000073 | 3300046515 | Bacteria | 83446 |
| 396 | Ga0495620_0013794 | 3300046515 | Bacteria | 4131 |
| 397 | Ga0495630_0042653 | 3300046517 | Bacteria | 3388 |
| 398 | Ga0495631_0000479 | 3300046518 | Bacteria | 26745 |
| 399 | Ga0495631_0001660 | 3300046518 | Bacteria | 13235 |
| 400 | Ga0495631_0005867 | 3300046518 | Bacteria | 6399 |
| 401 | Ga0495631_0007461 | 3300046518 | Bacteria | 5558 |
| 402 | Ga0495631_0014323 | 3300046518 | Bacteria | 3831 |
| 403 | Ga0495631_0020789 | 3300046518 | Bacteria | 3061 |
| 404 | Ga0495631_0062551 | 3300046518 | Bacteria | 1612 |
| 405 | Ga0495631_0063622 | 3300046518 | Bacteria | 1597 |
| 406 | Ga0495631_0105316 | 3300046518 | Bacteria | 1213 |
| 407 | Ga0495631_0117116 | 3300046518 | Bacteria | 1145 |
| 408 | Ga0495631_0133516 | 3300046518 | Bacteria | 1066 |
| 409 | Ga0495631_0142158 | 3300046518 | Bacteria | 1030 |
| 410 | Ga0495631_0199972 | 3300046518 | Bacteria | 854 |
| 411 | Ga0495632_0000001 | 3300046519 | Bacteria | 873295 |
| 412 | Ga0495632_0000212 | 3300046519 | Bacteria | 59013 |
| 413 | Ga0495632_0000264 | 3300046519 | Bacteria | 52194 |
| 414 | Ga0495632_0000674 | 3300046519 | Bacteria | 31134 |
| 415 | Ga0495632_0001027 | 3300046519 | Bacteria | 24127 |
| 416 | Ga0495632_0001229 | 3300046519 | Bacteria | 21737 |
| 417 | Ga0495632_0002656 | 3300046519 | Bacteria | 13415 |
| 418 | Ga0495632_0015773 | 3300046519 | Bacteria | 4223 |
| 419 | Ga0495632_0030467 | 3300046519 | Bacteria | 2800 |
| 420 | Ga0495632_0030836 | 3300046519 | Bacteria | 2779 |
| 421 | Ga0495632_0075450 | 3300046519 | Bacteria | 1614 |
| 422 | Ga0495632_0138145 | 3300046519 | Bacteria | 1131 |
| 423 | Ga0495637_0000028 | 3300046520 | Bacteria | 144203 |
| 424 | Ga0495637_0000145 | 3300046520 | Bacteria | 53682 |
| 425 | Ga0495637_0000360 | 3300046520 | Bacteria | 34584 |
| 426 | Ga0495637_0021081 | 3300046520 | Bacteria | 2990 |
| 427 | Ga0495637_0053950 | 3300046520 | Bacteria | 1671 |
| 428 | Ga0495637_0076051 | 3300046520 | Bacteria | 1346 |
| 429 | Ga0495637_0084091 | 3300046520 | Bacteria | 1264 |
| 430 | Ga0495643_0000020 | 3300046522 | Bacteria | 294973 |
| 431 | Ga0495643_0000080 | 3300046522 | Bacteria | 161872 |
| 432 | Ga0495643_0000318 | 3300046522 | Bacteria | 66545 |
| 433 | Ga0495643_0000534 | 3300046522 | Bacteria | 47409 |
| 434 | Ga0495643_0002025 | 3300046522 | Bacteria | 16891 |
| 435 | Ga0495643_0006392 | 3300046522 | Bacteria | 7778 |
| 436 | Ga0495643_0026586 | 3300046522 | Bacteria | 3263 |
| 437 | Ga0495643_0030351 | 3300046522 | Bacteria | 3019 |
| 438 | Ga0495643_0039658 | 3300046522 | Bacteria | 2575 |
| 439 | Ga0495643_0069512 | 3300046522 | Bacteria | 1850 |
| 440 | Ga0495644_0000274 | 3300046523 | Bacteria | 23698 |
| 441 | Ga0495644_0003657 | 3300046523 | Bacteria | 6059 |
| 442 | Ga0495644_0006697 | 3300046523 | Bacteria | 4462 |
| 443 | Ga0495644_0015315 | 3300046523 | Bacteria | 2936 |
| 444 | Ga0495644_0030340 | 3300046523 | Bacteria | 2042 |
| 445 | Ga0495644_0032577 | 3300046523 | Bacteria | 1969 |
| 446 | Ga0495644_0047295 | 3300046523 | Bacteria | 1616 |
| 447 | Ga0495644_0063102 | 3300046523 | Bacteria | 1392 |
| 448 | Ga0495644_0070794 | 3300046523 | Bacteria | 1310 |
| 449 | Ga0495648_0000004 | 3300046524 | Bacteria | 373639 |
| 450 | Ga0495648_0000047 | 3300046524 | Bacteria | 166756 |
| 451 | Ga0495648_0000311 | 3300046524 | Bacteria | 53614 |
| 452 | Ga0495648_0001397 | 3300046524 | Bacteria | 23719 |
| 453 | Ga0495648_0002684 | 3300046524 | Bacteria | 16084 |
| 454 | Ga0495648_0005717 | 3300046524 | Bacteria | 10268 |
| 455 | Ga0495648_0008072 | 3300046524 | Bacteria | 8326 |
| 456 | Ga0495648_0013125 | 3300046524 | Bacteria | 6141 |
| 457 | Ga0495648_0022646 | 3300046524 | Bacteria | 4318 |
| 458 | Ga0495648_0042145 | 3300046524 | Bacteria | 2874 |
| 459 | Ga0495648_0174254 | 3300046524 | Bacteria | 1099 |
| 460 | Ga0495648_0191968 | 3300046524 | Bacteria | 1029 |
| 461 | Ga0495663_0000002 | 3300046525 | Bacteria | 495384 |
| 462 | Ga0495663_0022936 | 3300046525 | Bacteria | 1805 |
| 463 | Ga0495663_0059677 | 3300046525 | Bacteria | 1197 |
| 464 | Ga0495666_0003876 | 3300046526 | Bacteria | 7565 |
| 465 | Ga0495666_0004089 | 3300046526 | Bacteria | 7371 |
| 466 | Ga0495666_0016373 | 3300046526 | Bacteria | 3692 |
| 467 | Ga0495666_0026983 | 3300046526 | Bacteria | 2827 |
| 468 | Ga0495666_0061624 | 3300046526 | Bacteria | 1792 |
| 469 | Ga0495642_0002677 | 3300046528 | Bacteria | 7162 |
| 470 | Ga0495642_0004431 | 3300046528 | Bacteria | 5449 |
| 471 | Ga0495642_0058278 | 3300046528 | Bacteria | 1599 |
| 472 | Ga0495642_0068904 | 3300046528 | Bacteria | 1477 |
| 473 | Ga0495642_0105065 | 3300046528 | Bacteria | 1204 |
| 474 | Ga0495642_0106322 | 3300046528 | Bacteria | 1197 |
| 475 | Ga0495642_0107947 | 3300046528 | Bacteria | 1188 |
| 476 | Ga0495642_0185178 | 3300046528 | Bacteria | 906 |
| 477 | Ga0495642_0232904 | 3300046528 | Bacteria | 804 |
| 478 | Ga0495652_0003777 | 3300046529 | Bacteria | 14780 |
| 479 | Ga0495652_0033748 | 3300046529 | Bacteria | 4465 |
| 480 | Ga0495654_0000025 | 3300046530 | Bacteria | 236572 |
| 481 | Ga0495654_0000246 | 3300046530 | Bacteria | 50620 |
| 482 | Ga0495654_0000561 | 3300046530 | Bacteria | 30020 |
| 483 | Ga0495654_0006416 | 3300046530 | Bacteria | 6684 |
| 484 | Ga0495654_0007471 | 3300046530 | Bacteria | 6102 |
| 485 | Ga0495654_0013471 | 3300046530 | Bacteria | 4375 |
| 486 | Ga0495654_0025275 | 3300046530 | Bacteria | 3060 |
| 487 | Ga0495654_0031291 | 3300046530 | Bacteria | 2701 |
| 488 | Ga0495654_0032154 | 3300046530 | Bacteria | 2660 |
| 489 | Ga0495654_0037642 | 3300046530 | Bacteria | 2423 |
| 490 | Ga0495654_0069846 | 3300046530 | Bacteria | 1667 |
| 491 | Ga0495654_0120340 | 3300046530 | Bacteria | 1189 |
| 492 | Ga0495665_0000878 | 3300046531 | Bacteria | 15744 |
| 493 | Ga0495665_0009972 | 3300046531 | Bacteria | 5145 |
| 494 | Ga0495586_0170593 | 3300046535 | Bacteria | 1229 |
| 495 | Ga0495587_0180900 | 3300046536 | Bacteria | 1195 |
| 496 | Ga0495587_0219004 | 3300046536 | Bacteria | 1074 |
| 497 | Ga0495609_0000005 | 3300046538 | Bacteria | 439165 |
| 498 | Ga0495609_0000115 | 3300046538 | Bacteria | 93419 |
| 499 | Ga0495609_0000933 | 3300046538 | Bacteria | 21140 |
| 500 | Ga0495609_0001680 | 3300046538 | Bacteria | 14357 |
| 501 | Ga0495609_0002709 | 3300046538 | Bacteria | 10683 |
| 502 | Ga0495609_0002912 | 3300046538 | Bacteria | 10190 |
| 503 | Ga0495609_0003559 | 3300046538 | Bacteria | 8882 |
| 504 | Ga0495609_0022202 | 3300046538 | Bacteria | 2924 |
| 505 | Ga0495609_0029000 | 3300046538 | Bacteria | 2522 |
| 506 | Ga0495609_0029867 | 3300046538 | Bacteria | 2480 |
| 507 | Ga0495609_0094501 | 3300046538 | Bacteria | 1298 |
| 508 | Ga0495597_0000147 | 3300046542 | Bacteria | 62147 |
| 509 | Ga0495597_0000161 | 3300046542 | Bacteria | 59525 |
| 510 | Ga0495597_0000983 | 3300046542 | Bacteria | 21981 |
| 511 | Ga0495597_0001304 | 3300046542 | Bacteria | 18318 |
| 512 | Ga0495597_0003956 | 3300046542 | Bacteria | 8339 |
| 513 | Ga0495597_0006022 | 3300046542 | Bacteria | 6322 |
| 514 | Ga0495597_0011813 | 3300046542 | Bacteria | 4227 |
| 515 | Ga0495597_0033732 | 3300046542 | Bacteria | 2316 |
| 516 | Ga0495597_0041125 | 3300046542 | Bacteria | 2065 |
| 517 | Ga0495597_0043304 | 3300046542 | Bacteria | 2005 |
| 518 | Ga0495645_0053393 | 3300046543 | Bacteria | 2938 |
| 519 | Ga0495645_0220747 | 3300046543 | Bacteria | 1275 |
| 520 | Ga0495622_0000204 | 3300046557 | Bacteria | 47081 |
| 521 | Ga0495622_0000567 | 3300046557 | Bacteria | 22203 |
| 522 | Ga0495622_0016362 | 3300046557 | Bacteria | 3453 |
| 523 | Ga0495622_0021765 | 3300046557 | Bacteria | 2985 |
| 524 | Ga0495622_0124699 | 3300046557 | Bacteria | 1175 |
| 525 | Ga0495633_0000028 | 3300046558 | Bacteria | 203214 |
| 526 | Ga0495633_0000068 | 3300046558 | Bacteria | 136733 |
| 527 | Ga0495633_0000094 | 3300046558 | Bacteria | 120459 |
| 528 | Ga0495633_0000213 | 3300046558 | Bacteria | 72710 |
| 529 | Ga0495633_0004241 | 3300046558 | Bacteria | 9176 |
| 530 | Ga0495633_0006081 | 3300046558 | Bacteria | 7233 |
| 531 | Ga0495633_0007208 | 3300046558 | Bacteria | 6440 |
| 532 | Ga0495633_0007557 | 3300046558 | Bacteria | 6237 |
| 533 | Ga0495633_0008071 | 3300046558 | Bacteria | 5981 |
| 534 | Ga0495633_0010511 | 3300046558 | Bacteria | 5045 |
| 535 | Ga0495633_0012141 | 3300046558 | Bacteria | 4597 |
| 536 | Ga0495633_0014239 | 3300046558 | Bacteria | 4166 |
| 537 | Ga0495633_0016968 | 3300046558 | Bacteria | 3735 |
| 538 | Ga0495633_0017649 | 3300046558 | Bacteria | 3642 |
| 539 | Ga0495633_0027444 | 3300046558 | Bacteria | 2783 |
| 540 | Ga0495633_0039760 | 3300046558 | Bacteria | 2243 |
| 541 | Ga0495633_0072914 | 3300046558 | Bacteria | 1601 |
| 542 | Ga0495633_0079938 | 3300046558 | Bacteria | 1522 |
| 543 | Ga0495633_0143064 | 3300046558 | Bacteria | 1105 |
| 544 | Ga0495633_0187123 | 3300046558 | Bacteria | 952 |
| 545 | Ga0495633_0192930 | 3300046558 | Bacteria | 936 |
| 546 | Ga0495633_0196141 | 3300046558 | Bacteria | 927 |
| 547 | Ga0495633_0247142 | 3300046558 | Bacteria | 814 |
| 548 | Ga0495656_0015692 | 3300046615 | Bacteria | 2865 |
| 549 | Ga0495656_0044981 | 3300046615 | Bacteria | 1861 |
| 550 | Ga0495656_0124388 | 3300046615 | Bacteria | 1221 |
| 551 | Ga0495656_0247534 | 3300046615 | Bacteria | 899 |
| 552 | Ga0495668_0000136 | 3300046616 | Bacteria | 111262 |
| 553 | Ga0495668_0000444 | 3300046616 | Bacteria | 53002 |
| 554 | Ga0495668_0000491 | 3300046616 | Bacteria | 49600 |
| 555 | Ga0495668_0000773 | 3300046616 | Bacteria | 37273 |
| 556 | Ga0495668_0000949 | 3300046616 | Bacteria | 32193 |
| 557 | Ga0495668_0000972 | 3300046616 | Bacteria | 31521 |
| 558 | Ga0495668_0001176 | 3300046616 | Bacteria | 26639 |
| 559 | Ga0495668_0001816 | 3300046616 | Bacteria | 19387 |
| 560 | Ga0495668_0002180 | 3300046616 | Bacteria | 16763 |
| 561 | Ga0495668_0009195 | 3300046616 | Bacteria | 6080 |
| 562 | Ga0495668_0009237 | 3300046616 | Bacteria | 6067 |
| 563 | Ga0495668_0011282 | 3300046616 | Bacteria | 5360 |
| 564 | Ga0495668_0024197 | 3300046616 | Bacteria | 3455 |
| 565 | Ga0495668_0095711 | 3300046616 | Bacteria | 1625 |
| 566 | Ga0495668_0197829 | 3300046616 | Bacteria | 1100 |
| 567 | Ga0495668_0219337 | 3300046616 | Bacteria | 1041 |
| 568 | Ga0495634_0004310 | 3300046642 | Bacteria | 11214 |
| 569 | Ga0495634_0073745 | 3300046642 | Bacteria | 2244 |
| 570 | Ga0495611_0000260 | 3300046648 | Bacteria | 36404 |
| 571 | Ga0495611_0002212 | 3300046648 | Bacteria | 9042 |
| 572 | Ga0495611_0009194 | 3300046648 | Bacteria | 4171 |
| 573 | Ga0495611_0014795 | 3300046648 | Bacteria | 3335 |
| 574 | Ga0495611_0018770 | 3300046648 | Bacteria | 2966 |
| 575 | Ga0495611_0022485 | 3300046648 | Bacteria | 2729 |
| 576 | Ga0495611_0024974 | 3300046648 | Bacteria | 2601 |
| 577 | Ga0495611_0047384 | 3300046648 | Bacteria | 1929 |
| 578 | Ga0495611_0058275 | 3300046648 | Bacteria | 1751 |
| 579 | Ga0495611_0183080 | 3300046648 | Bacteria | 978 |
| 580 | Ga0495625_0000257 | 3300046660 | Bacteria | 82608 |
| 581 | Ga0495625_0000633 | 3300046660 | Bacteria | 50484 |
| 582 | Ga0495625_0002526 | 3300046660 | Bacteria | 19676 |
| 583 | Ga0495625_0006889 | 3300046660 | Bacteria | 10033 |
| 584 | Ga0495625_0009106 | 3300046660 | Bacteria | 8373 |
| 585 | Ga0495625_0011668 | 3300046660 | Bacteria | 7147 |
| 586 | Ga0495625_0012558 | 3300046660 | Bacteria | 6857 |
| 587 | Ga0495625_0040810 | 3300046660 | Bacteria | 3381 |
| 588 | Ga0495625_0049203 | 3300046660 | Bacteria | 3031 |
| 589 | Ga0495625_0074307 | 3300046660 | Bacteria | 2381 |
| 590 | Ga0495625_0081187 | 3300046660 | Bacteria | 2257 |
| 591 | Ga0495625_0092746 | 3300046660 | Bacteria | 2086 |
| 592 | Ga0495625_0172346 | 3300046660 | Bacteria | 1444 |
| 593 | Ga0495625_0275145 | 3300046660 | Bacteria | 1085 |
| 594 | Ga0495659_0000025 | 3300046664 | Bacteria | 69322 |
| 595 | Ga0495659_0001206 | 3300046664 | Bacteria | 8974 |
| 596 | Ga0495659_0039659 | 3300046664 | Bacteria | 1675 |
| 597 | Ga0495661_0000211 | 3300046665 | Bacteria | 67481 |
| 598 | Ga0495661_0000266 | 3300046665 | Bacteria | 59871 |
| 599 | Ga0495661_0001391 | 3300046665 | Bacteria | 20311 |
| 600 | Ga0495661_0001392 | 3300046665 | Bacteria | 20286 |
| 601 | Ga0495661_0004919 | 3300046665 | Bacteria | 9560 |
| 602 | Ga0495661_0016463 | 3300046665 | Bacteria | 4901 |
| 603 | Ga0495661_0022038 | 3300046665 | Bacteria | 4145 |
| 604 | Ga0495661_0034730 | 3300046665 | Bacteria | 3170 |
| 605 | Ga0495661_0038083 | 3300046665 | Bacteria | 2998 |
| 606 | Ga0495661_0041375 | 3300046665 | Bacteria | 2851 |
| 607 | Ga0495661_0041435 | 3300046665 | Bacteria | 2848 |
| 608 | Ga0495661_0055263 | 3300046665 | Bacteria | 2380 |
| 609 | Ga0495661_0073999 | 3300046665 | Bacteria | 1983 |
| 610 | Ga0495661_0113781 | 3300046665 | Bacteria | 1504 |
| 611 | Ga0495661_0152046 | 3300046665 | Bacteria | 1250 |
| 612 | Ga0495661_0209336 | 3300046665 | Bacteria | 1016 |
| 613 | Ga0495661_0216088 | 3300046665 | Bacteria | 995 |
| 614 | Ga0495661_0316170 | 3300046665 | Bacteria | 777 |
| 615 | Ga0495588_0000059 | 3300046674 | Bacteria | 263358 |
| 616 | Ga0495588_0004237 | 3300046674 | Bacteria | 6327 |
| 617 | Ga0495588_0007489 | 3300046674 | Bacteria | 4971 |
| 618 | Ga0495588_0051698 | 3300046674 | Bacteria | 2116 |
| 619 | Ga0495588_0068058 | 3300046674 | Bacteria | 1849 |
| 620 | Ga0495588_0087673 | 3300046674 | Bacteria | 1628 |
| 621 | Ga0495588_0148792 | 3300046674 | Bacteria | 1237 |
| 622 | Ga0495588_0223960 | 3300046674 | Bacteria | 992 |
| 623 | Ga0495588_0270369 | 3300046674 | Bacteria | 895 |
| 624 | Ga0495599_0063211 | 3300046678 | Bacteria | 2313 |
| 625 | Ga0495599_0095526 | 3300046678 | Bacteria | 1854 |
| 626 | Ga0495623_0003760 | 3300046679 | Bacteria | 10004 |
| 627 | Ga0495623_0184029 | 3300046679 | Bacteria | 1211 |
| 628 | Ga0495623_0464380 | 3300046679 | Bacteria | 672 |
| 629 | Ga0495669_0000095 | 3300046684 | Bacteria | 57161 |
| 630 | Ga0495669_0000287 | 3300046684 | Bacteria | 28730 |
| 631 | Ga0495669_0001028 | 3300046684 | Bacteria | 11630 |
| 632 | Ga0495669_0004084 | 3300046684 | Bacteria | 6003 |
| 633 | Ga0495669_0043221 | 3300046684 | Bacteria | 2005 |
| 634 | Ga0495669_0096834 | 3300046684 | Bacteria | 1367 |
| 635 | Ga0495613_0350777 | 3300046689 | Bacteria | 1013 |
| 636 | Ga0495613_0631324 | 3300046689 | Bacteria | 710 |
| 637 | Ga0495624_0001233 | 3300046690 | Bacteria | 20184 |
| 638 | Ga0495670_0001234 | 3300046691 | Bacteria | 12462 |
| 639 | Ga0495670_0002960 | 3300046691 | Bacteria | 8383 |
| 640 | Ga0495670_0009158 | 3300046691 | Bacteria | 4868 |
| 641 | Ga0495670_0085018 | 3300046691 | Bacteria | 1614 |
| 642 | Ga0495670_0088664 | 3300046691 | Bacteria | 1581 |
| 643 | Ga0495670_0105103 | 3300046691 | Bacteria | 1457 |
| 644 | Ga0495670_0126694 | 3300046691 | Bacteria | 1329 |
| 645 | Ga0495670_0157173 | 3300046691 | Bacteria | 1193 |
| 646 | Ga0495670_0189122 | 3300046691 | Bacteria | 1088 |
| 647 | Ga0495670_0258370 | 3300046691 | Bacteria | 929 |
| 648 | Ga0495671_0000016 | 3300046692 | Bacteria | 294821 |
| 649 | Ga0495671_0000238 | 3300046692 | Bacteria | 47528 |
| 650 | Ga0495671_0000519 | 3300046692 | Bacteria | 29372 |
| 651 | Ga0495671_0000731 | 3300046692 | Bacteria | 23680 |
| 652 | Ga0495671_0004720 | 3300046692 | Bacteria | 8055 |
| 653 | Ga0495671_0009668 | 3300046692 | Bacteria | 5378 |
| 654 | Ga0495671_0022618 | 3300046692 | Bacteria | 3292 |
| 655 | Ga0495671_0024564 | 3300046692 | Bacteria | 3137 |
| 656 | Ga0495671_0060127 | 3300046692 | Bacteria | 1876 |
| 657 | Ga0495671_0076666 | 3300046692 | Bacteria | 1639 |
| 658 | Ga0495671_0077320 | 3300046692 | Bacteria | 1631 |
| 659 | Ga0495671_0092460 | 3300046692 | Bacteria | 1480 |
| 660 | Ga0495671_0118806 | 3300046692 | Bacteria | 1290 |
| 661 | Ga0495671_0162566 | 3300046692 | Bacteria | 1086 |
| 662 | Ga0495671_0223735 | 3300046692 | Bacteria | 911 |
| 663 | Ga0495671_0459257 | 3300046692 | Bacteria | 608 |
| 664 | Ga0495649_0000185 | 3300046694 | Bacteria | 54619 |
| 665 | Ga0495649_0000525 | 3300046694 | Bacteria | 32554 |
| 666 | Ga0495649_0001619 | 3300046694 | Bacteria | 16762 |
| 667 | Ga0495649_0012397 | 3300046694 | Bacteria | 4958 |
| 668 | Ga0495649_0013202 | 3300046694 | Bacteria | 4770 |
| 669 | Ga0495649_0083532 | 3300046694 | Bacteria | 1706 |
| 670 | Ga0495649_0097768 | 3300046694 | Bacteria | 1562 |
| 671 | Ga0495649_0196016 | 3300046694 | Bacteria | 1050 |
| 672 | Ga0495589_0000024 | 3300046794 | Bacteria | 191021 |
| 673 | Ga0495589_0000047 | 3300046794 | Bacteria | 117810 |
| 674 | Ga0495589_0000266 | 3300046794 | Bacteria | 42658 |
| 675 | Ga0495589_0000402 | 3300046794 | Bacteria | 32574 |
| 676 | Ga0495589_0002737 | 3300046794 | Bacteria | 9750 |
| 677 | Ga0495589_0009958 | 3300046794 | Bacteria | 4939 |
| 678 | Ga0495589_0048743 | 3300046794 | Bacteria | 2096 |
| 679 | Ga0495589_0061858 | 3300046794 | Bacteria | 1836 |
| 680 | Ga0495589_0067011 | 3300046794 | Bacteria | 1757 |
| 681 | Ga0495589_0097308 | 3300046794 | Bacteria | 1426 |
| 682 | Ga0495589_0173601 | 3300046794 | Bacteria | 1024 |
| 683 | Ga0495600_0021502 | 3300046809 | Bacteria | 4132 |
| 684 | Ga0495660_0000135 | 3300046810 | Bacteria | 80391 |
| 685 | Ga0495660_0000521 | 3300046810 | Bacteria | 31551 |
| 686 | Ga0495660_0000864 | 3300046810 | Bacteria | 22369 |
| 687 | Ga0495660_0002750 | 3300046810 | Bacteria | 11092 |
| 688 | Ga0495660_0009609 | 3300046810 | Bacteria | 5637 |
| 689 | Ga0495660_0013585 | 3300046810 | Bacteria | 4720 |
| 690 | Ga0495660_0014894 | 3300046810 | Bacteria | 4497 |
| 691 | Ga0495660_0017634 | 3300046810 | Bacteria | 4108 |
| 692 | Ga0495660_0027885 | 3300046810 | Bacteria | 3193 |
| 693 | Ga0495660_0058785 | 3300046810 | Bacteria | 2069 |
| 694 | Ga0495660_0059995 | 3300046810 | Bacteria | 2045 |
| 695 | Ga0495660_0065503 | 3300046810 | Bacteria | 1939 |
| 696 | Ga0495660_0066913 | 3300046810 | Bacteria | 1915 |
| 697 | Ga0495660_0068535 | 3300046810 | Bacteria | 1887 |
| 698 | Ga0495660_0094411 | 3300046810 | Bacteria | 1549 |
| 699 | Ga0495581_0005630 | 3300047315 | Bacteria | 7262 |
| 700 | Ga0495581_0205348 | 3300047315 | Bacteria | 1152 |
| 701 | Ga0495581_0290280 | 3300047315 | Bacteria | 956 |
| 702 | Ga0495581_0517437 | 3300047315 | Bacteria | 693 |
| 703 | Ga0495604_0049891 | 3300047317 | Bacteria | 3250 |
| 704 | Ga0495604_0118845 | 3300047317 | Bacteria | 1915 |
| 705 | Ga0495604_0338766 | 3300047317 | Bacteria | 1002 |
| 706 | Ga0495636_0019183 | 3300047318 | Bacteria | 2747 |
| 707 | Ga0495636_0040419 | 3300047318 | Bacteria | 1933 |
| 708 | Ga0495636_0060644 | 3300047318 | Bacteria | 1598 |
| 709 | Ga0495636_0114861 | 3300047318 | Bacteria | 1187 |
| 710 | Ga0495636_0379018 | 3300047318 | Bacteria | 671 |
| 711 | Ga0495674_0006108 | 3300047319 | Bacteria | 11566 |
| 712 | Ga0495674_0569305 | 3300047319 | Bacteria | 900 |
| 713 | Ga0495672_0000305 | 3300047320 | Bacteria | 66204 |
| 714 | Ga0495672_0000328 | 3300047320 | Bacteria | 62377 |
| 715 | Ga0495672_0000765 | 3300047320 | Bacteria | 34954 |
| 716 | Ga0495672_0000944 | 3300047320 | Bacteria | 30335 |
| 717 | Ga0495672_0002149 | 3300047320 | Bacteria | 18430 |
| 718 | Ga0495672_0044545 | 3300047320 | Bacteria | 2661 |
| 719 | Ga0495672_0048672 | 3300047320 | Bacteria | 2513 |
| 720 | Ga0495672_0062064 | 3300047320 | Bacteria | 2151 |
| 721 | Ga0495672_0122139 | 3300047320 | Bacteria | 1382 |
| 722 | Ga0495672_0244440 | 3300047320 | Bacteria | 874 |
| 723 | Ga0495676_0042583 | 3300047321 | Bacteria | 3725 |
| 724 | Ga0495676_0054847 | 3300047321 | Bacteria | 3165 |
| 725 | Ga0495676_0056281 | 3300047321 | Bacteria | 3111 |
| 726 | Ga0495676_0083502 | 3300047321 | Bacteria | 2414 |
| 727 | Ga0495680_0031260 | 3300047322 | Bacteria | 4336 |
| 728 | Ga0495683_0000091 | 3300047323 | Bacteria | 91313 |
| 729 | Ga0495683_0000224 | 3300047323 | Bacteria | 53121 |
| 730 | Ga0495683_0001053 | 3300047323 | Bacteria | 19170 |
| 731 | Ga0495683_0016599 | 3300047323 | Bacteria | 3823 |
| 732 | Ga0495683_0031136 | 3300047323 | Bacteria | 2718 |
| 733 | Ga0495683_0034805 | 3300047323 | Bacteria | 2560 |
| 734 | Ga0495683_0040679 | 3300047323 | Bacteria | 2348 |
| 735 | Ga0495683_0044331 | 3300047323 | Bacteria | 2237 |
| 736 | Ga0495683_0074595 | 3300047323 | Bacteria | 1662 |
| 737 | Ga0495683_0114211 | 3300047323 | Bacteria | 1287 |
| 738 | Ga0495683_0131444 | 3300047323 | Bacteria | 1180 |
| 739 | Ga0495687_000008 | 3300047443 | Bacteria | 546666 |
| 740 | Ga0495687_000637 | 3300047443 | Bacteria | 40184 |
| 741 | Ga0495687_000931 | 3300047443 | Bacteria | 30356 |
| 742 | Ga0495687_000964 | 3300047443 | Bacteria | 29325 |
| 743 | Ga0495687_001219 | 3300047443 | Bacteria | 24597 |
| 744 | Ga0495687_052217 | 3300047443 | Bacteria | 1729 |
| 745 | Ga0495687_182527 | 3300047443 | Bacteria | 683 |
| 746 | Ga0495675_0008345 | 3300047444 | Bacteria | 6413 |
| 747 | Ga0495675_0081234 | 3300047444 | Bacteria | 2041 |
| 748 | Ga0495677_0000007 | 3300047445 | Bacteria | 181193 |
| 749 | Ga0495677_0000318 | 3300047445 | Bacteria | 20836 |
| 750 | Ga0495677_0006979 | 3300047445 | Bacteria | 4236 |
| 751 | Ga0495677_0009186 | 3300047445 | Bacteria | 3653 |
| 752 | Ga0495677_0010620 | 3300047445 | Bacteria | 3376 |
| 753 | Ga0495677_0019806 | 3300047445 | Bacteria | 2439 |
| 754 | Ga0495677_0040882 | 3300047445 | Bacteria | 1695 |
| 755 | Ga0495677_0053331 | 3300047445 | Bacteria | 1491 |
| 756 | Ga0495677_0073180 | 3300047445 | Bacteria | 1278 |
| 757 | Ga0495677_0084560 | 3300047445 | Bacteria | 1191 |
| 758 | Ga0495677_0131090 | 3300047445 | Bacteria | 959 |
| 759 | Ga0495677_0133197 | 3300047445 | Bacteria | 952 |
| 760 | Ga0495677_0216445 | 3300047445 | Bacteria | 746 |
| 761 | Ga0495679_000083 | 3300047446 | Bacteria | 87051 |
| 762 | Ga0495679_003242 | 3300047446 | Bacteria | 7893 |
| 763 | Ga0495679_010172 | 3300047446 | Bacteria | 3712 |
| 764 | Ga0495679_015315 | 3300047446 | Bacteria | 2808 |
| 765 | Ga0495679_026669 | 3300047446 | Bacteria | 1915 |
| 766 | Ga0495679_141859 | 3300047446 | Bacteria | 648 |
| 767 | Ga0495685_001511 | 3300047447 | Bacteria | 7130 |
| 768 | Ga0495685_008358 | 3300047447 | Bacteria | 3436 |
| 769 | Ga0495685_011208 | 3300047447 | Bacteria | 3020 |
| 770 | Ga0495685_018263 | 3300047447 | Bacteria | 2405 |
| 771 | Ga0495685_074201 | 3300047447 | Bacteria | 1137 |
| 772 | Ga0495673_0000031 | 3300047469 | Bacteria | 447868 |
| 773 | Ga0495673_0000032 | 3300047469 | Bacteria | 375856 |
| 774 | Ga0495673_0000037 | 3300047469 | Bacteria | 307717 |
| 775 | Ga0495673_0000193 | 3300047469 | Bacteria | 96057 |
| 776 | Ga0495673_0000994 | 3300047469 | Bacteria | 25254 |
| 777 | Ga0495673_0065861 | 3300047469 | Bacteria | 1537 |
| 778 | Ga0495681_0000317 | 3300047470 | Bacteria | 38608 |
| 779 | Ga0495681_0000836 | 3300047470 | Bacteria | 23720 |
| 780 | Ga0495681_0001240 | 3300047470 | Bacteria | 19389 |
| 781 | Ga0495681_0001397 | 3300047470 | Bacteria | 18193 |
| 782 | Ga0495681_0004217 | 3300047470 | Bacteria | 9859 |
| 783 | Ga0495681_0004922 | 3300047470 | Bacteria | 9021 |
| 784 | Ga0495681_0014221 | 3300047470 | Bacteria | 4577 |
| 785 | Ga0495681_0018340 | 3300047470 | Bacteria | 3858 |
| 786 | Ga0495681_0024976 | 3300047470 | Bacteria | 3133 |
| 787 | Ga0495681_0025558 | 3300047470 | Bacteria | 3088 |
| 788 | Ga0495681_0030196 | 3300047470 | Bacteria | 2763 |
| 789 | Ga0495681_0041507 | 3300047470 | Bacteria | 2232 |
| 790 | Ga0495681_0043732 | 3300047470 | Bacteria | 2157 |
| 791 | Ga0495681_0111489 | 3300047470 | Bacteria | 1184 |
| 792 | Ga0495686_0000735 | 3300047472 | Bacteria | 43727 |
| 793 | Ga0495686_0001460 | 3300047472 | Bacteria | 25736 |
| 794 | Ga0495686_0001857 | 3300047472 | Bacteria | 21192 |
| 795 | Ga0495686_0003344 | 3300047472 | Bacteria | 13993 |
| 796 | Ga0495686_0014278 | 3300047472 | Bacteria | 5472 |
| 797 | Ga0495686_0018581 | 3300047472 | Bacteria | 4661 |
| 798 | Ga0495686_0033274 | 3300047472 | Bacteria | 3330 |
| 799 | Ga0495686_0054842 | 3300047472 | Bacteria | 2494 |
| 800 | Ga0495686_0071149 | 3300047472 | Bacteria | 2142 |
| 801 | Ga0495686_0078116 | 3300047472 | Bacteria | 2026 |
| 802 | Ga0495686_0132687 | 3300047472 | Bacteria | 1475 |
| 803 | Ga0495602_0001033 | 3300048088 | Bacteria | 27111 |
| 804 | Ga0495614_0152327 | 3300048089 | Bacteria | 1032 |
| 805 | Ga0495615_0012049 | 3300048090 | Bacteria | 1774 |
| 806 | Ga0495615_0050752 | 3300048090 | Bacteria | 1067 |
| 807 | Ga0495626_0000047 | 3300048091 | Bacteria | 161939 |
| 808 | Ga0495626_0000570 | 3300048091 | Bacteria | 36560 |
| 809 | Ga0495626_0000708 | 3300048091 | Bacteria | 31602 |
| 810 | Ga0495626_0001201 | 3300048091 | Bacteria | 21448 |
| 811 | Ga0495626_0001287 | 3300048091 | Bacteria | 20482 |
| 812 | Ga0495626_0001398 | 3300048091 | Bacteria | 19340 |
| 813 | Ga0495626_0003226 | 3300048091 | Bacteria | 10573 |
| 814 | Ga0495626_0003592 | 3300048091 | Bacteria | 9866 |
| 815 | Ga0495626_0008401 | 3300048091 | Bacteria | 5665 |
| 816 | Ga0495626_0013083 | 3300048091 | Bacteria | 4323 |
| 817 | Ga0495626_0019518 | 3300048091 | Bacteria | 3391 |
| 818 | Ga0495626_0037610 | 3300048091 | Bacteria | 2298 |
| 819 | Ga0495626_0051919 | 3300048091 | Bacteria | 1890 |
| 820 | Ga0495626_0072156 | 3300048091 | Bacteria | 1549 |
| 821 | Ga0495626_0081698 | 3300048091 | Bacteria | 1435 |
| 822 | Ga0495626_0256193 | 3300048091 | Bacteria | 700 |
| 823 | Ga0496100_0186843 | 3300048903 | Bacteria | 1502 |
| 824 | Ga0496100_0217886 | 3300048903 | Bacteria | 1399 |
| 825 | Ga0496100_0562175 | 3300048903 | Bacteria | 883 |
| 826 | Ga0496101_0000029 | 3300048904 | Bacteria | 198515 |
| 827 | Ga0496101_0620962 | 3300048904 | Bacteria | 854 |
| 828 | Ga0496102_0000202 | 3300048905 | Bacteria | 80040 |
| 829 | Ga0496102_0001226 | 3300048905 | Bacteria | 23222 |
| 830 | Ga0496102_0199781 | 3300048905 | Bacteria | 1884 |
| 831 | Ga0496102_0495558 | 3300048905 | Bacteria | 1143 |
| 832 | Ga0496103_0016417 | 3300048906 | Bacteria | 4418 |
| 833 | Ga0496103_0444957 | 3300048906 | Bacteria | 831 |
| 834 | Ga0496103_0555790 | 3300048906 | Bacteria | 732 |
| 835 | Ga0496104_0128831 | 3300048907 | Bacteria | 2430 |
| 836 | Ga0496105_0068802 | 3300048908 | Bacteria | 2925 |
| 837 | Ga0496106_0018042 | 3300048909 | Bacteria | 5217 |
| 838 | Ga0496106_0149151 | 3300048909 | Bacteria | 1844 |
| 839 | Ga0496107_0063377 | 3300048910 | Bacteria | 2679 |
| 840 | Ga0496107_0064745 | 3300048910 | Bacteria | 2650 |
| 841 | Ga0496109_0347673 | 3300048912 | Bacteria | 1401 |
| 842 | Ga0496110_0001122 | 3300048913 | Bacteria | 18904 |
| 843 | Ga0496110_0002331 | 3300048913 | Bacteria | 14193 |
| 844 | Ga0496110_0590413 | 3300048913 | Bacteria | 1008 |
| 845 | Ga0496111_0025137 | 3300048914 | Bacteria | 4200 |
| 846 | Ga0496111_0116867 | 3300048914 | Bacteria | 1967 |
| 847 | Ga0496111_0178607 | 3300048914 | Bacteria | 1578 |
| 848 | Ga0496115_0003645 | 3300048918 | Bacteria | 11085 |
| 849 | Ga0496115_0011759 | 3300048918 | Bacteria | 6574 |
| 850 | Ga0496115_0109062 | 3300048918 | Bacteria | 2273 |
| 851 | Ga0496116_0000003 | 3300048919 | Bacteria | 858374 |
| 852 | Ga0496116_0015099 | 3300048919 | Bacteria | 6123 |
| 853 | Ga0496116_0017691 | 3300048919 | Bacteria | 5523 |
| 854 | Ga0496116_0023670 | 3300048919 | Bacteria | 4567 |
| 855 | Ga0496116_0034370 | 3300048919 | Bacteria | 3578 |
| 856 | Ga0496116_0035534 | 3300048919 | Bacteria | 3499 |
| 857 | Ga0496116_0048326 | 3300048919 | Bacteria | 2856 |
| 858 | Ga0496116_0098145 | 3300048919 | Bacteria | 1758 |
| 859 | Ga0496116_0368221 | 3300048919 | Bacteria | 650 |
| 860 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 861 | Ga0496117_0026769 | 3300048920 | Bacteria | 4505 |
| 862 | Ga0496117_0081126 | 3300048920 | Bacteria | 2130 |
| 863 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 864 | Ga0496118_0033984 | 3300048921 | Bacteria | 4171 |
| 865 | Ga0496118_0042722 | 3300048921 | Bacteria | 3572 |
| 866 | Ga0496118_0081704 | 3300048921 | Bacteria | 2268 |
| 867 | Ga0496119_0000001 | 3300048922 | Bacteria | 789520 |
| 868 | Ga0496119_0022619 | 3300048922 | Bacteria | 4492 |
| 869 | Ga0496119_0032968 | 3300048922 | Bacteria | 3444 |
| 870 | Ga0496119_0234918 | 3300048922 | Bacteria | 931 |
| 871 | Ga0496120_0000493 | 3300048923 | Bacteria | 61700 |
| 872 | Ga0496120_0086359 | 3300048923 | Bacteria | 1686 |
| 873 | Ga0496121_0016262 | 3300048924 | Bacteria | 7694 |
| 874 | Ga0496121_0017738 | 3300048924 | Bacteria | 7242 |
| 875 | Ga0496121_0034218 | 3300048924 | Bacteria | 4577 |
| 876 | Ga0496121_0069404 | 3300048924 | Bacteria | 2844 |
| 877 | Ga0496121_0200929 | 3300048924 | Bacteria | 1421 |
| 878 | Ga0496121_0383341 | 3300048924 | Bacteria | 926 |
| 879 | Ga0496122_0000093 | 3300048925 | Bacteria | 204176 |
| 880 | Ga0496122_0001676 | 3300048925 | Bacteria | 34352 |
| 881 | Ga0496122_0005717 | 3300048925 | Bacteria | 14657 |
| 882 | Ga0496122_0009914 | 3300048925 | Bacteria | 9924 |
| 883 | Ga0496122_0054802 | 3300048925 | Bacteria | 2990 |
| 884 | Ga0496122_0066596 | 3300048925 | Bacteria | 2600 |
| 885 | Ga0496122_0347207 | 3300048925 | Bacteria | 776 |
| 886 | Ga0496123_0000125 | 3300048926 | Bacteria | 158076 |
| 887 | Ga0496123_0002807 | 3300048926 | Bacteria | 20674 |
| 888 | Ga0496123_0004561 | 3300048926 | Bacteria | 14446 |
| 889 | Ga0496123_0005967 | 3300048926 | Bacteria | 11994 |
| 890 | Ga0496123_0006479 | 3300048926 | Bacteria | 11331 |
| 891 | Ga0496123_0009487 | 3300048926 | Bacteria | 8759 |
| 892 | Ga0496123_0021664 | 3300048926 | Bacteria | 4986 |
| 893 | Ga0496123_0068724 | 3300048926 | Bacteria | 2229 |
| 894 | Ga0496124_0000449 | 3300048927 | Bacteria | 72320 |
| 895 | Ga0496124_0003087 | 3300048927 | Bacteria | 20728 |
| 896 | Ga0496124_0007374 | 3300048927 | Bacteria | 11702 |
| 897 | Ga0496124_0015702 | 3300048927 | Bacteria | 7241 |
| 898 | Ga0496124_0028614 | 3300048927 | Bacteria | 4983 |
| 899 | Ga0496124_0051177 | 3300048927 | Bacteria | 3516 |
| 900 | Ga0496124_0088747 | 3300048927 | Bacteria | 2526 |
| 901 | Ga0496124_0154124 | 3300048927 | Bacteria | 1799 |
| 902 | Ga0496124_0200527 | 3300048927 | Bacteria | 1518 |
| 903 | Ga0496124_0242562 | 3300048927 | Bacteria | 1339 |
| 904 | Ga0496124_0319322 | 3300048927 | Bacteria | 1113 |
| 905 | Ga0496125_0000049 | 3300048928 | Bacteria | 287250 |
| 906 | Ga0496125_0034579 | 3300048928 | Bacteria | 4451 |
| 907 | Ga0496125_0036570 | 3300048928 | Bacteria | 4283 |
| 908 | Ga0496125_0086001 | 3300048928 | Bacteria | 2380 |
| 909 | Ga0496125_0232986 | 3300048928 | Bacteria | 1176 |
| 910 | Ga0496125_0392016 | 3300048928 | Bacteria | 815 |
| 911 | Ga0496126_0011658 | 3300048929 | Bacteria | 9070 |
| 912 | Ga0496126_0087948 | 3300048929 | Bacteria | 2738 |
| 913 | Ga0496126_0112505 | 3300048929 | Bacteria | 2370 |
| 914 | Ga0496126_0173973 | 3300048929 | Bacteria | 1832 |
| 915 | Ga0496126_0684508 | 3300048929 | Bacteria | 799 |
| 916 | Ga0501306_017742 | 3300049127 | Bacteria | 968 |
| 917 | Ga0501308_000130 | 3300049128 | Bacteria | 3722 |
| 918 | Ga0501309_013539 | 3300049129 | Bacteria | 1086 |
| 919 | Ga0501304_000124 | 3300049160 | Bacteria | 3039 |
| 920 | Ga0501304_018166 | 3300049160 | Bacteria | 677 |
| 921 | Ga0501305_017264 | 3300049161 | Bacteria | 1036 |
| 922 | Ga0501307_003537 | 3300049162 | Bacteria | 1538 |
| 923 | Ga0495678_000020 | 3300049459 | Bacteria | 253654 |
| 924 | Ga0495678_000032 | 3300049459 | Bacteria | 212537 |
| 925 | Ga0495678_000188 | 3300049459 | Bacteria | 72283 |
| 926 | Ga0495678_000189 | 3300049459 | Bacteria | 72122 |
| 927 | Ga0495678_000264 | 3300049459 | Bacteria | 58107 |
| 928 | Ga0495678_000368 | 3300049459 | Bacteria | 46143 |
| 929 | Ga0495678_000795 | 3300049459 | Bacteria | 28292 |
| 930 | Ga0495678_001001 | 3300049459 | Bacteria | 24213 |
| 931 | Ga0495678_004390 | 3300049459 | Bacteria | 8179 |
| 932 | Ga0495678_006399 | 3300049459 | Bacteria | 6272 |
| 933 | Ga0495678_008330 | 3300049459 | Bacteria | 5243 |
| 934 | Ga0495678_020462 | 3300049459 | Bacteria | 2929 |
| 935 | Ga0495678_036787 | 3300049459 | Bacteria | 1994 |
| 936 | Ga0495678_053456 | 3300049459 | Bacteria | 1550 |
| 937 | Ga0495682_0002972 | 3300049460 | Bacteria | 7740 |
| 938 | Ga0495682_0004832 | 3300049460 | Bacteria | 5690 |
| 939 | Ga0495682_0005056 | 3300049460 | Bacteria | 5539 |
| 940 | Ga0495682_0007345 | 3300049460 | Bacteria | 4394 |
| 941 | Ga0495682_0012485 | 3300049460 | Bacteria | 3256 |
| 942 | Ga0495682_0016296 | 3300049460 | Bacteria | 2813 |
| 943 | Ga0495682_0174083 | 3300049460 | Bacteria | 765 |
| 944 | Ga0501312_041899 | 3300049528 | Bacteria | 750 |
| 945 | Ga0501314_004864 | 3300049530 | Bacteria | 1128 |
| 946 | Ga0501315_006614 | 3300049531 | Bacteria | 1296 |
| 947 | Ga0501315_018995 | 3300049531 | Bacteria | 911 |
| 948 | Ga0501318_001300 | 3300049534 | Bacteria | 1924 |
| 949 | Ga0501319_005482 | 3300049535 | Bacteria | 912 |
| 950 | Ga0501320_007751 | 3300049536 | Bacteria | 1041 |
| 951 | Ga0501321_009154 | 3300049537 | Bacteria | 1064 |
| 952 | Ga0501322_002053 | 3300049538 | Bacteria | 1205 |
| 953 | Ga0501323_013607 | 3300049539 | Bacteria | 1008 |
| 954 | Ga0501323_014644 | 3300049539 | Bacteria | 982 |
| 955 | Ga0501334_07325 | 3300049550 | Bacteria | 759 |
| 956 | Ga0501335_006826 | 3300049551 | Bacteria | 1046 |
| 957 | Ga0501249_003520 | 3300049679 | Bacteria | 3144 |
| 958 | Ga0501229_013289 | 3300049706 | Bacteria | 1057 |
| 959 | Ga0501269_000214 | 3300049766 | Bacteria | 17075 |
| 960 | Ga0501035_0001727 | 3300049822 | Bacteria | 22070 |
| 961 | nmdc:mga03683_181858_c1 | 3300050489 | Bacteria | 959 |
| 962 | nmdc:mga00v17_175812_c1 | 3300050491 | Bacteria | 1050 |
| 963 | nmdc:mga06z11_579638_c1 | 3300050494 | Bacteria | 682 |
| 964 | nmdc:mga08x19_1130_c1 | 3300050514 | Bacteria | 16636 |
| 965 | Ga0500594_0003023 | 3300053118 | Bacteria | 3681 |
| 966 | Ga0500618_000231 | 3300053125 | Bacteria | 43846 |
| 967 | Ga0500559_0004383 | 3300053136 | Bacteria | 6718 |
| 968 | Ga0500586_011675 | 3300053145 | Bacteria | 2525 |
| 969 | Ga0500616_0029402 | 3300053153 | Bacteria | 3024 |
| 970 | Ga0500636_0299392 | 3300053177 | Bacteria | 793 |
| 971 | Ga0587084_007047 | 3300059477 | Bacteria | 1385 |
| 972 | Ga0587066_043010 | 3300059490 | Bacteria | 859 |
| 973 | Ga0587070_007408 | 3300059491 | Bacteria | 1521 |
| 974 | Ga0587070_034513 | 3300059491 | Bacteria | 936 |
| 975 | Ga0587070_088119 | 3300059491 | Bacteria | 693 |
| 976 | Ga0587073_0085036 | 3300059492 | Bacteria | 793 |
| 977 | Ga0587082_002682 | 3300059504 | Bacteria | 2045 |
| 978 | Ga0587083_0071608 | 3300059505 | Bacteria | 806 |
| 979 | Ga0587088_004957 | 3300059508 | Bacteria | 1721 |
| 980 | Ga0587088_006407 | 3300059508 | Bacteria | 1587 |
| 981 | Ga0587091_045519 | 3300059511 | Bacteria | 882 |
| 982 | Ga0587094_043281 | 3300059513 | Bacteria | 741 |
| 983 | Ga0587098_003750 | 3300059604 | Bacteria | 1390 |
| 984 | Ga0587098_024306 | 3300059604 | Bacteria | 793 |
| 985 | Ga0587125_029107 | 3300059607 | Bacteria | 697 |
| 986 | Ga0587109_006348 | 3300059624 | Bacteria | 1743 |
| 987 | Ga0587062_000628 | 3300059639 | Bacteria | 2613 |
| 988 | Ga0587068_000732 | 3300059641 | Bacteria | 3254 |
| 989 | Ga0587069_005162 | 3300059642 | Bacteria | 1507 |
| 990 | Ga0587075_003340 | 3300059644 | Bacteria | 1781 |
| 991 | Ga0587076_004491 | 3300059645 | Bacteria | 1744 |
| 992 | Ga0587079_035845 | 3300059647 | Bacteria | 978 |
| 993 | Ga0587102_015188 | 3300059649 | Bacteria | 816 |
| 994 | Ga0587104_008736 | 3300059650 | Bacteria | 722 |
| 995 | Ga0587105_006279 | 3300059651 | Bacteria | 812 |
| 996 | Ga0587107_030229 | 3300059652 | Bacteria | 820 |
| 997 | Ga0587108_005403 | 3300059653 | Bacteria | 963 |
| 998 | Ga0587096_02842 | 3300060247 | Bacteria | 671 |
| 999 | Ga0466962_0056340 | 3300061719 | Bacteria | 1877 |
| 1000 | Ga0466962_0084531 | 3300061719 | Bacteria | 1518 |
| 1001 | Ga0466962_0177803 | 3300061719 | Bacteria | 1037 |
| 1002 | Ga0495584_0066478 | |||
| 1003 | MRS1b_contig_4452190 | |||
| 1004 | JGI25152J39213_1000269 | |||
| 1005 | rootH2_10190752 | |||
| 1006 | Ga0007410J51695_1031617 | |||
| 1007 | Ga0007409J51694_1009621 | |||
| 1008 | Ga0055525_1000006 | |||
| 1009 | Ga0055529_1000027 | |||
| 1010 | Ga0055526_1000255 | |||
| 1011 | Ga0055526_1002817 | |||
| 1012 | Ga0055537_1000103 | |||
| 1013 | Ga0055534_1000317 | |||
| 1014 | Ga0055528_1000031 | |||
| 1015 | Ga0058692_1006105 | |||
| 1016 | Ga0065165_1001722 | |||
| 1017 | Ga0065165_1032128 | |||
| 1018 | Ga0070658_10314973 | |||
| 1019 | Ga0070658_10548397 | |||
| 1020 | Ga0070676_10088511 | |||
| 1021 | Ga0070660_100207444 | |||
| 1022 | Ga0070675_101011507 | |||
| 1023 | Ga0070700_100000075 | |||
| 1024 | Ga0070663_100231512 | |||
| 1025 | Ga0070678_101094212 | |||
| 1026 | Ga0070684_101166624 | |||
| 1027 | Ga0068853_100130090 | |||
| 1028 | Ga0068855_100041266 | |||
| 1029 | Ga0068856_101449653 | |||
| 1030 | Ga0068852_100727862 | |||
| 1031 | Ga0068851_10625461 | |||
| 1032 | Ga0075367_10569162 | |||
| 1033 | Ga0097621_100288182 | |||
| 1034 | Ga0068871_100800850 | |||
| 1035 | Ga0068865_100091524 | |||
| 1036 | Ga0075436_100001369 | |||
| 1037 | Ga0079104_1001753 | |||
| 1038 | Ga0105251_10013378 | |||
| 1039 | Ga0105251_10029677 | |||
| 1040 | Ga0105244_10000413 | |||
| 1041 | Ga0105244_10009929 | |||
| 1042 | Ga0105244_10041153 | |||
| 1043 | Ga0105244_10066709 | |||
| 1044 | Ga0105244_10120120 | |||
| 1045 | Ga0105250_10014054 | |||
| 1046 | Ga0105241_10008918 | |||
| 1047 | Ga0105242_10032034 | |||
| 1048 | Ga0105237_10089852 | |||
| 1049 | Ga0105238_10091890 | |||
| 1050 | Ga0105239_10274105 | |||
| 1051 | Ga0105246_10341772 | |||
| 1052 | Ga0157373_10000104 | |||
| 1053 | Ga0157373_10002311 | |||
| 1054 | Ga0157371_10000077 | |||
| 1055 | Ga0157371_10000287 | |||
| 1056 | Ga0157371_10002111 | |||
| 1057 | Ga0157371_10108123 | |||
| 1058 | Ga0157369_10001457 | |||
| 1059 | Ga0157369_10506610 | |||
| 1060 | Ga0157374_11021460 | |||
| 1061 | Ga0157378_10363044 | |||
| 1062 | Ga0157372_10009448 | |||
| 1063 | Ga0157372_10370228 | |||
| 1064 | Ga0182008_10000119 | |||
| 1065 | Ga0182008_10054949 | |||
| 1066 | Ga0182006_1000067 | |||
| 1067 | Ga0182007_10000123 | |||
| 1068 | Ga0182005_1000002 | |||
| 1069 | Ga0163161_10052490 | |||
| 1070 | Ga0206351_10121764 | |||
| 1071 | Ga0206351_10175741 | |||
| 1072 | Ga0206352_11130243 | |||
| 1073 | Ga0206350_10126696 | |||
| 1074 | Ga0206350_10466205 | |||
| 1075 | Ga0206354_11461571 | |||
| 1076 | Ga0154015_1164890 | |||
| 1077 | Ga0213872_10000817 | |||
| 1078 | Ga0213872_10084916 | |||
| 1079 | Ga0213876_10000739 | |||
| 1080 | Ga0213875_10054315 | |||
| 1081 | Ga0224712_10035881 | |||
| 1082 | Ga0209563_100022 | |||
| 1083 | Ga0209437_102183 | |||
| 1084 | Ga0207425_1000212 | |||
| 1085 | Ga0207425_1017463 | |||
| 1086 | Ga0209646_1000126 | |||
| 1087 | Ga0209677_103931 | |||
| 1088 | Ga0209148_1008351 | |||
| 1089 | Ga0209759_1008072 | |||
| 1090 | Ga0209129_1000004 | |||
| 1091 | Ga0209565_1000035 | |||
| 1092 | Ga0209455_1000033 | |||
| 1093 | Ga0209673_1000006 | |||
| 1094 | Ga0209675_1000005 | |||
| 1095 | Ga0209025_1011901 | |||
| 1096 | Ga0209564_1000028 | |||
| 1097 | Ga0209564_1000032 | |||
| 1098 | Ga0209564_1000083 | |||
| 1099 | Ga0209758_1003060 | |||
| 1100 | Ga0209256_1000141 | |||
| 1101 | Ga0207656_10167613 | |||
| 1102 | Ga0207696_1000525 | |||
| 1103 | Ga0207655_1000075 | |||
| 1104 | Ga0207655_1000211 | |||
| 1105 | Ga0207655_1001333 | |||
| 1106 | Ga0207655_1008337 | |||
| 1107 | Ga0207655_1019685 | |||
| 1108 | Ga0207655_1051392 | |||
| 1109 | Ga0207713_1021905 | |||
| 1110 | Ga0207713_1057471 | |||
| 1111 | Ga0207713_1080751 | |||
| 1112 | Ga0207645_10231082 | |||
| 1113 | Ga0207705_10003242 | |||
| 1114 | Ga0207705_10294203 | |||
| 1115 | Ga0207705_10430677 | |||
| 1116 | Ga0207654_10273865 | |||
| 1117 | Ga0207695_10421815 | |||
| 1118 | Ga0207671_10000532 | |||
| 1119 | Ga0207671_10188671 | |||
| 1120 | Ga0207660_10350672 | |||
| 1121 | Ga0207657_10177183 | |||
| 1122 | Ga0207657_10407549 | |||
| 1123 | Ga0207690_10059576 | |||
| 1124 | Ga0207690_10086663 | |||
| 1125 | Ga0207706_10400674 | |||
| 1126 | Ga0207709_10023315 | |||
| 1127 | Ga0207704_10091230 | |||
| 1128 | Ga0207667_10071743 | |||
| 1129 | Ga0207639_10677875 | |||
| 1130 | Ga0207678_10238821 | |||
| 1131 | Ga0207678_10249836 | |||
| 1132 | Ga0207708_10000097 | |||
| 1133 | Ga0207702_10568292 | |||
| 1134 | Ga0207698_11048266 | |||
| 1135 | Ga0209281_1000945 | |||
| 1136 | Ga0209371_1000247 | |||
| 1137 | Ga0209371_1001309 | |||
| 1138 | Ga0209371_1010092 | |||
| 1139 | Ga0268266_10338620 | |||
| 1140 | Ga0268256_1000129 | |||
| 1141 | Ga0268256_1001109 | |||
| 1142 | Ga0268256_1011519 | |||
| 1143 | Ga0316177_1024763 | |||
| 1144 | Ga0314311_1205692 | |||
| 1145 | Ga0316178_1068594 | |||
| 1146 | Ga0316178_1165183 | |||
| 1147 | Ga0316180_1077983 | |||
| 1148 | Ga0316180_1158392 | |||
| 1149 | Ga0316181_1251613 | |||
| 1150 | Ga0316182_1009132 | |||
| 1151 | Ga0316182_1163827 | |||
| 1152 | Ga0316182_1211468 | |||
| 1153 | Ga0307513_10017979 | |||
| 1154 | Ga0307518_10010347 | |||
| 1155 | Ga0307406_10263812 | |||
| 1156 | Ga0307412_11136770 | |||
| 1157 | Ga0307415_100373660 | |||
| 1158 | Ga0307415_101367374 | |||
| 1159 | Ga0395899_0000123 | |||
| 1160 | Ga0395899_0013530 | |||
| 1161 | Ga0395899_0080946 | |||
| 1162 | Ga0395899_0346559 | |||
| 1163 | Ga0395900_0000091 | |||
| 1164 | Ga0395900_0000412 | |||
| 1165 | Ga0395900_0026912 | |||
| 1166 | Ga0395900_0027894 | |||
| 1167 | Ga0395900_0176908 | |||
| 1168 | Ga0395900_0265766 | |||
| 1169 | Ga0395900_0380124 | |||
| 1170 | Ga0395900_0399178 | |||
| 1171 | Ga0395900_0436178 | |||
| 1172 | Ga0395900_0482062 | |||
| 1173 | Ga0395898_0193089 | |||
| 1174 | Ga0395898_0400580 | |||
| 1175 | Ga0395898_0524882 | |||
| 1176 | Ga0395898_0657461 | |||
| 1177 | Ga0395898_0826800 | |||
| 1178 | Ga0395905_0032094 | |||
| 1179 | Ga0395905_0459494 | |||
| 1180 | Ga0395905_0508788 | |||
| 1181 | Ga0436364_0389133 | |||
| 1182 | Ga0395901_0000629 | |||
| 1183 | Ga0395901_0000959 | |||
| 1184 | Ga0395901_0004830 | |||
| 1185 | Ga0395901_0353822 | |||
| 1186 | Ga0395901_0543195 | |||
| 1187 | Ga0395901_1164575 | |||
| 1188 | Ga0436365_0876968 | |||
| 1189 | Ga0436361_0399914 | |||
| 1190 | Ga0436361_0693625 | |||
| 1191 | Ga0451843_0173729 | |||
| 1192 | Ga0439448_0000386 | |||
| 1193 | Ga0439432_006025 | |||
| 1194 | Ga0439432_074723 | |||
| 1195 | Ga0439449_0045194 | |||
| 1196 | Ga0439452_000016 | |||
| 1197 | Ga0439455_0032758 | |||
| 1198 | Ga0450904_000390 | |||
| 1199 | Ga0439458_0004986 | |||
| 1200 | Ga0439458_0035767 | |||
| 1201 | Ga0466969_0138920 | |||
| 1202 | Ga0466969_0199319 | |||
| 1203 | Ga0466965_0008261 | |||
| 1204 | Ga0466965_0093983 | |||
| 1205 | Ga0466965_0187611 | |||
| 1206 | Ga0466965_0345959 | |||
| 1207 | Ga0466966_0059326 | |||
| 1208 | Ga0466966_0174024 | |||
| 1209 | Ga0466961_0235792 | |||
| 1210 | Ga0466964_0002105 | |||
| 1211 | Ga0466964_0026785 | |||
| 1212 | Ga0453684_0076776 | |||
| 1213 | Ga0466968_0000110 | |||
| 1214 | Ga0466968_0005851 | |||
| 1215 | Ga0466968_0219917 | |||
| 1216 | Ga0466970_0345217 | |||
| 1217 | Ga0466957_0000031 | |||
| 1218 | Ga0466957_0280342 | |||
| 1219 | Ga0466959_0015944 | |||
| 1220 | Ga0466959_0240201 | |||
| 1221 | Ga0466959_0272733 | |||
| 1222 | Ga0466959_0333487 | |||
| 1223 | Ga0466959_0346940 | |||
| 1224 | Ga0466959_0756348 | |||
| 1225 | Ga0451576_0000200 | |||
| 1226 | Ga0466958_0245988 | |||
| 1227 | Ga0466958_0805424 | |||
| 1228 | Ga0466967_0089730 | |||
| 1229 | Ga0466967_0228059 | |||
| 1230 | Ga0466967_0313197 | |||
| 1231 | Ga0495617_000108 | |||
| 1232 | Ga0495617_001398 | |||
| 1233 | Ga0495617_011543 | |||
| 1234 | Ga0495627_000140 | |||
| 1235 | Ga0495627_000249 | |||
| 1236 | Ga0495627_001076 | |||
| 1237 | Ga0495627_003674 | |||
| 1238 | Ga0495627_003968 | |||
| 1239 | Ga0495603_0023473 | |||
| 1240 | Ga0495603_0069635 | |||
| 1241 | Ga0495590_0000058 | |||
| 1242 | Ga0495590_0000263 | |||
| 1243 | Ga0495590_0001394 | |||
| 1244 | Ga0495590_0001595 | |||
| 1245 | Ga0495590_0012621 | |||
| 1246 | Ga0495590_0047872 | |||
| 1247 | Ga0495591_000017 | |||
| 1248 | Ga0495591_000132 | |||
| 1249 | Ga0495591_004768 | |||
| 1250 | Ga0495629_0005404 | |||
| 1251 | Ga0495629_0007599 | |||
| 1252 | Ga0495629_0382847 | |||
| 1253 | Ga0495638_0000229 | |||
| 1254 | Ga0495638_0001259 | |||
| 1255 | Ga0495638_0004201 | |||
| 1256 | Ga0495638_0005840 | |||
| 1257 | Ga0495638_0030750 | |||
| 1258 | Ga0495638_0196462 | |||
| 1259 | Ga0495653_0000029 | |||
| 1260 | Ga0495653_0048085 | |||
| 1261 | Ga0495653_0179681 | |||
| 1262 | Ga0495650_0000146 | |||
| 1263 | Ga0495650_0000359 | |||
| 1264 | Ga0495650_0000460 | |||
| 1265 | Ga0495650_0000463 | |||
| 1266 | Ga0495650_0001164 | |||
| 1267 | Ga0495650_0001990 | |||
| 1268 | Ga0495650_0002128 | |||
| 1269 | Ga0495650_0004597 | |||
| 1270 | Ga0495650_0022009 | |||
| 1271 | Ga0495650_0029661 | |||
| 1272 | Ga0495580_0020170 | |||
| 1273 | Ga0495582_0006434 | |||
| 1274 | Ga0495605_0000036 | |||
| 1275 | Ga0495605_0000039 | |||
| 1276 | Ga0495605_0000407 | |||
| 1277 | Ga0495605_0032512 | |||
| 1278 | Ga0495605_0036355 | |||
| 1279 | Ga0495605_0097662 | |||
| 1280 | Ga0495605_0122966 | |||
| 1281 | Ga0495639_0007677 | |||
| 1282 | Ga0495639_0025849 | |||
| 1283 | Ga0495639_0397370 | |||
| 1284 | Ga0495664_0381246 | |||
| 1285 | Ga0495584_0000013 | |||
| 1286 | Ga0495584_0000135 | |||
| 1287 | Ga0495584_0000487 | |||
| 1288 | Ga0495584_0001436 | |||
| 1289 | Ga0495584_0002431 | |||
| 1290 | Ga0495584_0024821 | |||
| 1291 | Ga0495584_0036425 | |||
| 1292 | Ga0495584_0052298 | |||
| 1293 | Ga0495584_0062743 | |||
| 1294 | Ga0495584_0086963 | |||
| 1295 | Ga0495584_0087108 | |||
| 1296 | Ga0495584_0116271 | |||
| 1297 | Ga0495584_0130945 | |||
| 1298 | Ga0495584_0157683 | |||
| 1299 | Ga0495584_0157935 | |||
| 1300 | Ga0495584_0183357 | |||
| 1301 | Ga0495585_0000022 | |||
| 1302 | Ga0495585_0000113 | |||
| 1303 | Ga0495585_0000829 | |||
| 1304 | Ga0495585_0001132 | |||
| 1305 | Ga0495585_0002488 | |||
| 1306 | Ga0495585_0016324 | |||
| 1307 | Ga0495585_0018215 | |||
| 1308 | Ga0495585_0043270 | |||
| 1309 | Ga0495585_0051576 | |||
| 1310 | Ga0495585_0080646 | |||
| 1311 | Ga0495585_0108734 | |||
| 1312 | Ga0495585_0123270 | |||
| 1313 | Ga0495585_0146506 | |||
| 1314 | Ga0495585_0153240 | |||
| 1315 | Ga0495585_0209286 | |||
| 1316 | Ga0495585_0227978 | |||
| 1317 | Ga0495594_0000535 | |||
| 1318 | Ga0495594_0006275 | |||
| 1319 | Ga0495594_0018653 | |||
| 1320 | Ga0495594_0030616 | |||
| 1321 | Ga0495594_0067170 | |||
| 1322 | Ga0495594_0071061 | |||
| 1323 | Ga0495594_0099492 | |||
| 1324 | Ga0495594_0133347 | |||
| 1325 | Ga0495596_0001491 | |||
| 1326 | Ga0495596_0001943 | |||
| 1327 | Ga0495596_0002010 | |||
| 1328 | Ga0495596_0003257 | |||
| 1329 | Ga0495596_0003642 | |||
| 1330 | Ga0495596_0005788 | |||
| 1331 | Ga0495596_0007607 | |||
| 1332 | Ga0495596_0043370 | |||
| 1333 | Ga0495596_0051759 | |||
| 1334 | Ga0495596_0057970 | |||
| 1335 | Ga0495596_0109913 | |||
| 1336 | Ga0495596_0136651 | |||
| 1337 | Ga0495596_0210332 | |||
| 1338 | Ga0495596_0238231 | |||
| 1339 | Ga0495607_0001566 | |||
| 1340 | Ga0495607_0001994 | |||
| 1341 | Ga0495607_0002732 | |||
| 1342 | Ga0495607_0006080 | |||
| 1343 | Ga0495607_0024544 | |||
| 1344 | Ga0495607_0028855 | |||
| 1345 | Ga0495607_0042553 | |||
| 1346 | Ga0495607_0069425 | |||
| 1347 | Ga0495607_0101926 | |||
| 1348 | Ga0495607_0103940 | |||
| 1349 | Ga0495607_0122235 | |||
| 1350 | Ga0495607_0165218 | |||
| 1351 | Ga0495607_0270492 | |||
| 1352 | Ga0495607_0358579 | |||
| 1353 | Ga0495583_0000028 | |||
| 1354 | Ga0495583_0000346 | |||
| 1355 | Ga0495583_0000907 | |||
| 1356 | Ga0495583_0001433 | |||
| 1357 | Ga0495583_0003983 | |||
| 1358 | Ga0495583_0008293 | |||
| 1359 | Ga0495583_0034576 | |||
| 1360 | Ga0495583_0044249 | |||
| 1361 | Ga0495583_0075561 | |||
| 1362 | Ga0495606_0000004 | |||
| 1363 | Ga0495606_0000542 | |||
| 1364 | Ga0495606_0000618 | |||
| 1365 | Ga0495606_0031660 | |||
| 1366 | Ga0495606_0035520 | |||
| 1367 | Ga0495606_0054269 | |||
| 1368 | Ga0495606_0060129 | |||
| 1369 | Ga0495606_0074428 | |||
| 1370 | Ga0495606_0092394 | |||
| 1371 | Ga0495606_0131891 | |||
| 1372 | Ga0495606_0167733 | |||
| 1373 | Ga0495606_0293827 | |||
| 1374 | Ga0495610_0000007 | |||
| 1375 | Ga0495610_0001009 | |||
| 1376 | Ga0495610_0002648 | |||
| 1377 | Ga0495610_0004527 | |||
| 1378 | Ga0495610_0005845 | |||
| 1379 | Ga0495610_0010045 | |||
| 1380 | Ga0495610_0051531 | |||
| 1381 | Ga0495616_0000376 | |||
| 1382 | Ga0495616_0000611 | |||
| 1383 | Ga0495616_0000659 | |||
| 1384 | Ga0495616_0000686 | |||
| 1385 | Ga0495616_0000689 | |||
| 1386 | Ga0495616_0005181 | |||
| 1387 | Ga0495616_0005223 | |||
| 1388 | Ga0495616_0007856 | |||
| 1389 | Ga0495616_0010942 | |||
| 1390 | Ga0495616_0027443 | |||
| 1391 | Ga0495616_0037642 | |||
| 1392 | Ga0495616_0039267 | |||
| 1393 | Ga0495616_0054746 | |||
| 1394 | Ga0495616_0090556 | |||
| 1395 | Ga0495616_0096630 | |||
| 1396 | Ga0495620_0000073 | |||
| 1397 | Ga0495620_0013794 | |||
| 1398 | Ga0495630_0042653 | |||
| 1399 | Ga0495631_0000479 | |||
| 1400 | Ga0495631_0001660 | |||
| 1401 | Ga0495631_0005867 | |||
| 1402 | Ga0495631_0007461 | |||
| 1403 | Ga0495631_0014323 | |||
| 1404 | Ga0495631_0020789 | |||
| 1405 | Ga0495631_0062551 | |||
| 1406 | Ga0495631_0063622 | |||
| 1407 | Ga0495631_0105316 | |||
| 1408 | Ga0495631_0117116 | |||
| 1409 | Ga0495631_0133516 | |||
| 1410 | Ga0495631_0142158 | |||
| 1411 | Ga0495631_0199972 | |||
| 1412 | Ga0495632_0000001 | |||
| 1413 | Ga0495632_0000212 | |||
| 1414 | Ga0495632_0000264 | |||
| 1415 | Ga0495632_0000674 | |||
| 1416 | Ga0495632_0001027 | |||
| 1417 | Ga0495632_0001229 | |||
| 1418 | Ga0495632_0002656 | |||
| 1419 | Ga0495632_0015773 | |||
| 1420 | Ga0495632_0030467 | |||
| 1421 | Ga0495632_0030836 | |||
| 1422 | Ga0495632_0075450 | |||
| 1423 | Ga0495632_0138145 | |||
| 1424 | Ga0495637_0000028 | |||
| 1425 | Ga0495637_0000145 | |||
| 1426 | Ga0495637_0000360 | |||
| 1427 | Ga0495637_0021081 | |||
| 1428 | Ga0495637_0053950 | |||
| 1429 | Ga0495637_0076051 | |||
| 1430 | Ga0495637_0084091 | |||
| 1431 | Ga0495643_0000020 | |||
| 1432 | Ga0495643_0000080 | |||
| 1433 | Ga0495643_0000318 | |||
| 1434 | Ga0495643_0000534 | |||
| 1435 | Ga0495643_0002025 | |||
| 1436 | Ga0495643_0006392 | |||
| 1437 | Ga0495643_0026586 | |||
| 1438 | Ga0495643_0030351 | |||
| 1439 | Ga0495643_0039658 | |||
| 1440 | Ga0495643_0069512 | |||
| 1441 | Ga0495644_0000274 | |||
| 1442 | Ga0495644_0003657 | |||
| 1443 | Ga0495644_0006697 | |||
| 1444 | Ga0495644_0015315 | |||
| 1445 | Ga0495644_0030340 | |||
| 1446 | Ga0495644_0032577 | |||
| 1447 | Ga0495644_0047295 | |||
| 1448 | Ga0495644_0063102 | |||
| 1449 | Ga0495644_0070794 | |||
| 1450 | Ga0495648_0000004 | |||
| 1451 | Ga0495648_0000047 | |||
| 1452 | Ga0495648_0000311 | |||
| 1453 | Ga0495648_0001397 | |||
| 1454 | Ga0495648_0002684 | |||
| 1455 | Ga0495648_0005717 | |||
| 1456 | Ga0495648_0008072 | |||
| 1457 | Ga0495648_0013125 | |||
| 1458 | Ga0495648_0022646 | |||
| 1459 | Ga0495648_0042145 | |||
| 1460 | Ga0495648_0174254 | |||
| 1461 | Ga0495648_0191968 | |||
| 1462 | Ga0495663_0000002 | |||
| 1463 | Ga0495663_0022936 | |||
| 1464 | Ga0495663_0059677 | |||
| 1465 | Ga0495666_0003876 | |||
| 1466 | Ga0495666_0004089 | |||
| 1467 | Ga0495666_0016373 | |||
| 1468 | Ga0495666_0026983 | |||
| 1469 | Ga0495666_0061624 | |||
| 1470 | Ga0495642_0002677 | |||
| 1471 | Ga0495642_0004431 | |||
| 1472 | Ga0495642_0058278 | |||
| 1473 | Ga0495642_0068904 | |||
| 1474 | Ga0495642_0105065 | |||
| 1475 | Ga0495642_0106322 | |||
| 1476 | Ga0495642_0107947 | |||
| 1477 | Ga0495642_0185178 | |||
| 1478 | Ga0495642_0232904 | |||
| 1479 | Ga0495652_0003777 | |||
| 1480 | Ga0495652_0033748 | |||
| 1481 | Ga0495654_0000025 | |||
| 1482 | Ga0495654_0000246 | |||
| 1483 | Ga0495654_0000561 | |||
| 1484 | Ga0495654_0006416 | |||
| 1485 | Ga0495654_0007471 | |||
| 1486 | Ga0495654_0013471 | |||
| 1487 | Ga0495654_0025275 | |||
| 1488 | Ga0495654_0031291 | |||
| 1489 | Ga0495654_0032154 | |||
| 1490 | Ga0495654_0037642 | |||
| 1491 | Ga0495654_0069846 | |||
| 1492 | Ga0495654_0120340 | |||
| 1493 | Ga0495665_0000878 | |||
| 1494 | Ga0495665_0009972 | |||
| 1495 | Ga0495586_0170593 | |||
| 1496 | Ga0495587_0180900 | |||
| 1497 | Ga0495587_0219004 | |||
| 1498 | Ga0495609_0000005 | |||
| 1499 | Ga0495609_0000115 | |||
| 1500 | Ga0495609_0000933 | |||
| 1501 | Ga0495609_0001680 | |||
| 1502 | Ga0495609_0002709 | |||
| 1503 | Ga0495609_0002912 | |||
| 1504 | Ga0495609_0003559 | |||
| 1505 | Ga0495609_0022202 | |||
| 1506 | Ga0495609_0029000 | |||
| 1507 | Ga0495609_0029867 | |||
| 1508 | Ga0495609_0094501 | |||
| 1509 | Ga0495597_0000147 | |||
| 1510 | Ga0495597_0000161 | |||
| 1511 | Ga0495597_0000983 | |||
| 1512 | Ga0495597_0001304 | |||
| 1513 | Ga0495597_0003956 | |||
| 1514 | Ga0495597_0006022 | |||
| 1515 | Ga0495597_0011813 | |||
| 1516 | Ga0495597_0033732 | |||
| 1517 | Ga0495597_0041125 | |||
| 1518 | Ga0495597_0043304 | |||
| 1519 | Ga0495645_0053393 | |||
| 1520 | Ga0495645_0220747 | |||
| 1521 | Ga0495622_0000204 | |||
| 1522 | Ga0495622_0000567 | |||
| 1523 | Ga0495622_0016362 | |||
| 1524 | Ga0495622_0021765 | |||
| 1525 | Ga0495622_0124699 | |||
| 1526 | Ga0495633_0000028 | |||
| 1527 | Ga0495633_0000068 | |||
| 1528 | Ga0495633_0000094 | |||
| 1529 | Ga0495633_0000213 | |||
| 1530 | Ga0495633_0004241 | |||
| 1531 | Ga0495633_0006081 | |||
| 1532 | Ga0495633_0007208 | |||
| 1533 | Ga0495633_0007557 | |||
| 1534 | Ga0495633_0008071 | |||
| 1535 | Ga0495633_0010511 | |||
| 1536 | Ga0495633_0012141 | |||
| 1537 | Ga0495633_0014239 | |||
| 1538 | Ga0495633_0016968 | |||
| 1539 | Ga0495633_0017649 | |||
| 1540 | Ga0495633_0027444 | |||
| 1541 | Ga0495633_0039760 | |||
| 1542 | Ga0495633_0072914 | |||
| 1543 | Ga0495633_0079938 | |||
| 1544 | Ga0495633_0143064 | |||
| 1545 | Ga0495633_0187123 | |||
| 1546 | Ga0495633_0192930 | |||
| 1547 | Ga0495633_0196141 | |||
| 1548 | Ga0495633_0247142 | |||
| 1549 | Ga0495656_0015692 | |||
| 1550 | Ga0495656_0044981 | |||
| 1551 | Ga0495656_0124388 | |||
| 1552 | Ga0495656_0247534 | |||
| 1553 | Ga0495668_0000136 | |||
| 1554 | Ga0495668_0000444 | |||
| 1555 | Ga0495668_0000491 | |||
| 1556 | Ga0495668_0000773 | |||
| 1557 | Ga0495668_0000949 | |||
| 1558 | Ga0495668_0000972 | |||
| 1559 | Ga0495668_0001176 | |||
| 1560 | Ga0495668_0001816 | |||
| 1561 | Ga0495668_0002180 | |||
| 1562 | Ga0495668_0009195 | |||
| 1563 | Ga0495668_0009237 | |||
| 1564 | Ga0495668_0011282 | |||
| 1565 | Ga0495668_0024197 | |||
| 1566 | Ga0495668_0095711 | |||
| 1567 | Ga0495668_0197829 | |||
| 1568 | Ga0495668_0219337 | |||
| 1569 | Ga0495634_0004310 | |||
| 1570 | Ga0495634_0073745 | |||
| 1571 | Ga0495611_0000260 | |||
| 1572 | Ga0495611_0002212 | |||
| 1573 | Ga0495611_0009194 | |||
| 1574 | Ga0495611_0014795 | |||
| 1575 | Ga0495611_0018770 | |||
| 1576 | Ga0495611_0022485 | |||
| 1577 | Ga0495611_0024974 | |||
| 1578 | Ga0495611_0047384 | |||
| 1579 | Ga0495611_0058275 | |||
| 1580 | Ga0495611_0183080 | |||
| 1581 | Ga0495625_0000257 | |||
| 1582 | Ga0495625_0000633 | |||
| 1583 | Ga0495625_0002526 | |||
| 1584 | Ga0495625_0006889 | |||
| 1585 | Ga0495625_0009106 | |||
| 1586 | Ga0495625_0011668 | |||
| 1587 | Ga0495625_0012558 | |||
| 1588 | Ga0495625_0040810 | |||
| 1589 | Ga0495625_0049203 | |||
| 1590 | Ga0495625_0074307 | |||
| 1591 | Ga0495625_0081187 | |||
| 1592 | Ga0495625_0092746 | |||
| 1593 | Ga0495625_0172346 | |||
| 1594 | Ga0495625_0275145 | |||
| 1595 | Ga0495659_0000025 | |||
| 1596 | Ga0495659_0001206 | |||
| 1597 | Ga0495659_0039659 | |||
| 1598 | Ga0495661_0000211 | |||
| 1599 | Ga0495661_0000266 | |||
| 1600 | Ga0495661_0001391 | |||
| 1601 | Ga0495661_0001392 | |||
| 1602 | Ga0495661_0004919 | |||
| 1603 | Ga0495661_0016463 | |||
| 1604 | Ga0495661_0022038 | |||
| 1605 | Ga0495661_0034730 | |||
| 1606 | Ga0495661_0038083 | |||
| 1607 | Ga0495661_0041375 | |||
| 1608 | Ga0495661_0041435 | |||
| 1609 | Ga0495661_0055263 | |||
| 1610 | Ga0495661_0073999 | |||
| 1611 | Ga0495661_0113781 | |||
| 1612 | Ga0495661_0152046 | |||
| 1613 | Ga0495661_0209336 | |||
| 1614 | Ga0495661_0216088 | |||
| 1615 | Ga0495661_0316170 | |||
| 1616 | Ga0495588_0000059 | |||
| 1617 | Ga0495588_0004237 | |||
| 1618 | Ga0495588_0007489 | |||
| 1619 | Ga0495588_0051698 | |||
| 1620 | Ga0495588_0068058 | |||
| 1621 | Ga0495588_0087673 | |||
| 1622 | Ga0495588_0148792 | |||
| 1623 | Ga0495588_0223960 | |||
| 1624 | Ga0495588_0270369 | |||
| 1625 | Ga0495599_0063211 | |||
| 1626 | Ga0495599_0095526 | |||
| 1627 | Ga0495623_0003760 | |||
| 1628 | Ga0495623_0184029 | |||
| 1629 | Ga0495623_0464380 | |||
| 1630 | Ga0495669_0000095 | |||
| 1631 | Ga0495669_0000287 | |||
| 1632 | Ga0495669_0001028 | |||
| 1633 | Ga0495669_0004084 | |||
| 1634 | Ga0495669_0043221 | |||
| 1635 | Ga0495669_0096834 | |||
| 1636 | Ga0495613_0350777 | |||
| 1637 | Ga0495613_0631324 | |||
| 1638 | Ga0495624_0001233 | |||
| 1639 | Ga0495670_0001234 | |||
| 1640 | Ga0495670_0002960 | |||
| 1641 | Ga0495670_0009158 | |||
| 1642 | Ga0495670_0085018 | |||
| 1643 | Ga0495670_0088664 | |||
| 1644 | Ga0495670_0105103 | |||
| 1645 | Ga0495670_0126694 | |||
| 1646 | Ga0495670_0157173 | |||
| 1647 | Ga0495670_0189122 | |||
| 1648 | Ga0495670_0258370 | |||
| 1649 | Ga0495671_0000016 | |||
| 1650 | Ga0495671_0000238 | |||
| 1651 | Ga0495671_0000519 | |||
| 1652 | Ga0495671_0000731 | |||
| 1653 | Ga0495671_0004720 | |||
| 1654 | Ga0495671_0009668 | |||
| 1655 | Ga0495671_0022618 | |||
| 1656 | Ga0495671_0024564 | |||
| 1657 | Ga0495671_0060127 | |||
| 1658 | Ga0495671_0076666 | |||
| 1659 | Ga0495671_0077320 | |||
| 1660 | Ga0495671_0092460 | |||
| 1661 | Ga0495671_0118806 | |||
| 1662 | Ga0495671_0162566 | |||
| 1663 | Ga0495671_0223735 | |||
| 1664 | Ga0495671_0459257 | |||
| 1665 | Ga0495649_0000185 | |||
| 1666 | Ga0495649_0000525 | |||
| 1667 | Ga0495649_0001619 | |||
| 1668 | Ga0495649_0012397 | |||
| 1669 | Ga0495649_0013202 | |||
| 1670 | Ga0495649_0083532 | |||
| 1671 | Ga0495649_0097768 | |||
| 1672 | Ga0495649_0196016 | |||
| 1673 | Ga0495589_0000024 | |||
| 1674 | Ga0495589_0000047 | |||
| 1675 | Ga0495589_0000266 | |||
| 1676 | Ga0495589_0000402 | |||
| 1677 | Ga0495589_0002737 | |||
| 1678 | Ga0495589_0009958 | |||
| 1679 | Ga0495589_0048743 | |||
| 1680 | Ga0495589_0061858 | |||
| 1681 | Ga0495589_0067011 | |||
| 1682 | Ga0495589_0097308 | |||
| 1683 | Ga0495589_0173601 | |||
| 1684 | Ga0495600_0021502 | |||
| 1685 | Ga0495660_0000135 | |||
| 1686 | Ga0495660_0000521 | |||
| 1687 | Ga0495660_0000864 | |||
| 1688 | Ga0495660_0002750 | |||
| 1689 | Ga0495660_0009609 | |||
| 1690 | Ga0495660_0013585 | |||
| 1691 | Ga0495660_0014894 | |||
| 1692 | Ga0495660_0017634 | |||
| 1693 | Ga0495660_0027885 | |||
| 1694 | Ga0495660_0058785 | |||
| 1695 | Ga0495660_0059995 | |||
| 1696 | Ga0495660_0065503 | |||
| 1697 | Ga0495660_0066913 | |||
| 1698 | Ga0495660_0068535 | |||
| 1699 | Ga0495660_0094411 | |||
| 1700 | Ga0495581_0005630 | |||
| 1701 | Ga0495581_0205348 | |||
| 1702 | Ga0495581_0290280 | |||
| 1703 | Ga0495581_0517437 | |||
| 1704 | Ga0495604_0049891 | |||
| 1705 | Ga0495604_0118845 | |||
| 1706 | Ga0495604_0338766 | |||
| 1707 | Ga0495636_0019183 | |||
| 1708 | Ga0495636_0040419 | |||
| 1709 | Ga0495636_0060644 | |||
| 1710 | Ga0495636_0114861 | |||
| 1711 | Ga0495636_0379018 | |||
| 1712 | Ga0495674_0006108 | |||
| 1713 | Ga0495674_0569305 | |||
| 1714 | Ga0495672_0000305 | |||
| 1715 | Ga0495672_0000328 | |||
| 1716 | Ga0495672_0000765 | |||
| 1717 | Ga0495672_0000944 | |||
| 1718 | Ga0495672_0002149 | |||
| 1719 | Ga0495672_0044545 | |||
| 1720 | Ga0495672_0048672 | |||
| 1721 | Ga0495672_0062064 | |||
| 1722 | Ga0495672_0122139 | |||
| 1723 | Ga0495672_0244440 | |||
| 1724 | Ga0495676_0042583 | |||
| 1725 | Ga0495676_0054847 | |||
| 1726 | Ga0495676_0056281 | |||
| 1727 | Ga0495676_0083502 | |||
| 1728 | Ga0495680_0031260 | |||
| 1729 | Ga0495683_0000091 | |||
| 1730 | Ga0495683_0000224 | |||
| 1731 | Ga0495683_0001053 | |||
| 1732 | Ga0495683_0016599 | |||
| 1733 | Ga0495683_0031136 | |||
| 1734 | Ga0495683_0034805 | |||
| 1735 | Ga0495683_0040679 | |||
| 1736 | Ga0495683_0044331 | |||
| 1737 | Ga0495683_0074595 | |||
| 1738 | Ga0495683_0114211 | |||
| 1739 | Ga0495683_0131444 | |||
| 1740 | Ga0495687_000008 | |||
| 1741 | Ga0495687_000637 | |||
| 1742 | Ga0495687_000931 | |||
| 1743 | Ga0495687_000964 | |||
| 1744 | Ga0495687_001219 | |||
| 1745 | Ga0495687_052217 | |||
| 1746 | Ga0495687_182527 | |||
| 1747 | Ga0495675_0008345 | |||
| 1748 | Ga0495675_0081234 | |||
| 1749 | Ga0495677_0000007 | |||
| 1750 | Ga0495677_0000318 | |||
| 1751 | Ga0495677_0006979 | |||
| 1752 | Ga0495677_0009186 | |||
| 1753 | Ga0495677_0010620 | |||
| 1754 | Ga0495677_0019806 | |||
| 1755 | Ga0495677_0040882 | |||
| 1756 | Ga0495677_0053331 | |||
| 1757 | Ga0495677_0073180 | |||
| 1758 | Ga0495677_0084560 | |||
| 1759 | Ga0495677_0131090 | |||
| 1760 | Ga0495677_0133197 | |||
| 1761 | Ga0495677_0216445 | |||
| 1762 | Ga0495679_000083 | |||
| 1763 | Ga0495679_003242 | |||
| 1764 | Ga0495679_010172 | |||
| 1765 | Ga0495679_015315 | |||
| 1766 | Ga0495679_026669 | |||
| 1767 | Ga0495679_141859 | |||
| 1768 | Ga0495685_001511 | |||
| 1769 | Ga0495685_008358 | |||
| 1770 | Ga0495685_011208 | |||
| 1771 | Ga0495685_018263 | |||
| 1772 | Ga0495685_074201 | |||
| 1773 | Ga0495673_0000031 | |||
| 1774 | Ga0495673_0000032 | |||
| 1775 | Ga0495673_0000037 | |||
| 1776 | Ga0495673_0000193 | |||
| 1777 | Ga0495673_0000994 | |||
| 1778 | Ga0495673_0065861 | |||
| 1779 | Ga0495681_0000317 | |||
| 1780 | Ga0495681_0000836 | |||
| 1781 | Ga0495681_0001240 | |||
| 1782 | Ga0495681_0001397 | |||
| 1783 | Ga0495681_0004217 | |||
| 1784 | Ga0495681_0004922 | |||
| 1785 | Ga0495681_0014221 | |||
| 1786 | Ga0495681_0018340 | |||
| 1787 | Ga0495681_0024976 | |||
| 1788 | Ga0495681_0025558 | |||
| 1789 | Ga0495681_0030196 | |||
| 1790 | Ga0495681_0041507 | |||
| 1791 | Ga0495681_0043732 | |||
| 1792 | Ga0495681_0111489 | |||
| 1793 | Ga0495686_0000735 | |||
| 1794 | Ga0495686_0001460 | |||
| 1795 | Ga0495686_0001857 | |||
| 1796 | Ga0495686_0003344 | |||
| 1797 | Ga0495686_0014278 | |||
| 1798 | Ga0495686_0018581 | |||
| 1799 | Ga0495686_0033274 | |||
| 1800 | Ga0495686_0054842 | |||
| 1801 | Ga0495686_0071149 | |||
| 1802 | Ga0495686_0078116 | |||
| 1803 | Ga0495686_0132687 | |||
| 1804 | Ga0495602_0001033 | |||
| 1805 | Ga0495614_0152327 | |||
| 1806 | Ga0495615_0012049 | |||
| 1807 | Ga0495615_0050752 | |||
| 1808 | Ga0495626_0000047 | |||
| 1809 | Ga0495626_0000570 | |||
| 1810 | Ga0495626_0000708 | |||
| 1811 | Ga0495626_0001201 | |||
| 1812 | Ga0495626_0001287 | |||
| 1813 | Ga0495626_0001398 | |||
| 1814 | Ga0495626_0003226 | |||
| 1815 | Ga0495626_0003592 | |||
| 1816 | Ga0495626_0008401 | |||
| 1817 | Ga0495626_0013083 | |||
| 1818 | Ga0495626_0019518 | |||
| 1819 | Ga0495626_0037610 | |||
| 1820 | Ga0495626_0051919 | |||
| 1821 | Ga0495626_0072156 | |||
| 1822 | Ga0495626_0081698 | |||
| 1823 | Ga0495626_0256193 | |||
| 1824 | Ga0496100_0186843 | |||
| 1825 | Ga0496100_0217886 | |||
| 1826 | Ga0496100_0562175 | |||
| 1827 | Ga0496101_0000029 | |||
| 1828 | Ga0496101_0620962 | |||
| 1829 | Ga0496102_0000202 | |||
| 1830 | Ga0496102_0001226 | |||
| 1831 | Ga0496102_0199781 | |||
| 1832 | Ga0496102_0495558 | |||
| 1833 | Ga0496103_0016417 | |||
| 1834 | Ga0496103_0444957 | |||
| 1835 | Ga0496103_0555790 | |||
| 1836 | Ga0496104_0128831 | |||
| 1837 | Ga0496105_0068802 | |||
| 1838 | Ga0496106_0018042 | |||
| 1839 | Ga0496106_0149151 | |||
| 1840 | Ga0496107_0063377 | |||
| 1841 | Ga0496107_0064745 | |||
| 1842 | Ga0496109_0347673 | |||
| 1843 | Ga0496110_0001122 | |||
| 1844 | Ga0496110_0002331 | |||
| 1845 | Ga0496110_0590413 | |||
| 1846 | Ga0496111_0025137 | |||
| 1847 | Ga0496111_0116867 | |||
| 1848 | Ga0496111_0178607 | |||
| 1849 | Ga0496115_0003645 | |||
| 1850 | Ga0496115_0011759 | |||
| 1851 | Ga0496115_0109062 | |||
| 1852 | Ga0496116_0000003 | |||
| 1853 | Ga0496116_0015099 | |||
| 1854 | Ga0496116_0017691 | |||
| 1855 | Ga0496116_0023670 | |||
| 1856 | Ga0496116_0034370 | |||
| 1857 | Ga0496116_0035534 | |||
| 1858 | Ga0496116_0048326 | |||
| 1859 | Ga0496116_0098145 | |||
| 1860 | Ga0496116_0368221 | |||
| 1861 | Ga0496117_0000001 | |||
| 1862 | Ga0496117_0026769 | |||
| 1863 | Ga0496117_0081126 | |||
| 1864 | Ga0496118_0000002 | |||
| 1865 | Ga0496118_0033984 | |||
| 1866 | Ga0496118_0042722 | |||
| 1867 | Ga0496118_0081704 | |||
| 1868 | Ga0496119_0000001 | |||
| 1869 | Ga0496119_0022619 | |||
| 1870 | Ga0496119_0032968 | |||
| 1871 | Ga0496119_0234918 | |||
| 1872 | Ga0496120_0000493 | |||
| 1873 | Ga0496120_0086359 | |||
| 1874 | Ga0496121_0016262 | |||
| 1875 | Ga0496121_0017738 | |||
| 1876 | Ga0496121_0034218 | |||
| 1877 | Ga0496121_0069404 | |||
| 1878 | Ga0496121_0200929 | |||
| 1879 | Ga0496121_0383341 | |||
| 1880 | Ga0496122_0000093 | |||
| 1881 | Ga0496122_0001676 | |||
| 1882 | Ga0496122_0005717 | |||
| 1883 | Ga0496122_0009914 | |||
| 1884 | Ga0496122_0054802 | |||
| 1885 | Ga0496122_0066596 | |||
| 1886 | Ga0496122_0347207 | |||
| 1887 | Ga0496123_0000125 | |||
| 1888 | Ga0496123_0002807 | |||
| 1889 | Ga0496123_0004561 | |||
| 1890 | Ga0496123_0005967 | |||
| 1891 | Ga0496123_0006479 | |||
| 1892 | Ga0496123_0009487 | |||
| 1893 | Ga0496123_0021664 | |||
| 1894 | Ga0496123_0068724 | |||
| 1895 | Ga0496124_0000449 | |||
| 1896 | Ga0496124_0003087 | |||
| 1897 | Ga0496124_0007374 | |||
| 1898 | Ga0496124_0015702 | |||
| 1899 | Ga0496124_0028614 | |||
| 1900 | Ga0496124_0051177 | |||
| 1901 | Ga0496124_0088747 | |||
| 1902 | Ga0496124_0154124 | |||
| 1903 | Ga0496124_0200527 | |||
| 1904 | Ga0496124_0242562 | |||
| 1905 | Ga0496124_0319322 | |||
| 1906 | Ga0496125_0000049 | |||
| 1907 | Ga0496125_0034579 | |||
| 1908 | Ga0496125_0036570 | |||
| 1909 | Ga0496125_0086001 | |||
| 1910 | Ga0496125_0232986 | |||
| 1911 | Ga0496125_0392016 | |||
| 1912 | Ga0496126_0011658 | |||
| 1913 | Ga0496126_0087948 | |||
| 1914 | Ga0496126_0112505 | |||
| 1915 | Ga0496126_0173973 | |||
| 1916 | Ga0496126_0684508 | |||
| 1917 | Ga0501306_017742 | |||
| 1918 | Ga0501308_000130 | |||
| 1919 | Ga0501309_013539 | |||
| 1920 | Ga0501304_000124 | |||
| 1921 | Ga0501304_018166 | |||
| 1922 | Ga0501305_017264 | |||
| 1923 | Ga0501307_003537 | |||
| 1924 | Ga0495678_000020 | |||
| 1925 | Ga0495678_000032 | |||
| 1926 | Ga0495678_000188 | |||
| 1927 | Ga0495678_000189 | |||
| 1928 | Ga0495678_000264 | |||
| 1929 | Ga0495678_000368 | |||
| 1930 | Ga0495678_000795 | |||
| 1931 | Ga0495678_001001 | |||
| 1932 | Ga0495678_004390 | |||
| 1933 | Ga0495678_006399 | |||
| 1934 | Ga0495678_008330 | |||
| 1935 | Ga0495678_020462 | |||
| 1936 | Ga0495678_036787 | |||
| 1937 | Ga0495678_053456 | |||
| 1938 | Ga0495682_0002972 | |||
| 1939 | Ga0495682_0004832 | |||
| 1940 | Ga0495682_0005056 | |||
| 1941 | Ga0495682_0007345 | |||
| 1942 | Ga0495682_0012485 | |||
| 1943 | Ga0495682_0016296 | |||
| 1944 | Ga0495682_0174083 | |||
| 1945 | Ga0501312_041899 | |||
| 1946 | Ga0501314_004864 | |||
| 1947 | Ga0501315_006614 | |||
| 1948 | Ga0501315_018995 | |||
| 1949 | Ga0501318_001300 | |||
| 1950 | Ga0501319_005482 | |||
| 1951 | Ga0501320_007751 | |||
| 1952 | Ga0501321_009154 | |||
| 1953 | Ga0501322_002053 | |||
| 1954 | Ga0501323_013607 | |||
| 1955 | Ga0501323_014644 | |||
| 1956 | Ga0501334_07325 | |||
| 1957 | Ga0501335_006826 | |||
| 1958 | Ga0501249_003520 | |||
| 1959 | Ga0501229_013289 | |||
| 1960 | Ga0501269_000214 | |||
| 1961 | Ga0501035_0001727 | |||
| 1962 | nmdc:mga03683_181858_c1 | |||
| 1963 | nmdc:mga00v17_175812_c1 | |||
| 1964 | nmdc:mga06z11_579638_c1 | |||
| 1965 | nmdc:mga08x19_1130_c1 | |||
| 1966 | Ga0500594_0003023 | |||
| 1967 | Ga0500618_000231 | |||
| 1968 | Ga0500559_0004383 | |||
| 1969 | Ga0500586_011675 | |||
| 1970 | Ga0500616_0029402 | |||
| 1971 | Ga0500636_0299392 | |||
| 1972 | Ga0587084_007047 | |||
| 1973 | Ga0587066_043010 | |||
| 1974 | Ga0587070_007408 | |||
| 1975 | Ga0587070_034513 | |||
| 1976 | Ga0587070_088119 | |||
| 1977 | Ga0587073_0085036 | |||
| 1978 | Ga0587082_002682 | |||
| 1979 | Ga0587083_0071608 | |||
| 1980 | Ga0587088_004957 | |||
| 1981 | Ga0587088_006407 | |||
| 1982 | Ga0587091_045519 | |||
| 1983 | Ga0587094_043281 | |||
| 1984 | Ga0587098_003750 | |||
| 1985 | Ga0587098_024306 | |||
| 1986 | Ga0587125_029107 | |||
| 1987 | Ga0587109_006348 | |||
| 1988 | Ga0587062_000628 | |||
| 1989 | Ga0587068_000732 | |||
| 1990 | Ga0587069_005162 | |||
| 1991 | Ga0587075_003340 | |||
| 1992 | Ga0587076_004491 | |||
| 1993 | Ga0587079_035845 | |||
| 1994 | Ga0587102_015188 | |||
| 1995 | Ga0587104_008736 | |||
| 1996 | Ga0587105_006279 | |||
| 1997 | Ga0587107_030229 | |||
| 1998 | Ga0587108_005403 | |||
| 1999 | Ga0587096_02842 | |||
| 2000 | Ga0466962_0056340 | |||
| 2001 | Ga0466962_0084531 | |||
| 2002 | Ga0466962_0177803 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ibz-assembly1.cif.gz_A | crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) | 0.8877 | 20 | 191 |
| 3ibz-assembly1.cif.gz_A | crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) | 0.8601 | 20 | 191 |
| 2kxv-assembly1.cif.gz_A | nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae | 0.8429 | 20 | 191 |
| 2kxv-assembly1.cif.gz_A | nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae | 0.83 | 20 | 191 |
| 2qng-assembly1.cif.gz_A | crystal structure of unknown function protein sav2460 | 0.8149 | 20 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P19198_159_328_2.60.60.30 | Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains | 0.9571 | 20 | 184 | 2.60.60.30 |
| af_P19198_159_328_2.60.60.30 | Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains | 0.9245 | 20 | 184 | 2.60.60.30 |
| 3ibzA01 | Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains | 0.8819 | 20 | 185 | 2.60.60.30 |
| 3ibzA01 | Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains | 0.8675 | 20 | 185 | 2.60.60.30 |
| 2qz7B01 | Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains | 0.7977 | 20 | 184 | 2.60.60.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M3NX05-F1-model_v4 | deleted | 0.985 | 1 | 191 |
|
| AF-A0A3M3NX05-F1-model_v4 | deleted | 0.9799 | 1 | 191 |
|
| AF-A0A6P0DGD9-F1-model_v4 | Chemical-damaging agent resistance protein C | 0.9778 | 3 | 190 |
GO:0046690
|
| AF-A0A7Y9LIH7-F1-model_v4 | deleted | 0.9743 | 1 | 191 |
|
| AF-A0A2T4MWE9-F1-model_v4 | Chemical-damaging agent resistance protein C | 0.9722 | 1 | 190 |
GO:0046690
|