F488498

General Info

Members Datasets Scaffolds Average Seq Length
1025 855 2050 373

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0394339|Ga0496126_0394339_27_1019
Length 318
Sequence MDQVRGVGADIILGNTYHLMLRPGAERVARLGGLHEFARWPHPILTDSGGFQVMSLSKLRKLTEKGVTFRSHIDGAPYEMSPERSIEIQGLLDSDIQMQLDECTALPAELKEIERAMELSLRWAERCKTAFGDQPGKAMFGIVQGGDNAALRVRSAQALSAMGEPQAVMLEMLDITCPELPADKPRYLMGVGTPDDILKSVARGIDMFDCVMPTRAGRHGLAYTRRGKVNLRNARHADDPRPLDEESDCPAARDYSRAYLHHLVRSQEALGAMLLTWNNLSYYQKLMQDIRAAIETGSFEARGAEISEGWARGDIPVL

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
42 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
49 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
50 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
51 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
52 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
53 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
54 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
55 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
61 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
93 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
97 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
98 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
161 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
173 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
178 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
181 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
182 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
183 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
184 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
185 2509276019 Ensifer aridi TW10 Isolate Nodule
186 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
187 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
188 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
189 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
190 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
191 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
192 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
193 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
194 2512875024
195 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
196 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
197 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
198 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
199 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
200 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
201 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
202 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
203 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
204 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
205 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
206 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
207 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
208 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
209 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
210 2516143018 Ensifer sp. BR816 Isolate Nodule
211 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
212 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
213 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
214 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
215 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
216 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
217 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
218 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
219 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
220 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
221 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
222 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
223 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
224 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
225 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
226 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
227 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
228 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
229 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
230 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
231 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
232 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
233 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
234 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
235 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
236 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
237 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
238 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
239 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
240 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
241 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
242 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
243 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
244 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
245 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
246 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
247 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
248 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
249 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
250 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
251 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
252 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
253 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
254 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
255 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
256 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
257 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
258 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
259 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
260 2643221557 Ensifer sp. Root558 Isolate Unclassified
261 2643221558 Rhizobium sp. Root149 Isolate Unclassified
262 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
263 2643221582 Rhizobium sp. Root651 Isolate Unclassified
264 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
265 2643221607 Rhizobium sp. Root73 Isolate Unclassified
266 2643221610 Ensifer sp. Root74 Isolate Unclassified
267 2643221618 Ensifer sp. Root231 Isolate Unclassified
268 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
269 2643221626 Ensifer sp. Root31 Isolate Unclassified
270 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
271 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
272 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
273 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
274 2643221655 Ensifer sp. Root1252 Isolate Unclassified
275 2643221659 Ensifer sp. Root127 Isolate Unclassified
276 2643221668 Ensifer sp. Root423 Isolate Unclassified
277 2643221675 Ensifer sp. Root1298 Isolate Unclassified
278 2643221680 Ensifer sp. Root1312 Isolate Unclassified
279 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
280 2643221688 Rhizobium sp. Root482 Isolate Unclassified
281 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
282 2643221693 Rhizobium sp. Root491 Isolate Unclassified
283 2643221698 Ensifer sp. Root142 Isolate Unclassified
284 2643221712 Ensifer sp. Root258 Isolate Unclassified
285 2643221718 Rhizobium sp. Root268 Isolate Unclassified
286 2643221719 Rhizobium sp. Root274 Isolate Unclassified
287 2643221723 Ensifer sp. Root278 Isolate Unclassified
288 2643221726 Ensifer sp. Root954 Isolate Unclassified
289 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
290 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
291 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
292 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
293 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
294 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
295 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
296 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
297 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
298 2738543024 Aminobacter sp. AP02 Isolate Unclassified
299 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
300 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
301 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
302 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
303 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
304 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
305 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
306 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
307 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
308 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
309 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
310 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
311 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
312 2791355256 Rhizobium sp. M10 Isolate Nodule
313 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
314 2791355262 Rhizobium sp. M1 Isolate Nodule
315 2791355263 Rhizobium chutanense C5 Isolate Nodule
316 2791355266 Rhizobium sp. L43 Isolate Nodule
317 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
318 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
319 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
320 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
321 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
322 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
323 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
324 2802429633 Rhizobium anhuiense J3 Isolate Nodule
325 2802429634 Rhizobium anhuiense S10 Isolate Nodule
326 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
327 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
328 2802429637 Rhizobium anhuiense C15 Isolate Nodule
329 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
330 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
331 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
332 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
333 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
334 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
335 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
336 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
337 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
338 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
339 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
340 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
341 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
342 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
343 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
344 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
345 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
346 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
347 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
348 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
349 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
350 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
351 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
352 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
353 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
354 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
355 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
356 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
357 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
358 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
359 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
360 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
361 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
362 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
363 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
364 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
365 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
366 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
367 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
368 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
369 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
370 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
371 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
372 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
373 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
374 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
375 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
376 2844163670 Ensifer sp. 1H6 Isolate Unclassified
377 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
378 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
379 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
380 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
381 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
382 2854911287 Brucella lupini LUP21 Isolate Unclassified
383 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
384 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
385 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
386 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
387 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
388 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
389 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
390 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
391 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
392 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
393 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
394 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
395 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
396 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
397 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
398 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
399 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
400 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
401 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
402 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
403 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
404 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
405 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
406 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
407 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
408 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
409 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
410 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
411 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
412 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
413 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
414 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
415 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
416 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
417 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
418 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
419 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
420 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
421 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
422 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
423 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
424 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
425 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
426 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
427 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
428 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
429 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
430 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
431 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
432 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
433 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
434 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
435 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
436 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
437 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
438 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
439 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
440 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
441 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
442 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
443 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
444 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
445 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
446 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
447 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
448 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
449 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
450 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
451 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
452 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
453 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
454 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
455 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
456 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
457 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
458 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
459 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
460 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
461 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
462 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
463 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
464 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
465 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
466 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
467 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
468 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
469 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
470 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
471 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
472 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
473 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
474 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
475 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
476 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
477 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
478 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
479 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
480 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
481 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
482 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
483 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
484 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
485 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
486 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
487 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
488 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
489 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
490 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
491 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
492 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
493 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
494 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
495 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
496 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
497 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
498 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
499 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
500 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
501 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
502 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
503 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
504 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
505 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
506 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
507 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
508 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
509 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
510 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
511 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
512 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
513 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
514 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
515 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
516 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
517 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
518 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
519 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
520 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
521 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
522 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
523 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
524 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
525 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
526 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
527 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
528 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
529 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
530 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
531 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
532 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
533 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
534 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
535 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
536 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
537 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
538 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
539 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
540 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
541 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
542 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
543 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
544 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
545 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
546 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
547 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
548 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
549 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
550 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
551 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
552 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
553 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
554 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
555 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
556 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
557 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
558 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
559 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
560 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
561 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
562 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
563 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
564 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
565 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
566 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
567 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
568 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
569 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
570 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
571 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
572 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
573 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
574 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
575 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
576 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
577 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
578 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
579 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
580 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
581 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
582 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
583 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
584 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
585 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
586 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
587 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
588 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
589 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
590 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
591 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
592 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
593 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
594 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
595 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
596 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
597 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
598 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
599 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
600 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
601 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
602 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
603 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
604 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
605 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
606 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
607 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
608 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
609 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
610 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
611 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
612 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
613 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
614 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
615 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
616 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
617 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
618 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
619 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
620 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
621 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
622 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
623 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
624 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
625 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
626 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
627 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
628 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
629 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
630 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
631 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
632 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
633 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
634 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
635 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
636 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
637 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
638 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
639 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
640 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
641 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
642 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
643 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
644 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
645 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
646 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
647 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
648 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
649 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
650 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
651 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
652 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
653 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
654 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
655 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
656 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
657 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
658 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
659 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
660 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
661 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
662 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
663 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
664 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
665 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
666 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
667 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
668 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
669 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
670 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
671 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
672 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
673 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
674 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
675 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
676 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
677 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
678 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
679 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
680 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
681 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
682 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
683 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
684 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
685 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
686 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
687 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
688 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
689 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
690 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
691 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
692 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
693 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
694 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
695 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
696 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
697 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
698 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
699 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
700 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
701 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
702 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
703 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
704 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
705 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
706 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
707 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
708 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
709 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
710 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
711 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
712 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
713 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
714 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
715 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
716 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
717 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
718 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
719 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
720 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
721 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
722 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
723 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
724 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
725 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
726 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
727 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
728 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
729 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
730 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
731 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
732 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
733 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
734 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
735 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
736 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
737 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
738 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
739 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
740 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
741 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
742 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
743 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
744 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
745 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
746 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
747 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
748 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
749 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
750 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
751 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
752 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
753 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
754 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
755 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
756 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
757 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
758 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
759 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
760 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
761 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
762 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
763 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
764 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
765 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
766 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
767 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
768 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
769 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
770 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
771 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
772 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
773 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
774 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
775 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
776 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
777 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
778 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
779 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
780 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
781 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
782 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
783 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
784 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
785 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
786 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
787 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
788 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
789 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
790 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
791 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
792 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
793 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
794 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
795 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
796 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
797 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
798 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
799 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
800 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
801 3004167301 Mesorhizobium loti 582 Isolate Unclassified
802 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
803 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
804 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
805 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
806 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
807 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
808 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
809 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
810 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
811 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
812 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
813 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
814 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
815 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
816 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
817 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
818 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
819 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
820 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
821 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
822 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
823 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
824 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
825 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
826 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
827 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
828 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
829 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
830 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
831 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
832 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
833 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
834 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
835 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
836 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
837 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
838 8005382845 Rhizobium sp. R634 Isolate Nodule
839 8005395548 Rhizobium sp. R339 Isolate Nodule
840 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
841 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
842 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
843 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
844 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
845 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
846 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
847 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
848 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
849 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
850 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
851 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
852 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
853 8056382006 Rhizobium croatiense 13T Isolate Nodule
854 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
855 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 33.85
Metatranscriptomes 0
Isolates 66.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 11.71
Nodule 50.83
Rhizoplane 1.66
Rhizosphere 19.71
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0394339 3300048929 Bacteria 1124
2 JGI25156J39149_1000030 3300002705 Bacteria 126029
3 JGI25162J39368_1001515 3300002737 Bacteria 12058
4 JGI25154J39366_1000289 3300002738 Bacteria 30213
5 JGI25157J39369_1000010 3300002741 Bacteria 207685
6 JGI25152J39213_1008181 3300002773 Bacteria 2621
7 JGI25150J39212_1000010 3300002774 Bacteria 236260
8 JGI25150J39212_1006773 3300002774 Bacteria 2341
9 JGI25159J45721_1001125 3300002987 Bacteria 11424
10 JGI25151J46595_10000026 3300003187 Bacteria 211045
11 JGI25151J46595_10005052 3300003187 Bacteria 6869
12 JGI25406J46586_10003438 3300003203 Bacteria 7450
13 JGI25165J46597_1000087 3300003214 Bacteria 170335
14 JGI25165J46597_1000139 3300003214 Bacteria 121216
15 JGI25165J46597_1000654 3300003214 Bacteria 28366
16 JGI25165J46597_1001229 3300003214 Bacteria 15248
17 JGI25153J46596_10003622 3300003215 Bacteria 8574
18 JGI25153J46596_10004316 3300003215 Bacteria 7687
19 JGI25153J46596_10011346 3300003215 Bacteria 3943
20 JGI25160J50197_1000011 3300003354 Bacteria 275577
21 JGI25160J50197_1000593 3300003354 Bacteria 20289
22 JGI25160J50197_1016555 3300003354 Bacteria 2372
23 JGI25161J50226_1001660 3300003374 Bacteria 6391
24 JGI25161J50226_1001956 3300003374 Bacteria 5662
25 JGI25161J50226_1002628 3300003374 Bacteria 4505
26 Ga0055526_1006958 3300003771 Bacteria 6004
27 Ga0055526_1010394 3300003771 Bacteria 4335
28 Ga0055524_1006744 3300003775 Bacteria 4956
29 Ga0055536_1000356 3300003781 Bacteria 34069
30 Ga0055540_1005062 3300003792 Bacteria 5702
31 Ga0055540_1015994 3300003792 Bacteria 2155
32 Ga0055531_10003828 3300003794 Bacteria 9428
33 Ga0058692_1002330 3300003856 Bacteria 6416
34 Ga0055543_1000097 3300004625 Bacteria 75364
35 Ga0055543_1000255 3300004625 Bacteria 40071
36 Ga0055543_1001144 3300004625 Bacteria 11331
37 Ga0065165_1000018 3300005262 Bacteria 275082
38 Ga0065165_1008107 3300005262 Bacteria 5004
39 Ga0065165_1010197 3300005262 Bacteria 4097
40 Ga0070665_100068348 3300005548 Bacteria 3562
41 Ga0068852_100136537 3300005616 Bacteria 2265
42 Ga0081455_10011719 3300005937 Bacteria 8790
43 Ga0081539_10010362 3300005985 Bacteria 7585
44 Ga0075365_10000809 3300006038 Bacteria 12860
45 Ga0075365_10001555 3300006038 Bacteria 10502
46 Ga0075365_10028061 3300006038 Bacteria 3587
47 Ga0075368_10002095 3300006042 Bacteria 6447
48 Ga0075368_10003990 3300006042 Bacteria 4969
49 Ga0075363_100016486 3300006048 Bacteria 3650
50 Ga0075363_100029663 3300006048 Bacteria 2826
51 Ga0075364_10012524 3300006051 Bacteria 5191
52 Ga0075367_10009642 3300006178 Bacteria 5054
53 Ga0075369_10010101 3300006186 Bacteria 3687
54 Ga0075366_10021694 3300006195 Bacteria 3734
55 Ga0075366_10026232 3300006195 Bacteria 3411
56 Ga0075370_10000970 3300006353 Bacteria 11849
57 Ga0075370_10001750 3300006353 Bacteria 9672
58 Ga0075370_10138937 3300006353 Bacteria 1420
59 Ga0079104_1001402 3300006946 Bacteria 16290
60 Ga0079104_1006507 3300006946 Bacteria 4403
61 Ga0099826_10000090 3300006948 Bacteria 44830
62 Ga0099826_10004510 3300006948 Bacteria 9777
63 Ga0105240_10000005 3300009093 Bacteria 702630
64 Ga0105241_10186520 3300009174 Bacteria 1724
65 Ga0105237_10000773 3300009545 Bacteria 43739
66 Ga0105237_10007070 3300009545 Bacteria 12341
67 Ga0105238_10004109 3300009551 Bacteria 14443
68 Ga0123341_1000049 3300009765 Bacteria 49561
69 Ga0123342_1012839 3300009766 Bacteria 8588
70 Ga0105239_10004008 3300010375 Bacteria 17836
71 Ga0105239_10020587 3300010375 Bacteria 7278
72 Ga0157373_10002285 3300013100 Bacteria 14521
73 Ga0157371_10000015 3300013102 Bacteria 339838
74 Ga0157370_10000992 3300013104 Bacteria 35815
75 Ga0157370_10003013 3300013104 Bacteria 20000
76 Ga0157370_10055044 3300013104 Bacteria 3792
77 Ga0182007_10000618 3300015262 Bacteria 20687
78 Ga0183363_1281 3300015690 Bacteria 7689
79 Ga0214544_1000129 3300021320 Bacteria 108948
80 Ga0214542_1000828 3300021321 Bacteria 59640
81 Ga0214542_1027439 3300021321 Bacteria 2608
82 Ga0214543_1000010 3300021327 Bacteria 364844
83 Ga0214543_1000134 3300021327 Bacteria 102056
84 Ga0228711_1002680 3300022739 Bacteria 27471
85 Ga0228710_1002851 3300022740 Bacteria 27471
86 Ga0209435_100022 3300025206 Bacteria 207766
87 Ga0209760_104110 3300025207 Bacteria 1262
88 Ga0209436_100507 3300025208 Bacteria 17013
89 Ga0209436_103093 3300025208 Bacteria 4584
90 Ga0209437_100122 3300025233 Bacteria 201364
91 Ga0209437_100160 3300025233 Bacteria 149451
92 Ga0207425_1000010 3300025245 Bacteria 572898
93 Ga0209646_1000078 3300025246 Bacteria 207766
94 Ga0209026_1000065 3300025250 Bacteria 207766
95 Ga0209677_104805 3300025253 Bacteria 3743
96 Ga0209148_1000072 3300025254 Bacteria 325292
97 Ga0209759_1000055 3300025256 Bacteria 207766
98 Ga0209129_1000197 3300025258 Bacteria 78908
99 Ga0209129_1001042 3300025258 Bacteria 16374
100 Ga0209129_1001442 3300025258 Bacteria 13289
101 Ga0209233_1000027 3300025261 Bacteria 652089
102 Ga0209233_1000168 3300025261 Bacteria 149312
103 Ga0209233_1000170 3300025261 Bacteria 147527
104 Ga0209233_1001127 3300025261 Bacteria 10903
105 Ga0209455_1000133 3300025272 Bacteria 155670
106 Ga0209673_1002230 3300025273 Bacteria 14043
107 Ga0209673_1006554 3300025273 Bacteria 5584
108 Ga0209673_1007969 3300025273 Bacteria 4780
109 Ga0209673_1007970 3300025273 Bacteria 4780
110 Ga0209130_1000029 3300025284 Bacteria 323399
111 Ga0209130_1000097 3300025284 Bacteria 143750
112 Ga0209676_1000438 3300025292 Bacteria 71339
113 Ga0209025_1000022 3300025294 Bacteria 574487
114 Ga0209025_1000033 3300025294 Bacteria 414511
115 Ga0209025_1000358 3300025294 Bacteria 97655
116 Ga0209025_1000563 3300025294 Bacteria 68086
117 Ga0209025_1001678 3300025294 Bacteria 27100
118 Ga0209025_1020471 3300025294 Bacteria 3618
119 Ga0209564_1000275 3300025295 Bacteria 107884
120 Ga0209564_1000986 3300025295 Bacteria 35645
121 Ga0209564_1001528 3300025295 Bacteria 22999
122 Ga0209758_1000086 3300025297 Bacteria 254778
123 Ga0209758_1000505 3300025297 Bacteria 63185
124 Ga0209758_1000534 3300025297 Bacteria 60556
125 Ga0209758_1020108 3300025297 Bacteria 3178
126 Ga0209758_1045640 3300025297 Bacteria 1589
127 Ga0209050_1000516 3300025298 Bacteria 64933
128 Ga0209256_1001255 3300025299 Bacteria 27934
129 Ga0209256_1001768 3300025299 Bacteria 20511
130 Ga0207426_1000003 3300025302 Bacteria 1063212
131 Ga0207426_1000074 3300025302 Bacteria 323399
132 Ga0207426_1000408 3300025302 Bacteria 72326
133 Ga0209051_1003377 3300025303 Bacteria 10501
134 Ga0209051_1004697 3300025303 Bacteria 8308
135 Ga0209257_1009229 3300025304 Bacteria 5347
136 Ga0209257_1030233 3300025304 Bacteria 1751
137 Ga0207647_10003836 3300025904 Bacteria 11245
138 Ga0207705_10088769 3300025909 Bacteria 2262
139 Ga0207695_10000011 3300025913 Bacteria 910221
140 Ga0207671_10004599 3300025914 Bacteria 13104
141 Ga0207671_10046567 3300025914 Bacteria 3209
142 Ga0207671_10063925 3300025914 Bacteria 2735
143 Ga0207694_10033192 3300025924 Bacteria 3954
144 Ga0207678_10064346 3300026067 Bacteria 3151
145 Ga0207678_10180755 3300026067 Bacteria 1801
146 Ga0207702_10009685 3300026078 Bacteria 8090
147 Ga0207674_10118013 3300026116 Bacteria 2623
148 Ga0209281_1000508 3300027111 Bacteria 51432
149 Ga0209281_1004020 3300027111 Bacteria 4553
150 Ga0209371_1000178 3300027312 Bacteria 93894
151 Ga0209371_1017786 3300027312 Bacteria 1829
152 Ga0209282_1000116 3300027666 Bacteria 51432
153 Ga0209282_1000235 3300027666 Bacteria 28597
154 Ga0209813_10007397 3300027866 Bacteria 2735
155 Ga0268266_10059721 3300028379 Bacteria 3285
156 Ga0268266_10107615 3300028379 Bacteria 2466
157 Ga0307515_10000233 3300028794 Bacteria 137311
158 Ga0307515_10013071 3300028794 Bacteria 15547
159 Ga0307515_10265602 3300028794 Bacteria 1445
160 Ga0268256_1000251 3300030500 Bacteria 56750
161 Ga0268256_1022835 3300030500 Bacteria 1634
162 Ga0316181_1236523 3300030744 Bacteria 1896
163 Ga0307513_10021520 3300031456 Bacteria 7611
164 Ga0307412_10000449 3300031911 Bacteria 24913
165 Ga0315914_1002646 3300031967 Bacteria 27416
166 Ga0315913_1001232 3300033430 Bacteria 27471
167 Ga0315915_1000058 3300033464 Bacteria 72461
168 Ga0373947_0010286 3300035725 Bacteria 5368
169 Ga0373925_0063164 3300037068 Bacteria 2786
170 Ga0395899_0000073 3300037312 Bacteria 181387
171 Ga0395899_0305665 3300037312 Bacteria 1075
172 Ga0395900_0000027 3300037418 Bacteria 285957
173 Ga0395900_0037124 3300037418 Bacteria 5025
174 Ga0395900_0314024 3300037418 Bacteria 1550
175 Ga0395898_0000255 3300037466 Bacteria 131017
176 Ga0395898_0108397 3300037466 Bacteria 2663
177 Ga0395905_0000032 3300037471 Bacteria 285932
178 Ga0395905_0000386 3300037471 Bacteria 62786
179 Ga0395905_0046935 3300037471 Bacteria 4049
180 Ga0395905_0208393 3300037471 Bacteria 1832
181 Ga0395901_0000110 3300038443 Bacteria 112682
182 Ga0395901_0033538 3300038443 Bacteria 5300
183 Ga0395901_0089747 3300038443 Bacteria 3216
184 Ga0395901_0206055 3300038443 Bacteria 2060
185 Ga0436365_0571926 3300039437 Bacteria 4180
186 Ga0436365_1745677 3300039437 Bacteria 2074
187 Ga0436360_1264804 3300039438 Bacteria 1141
188 Ga0436362_0562496 3300039453 Unclassified 1356
189 Ga0436362_1220355 3300039453 Bacteria 1757
190 Ga0451851_0841148 3300041507 Bacteria 3941
191 Ga0439449_0005586 3300042007 Bacteria 4813
192 Ga0466968_0026106 3300044735 Bacteria 2395
193 Ga0495638_0034607 3300046460 Bacteria 3225
194 Ga0495664_0078795 3300046477 Bacteria 1974
195 Ga0495583_0044363 3300046506 Bacteria 2063
196 Ga0495587_0052935 3300046536 Bacteria 2394
197 Ga0495634_0011375 3300046642 Bacteria 6483
198 Ga0495625_0023055 3300046660 Bacteria 4760
199 Ga0495625_0270331 3300046660 Bacteria 1097
200 Ga0495613_0125857 3300046689 Bacteria 1838
201 Ga0495686_0002178 3300047472 Bacteria 19063
202 Ga0496101_0052923 3300048904 Bacteria 2928
203 Ga0496104_0007867 3300048907 Bacteria 9450
204 Ga0496104_0465763 3300048907 Bacteria 1175
205 Ga0496105_0115440 3300048908 Bacteria 2215
206 Ga0496110_0080939 3300048913 Bacteria 2895
207 Ga0496112_0023334 3300048915 Bacteria 5910
208 Ga0496115_0242934 3300048918 Bacteria 1484
209 Ga0496116_0036906 3300048919 Bacteria 3414
210 Ga0496116_0116082 3300048919 Bacteria 1560
211 Ga0496117_0000002 3300048920 Bacteria 2483758
212 Ga0496117_0002298 3300048920 Bacteria 24600
213 Ga0496117_0012239 3300048920 Bacteria 7587
214 Ga0496118_0000460 3300048921 Bacteria 67445
215 Ga0496118_0003956 3300048921 Bacteria 18115
216 Ga0496118_0011413 3300048921 Bacteria 8672
217 Ga0496118_0031959 3300048921 Bacteria 4348
218 Ga0496119_0047784 3300048922 Bacteria 2659
219 Ga0496120_0000078 3300048923 Bacteria 162312
220 Ga0496120_0007642 3300048923 Bacteria 8010
221 Ga0496121_0002309 3300048924 Bacteria 29564
222 Ga0496121_0009598 3300048924 Bacteria 11087
223 Ga0496121_0010507 3300048924 Bacteria 10428
224 Ga0496122_0000001 3300048925 Bacteria 1827766
225 Ga0496122_0000025 3300048925 Bacteria 362915
226 Ga0496122_0000957 3300048925 Bacteria 52113
227 Ga0496122_0004632 3300048925 Bacteria 16911
228 Ga0496122_0011586 3300048925 Bacteria 8900
229 Ga0496122_0012223 3300048925 Bacteria 8585
230 Ga0496123_0000001 3300048926 Bacteria 1831497
231 Ga0496123_0000032 3300048926 Bacteria 285282
232 Ga0496123_0000043 3300048926 Bacteria 253752
233 Ga0496123_0005205 3300048926 Bacteria 13219
234 Ga0496124_0002623 3300048927 Bacteria 23151
235 Ga0496124_0003161 3300048927 Bacteria 20373
236 Ga0496124_0014237 3300048927 Bacteria 7705
237 Ga0496125_0000311 3300048928 Bacteria 95568
238 Ga0496125_0005370 3300048928 Bacteria 14292
239 Ga0496125_0077891 3300048928 Bacteria 2552
240 Ga0496125_0150703 3300048928 Bacteria 1598
241 Ga0496126_0001233 3300048929 Bacteria 41528
242 Ga0501031_0000217 3300049568 Bacteria 32968
243 Ga0501031_0007446 3300049568 Bacteria 7130
244 Ga0501031_0025811 3300049568 Bacteria 3833
245 Ga0501032_0000009 3300049569 Bacteria 228107
246 Ga0501032_0000064 3300049569 Bacteria 91971
247 Ga0501032_0004360 3300049569 Bacteria 10684
248 Ga0501032_0093103 3300049569 Bacteria 1999
249 Ga0501033_0000019 3300049570 Bacteria 204699
250 Ga0501033_0000330 3300049570 Bacteria 44983
251 Ga0501033_0001030 3300049570 Bacteria 25380
252 Ga0501033_0033887 3300049570 Bacteria 3833
253 Ga0501033_0179189 3300049570 Bacteria 1519
254 Ga0501034_0000044 3300049571 Bacteria 227982
255 Ga0501034_0000174 3300049571 Bacteria 119615
256 Ga0501034_0015374 3300049571 Bacteria 7865
257 Ga0501034_0026260 3300049571 Bacteria 5931
258 Ga0501034_0375761 3300049571 Bacteria 1347
259 Ga0501036_0000008 3300049572 Bacteria 228106
260 Ga0501036_0000399 3300049572 Bacteria 30550
261 Ga0501036_0095797 3300049572 Bacteria 2509
262 Ga0501036_0174211 3300049572 Bacteria 1812
263 Ga0501037_0000163 3300049573 Bacteria 62625
264 Ga0501037_0000267 3300049573 Bacteria 44964
265 Ga0501037_0000448 3300049573 Bacteria 33911
266 Ga0501038_0000006 3300049574 Bacteria 228107
267 Ga0501038_0000031 3300049574 Bacteria 132231
268 Ga0501038_0084809 3300049574 Bacteria 2665
269 Ga0501038_0107639 3300049574 Bacteria 2313
270 Ga0501039_0000014 3300049575 Bacteria 228107
271 Ga0501039_0000057 3300049575 Bacteria 89756
272 Ga0501039_0038919 3300049575 Bacteria 3673
273 Ga0501040_0057227 3300049576 Bacteria 2677
274 Ga0501043_0000048 3300049579 Bacteria 109146
275 Ga0501043_0000294 3300049579 Bacteria 45142
276 Ga0501043_0000566 3300049579 Bacteria 33076
277 Ga0501043_0044900 3300049579 Bacteria 3475
278 Ga0501043_0089584 3300049579 Bacteria 2418
279 Ga0501047_0003119 3300049581 Bacteria 15727
280 Ga0501047_0003704 3300049581 Bacteria 14393
281 Ga0501047_0009890 3300049581 Bacteria 9016
282 Ga0501047_0086262 3300049581 Bacteria 3016
283 Ga0501048_0101550 3300049582 Bacteria 2029
284 Ga0501067_0040840 3300049583 Bacteria 2576
285 Ga0501068_0057312 3300049584 Bacteria 2362
286 Ga0501068_0083040 3300049584 Bacteria 1969
287 Ga0501068_0125193 3300049584 Bacteria 1604
288 Ga0501069_0000084 3300049585 Bacteria 45142
289 Ga0501070_0001180 3300049586 Bacteria 23337
290 Ga0501070_0001515 3300049586 Bacteria 20712
291 Ga0501070_0005785 3300049586 Bacteria 10550
292 Ga0501070_0011207 3300049586 Bacteria 7568
293 Ga0501070_0015976 3300049586 Bacteria 6309
294 Ga0501070_0019103 3300049586 Bacteria 5748
295 Ga0501071_0018777 3300049587 Bacteria 4793
296 Ga0501073_0260312 3300049589 Bacteria 1197
297 Ga0501074_0000085 3300049590 Bacteria 45569
298 Ga0501074_0060749 3300049590 Bacteria 2723
299 Ga0501080_0003149 3300049742 Bacteria 14529
300 Ga0501080_0004202 3300049742 Bacteria 12777
301 Ga0501080_0033670 3300049742 Bacteria 4783
302 Ga0501080_0071228 3300049742 Bacteria 3233
303 Ga0501083_0000078 3300049744 Bacteria 65280
304 Ga0501280_004928 3300049776 Bacteria 1931
305 Ga0501035_0000198 3300049822 Bacteria 73523
306 Ga0501035_0000471 3300049822 Bacteria 45142
307 Ga0501035_0000823 3300049822 Bacteria 33092
308 Ga0501035_0001118 3300049822 Bacteria 28029
309 Ga0501035_0002538 3300049822 Bacteria 17848
310 Ga0501035_0021740 3300049822 Bacteria 5898
311 Ga0501035_0028077 3300049822 Bacteria 5138
312 Ga0501044_0000017 3300049823 Bacteria 228107
313 Ga0501044_0000649 3300049823 Bacteria 42017
314 Ga0501044_0021213 3300049823 Bacteria 6935
315 Ga0501044_0026568 3300049823 Bacteria 6127
316 Ga0501044_0130972 3300049823 Bacteria 2502
317 Ga0501044_0136994 3300049823 Bacteria 2439
318 Ga0501044_0199061 3300049823 Bacteria 1962
319 nmdc:mga03683_3419_c1 3300050489 Bacteria 5117
320 nmdc:mga03n38_44285_c1 3300050490 Bacteria 1954
321 nmdc:mga03n38_4569_c1 3300050490 Bacteria 4607
322 nmdc:mga00v17_49200_c1 3300050491 Bacteria 2557
323 nmdc:mga00v17_59031_c2 3300050491 Bacteria 1572
324 nmdc:mga0yw44_5123_c1 3300050492 Bacteria 6133
325 nmdc:mga0yw44_697_c1 3300050492 Bacteria 12311
326 nmdc:mga0k408_25595_c1 3300050493 Bacteria 3342
327 nmdc:mga06z11_8356_c1 3300050494 Bacteria 4313
328 nmdc:mga06z11_88752_c1 3300050494 Bacteria 1675
329 nmdc:mga04h51_5032_c1 3300050495 Bacteria 3340
330 nmdc:mga0sz30_14502_c1 3300050516 Bacteria 3104
331 nmdc:mga0sz30_4182_c1 3300050516 Bacteria 5200
332 nmdc:mga0sz30_77268_c1 3300050516 Bacteria 1438
333 Ga0495601_0042123 3300053077 Bacteria 2863
334 Ga0495601_0043570 3300053077 Bacteria 2818
335 Ga0495595_0057471 3300053084 Bacteria 1814
336 Ga0495619_0329604 3300053085 Bacteria 1057
337 Ga0500641_0013413 3300053096 Bacteria 3011
338 Ga0500608_074924 3300053122 Bacteria 1605
339 Ga0500652_000214 3300053131 Bacteria 22083
340 Ga0500568_0000592 3300053139 Bacteria 26355
341 Ga0500620_000253 3300053155 Bacteria 10442
342 Ga0500620_001907 3300053155 Bacteria 4023
343 Ga0500622_0000378 3300053156 Bacteria 42912
344 Ga0500622_0000778 3300053156 Bacteria 27680
345 Ga0500627_0012784 3300053158 Bacteria 3159
346 Ga0500636_0005342 3300053177 Bacteria 7322
347 Ga0501082_0016825 3300060353 Bacteria 6297
348 2503202237 2503198000 Bacteria 6884444
349 2509107651 2508501122 Bacteria 6292184
350 2509117046 2508501123 Bacteria 6283661
351 2509140617 2508501127 Bacteria 7037543
352 2509370685 2509276018 Bacteria 6910194
353 2509375989 2509276019 Bacteria 6802256
354 2509396886 2509276022 Bacteria 6200534
355 2510308660 2510065057 Bacteria 6649661
356 2510317478 2510065059 Bacteria 6847884
357 2511134930 2510917022 Bacteria 6504556
358 2511193390 2510917030 Bacteria 7460662
359 2511389446 2511231027 Bacteria 5013807
360 2511501508 2511231052 Bacteria 6974333
361 2512930861 2512875016 Bacteria 6529530
362 2512958587 2512875024 Bacteria 7195110
363 2512971739 2512875026 Bacteria 6861065
364 2513588111 2513237086 Bacteria 7265287
365 2513605271 2513237089 Bacteria 6553624
366 2513609899 2513237090 Bacteria 7096802
367 2513618702 2513237091 Bacteria 6900273
368 2513886970 2513237140 Bacteria 7076289
369 2513907205 2513237143 Bacteria 6664116
370 2513987069 2513237156 Bacteria 6402557
371 2513997347 2513237159 Bacteria 6810126
372 2514005287 2513237160 Bacteria 6650282
373 2514034997 2513237164 Bacteria 7563725
374 2514418966 2513237305 Bacteria 7293571
375 2514589937 2513237351 Bacteria 6968952
376 2515611351 2515154107 Bacteria 6795637
377 2515645036 2515154114 Bacteria 7848616
378 2516209511 2516143018 Bacteria 6951533
379 2516892826 2516653046 Bacteria 6989037
380 2517569601 2517487022 Bacteria 7227575
381 2524453662 2524023207 Bacteria 6813453
382 2537877785 2537561587 Bacteria 5425293
383 2551674253 2551306084 Bacteria 8942552
384 2551680405 2551306084 Bacteria 8942552
385 2551686545 2551306085 Bacteria 7347181
386 2551691822 2551306086 Bacteria 6843938
387 2551699774 2551306087 Bacteria 7351905
388 2551711740 2551306089 Bacteria 7162724
389 2551719509 2551306090 Bacteria 7953713
390 2551729149 2551306091 Bacteria 7086830
391 2551737099 2551306092 Bacteria 6992595
392 2551742526 2551306093 Bacteria 7064773
393 2554247753 2554235003 Bacteria 5877155
394 2559294886 2558860242 Bacteria 5568029
395 2561466506 2558860983 Bacteria 4133860
396 2585168471 2582581283 Bacteria 6030556
397 2585225791 2582581298 Bacteria 7315509
398 2585254506 2582581304 Bacteria 5831370
399 2585270045 2582581306 Bacteria 6450535
400 2585270670 2582581307 Bacteria 6597605
401 2585277011 2582581308 Bacteria 7413247
402 2585323983 2582581315 Bacteria 7318924
403 2585333620 2582581316 Bacteria 7774528
404 2585389750 2582581865 Bacteria 6644329
405 2585393715 2582581866 Bacteria 6859583
406 2585537021 2585427527 Bacteria 7273426
407 2585540496 2585427528 Bacteria 6842387
408 2585546751 2585427529 Bacteria 7395659
409 2585551872 2585427530 Bacteria 7383882
410 2585558373 2585427531 Bacteria 6992870
411 2585838712 2585427593 Bacteria 7141551
412 2585846560 2585427594 Bacteria 6180594
413 2585897768 2585427608 Bacteria 6544331
414 2585904638 2585427609 Bacteria 6667127
415 2587980246 2585428125 Bacteria 6662905
416 2597814072 2597489875 Bacteria 7010078
417 2599336304 2599185156 Bacteria 5403036
418 2599604147 2599185210 Bacteria 5624189
419 2599938053 2599185301 Bacteria 6161860
420 2600197124 2599185352 Bacteria 7228948
421 2601608060 2600255279 Bacteria 5605316
422 2601744835 2600255308 Bacteria 5611129
423 2616308385 2615840626 Bacteria 7921970
424 2616556547 2615840698 Bacteria 7319877
425 2617385874 2617270742 Bacteria 6808054
426 2643773749 2643221550 Bacteria 4619371
427 2643775545 2643221551 Bacteria 3750538
428 2643793991 2643221555 Bacteria 3749717
429 2643808723 2643221557 Bacteria 7184309
430 2643811902 2643221558 Bacteria 5460675
431 2643837486 2643221564 Bacteria 4193379
432 2643919377 2643221582 Bacteria 5804683
433 2643989415 2643221595 Bacteria 6565519
434 2644049363 2643221607 Bacteria 6314006
435 2644066255 2643221610 Bacteria 7480339
436 2644107979 2643221618 Bacteria 7717186
437 2644132065 2643221623 Bacteria 5239945
438 2644148349 2643221626 Bacteria 8069654
439 2644152987 2643221627 Bacteria 6761570
440 2644204298 2643221636 Bacteria 6583769
441 2644210480 2643221637 Bacteria 5345260
442 2644300654 2643221653 Bacteria 4569637
443 2644309373 2643221655 Bacteria 7722067
444 2644333199 2643221659 Bacteria 7890716
445 2644377795 2643221668 Bacteria 7306521
446 2644415532 2643221675 Bacteria 7473456
447 2644450066 2643221680 Bacteria 7473610
448 2644482397 2643221686 Bacteria 6310811
449 2644494477 2643221688 Bacteria 5260751
450 2644502050 2643221689 Bacteria 6042950
451 2644522279 2643221693 Bacteria 5513853
452 2644545629 2643221698 Bacteria 7756764
453 2644615315 2643221712 Bacteria 7729434
454 2644654032 2643221718 Bacteria 5345506
455 2644658692 2643221719 Bacteria 4568197
456 2644673622 2643221723 Bacteria 7095460
457 2644687623 2643221726 Bacteria 7455827
458 2657683821 2657244999 Bacteria 5946535
459 2671115786 2667528174 Bacteria 6435400
460 2671695808 2671180139 Bacteria 4196045
461 2688599400 2687453392 Bacteria 6880454
462 2692316027 2690316117 Bacteria 6800650
463 2694632184 2693429783 Bacteria 7019804
464 2723576352 2721755686 Bacteria 7343952
465 2738945593 2738541317 Bacteria 5340176
466 2739037992 2738541333 Bacteria 7106503
467 2739307890 2738543024 Bacteria 5603683
468 2753458335 2751185821 Bacteria 6189929
469 2756675869 2756170246 Bacteria 7451806
470 2757572064 2757320392 Bacteria 3737298
471 2765465588 2765235802 Bacteria 5618596
472 2770195611 2767802442 Bacteria 5747986
473 2776271527 2775506902 Bacteria 6208009
474 2776279962 2775506904 Bacteria 5954060
475 2776913376 2775507049 Bacteria 6284736
476 2778176525 2775507266 Bacteria 7392367
477 2792580745 2791355082 Bacteria 5973319
478 2792639536 2791355094 Bacteria 7011481
479 2792748508 2791355123 Bacteria 8049106
480 2793279679 2791355253 Bacteria 5171699
481 2793298261 2791355256 Bacteria 6798008
482 2793313742 2791355259 Bacteria 7254731
483 2793337049 2791355262 Bacteria 6774204
484 2793341300 2791355263 Bacteria 6872478
485 2793361396 2791355266 Bacteria 7116587
486 2802718737 2802428858 Bacteria 6636079
487 2802726349 2802428859 Bacteria 6667919
488 2802732889 2802428860 Bacteria 6525526
489 2802738244 2802428861 Bacteria 6534206
490 2802744578 2802428862 Bacteria 6633353
491 2802751216 2802428863 Bacteria 6410669
492 2804752084 2802429268 Bacteria 6094027
493 2806045383 2802429633 Bacteria 7341974
494 2806055424 2802429634 Bacteria 7083200
495 2806061467 2802429635 Bacteria 7650140
496 2806068041 2802429636 Bacteria 7597525
497 2806072611 2802429637 Bacteria 7067217
498 2808985344 2808606387 Bacteria 5697198
499 2819241892 2818991272 Bacteria 4622173
500 2819559777 2818991439 Bacteria 6907412
501 2819610358 2818991448 Bacteria 6772224
502 2819638100 2818991453 Bacteria 7181617
503 2837653068 2837651117 Bacteria 3772164
504 2837680218 2837678835 Bacteria 5252418
505 2838035090 2838029111 Bacteria 6603031
506 2838043207 2838042994 Bacteria 6046894
507 2838078755 2838074704 Bacteria 6785777
508 2838676188 2838675328 Bacteria 4909118
509 2838682461 2838680041 Bacteria 6545511
510 2838697032 2838694306 Bacteria 6853137
511 2838709727 2838707686 Bacteria 6619912
512 2838715070 2838714209 Bacteria 5525906
513 2838721130 2838719591 Bacteria 5523910
514 2838725829 2838724970 Bacteria 4908691
515 2839995544 2839993093 Bacteria 5512535
516 2840768071 2840764183 Bacteria 6358399
517 2841740039 2841734538 Bacteria 6784580
518 2841848087 2841846520 Bacteria 5345850
519 2841859362 2841859092 Bacteria 5436171
520 2842077901 2842077413 Bacteria 6508645
521 2842119591 2842118031 Bacteria 7033875
522 2842125883 2842124991 Bacteria 5346824
523 2842131082 2842130223 Bacteria 4909145
524 2842153748 2842152218 Bacteria 4908957
525 2842171313 2842170452 Bacteria 5525737
526 2842177368 2842175837 Bacteria 4908771
527 2842188178 2842187318 Bacteria 5524014
528 2842212489 2842211629 Bacteria 5523832
529 2842225892 2842224351 Bacteria 5524473
530 2842239140 2842237096 Bacteria 6620661
531 2842291563 2842291075 Bacteria 7076806
532 2842373028 2842370503 Bacteria 7038661
533 2842377959 2842377471 Bacteria 7140707
534 2842386100 2842384541 Bacteria 7057858
535 2842481858 2842475841 Bacteria 6603183
536 2842487084 2842482326 Bacteria 7212537
537 2842508733 2842502639 Bacteria 6604161
538 2842510259 2842509118 Bacteria 6850950
539 2842516146 2842515876 Bacteria 5436280
540 2842522408 2842521101 Bacteria 6569494
541 2842872740 2842871566 Bacteria 4827117
542 2842927723 2842922631 Bacteria 5824079
543 2844006466 2844002411 Bacteria 7168230
544 2844014679 2844009547 Bacteria 6728125
545 2844167285 2844163670 Bacteria 7266046
546 2847418908 2847417321 Bacteria 6913799
547 2847692975 2847686936 Bacteria 6278406
548 2848993945 2848992105 Bacteria 6810864
549 2850081892 2850079185 Bacteria 6848280
550 2852389677 2852387548 Bacteria 8025568
551 2854911950 2854911287 Bacteria 5582813
552 2855825603 2855825444 Bacteria 6785811
553 2855840980 2855839649 Bacteria 7135830
554 2855876578 2855872281 Bacteria 6964271
555 2856316105 2856314179 Bacteria 6477897
556 2856325872 2856320880 Bacteria 7263508
557 2856328952 2856328259 Bacteria 6528202
558 2856335305 2856334872 Bacteria 7037011
559 2856343723 2856342000 Bacteria 7176905
560 2856353661 2856349417 Bacteria 6230045
561 2856360207 2856356410 Bacteria 6297484
562 2856368851 2856364286 Bacteria 6939991
563 2857350178 2857349434 Bacteria 7926032
564 2857373634 2857367948 Bacteria 6965560
565 2858801520 2858800743 Bacteria 6603254
566 2869165290 2869162929 Bacteria 6399702
567 2869172533 2869169390 Bacteria 6659796
568 2869251931 2869249662 Bacteria 6868783
569 2869262511 2869256925 Bacteria 6981691
570 2869266575 2869264136 Bacteria 6880765
571 2869272483 2869271264 Bacteria 6908218
572 2869278652 2869278585 Bacteria 7077053
573 2869291346 2869285874 Bacteria 6901219
574 2871433626 2871429161 Bacteria 6547891
575 2871447695 2871444079 Bacteria 6423508
576 2871458170 2871451962 Bacteria 7336357
577 2871459833 2871459585 Bacteria 6866887
578 2871472076 2871466892 Bacteria 6923287
579 2871475333 2871474448 Bacteria 6806570
580 2871486718 2871481445 Bacteria 6700002
581 2871495756 2871488783 Bacteria 6929816
582 2871500719 2871495908 Bacteria 6935695
583 2874113677 2874109183 Bacteria 6517025
584 2874119162 2874116593 Bacteria 6674494
585 2874125971 2874123672 Bacteria 7238285
586 2874136525 2874131515 Bacteria 6820270
587 2874145238 2874139085 Bacteria 7021506
588 2874153227 2874146452 Bacteria 7533118
589 2874160492 2874155637 Bacteria 6724144
590 2874168486 2874162495 Bacteria 6174670
591 2874176231 2874168670 Bacteria 8062617
592 2876365467 2876363079 Bacteria 6544991
593 2876371146 2876369609 Bacteria 6807521
594 2876382676 2876377896 Bacteria 6565995
595 2876386141 2876386047 Bacteria 6698674
596 2876394999 2876392853 Bacteria 6660880
597 2876403116 2876399893 Bacteria 6927900
598 2876413257 2876406927 Bacteria 6191900
599 2876419518 2876413966 Bacteria 6831344
600 2876424463 2876420981 Bacteria 6687741
601 2878040374 2878035449 Bacteria 6555736
602 2878743435 2878738818 Bacteria 7136951
603 2878751237 2878745973 Bacteria 6867388
604 2878753445 2878753008 Bacteria 6922523
605 2878764808 2878760144 Bacteria 6823465
606 2878771909 2878767105 Bacteria 6898628
607 2878774843 2878774303 Bacteria 6108671
608 2878787843 2878781027 Bacteria 6834456
609 2878793798 2878788777 Bacteria 6567085
610 2881152835 2881147464 Bacteria 7779814
611 2881156330 2881155292 Bacteria 6461656
612 2881168337 2881161766 Bacteria 7127907
613 2881853128 2881845957 Bacteria 6611900
614 2881857255 2881853255 Bacteria 6698367
615 2881862816 2881861095 Bacteria 7128710
616 2882633871 2882632389 Bacteria 8154593
617 2882915820 2882912400 Bacteria 6801539
618 2885317141 2885312484 Bacteria 6415165
619 2885321594 2885318864 Bacteria 6729568
620 2885332836 2885326080 Bacteria 7134805
621 2885339128 2885334103 Bacteria 7216818
622 2885344301 2885342637 Bacteria 7011821
623 2885352246 2885350715 Bacteria 6787678
624 2888340168 2888337043 Bacteria 6629336
625 2888347488 2888343758 Bacteria 6611049
626 2888356578 2888350351 Bacteria 7372807
627 2889011483 2889010040 Bacteria 6749192
628 2889016786 2889016732 Bacteria 6700763
629 2889793563 2889790730 Bacteria 5689708
630 2889918703 2889914905 Bacteria 5702301
631 2891051514 2891048133 Bacteria 4447501
632 2891374145 2891373044 Bacteria 5202277
633 2894654287 2894652903 Bacteria 4587256
634 2894818325 2894817345 Bacteria 4892941
635 2896390624 2896384573 Bacteria 7700774
636 2899794164 2899792073 Bacteria 4926588
637 2899808862 2899803654 Bacteria 5577784
638 2899846537 2899845264 Bacteria 5672268
639 2903455633 2903448605 Bacteria 7357801
640 2903495300 2903492973 Bacteria 13473544
641 2903501735 2903492973 Bacteria 13473544
642 2903517919 2903513507 Bacteria 6344008
643 2903522823 2903521522 Bacteria 6525694
644 2903533013 2903528002 Bacteria 6586099
645 2903545532 2903540706 Bacteria 7062119
646 2904583182 2904578770 Bacteria 5302906
647 2904661630 2904659560 Bacteria 6685615
648 2906313178 2906308376 Bacteria 6841989
649 2906325889 2906321335 Bacteria 6579571
650 2906335277 2906328253 Bacteria 6585166
651 2906365840 2906363423 Bacteria 6856682
652 2906376527 2906370794 Bacteria 6881062
653 2906381232 2906378014 Bacteria 6911440
654 2906388932 2906386501 Bacteria 5977019
655 2906397797 2906393657 Bacteria 6790866
656 2906402742 2906401398 Bacteria 6693206
657 2906412668 2906408224 Bacteria 6162342
658 2906416242 2906414383 Bacteria 6580790
659 2906433971 2906427513 Bacteria 6375796
660 2913301098 2913295892 Bacteria 6333755
661 2913310302 2913308742 Bacteria 5350706
662 2915653866 2915650412 Bacteria 4288180
663 2915985347 2915980308 Bacteria 6624279
664 2915987994 2915986958 Bacteria 6739310
665 2915996322 2915993759 Bacteria 7016183
666 2916001463 2916000859 Bacteria 6865702
667 2916010352 2916007675 Bacteria 6898660
668 2916017090 2916014648 Bacteria 6946486
669 2916022489 2916021584 Bacteria 6854472
670 2916029017 2916028427 Bacteria 6748433
671 2916041673 2916035215 Bacteria 6755766
672 2916047887 2916041962 Bacteria 6820487
673 2916054113 2916048683 Bacteria 6543552
674 2916061631 2916055098 Bacteria 6758838
675 2916062310 2916061851 Bacteria 6737736
676 2916071973 2916068649 Bacteria 6943657
677 2916081968 2916076590 Bacteria 6596108
678 2919107875 2919100787 Bacteria 7710546
679 2919115161 2919114240 Bacteria 5700270
680 2919123831 2919119836 Bacteria 5208557
681 2919409840 2919408235 Bacteria 6149349
682 2920765912 2920760137 Bacteria 7427611
683 2920824444 2920822456 Bacteria 6897201
684 2921201570 2921201388 Bacteria 6926299
685 2921210264 2921208531 Bacteria 6745326
686 2921239102 2921237296 Bacteria 6876710
687 2921250408 2921244191 Bacteria 6568419
688 2921253992 2921250672 Bacteria 6677771
689 2921257376 2921257292 Bacteria 6808382
690 2921264600 2921263974 Bacteria 6864552
691 2921283379 2921282425 Bacteria 6826397
692 2921293217 2921289301 Bacteria 7316391
693 2922134387 2922130491 Bacteria 7173936
694 2922157474 2922151315 Bacteria 6902399
695 2922164130 2922158528 Bacteria 6573167
696 2922176404 2922172374 Bacteria 6167644
697 2922184238 2922178524 Bacteria 6025201
698 2922186060 2922185730 Bacteria 7113964
699 2924147430 2924144063 Bacteria 6883928
700 2924151675 2924150972 Bacteria 7169444
701 2924159054 2924158325 Bacteria 7188855
702 2924167819 2924165586 Bacteria 7260590
703 2924176527 2924172951 Bacteria 6749356
704 2924180382 2924179722 Bacteria 6843264
705 2924187600 2924186466 Bacteria 6876637
706 2924200311 2924193448 Bacteria 6955718
707 2924203857 2924200457 Bacteria 6757188
708 2924213803 2924207177 Bacteria 6917007
709 2924217101 2924214083 Bacteria 7080103
710 2924224042 2924221636 Bacteria 7113495
711 2924235070 2924228884 Bacteria 6633132
712 2924715185 2924710171 Bacteria 6752351
713 2924733091 2924726620 Bacteria 6271473
714 2924736226 2924733363 Bacteria 7574837
715 2924742963 2924741084 Bacteria 6661321
716 2924752643 2924748358 Bacteria 6154725
717 2924759538 2924754689 Bacteria 6774424
718 2924768953 2924762789 Bacteria 6561353
719 2924781247 2924776078 Bacteria 7492003
720 2924789640 2924784321 Bacteria 7416538
721 2926756207 2926754445 Bacteria 5964435
722 2926760438 2926760298 Bacteria 5505990
723 2928523249 2928521798 Bacteria 4960112
724 2933008394 2933006813 Bacteria 4912075
725 2933013210 2933011516 Bacteria 5439334
726 2933019195 2933016740 Bacteria 6355406
727 2933597899 2933594066 Bacteria 5594265
728 2935899102 2935894831 Bacteria 6620579
729 2936998016 2936996657 Bacteria 6298727
730 2937006151 2937002841 Bacteria 6934057
731 2937012650 2937009748 Bacteria 6746052
732 2937019723 2937016420 Bacteria 6782579
733 2937029345 2937023124 Bacteria 6815156
734 2937032702 2937029754 Bacteria 6424026
735 2937042031 2937036028 Bacteria 6846469
736 2937045846 2937042894 Bacteria 6741576
737 2937051298 2937049772 Bacteria 6757901
738 2937057709 2937056579 Bacteria 7107896
739 2937070788 2937063883 Bacteria 7199456
740 2937077582 2937071275 Bacteria 6984483
741 2937082642 2937078374 Bacteria 6610289
742 2937091438 2937084907 Bacteria 6618516
743 2937095870 2937091812 Bacteria 6979387
744 2937100126 2937098957 Bacteria 7249374
745 2937111903 2937106411 Bacteria 6947143
746 2937118408 2937113482 Bacteria 6505872
747 2937125680 2937119839 Bacteria 6597547
748 2937130341 2937126314 Bacteria 6771275
749 2937820671 2937813078 Bacteria 7783518
750 2937827271 2937822353 Bacteria 7290551
751 2937845933 2937843397 Bacteria 5256375
752 2937849108 2937848649 Bacteria 6983481
753 2937867884 2937861824 Bacteria 6660327
754 2937879008 2937877337 Bacteria 7246526
755 2937891630 2937891427 Bacteria 6357007
756 2937975246 2937972304 Bacteria 7532020
757 2937999382 2937994558 Bacteria 7036190
758 2938016961 2938014810 Bacteria 6700592
759 2941505043 2941499720 Bacteria 7599444
760 2954015519 2954011201 Bacteria 4762601
761 2957379425 2957375807 Bacteria 6425588
762 2957386434 2957382221 Bacteria 6737050
763 2957389832 2957388812 Bacteria 6778072
764 2957399871 2957395598 Bacteria 6822399
765 2957406754 2957402308 Bacteria 6741770
766 2957410211 2957408893 Bacteria 6558585
767 2957421727 2957415311 Bacteria 6991633
768 2957426181 2957422303 Bacteria 7172205
769 2957437167 2957430029 Bacteria 7022557
770 2957441879 2957437181 Bacteria 6568994
771 2957445460 2957443900 Bacteria 6869977
772 2957453885 2957450854 Bacteria 6765715
773 2957459744 2957457609 Bacteria 6967680
774 2957465737 2957464669 Bacteria 6568877
775 2957476554 2957471148 Bacteria 6797643
776 2957478613 2957478035 Bacteria 6756658
777 2957486137 2957484790 Bacteria 6703082
778 2957498185 2957491536 Bacteria 6695180
779 2957502581 2957498199 Bacteria 7126688
780 2957506634 2957505466 Bacteria 7253085
781 2958034768 2958034702 Bacteria 6989922
782 2958043104 2958041894 Bacteria 13082850
783 2958067017 2958064165 Bacteria 7158582
784 2958077534 2958071322 Bacteria 6815895
785 2958086182 2958084443 Bacteria 7312792
786 2958097727 2958092219 Bacteria 6861151
787 2958106733 2958100919 Bacteria 6800575
788 2958115128 2958108152 Bacteria 6681128
789 2958122280 2958115193 Bacteria 6923548
790 2958123144 2958122699 Bacteria 7280457
791 2958135746 2958130278 Bacteria 6897202
792 2958141991 2958137437 Bacteria 6050276
793 2958148788 2958144490 Bacteria 6677056
794 2958158703 2958158011 Bacteria 6058449
795 2958169856 2958165035 Bacteria 6906348
796 2958178581 2958172287 Bacteria 6716688
797 2958185237 2958179912 Bacteria 6874908
798 2960588930 2960584000 Bacteria 6864594
799 2960596283 2960591022 Bacteria 6622873
800 2960603894 2960597568 Bacteria 6550735
801 2960604486 2960603979 Bacteria 6898737
802 2960616528 2960610863 Bacteria 6691244
803 2960618878 2960617483 Bacteria 6727748
804 2960628764 2960624210 Bacteria 6875384
805 2960632643 2960631154 Bacteria 6732508
806 2960645195 2960637947 Bacteria 7296468
807 2960646300 2960645483 Bacteria 7211087
808 2960656286 2960652885 Bacteria 7083688
809 2960664216 2960660292 Bacteria 7041660
810 2960669595 2960667422 Bacteria 6763020
811 2960676825 2960674078 Bacteria 6609048
812 2960686978 2960680706 Bacteria 6624464
813 2960688761 2960687367 Bacteria 6535474
814 2960700135 2960693952 Bacteria 6749742
815 2961083504 2961077736 Bacteria 7079850
816 2961116783 2961114664 Bacteria 6680456
817 2961136783 2961127735 Bacteria 7196641
818 2961139244 2961136820 Bacteria 6775228
819 2961168316 2961163497 Bacteria 6901077
820 2961177889 2961170736 Bacteria 7072258
821 2961189118 2961183825 Bacteria 6688536
822 2963648364 2963644680 Bacteria 6530403
823 2964609319 2964607997 Bacteria 7101408
824 2964616151 2964615318 Bacteria 6809089
825 2964622915 2964621998 Bacteria 6834995
826 2964632097 2964628898 Bacteria 7083044
827 2964639309 2964636051 Bacteria 7091832
828 2964648890 2964643177 Bacteria 6820887
829 2964652087 2964649959 Bacteria 6675118
830 2964662791 2964656573 Bacteria 7100150
831 2964666846 2964663802 Bacteria 7019362
832 2964671281 2964670856 Bacteria 6851364
833 2964681063 2964678106 Bacteria 6792020
834 2964690096 2964685014 Bacteria 6839111
835 2964696953 2964691889 Bacteria 6802758
836 2964699356 2964698721 Bacteria 6765331
837 2964709018 2964705432 Bacteria 7114648
838 2964716205 2964712639 Bacteria 6695970
839 2964724374 2964719344 Bacteria 7286602
840 2965023135 2965018300 Bacteria 6883036
841 2965029501 2965025482 Bacteria 6532201
842 2965035448 2965032056 Bacteria 6887443
843 2965042839 2965040258 Bacteria 6855979
844 2965054304 2965047637 Bacteria 6623551
845 2965069791 2965062239 Bacteria 7412989
846 2965094042 2965089291 Bacteria 6866420
847 2965111160 2965110997 Bacteria 6693150
848 2965121377 2965119406 Bacteria 6956431
849 2967667076 2967664464 Bacteria 6948836
850 2967672800 2967671571 Bacteria 7021409
851 2967683898 2967678726 Bacteria 7264382
852 2967691231 2967686174 Bacteria 6678622
853 2967693511 2967693043 Bacteria 6804451
854 2967700729 2967699805 Bacteria 6854538
855 2967711707 2967706974 Bacteria 7186053
856 2967715649 2967714385 Bacteria 7000047
857 2967726792 2967721400 Bacteria 7073753
858 2967734420 2967728569 Bacteria 6641507
859 2967736514 2967735183 Bacteria 6827012
860 2967742393 2967742019 Bacteria 6794534
861 2967750523 2967748971 Bacteria 6733771
862 2967758258 2967755722 Bacteria 6814706
863 2967765197 2967762386 Bacteria 6923502
864 2967770679 2967769361 Bacteria 6587838
865 2967776542 2967775926 Bacteria 6738189
866 2968003156 2967996073 Bacteria 6787468
867 2968003982 2968003550 Bacteria 6929263
868 2968017823 2968016561 Bacteria 7022047
869 2968084877 2968083720 Bacteria 7351627
870 2968091819 2968091066 Bacteria 6052692
871 2968101607 2968097103 Bacteria 6107094
872 2968112690 2968110612 Bacteria 6814636
873 2968123078 2968117919 Bacteria 6536078
874 2968129881 2968128360 Bacteria 6270294
875 2968143888 2968138860 Bacteria 6605449
876 2968176716 2968171901 Bacteria 6894245
877 2970022530 2970019648 Bacteria 7072033
878 2970032755 2970026789 Bacteria 6785236
879 2970034407 2970033650 Bacteria 7118744
880 2970041584 2970040964 Bacteria 6731123
881 2970052526 2970047711 Bacteria 7088379
882 2970061298 2970054988 Bacteria 6611507
883 2970063076 2970061556 Bacteria 7099761
884 2970074645 2970068827 Bacteria 7123112
885 2970082409 2970076120 Bacteria 6697332
886 2970088197 2970082768 Bacteria 6183754
887 2970095692 2970088815 Bacteria 6933825
888 2970102338 2970095765 Bacteria 6936963
889 2970104187 2970102677 Bacteria 6812532
890 2970114986 2970109326 Bacteria 6863976
891 2970121469 2970116247 Bacteria 6501857
892 2970126904 2970122695 Bacteria 6625855
893 2970130210 2970129317 Bacteria 6806560
894 2970138421 2970136068 Bacteria 7207982
895 2970147727 2970143518 Bacteria 6446480
896 2970154331 2970149975 Bacteria 6779706
897 2970158079 2970156795 Bacteria 7168044
898 2970170443 2970164137 Bacteria 6861252
899 2970172111 2970170962 Bacteria 6876229
900 2970178240 2970177841 Bacteria 6768001
901 2970187247 2970184632 Bacteria 7054431
902 2970193858 2970191845 Bacteria 7032787
903 2970472002 2970469710 Bacteria 6969209
904 2970495847 2970489779 Bacteria 6517260
905 2970510565 2970503327 Bacteria 7099517
906 2970512694 2970510686 Bacteria 7006402
907 2970531737 2970524798 Bacteria 6840927
908 2970536816 2970532167 Bacteria 6553173
909 2970541015 2970540015 Bacteria 6977556
910 2970550438 2970547951 Bacteria 6931819
911 2970559655 2970554993 Bacteria 6814252
912 2970593248 2970593180 Bacteria 7073582
913 2970621088 2970619444 Bacteria 6986144
914 2970631208 2970627176 Bacteria 6680862
915 2977521181 2977516862 Bacteria 6940108
916 2977526802 2977523885 Bacteria 6960446
917 2977535699 2977530762 Bacteria 6951399
918 2977541716 2977537788 Bacteria 6929320
919 2977550761 2977544691 Bacteria 6875412
920 2977554489 2977551784 Bacteria 7125765
921 2977562631 2977558990 Bacteria 6863948
922 2977572334 2977565890 Bacteria 6901543
923 2977577384 2977572785 Bacteria 6763888
924 2977583693 2977579622 Bacteria 6772100
925 2977822615 2977821940 Bacteria 6906439
926 2977832493 2977828996 Bacteria 7007971
927 2977848969 2977843712 Bacteria 6753583
928 2977855322 2977851361 Bacteria 6694324
929 2977858332 2977858184 Bacteria 6215359
930 2977872538 2977864932 Bacteria 7534097
931 2977875592 2977872689 Bacteria 7270173
932 2977910670 2977907340 Bacteria 6577984
933 2977917535 2977915119 Bacteria 6829656
934 2977923113 2977922695 Bacteria 6956781
935 2977941430 2977935797 Bacteria 6252826
936 2977948218 2977942078 Bacteria 7570577
937 2977951944 2977950692 Bacteria 6893264
938 2977961016 2977957713 Bacteria 6877875
939 2977975619 2977971508 Bacteria 7472917
940 2977992654 2977986579 Bacteria 6581278
941 2979094286 2979089926 Bacteria 5670289
942 2979098333 2979095461 Bacteria 5669583
943 2979103519 2979100975 Bacteria 5423623
944 2979714662 2979710463 Bacteria 6785254
945 2979767243 2979764755 Bacteria 6610066
946 2979774541 2979772303 Bacteria 6618277
947 2979779875 2979779861 Bacteria 6219781
948 2979799785 2979793036 Bacteria 6808957
949 2979815439 2979808191 Bacteria 7179355
950 2984511912 2984509177 Bacteria 5274802
951 2984521728 2984518228 Bacteria 5277463
952 2984541025 2984537506 Bacteria 5277481
953 2984603306 2984601300 Bacteria 5455244
954 2987637366 2987636660 Bacteria 8088555
955 2987648085 2987645492 Bacteria 6117018
956 2987655420 2987652177 Bacteria 6969023
957 2987664330 2987659509 Bacteria 6966464
958 2987670631 2987666974 Bacteria 6509233
959 2987676716 2987673487 Bacteria 6884027
960 2989352999 2989349275 Bacteria 6349068
961 2989778819 2989776772 Bacteria 4843317
962 2995393606 2995392953 Bacteria 4539380
963 2996311008 2996310559 Bacteria 6357320
964 2996337766 2996336353 Bacteria 5511628
965 2996345236 2996341866 Bacteria 6643098
966 2996350934 2996348954 Bacteria 7239054
967 2996392589 2996386984 Bacteria 6978667
968 3000138461 3000135777 Bacteria 6891109
969 3002143897 3002141150 Bacteria 5254435
970 3003671149 3003665799 Bacteria 7279786
971 3004169615 3004167301 Bacteria 8330599
972 3004193385 3004188549 Bacteria 6952365
973 3004196531 3004195979 Bacteria 6776956
974 3004206237 3004203850 Bacteria 7307914
975 3004211657 3004211236 Bacteria 7417683
976 3004218904 3004218560 Bacteria 7421728
977 3004235262 3004232784 Bacteria 6662140
978 3004244298 3004239961 Bacteria 6892290
979 3004250316 3004248173 Bacteria 6563236
980 3004275224 3004268573 Bacteria 7043476
981 3004277632 3004275668 Bacteria 7114440
982 3004292093 3004289098 Bacteria 6135450
983 3004340973 3004334049 Bacteria 8449246
984 3005420297 3005416602 Bacteria 7064308
985 3005447322 3005445848 Bacteria 6906074
986 637073907 637000159 Bacteria 7596297
987 643825786 643692032 Bacteria 6891900
988 648740969 648276728 Bacteria 6968865
989 649873904 649633066 Bacteria 6690028
990 8002286098 8002285264 Bacteria 6717907
991 8003571202 8003570095 Bacteria 5747666
992 8003993473 8003992118 Bacteria 7266902
993 8004000736 8003999396 Bacteria 7063185
994 8004301053 8004300914 Bacteria 6132239
995 8004368258 8004361976 Bacteria 6858373
996 8004375017 8004374579 Bacteria 6898112
997 8004394098 8004387939 Bacteria 7049250
998 8004400127 8004395343 Bacteria 6620908
999 8004445750 8004445564 Bacteria 6322258
1000 8004634050 8004633249 Bacteria 6723080
1001 8004646705 8004640170 Bacteria 6723001
1002 8004700294 8004695233 Bacteria 6731676
1003 8004713714 8004703790 Bacteria 8006957
1004 8004719435 8004714634 Bacteria 6776161
1005 8004734063 8004727605 Bacteria 6643904
1006 8005248369 8005246636 Bacteria 4933972
1007 8005317248 8005314921 Bacteria 7072929
1008 8005388121 8005382845 Bacteria 6732062
1009 8005396922 8005395548 Bacteria 6806915
1010 8005486691 8005484373 Bacteria 6297373
1011 8005575564 8005570704 Bacteria 6957481
1012 8005646169 8005645114 Bacteria 6950293
1013 8005659387 8005658619 Bacteria 4500593
1014 8005686299 8005682033 Bacteria 6726518
1015 8018155442 8018150411 Bacteria 5549903
1016 8024492637 8024486573 Bacteria 6540512
1017 8045865371 8045864390 Bacteria 5043873
1018 8046773947 8046767195 Bacteria 7547379
1019 8049294626 8049293176 Bacteria 6128433
1020 8054462279 8054460903 Bacteria 4872905
1021 8054560846 8054558443 Bacteria 5204801
1022 8055621555 8055617313 Bacteria 7548464
1023 8056388307 8056382006 Bacteria 6408074
1024 8056877657 8056875544 Bacteria 4355797
1025 8057578327 8057575449 Bacteria 7367519
1026 Ga0496126_0394339
1027 JGI25156J39149_1000030
1028 JGI25162J39368_1001515
1029 JGI25154J39366_1000289
1030 JGI25157J39369_1000010
1031 JGI25152J39213_1008181
1032 JGI25150J39212_1000010
1033 JGI25150J39212_1006773
1034 JGI25159J45721_1001125
1035 JGI25151J46595_10000026
1036 JGI25151J46595_10005052
1037 JGI25406J46586_10003438
1038 JGI25165J46597_1000087
1039 JGI25165J46597_1000139
1040 JGI25165J46597_1000654
1041 JGI25165J46597_1001229
1042 JGI25153J46596_10003622
1043 JGI25153J46596_10004316
1044 JGI25153J46596_10011346
1045 JGI25160J50197_1000011
1046 JGI25160J50197_1000593
1047 JGI25160J50197_1016555
1048 JGI25161J50226_1001660
1049 JGI25161J50226_1001956
1050 JGI25161J50226_1002628
1051 Ga0055526_1006958
1052 Ga0055526_1010394
1053 Ga0055524_1006744
1054 Ga0055536_1000356
1055 Ga0055540_1005062
1056 Ga0055540_1015994
1057 Ga0055531_10003828
1058 Ga0058692_1002330
1059 Ga0055543_1000097
1060 Ga0055543_1000255
1061 Ga0055543_1001144
1062 Ga0065165_1000018
1063 Ga0065165_1008107
1064 Ga0065165_1010197
1065 Ga0070665_100068348
1066 Ga0068852_100136537
1067 Ga0081455_10011719
1068 Ga0081539_10010362
1069 Ga0075365_10000809
1070 Ga0075365_10001555
1071 Ga0075365_10028061
1072 Ga0075368_10002095
1073 Ga0075368_10003990
1074 Ga0075363_100016486
1075 Ga0075363_100029663
1076 Ga0075364_10012524
1077 Ga0075367_10009642
1078 Ga0075369_10010101
1079 Ga0075366_10021694
1080 Ga0075366_10026232
1081 Ga0075370_10000970
1082 Ga0075370_10001750
1083 Ga0075370_10138937
1084 Ga0079104_1001402
1085 Ga0079104_1006507
1086 Ga0099826_10000090
1087 Ga0099826_10004510
1088 Ga0105240_10000005
1089 Ga0105241_10186520
1090 Ga0105237_10000773
1091 Ga0105237_10007070
1092 Ga0105238_10004109
1093 Ga0123341_1000049
1094 Ga0123342_1012839
1095 Ga0105239_10004008
1096 Ga0105239_10020587
1097 Ga0157373_10002285
1098 Ga0157371_10000015
1099 Ga0157370_10000992
1100 Ga0157370_10003013
1101 Ga0157370_10055044
1102 Ga0182007_10000618
1103 Ga0183363_1281
1104 Ga0214544_1000129
1105 Ga0214542_1000828
1106 Ga0214542_1027439
1107 Ga0214543_1000010
1108 Ga0214543_1000134
1109 Ga0228711_1002680
1110 Ga0228710_1002851
1111 Ga0209435_100022
1112 Ga0209760_104110
1113 Ga0209436_100507
1114 Ga0209436_103093
1115 Ga0209437_100122
1116 Ga0209437_100160
1117 Ga0207425_1000010
1118 Ga0209646_1000078
1119 Ga0209026_1000065
1120 Ga0209677_104805
1121 Ga0209148_1000072
1122 Ga0209759_1000055
1123 Ga0209129_1000197
1124 Ga0209129_1001042
1125 Ga0209129_1001442
1126 Ga0209233_1000027
1127 Ga0209233_1000168
1128 Ga0209233_1000170
1129 Ga0209233_1001127
1130 Ga0209455_1000133
1131 Ga0209673_1002230
1132 Ga0209673_1006554
1133 Ga0209673_1007969
1134 Ga0209673_1007970
1135 Ga0209130_1000029
1136 Ga0209130_1000097
1137 Ga0209676_1000438
1138 Ga0209025_1000022
1139 Ga0209025_1000033
1140 Ga0209025_1000358
1141 Ga0209025_1000563
1142 Ga0209025_1001678
1143 Ga0209025_1020471
1144 Ga0209564_1000275
1145 Ga0209564_1000986
1146 Ga0209564_1001528
1147 Ga0209758_1000086
1148 Ga0209758_1000505
1149 Ga0209758_1000534
1150 Ga0209758_1020108
1151 Ga0209758_1045640
1152 Ga0209050_1000516
1153 Ga0209256_1001255
1154 Ga0209256_1001768
1155 Ga0207426_1000003
1156 Ga0207426_1000074
1157 Ga0207426_1000408
1158 Ga0209051_1003377
1159 Ga0209051_1004697
1160 Ga0209257_1009229
1161 Ga0209257_1030233
1162 Ga0207647_10003836
1163 Ga0207705_10088769
1164 Ga0207695_10000011
1165 Ga0207671_10004599
1166 Ga0207671_10046567
1167 Ga0207671_10063925
1168 Ga0207694_10033192
1169 Ga0207678_10064346
1170 Ga0207678_10180755
1171 Ga0207702_10009685
1172 Ga0207674_10118013
1173 Ga0209281_1000508
1174 Ga0209281_1004020
1175 Ga0209371_1000178
1176 Ga0209371_1017786
1177 Ga0209282_1000116
1178 Ga0209282_1000235
1179 Ga0209813_10007397
1180 Ga0268266_10059721
1181 Ga0268266_10107615
1182 Ga0307515_10000233
1183 Ga0307515_10013071
1184 Ga0307515_10265602
1185 Ga0268256_1000251
1186 Ga0268256_1022835
1187 Ga0316181_1236523
1188 Ga0307513_10021520
1189 Ga0307412_10000449
1190 Ga0315914_1002646
1191 Ga0315913_1001232
1192 Ga0315915_1000058
1193 Ga0373947_0010286
1194 Ga0373925_0063164
1195 Ga0395899_0000073
1196 Ga0395899_0305665
1197 Ga0395900_0000027
1198 Ga0395900_0037124
1199 Ga0395900_0314024
1200 Ga0395898_0000255
1201 Ga0395898_0108397
1202 Ga0395905_0000032
1203 Ga0395905_0000386
1204 Ga0395905_0046935
1205 Ga0395905_0208393
1206 Ga0395901_0000110
1207 Ga0395901_0033538
1208 Ga0395901_0089747
1209 Ga0395901_0206055
1210 Ga0436365_0571926
1211 Ga0436365_1745677
1212 Ga0436360_1264804
1213 Ga0436362_0562496
1214 Ga0436362_1220355
1215 Ga0451851_0841148
1216 Ga0439449_0005586
1217 Ga0466968_0026106
1218 Ga0495638_0034607
1219 Ga0495664_0078795
1220 Ga0495583_0044363
1221 Ga0495587_0052935
1222 Ga0495634_0011375
1223 Ga0495625_0023055
1224 Ga0495625_0270331
1225 Ga0495613_0125857
1226 Ga0495686_0002178
1227 Ga0496101_0052923
1228 Ga0496104_0007867
1229 Ga0496104_0465763
1230 Ga0496105_0115440
1231 Ga0496110_0080939
1232 Ga0496112_0023334
1233 Ga0496115_0242934
1234 Ga0496116_0036906
1235 Ga0496116_0116082
1236 Ga0496117_0000002
1237 Ga0496117_0002298
1238 Ga0496117_0012239
1239 Ga0496118_0000460
1240 Ga0496118_0003956
1241 Ga0496118_0011413
1242 Ga0496118_0031959
1243 Ga0496119_0047784
1244 Ga0496120_0000078
1245 Ga0496120_0007642
1246 Ga0496121_0002309
1247 Ga0496121_0009598
1248 Ga0496121_0010507
1249 Ga0496122_0000001
1250 Ga0496122_0000025
1251 Ga0496122_0000957
1252 Ga0496122_0004632
1253 Ga0496122_0011586
1254 Ga0496122_0012223
1255 Ga0496123_0000001
1256 Ga0496123_0000032
1257 Ga0496123_0000043
1258 Ga0496123_0005205
1259 Ga0496124_0002623
1260 Ga0496124_0003161
1261 Ga0496124_0014237
1262 Ga0496125_0000311
1263 Ga0496125_0005370
1264 Ga0496125_0077891
1265 Ga0496125_0150703
1266 Ga0496126_0001233
1267 Ga0501031_0000217
1268 Ga0501031_0007446
1269 Ga0501031_0025811
1270 Ga0501032_0000009
1271 Ga0501032_0000064
1272 Ga0501032_0004360
1273 Ga0501032_0093103
1274 Ga0501033_0000019
1275 Ga0501033_0000330
1276 Ga0501033_0001030
1277 Ga0501033_0033887
1278 Ga0501033_0179189
1279 Ga0501034_0000044
1280 Ga0501034_0000174
1281 Ga0501034_0015374
1282 Ga0501034_0026260
1283 Ga0501034_0375761
1284 Ga0501036_0000008
1285 Ga0501036_0000399
1286 Ga0501036_0095797
1287 Ga0501036_0174211
1288 Ga0501037_0000163
1289 Ga0501037_0000267
1290 Ga0501037_0000448
1291 Ga0501038_0000006
1292 Ga0501038_0000031
1293 Ga0501038_0084809
1294 Ga0501038_0107639
1295 Ga0501039_0000014
1296 Ga0501039_0000057
1297 Ga0501039_0038919
1298 Ga0501040_0057227
1299 Ga0501043_0000048
1300 Ga0501043_0000294
1301 Ga0501043_0000566
1302 Ga0501043_0044900
1303 Ga0501043_0089584
1304 Ga0501047_0003119
1305 Ga0501047_0003704
1306 Ga0501047_0009890
1307 Ga0501047_0086262
1308 Ga0501048_0101550
1309 Ga0501067_0040840
1310 Ga0501068_0057312
1311 Ga0501068_0083040
1312 Ga0501068_0125193
1313 Ga0501069_0000084
1314 Ga0501070_0001180
1315 Ga0501070_0001515
1316 Ga0501070_0005785
1317 Ga0501070_0011207
1318 Ga0501070_0015976
1319 Ga0501070_0019103
1320 Ga0501071_0018777
1321 Ga0501073_0260312
1322 Ga0501074_0000085
1323 Ga0501074_0060749
1324 Ga0501080_0003149
1325 Ga0501080_0004202
1326 Ga0501080_0033670
1327 Ga0501080_0071228
1328 Ga0501083_0000078
1329 Ga0501280_004928
1330 Ga0501035_0000198
1331 Ga0501035_0000471
1332 Ga0501035_0000823
1333 Ga0501035_0001118
1334 Ga0501035_0002538
1335 Ga0501035_0021740
1336 Ga0501035_0028077
1337 Ga0501044_0000017
1338 Ga0501044_0000649
1339 Ga0501044_0021213
1340 Ga0501044_0026568
1341 Ga0501044_0130972
1342 Ga0501044_0136994
1343 Ga0501044_0199061
1344 nmdc:mga03683_3419_c1
1345 nmdc:mga03n38_44285_c1
1346 nmdc:mga03n38_4569_c1
1347 nmdc:mga00v17_49200_c1
1348 nmdc:mga00v17_59031_c2
1349 nmdc:mga0yw44_5123_c1
1350 nmdc:mga0yw44_697_c1
1351 nmdc:mga0k408_25595_c1
1352 nmdc:mga06z11_8356_c1
1353 nmdc:mga06z11_88752_c1
1354 nmdc:mga04h51_5032_c1
1355 nmdc:mga0sz30_14502_c1
1356 nmdc:mga0sz30_4182_c1
1357 nmdc:mga0sz30_77268_c1
1358 Ga0495601_0042123
1359 Ga0495601_0043570
1360 Ga0495595_0057471
1361 Ga0495619_0329604
1362 Ga0500641_0013413
1363 Ga0500608_074924
1364 Ga0500652_000214
1365 Ga0500568_0000592
1366 Ga0500620_000253
1367 Ga0500620_001907
1368 Ga0500622_0000378
1369 Ga0500622_0000778
1370 Ga0500627_0012784
1371 Ga0500636_0005342
1372 Ga0501082_0016825
1373 2503202237
1374 2509107651
1375 2509117046
1376 2509140617
1377 2509370685
1378 2509375989
1379 2509396886
1380 2510308660
1381 2510317478
1382 2511134930
1383 2511193390
1384 2511389446
1385 2511501508
1386 2512930861
1387 2512958587
1388 2512971739
1389 2513588111
1390 2513605271
1391 2513609899
1392 2513618702
1393 2513886970
1394 2513907205
1395 2513987069
1396 2513997347
1397 2514005287
1398 2514034997
1399 2514418966
1400 2514589937
1401 2515611351
1402 2515645036
1403 2516209511
1404 2516892826
1405 2517569601
1406 2524453662
1407 2537877785
1408 2551674253
1409 2551680405
1410 2551686545
1411 2551691822
1412 2551699774
1413 2551711740
1414 2551719509
1415 2551729149
1416 2551737099
1417 2551742526
1418 2554247753
1419 2559294886
1420 2561466506
1421 2585168471
1422 2585225791
1423 2585254506
1424 2585270045
1425 2585270670
1426 2585277011
1427 2585323983
1428 2585333620
1429 2585389750
1430 2585393715
1431 2585537021
1432 2585540496
1433 2585546751
1434 2585551872
1435 2585558373
1436 2585838712
1437 2585846560
1438 2585897768
1439 2585904638
1440 2587980246
1441 2597814072
1442 2599336304
1443 2599604147
1444 2599938053
1445 2600197124
1446 2601608060
1447 2601744835
1448 2616308385
1449 2616556547
1450 2617385874
1451 2643773749
1452 2643775545
1453 2643793991
1454 2643808723
1455 2643811902
1456 2643837486
1457 2643919377
1458 2643989415
1459 2644049363
1460 2644066255
1461 2644107979
1462 2644132065
1463 2644148349
1464 2644152987
1465 2644204298
1466 2644210480
1467 2644300654
1468 2644309373
1469 2644333199
1470 2644377795
1471 2644415532
1472 2644450066
1473 2644482397
1474 2644494477
1475 2644502050
1476 2644522279
1477 2644545629
1478 2644615315
1479 2644654032
1480 2644658692
1481 2644673622
1482 2644687623
1483 2657683821
1484 2671115786
1485 2671695808
1486 2688599400
1487 2692316027
1488 2694632184
1489 2723576352
1490 2738945593
1491 2739037992
1492 2739307890
1493 2753458335
1494 2756675869
1495 2757572064
1496 2765465588
1497 2770195611
1498 2776271527
1499 2776279962
1500 2776913376
1501 2778176525
1502 2792580745
1503 2792639536
1504 2792748508
1505 2793279679
1506 2793298261
1507 2793313742
1508 2793337049
1509 2793341300
1510 2793361396
1511 2802718737
1512 2802726349
1513 2802732889
1514 2802738244
1515 2802744578
1516 2802751216
1517 2804752084
1518 2806045383
1519 2806055424
1520 2806061467
1521 2806068041
1522 2806072611
1523 2808985344
1524 2819241892
1525 2819559777
1526 2819610358
1527 2819638100
1528 2837653068
1529 2837680218
1530 2838035090
1531 2838043207
1532 2838078755
1533 2838676188
1534 2838682461
1535 2838697032
1536 2838709727
1537 2838715070
1538 2838721130
1539 2838725829
1540 2839995544
1541 2840768071
1542 2841740039
1543 2841848087
1544 2841859362
1545 2842077901
1546 2842119591
1547 2842125883
1548 2842131082
1549 2842153748
1550 2842171313
1551 2842177368
1552 2842188178
1553 2842212489
1554 2842225892
1555 2842239140
1556 2842291563
1557 2842373028
1558 2842377959
1559 2842386100
1560 2842481858
1561 2842487084
1562 2842508733
1563 2842510259
1564 2842516146
1565 2842522408
1566 2842872740
1567 2842927723
1568 2844006466
1569 2844014679
1570 2844167285
1571 2847418908
1572 2847692975
1573 2848993945
1574 2850081892
1575 2852389677
1576 2854911950
1577 2855825603
1578 2855840980
1579 2855876578
1580 2856316105
1581 2856325872
1582 2856328952
1583 2856335305
1584 2856343723
1585 2856353661
1586 2856360207
1587 2856368851
1588 2857350178
1589 2857373634
1590 2858801520
1591 2869165290
1592 2869172533
1593 2869251931
1594 2869262511
1595 2869266575
1596 2869272483
1597 2869278652
1598 2869291346
1599 2871433626
1600 2871447695
1601 2871458170
1602 2871459833
1603 2871472076
1604 2871475333
1605 2871486718
1606 2871495756
1607 2871500719
1608 2874113677
1609 2874119162
1610 2874125971
1611 2874136525
1612 2874145238
1613 2874153227
1614 2874160492
1615 2874168486
1616 2874176231
1617 2876365467
1618 2876371146
1619 2876382676
1620 2876386141
1621 2876394999
1622 2876403116
1623 2876413257
1624 2876419518
1625 2876424463
1626 2878040374
1627 2878743435
1628 2878751237
1629 2878753445
1630 2878764808
1631 2878771909
1632 2878774843
1633 2878787843
1634 2878793798
1635 2881152835
1636 2881156330
1637 2881168337
1638 2881853128
1639 2881857255
1640 2881862816
1641 2882633871
1642 2882915820
1643 2885317141
1644 2885321594
1645 2885332836
1646 2885339128
1647 2885344301
1648 2885352246
1649 2888340168
1650 2888347488
1651 2888356578
1652 2889011483
1653 2889016786
1654 2889793563
1655 2889918703
1656 2891051514
1657 2891374145
1658 2894654287
1659 2894818325
1660 2896390624
1661 2899794164
1662 2899808862
1663 2899846537
1664 2903455633
1665 2903495300
1666 2903501735
1667 2903517919
1668 2903522823
1669 2903533013
1670 2903545532
1671 2904583182
1672 2904661630
1673 2906313178
1674 2906325889
1675 2906335277
1676 2906365840
1677 2906376527
1678 2906381232
1679 2906388932
1680 2906397797
1681 2906402742
1682 2906412668
1683 2906416242
1684 2906433971
1685 2913301098
1686 2913310302
1687 2915653866
1688 2915985347
1689 2915987994
1690 2915996322
1691 2916001463
1692 2916010352
1693 2916017090
1694 2916022489
1695 2916029017
1696 2916041673
1697 2916047887
1698 2916054113
1699 2916061631
1700 2916062310
1701 2916071973
1702 2916081968
1703 2919107875
1704 2919115161
1705 2919123831
1706 2919409840
1707 2920765912
1708 2920824444
1709 2921201570
1710 2921210264
1711 2921239102
1712 2921250408
1713 2921253992
1714 2921257376
1715 2921264600
1716 2921283379
1717 2921293217
1718 2922134387
1719 2922157474
1720 2922164130
1721 2922176404
1722 2922184238
1723 2922186060
1724 2924147430
1725 2924151675
1726 2924159054
1727 2924167819
1728 2924176527
1729 2924180382
1730 2924187600
1731 2924200311
1732 2924203857
1733 2924213803
1734 2924217101
1735 2924224042
1736 2924235070
1737 2924715185
1738 2924733091
1739 2924736226
1740 2924742963
1741 2924752643
1742 2924759538
1743 2924768953
1744 2924781247
1745 2924789640
1746 2926756207
1747 2926760438
1748 2928523249
1749 2933008394
1750 2933013210
1751 2933019195
1752 2933597899
1753 2935899102
1754 2936998016
1755 2937006151
1756 2937012650
1757 2937019723
1758 2937029345
1759 2937032702
1760 2937042031
1761 2937045846
1762 2937051298
1763 2937057709
1764 2937070788
1765 2937077582
1766 2937082642
1767 2937091438
1768 2937095870
1769 2937100126
1770 2937111903
1771 2937118408
1772 2937125680
1773 2937130341
1774 2937820671
1775 2937827271
1776 2937845933
1777 2937849108
1778 2937867884
1779 2937879008
1780 2937891630
1781 2937975246
1782 2937999382
1783 2938016961
1784 2941505043
1785 2954015519
1786 2957379425
1787 2957386434
1788 2957389832
1789 2957399871
1790 2957406754
1791 2957410211
1792 2957421727
1793 2957426181
1794 2957437167
1795 2957441879
1796 2957445460
1797 2957453885
1798 2957459744
1799 2957465737
1800 2957476554
1801 2957478613
1802 2957486137
1803 2957498185
1804 2957502581
1805 2957506634
1806 2958034768
1807 2958043104
1808 2958067017
1809 2958077534
1810 2958086182
1811 2958097727
1812 2958106733
1813 2958115128
1814 2958122280
1815 2958123144
1816 2958135746
1817 2958141991
1818 2958148788
1819 2958158703
1820 2958169856
1821 2958178581
1822 2958185237
1823 2960588930
1824 2960596283
1825 2960603894
1826 2960604486
1827 2960616528
1828 2960618878
1829 2960628764
1830 2960632643
1831 2960645195
1832 2960646300
1833 2960656286
1834 2960664216
1835 2960669595
1836 2960676825
1837 2960686978
1838 2960688761
1839 2960700135
1840 2961083504
1841 2961116783
1842 2961136783
1843 2961139244
1844 2961168316
1845 2961177889
1846 2961189118
1847 2963648364
1848 2964609319
1849 2964616151
1850 2964622915
1851 2964632097
1852 2964639309
1853 2964648890
1854 2964652087
1855 2964662791
1856 2964666846
1857 2964671281
1858 2964681063
1859 2964690096
1860 2964696953
1861 2964699356
1862 2964709018
1863 2964716205
1864 2964724374
1865 2965023135
1866 2965029501
1867 2965035448
1868 2965042839
1869 2965054304
1870 2965069791
1871 2965094042
1872 2965111160
1873 2965121377
1874 2967667076
1875 2967672800
1876 2967683898
1877 2967691231
1878 2967693511
1879 2967700729
1880 2967711707
1881 2967715649
1882 2967726792
1883 2967734420
1884 2967736514
1885 2967742393
1886 2967750523
1887 2967758258
1888 2967765197
1889 2967770679
1890 2967776542
1891 2968003156
1892 2968003982
1893 2968017823
1894 2968084877
1895 2968091819
1896 2968101607
1897 2968112690
1898 2968123078
1899 2968129881
1900 2968143888
1901 2968176716
1902 2970022530
1903 2970032755
1904 2970034407
1905 2970041584
1906 2970052526
1907 2970061298
1908 2970063076
1909 2970074645
1910 2970082409
1911 2970088197
1912 2970095692
1913 2970102338
1914 2970104187
1915 2970114986
1916 2970121469
1917 2970126904
1918 2970130210
1919 2970138421
1920 2970147727
1921 2970154331
1922 2970158079
1923 2970170443
1924 2970172111
1925 2970178240
1926 2970187247
1927 2970193858
1928 2970472002
1929 2970495847
1930 2970510565
1931 2970512694
1932 2970531737
1933 2970536816
1934 2970541015
1935 2970550438
1936 2970559655
1937 2970593248
1938 2970621088
1939 2970631208
1940 2977521181
1941 2977526802
1942 2977535699
1943 2977541716
1944 2977550761
1945 2977554489
1946 2977562631
1947 2977572334
1948 2977577384
1949 2977583693
1950 2977822615
1951 2977832493
1952 2977848969
1953 2977855322
1954 2977858332
1955 2977872538
1956 2977875592
1957 2977910670
1958 2977917535
1959 2977923113
1960 2977941430
1961 2977948218
1962 2977951944
1963 2977961016
1964 2977975619
1965 2977992654
1966 2979094286
1967 2979098333
1968 2979103519
1969 2979714662
1970 2979767243
1971 2979774541
1972 2979779875
1973 2979799785
1974 2979815439
1975 2984511912
1976 2984521728
1977 2984541025
1978 2984603306
1979 2987637366
1980 2987648085
1981 2987655420
1982 2987664330
1983 2987670631
1984 2987676716
1985 2989352999
1986 2989778819
1987 2995393606
1988 2996311008
1989 2996337766
1990 2996345236
1991 2996350934
1992 2996392589
1993 3000138461
1994 3002143897
1995 3003671149
1996 3004169615
1997 3004193385
1998 3004196531
1999 3004206237
2000 3004211657
2001 3004218904
2002 3004235262
2003 3004244298
2004 3004250316
2005 3004275224
2006 3004277632
2007 3004292093
2008 3004340973
2009 3005420297
2010 3005447322
2011 637073907
2012 643825786
2013 648740969
2014 649873904
2015 8002286098
2016 8003571202
2017 8003993473
2018 8004000736
2019 8004301053
2020 8004368258
2021 8004375017
2022 8004394098
2023 8004400127
2024 8004445750
2025 8004634050
2026 8004646705
2027 8004700294
2028 8004713714
2029 8004719435
2030 8004734063
2031 8005248369
2032 8005317248
2033 8005388121
2034 8005396922
2035 8005486691
2036 8005575564
2037 8005646169
2038 8005659387
2039 8005686299
2040 8018155442
2041 8024492637
2042 8045865371
2043 8046773947
2044 8049294626
2045 8054462279
2046 8054560846
2047 8055621555
2048 8056388307
2049 8056877657
2050 8057578327

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01702

TGT

Queuine tRNA-ribosyltransferase

1

312

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ipp-assembly1.cif.gz_A-2 trna-guanine-transglycosylase (tgt) mutant v262d apo-structure 0.9661 5 368
6ygk-assembly1.cif.gz_A-2 tgt y330f mutant crystallised at ph 8.5 0.9657 5 369
4hqv-assembly1.cif.gz_A-2 trna-guanine transglycosylase y106f, c158v, v233g mutant in complex with queuine 0.965 5 369
4q8m-assembly1.cif.gz_A-2 trna-guanine transglycosylase (tgt) mutant v262t apo structure 0.9646 5 369
1efz-assembly1.cif.gz_A-2 mutagenesis and crystallographic studies of zymomonas mobilis trna-guanine transglycosylase to elucidate the role of serine 103 for enzymatic activity 0.9638 5 368
ID Description Score Start End Superfamily
2ashB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9567 7 368 3.20.20.105
4jbrA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9503 2 372 3.20.20.105
2ashB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.949 7 368 3.20.20.105
af_Q23623_1_366_3.20.20.105 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9445 6 369 3.20.20.105
af_Q4DZ65_34_446_3.20.20.105 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Queuine tRNA-ribosyltransferase-like 0.9422 16 363 3.20.20.105
ID Description Score Start End GO Terms
AF-A0A6A5LDH1-F1-model_v4 deleted 0.9804 23 345
AF-A0A543NYG2-F1-model_v4 deleted 0.9803 2 372
AF-A0A3S2F0V2-F1-model_v4 deleted 0.9798 40 376
AF-D6LPW4-F1-model_v4 deleted 0.9797 1 223
AF-A0A3D3SHC0-F1-model_v4 deleted 0.9794 244 371

Map