F488499

General Info

Members Datasets Scaffolds Average Seq Length
1025 267 2050 134

Family's Representative Sequence

Representative Sequence 3300049850|Ga0501204_044804|Ga0501204_044804_123_500
Length 125
Sequence MRYQRAEPPLKLDGLAAARKFFAGCLAEEDPRRESLWVAHVDNDARCLHVACYRGDAVAADASHHGSAGIVLAHNHPSGDARPSDSDCRATRRLASAAEALDCTVLDHLVFAGKDCTSLRQLGYL

Samples

Sample ID Description Type Environment
1 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
197 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
198 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
199 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
200 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
241 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
242 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
243 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
244 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
245 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
246 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
247 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
248 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
249 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
250 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
253 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
254 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
255 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
256 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
257 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
258 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
259 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
260 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 3.41
Rhizosphere 96
Stem 0
Stem Tuber 0
Unclassified 7.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501204_044804 3300049850 Bacteria 660
2 JGI24736J21556_1031289 3300001904 Bacteria 822
3 JGI24740J21852_10008659 3300001979 Bacteria 4039
4 JGI24740J21852_10034115 3300001979 Bacteria 1607
5 JGI24739J22299_10009129 3300001989 Bacteria 3699
6 JGI24739J22299_10021228 3300001989 Bacteria 2313
7 JGI24737J22298_10004177 3300001990 Bacteria 5049
8 JGI24737J22298_10032855 3300001990 Bacteria 1614
9 JGI24737J22298_10051823 3300001990 Bacteria 1245
10 JGI24743J22301_10007370 3300001991 Bacteria 1906
11 JGI24743J22301_10031105 3300001991 Bacteria 1051
12 JGI24743J22301_10035884 3300001991 Bacteria 986
13 JGI24735J21928_10031903 3300002067 Bacteria 1561
14 JGI24735J21928_10132300 3300002067 Unclassified 719
15 JGI24745J21846_1003710 3300002073 Bacteria 1608
16 JGI24744J21845_10000111 3300002077 Bacteria 11081
17 JGI24742J22300_10015013 3300002244 Bacteria 1302
18 Ga0065704_10042887 3300005289 Unclassified 764
19 Ga0065715_10184812 3300005293 Bacteria 1452
20 Ga0070658_10005690 3300005327 Bacteria 10107
21 Ga0070658_10028246 3300005327 Bacteria 4503
22 Ga0070658_10044805 3300005327 Bacteria 3575
23 Ga0070658_10049652 3300005327 Bacteria 3399
24 Ga0070658_10078042 3300005327 Bacteria 2717
25 Ga0070658_10106887 3300005327 Bacteria 2315
26 Ga0070658_10114352 3300005327 Bacteria 2238
27 Ga0070658_10117686 3300005327 Bacteria 2206
28 Ga0070658_10132943 3300005327 Bacteria 2074
29 Ga0070658_10265834 3300005327 Bacteria 1458
30 Ga0070658_10322902 3300005327 Bacteria 1318
31 Ga0070658_10333048 3300005327 Bacteria 1297
32 Ga0070658_10347864 3300005327 Bacteria 1268
33 Ga0070658_10754517 3300005327 Unclassified 845
34 Ga0070658_10825464 3300005327 Bacteria 805
35 Ga0070658_10827438 3300005327 Bacteria 804
36 Ga0070658_10964448 3300005327 Bacteria 741
37 Ga0070658_11004821 3300005327 Unclassified 725
38 Ga0070658_11034082 3300005327 Unclassified 714
39 Ga0070658_11292408 3300005327 Bacteria 634
40 Ga0070676_10030556 3300005328 Bacteria 3073
41 Ga0070676_10057428 3300005328 Bacteria 2303
42 Ga0070676_10089920 3300005328 Bacteria 1879
43 Ga0070676_10113005 3300005328 Bacteria 1694
44 Ga0070676_10117500 3300005328 Bacteria 1664
45 Ga0070676_10124527 3300005328 Bacteria 1622
46 Ga0070676_10761984 3300005328 Bacteria 711
47 Ga0070683_100005914 3300005329 Bacteria 10237
48 Ga0070683_100016035 3300005329 Bacteria 6594
49 Ga0070683_100043657 3300005329 Bacteria 4132
50 Ga0070683_100116324 3300005329 Bacteria 2524
51 Ga0070683_100362861 3300005329 Bacteria 1380
52 Ga0070690_100005454 3300005330 Bacteria 7146
53 Ga0070690_100011910 3300005330 Bacteria 5105
54 Ga0070670_100190759 3300005331 Bacteria 1780
55 Ga0070670_100234802 3300005331 Bacteria 1596
56 Ga0070670_100578950 3300005331 Bacteria 1003
57 Ga0070677_10046990 3300005333 Bacteria 1728
58 Ga0068869_100079144 3300005334 Bacteria 2449
59 Ga0068869_100385084 3300005334 Bacteria 1150
60 Ga0068869_100896723 3300005334 Bacteria 767
61 Ga0070666_10005568 3300005335 Bacteria 7725
62 Ga0070666_10016133 3300005335 Bacteria 4773
63 Ga0070666_10020416 3300005335 Bacteria 4282
64 Ga0070666_10050842 3300005335 Bacteria 2789
65 Ga0070666_10376765 3300005335 Bacteria 1018
66 Ga0070666_10708590 3300005335 Unclassified 738
67 Ga0070680_100022384 3300005336 Bacteria 5034
68 Ga0070680_100161154 3300005336 Bacteria 1885
69 Ga0070680_100241907 3300005336 Bacteria 1525
70 Ga0070680_100480307 3300005336 Bacteria 1062
71 Ga0070680_100749171 3300005336 Bacteria 841
72 Ga0070682_100066675 3300005337 Bacteria 2291
73 Ga0070682_100420028 3300005337 Bacteria 1016
74 Ga0068868_100007444 3300005338 Bacteria 7795
75 Ga0068868_100112598 3300005338 Bacteria 2212
76 Ga0068868_100138552 3300005338 Bacteria 1996
77 Ga0068868_100259612 3300005338 Bacteria 1464
78 Ga0070660_100021004 3300005339 Bacteria 4807
79 Ga0070660_100047439 3300005339 Bacteria 3296
80 Ga0070660_100068007 3300005339 Bacteria 2776
81 Ga0070660_100072096 3300005339 Bacteria 2698
82 Ga0070660_100076394 3300005339 Bacteria 2623
83 Ga0070660_100163169 3300005339 Bacteria 1796
84 Ga0070660_100193964 3300005339 Bacteria 1646
85 Ga0070660_100207160 3300005339 Bacteria 1591
86 Ga0070660_100215612 3300005339 Bacteria 1559
87 Ga0070660_100254180 3300005339 Bacteria 1433
88 Ga0070660_100472128 3300005339 Bacteria 1042
89 Ga0070660_100960689 3300005339 Bacteria 721
90 Ga0070689_100780444 3300005340 Bacteria 839
91 Ga0070691_10002830 3300005341 Bacteria 7756
92 Ga0070687_100030928 3300005343 Bacteria 2621
93 Ga0070661_100017415 3300005344 Bacteria 5097
94 Ga0070661_100020888 3300005344 Bacteria 4673
95 Ga0070661_100024685 3300005344 Bacteria 4312
96 Ga0070661_100030553 3300005344 Bacteria 3892
97 Ga0070661_100034228 3300005344 Bacteria 3684
98 Ga0070661_100052208 3300005344 Bacteria 2992
99 Ga0070661_100072325 3300005344 Bacteria 2537
100 Ga0070661_100074859 3300005344 Bacteria 2494
101 Ga0070661_100215349 3300005344 Bacteria 1471
102 Ga0070661_100217775 3300005344 Bacteria 1463
103 Ga0070661_100586005 3300005344 Bacteria 900
104 Ga0070661_100740743 3300005344 Bacteria 803
105 Ga0070661_100881392 3300005344 Bacteria 738
106 Ga0070661_101409615 3300005344 Unclassified 586
107 Ga0070692_10031022 3300005345 Bacteria 2677
108 Ga0070692_10312758 3300005345 Bacteria 963
109 Ga0070692_10798390 3300005345 Bacteria 644
110 Ga0070668_100151724 3300005347 Bacteria 1874
111 Ga0070668_100239632 3300005347 Bacteria 1502
112 Ga0070668_100317777 3300005347 Bacteria 1310
113 Ga0070668_100493598 3300005347 Bacteria 1059
114 Ga0070669_100025211 3300005353 Bacteria 4270
115 Ga0070669_100179848 3300005353 Bacteria 1654
116 Ga0070675_100045611 3300005354 Bacteria 3587
117 Ga0070675_100224953 3300005354 Bacteria 1635
118 Ga0070675_100276139 3300005354 Bacteria 1476
119 Ga0070671_100007870 3300005355 Bacteria 8521
120 Ga0070671_100037184 3300005355 Bacteria 4037
121 Ga0070671_100160972 3300005355 Bacteria 1897
122 Ga0070674_100018215 3300005356 Bacteria 4435
123 Ga0070674_100146977 3300005356 Bacteria 1775
124 Ga0070674_100195205 3300005356 Bacteria 1559
125 Ga0070674_100248081 3300005356 Bacteria 1397
126 Ga0070674_100380828 3300005356 Bacteria 1148
127 Ga0070673_100029293 3300005364 Bacteria 4105
128 Ga0070673_100074529 3300005364 Bacteria 2735
129 Ga0070673_100680556 3300005364 Bacteria 943
130 Ga0070673_100840476 3300005364 Bacteria 849
131 Ga0070673_100888797 3300005364 Bacteria 826
132 Ga0070688_100233135 3300005365 Bacteria 1303
133 Ga0070659_100008501 3300005366 Bacteria 7503
134 Ga0070659_100008995 3300005366 Bacteria 7323
135 Ga0070659_100016125 3300005366 Bacteria 5607
136 Ga0070659_100023294 3300005366 Bacteria 4738
137 Ga0070659_100029693 3300005366 Bacteria 4226
138 Ga0070659_100037137 3300005366 Bacteria 3797
139 Ga0070659_100043143 3300005366 Bacteria 3527
140 Ga0070659_100053768 3300005366 Bacteria 3170
141 Ga0070659_100146067 3300005366 Bacteria 1927
142 Ga0070659_100269878 3300005366 Bacteria 1413
143 Ga0070659_100403745 3300005366 Bacteria 1154
144 Ga0070667_100010950 3300005367 Bacteria 7500
145 Ga0070667_100024075 3300005367 Bacteria 5056
146 Ga0070667_100046599 3300005367 Bacteria 3647
147 Ga0070667_100052622 3300005367 Bacteria 3436
148 Ga0070667_100080670 3300005367 Bacteria 2783
149 Ga0070667_100103121 3300005367 Bacteria 2466
150 Ga0070667_100171884 3300005367 Bacteria 1913
151 Ga0070714_100393350 3300005435 Bacteria 1309
152 Ga0070663_100009308 3300005455 Bacteria 6079
153 Ga0070663_100024579 3300005455 Bacteria 4057
154 Ga0070663_100032768 3300005455 Bacteria 3585
155 Ga0070663_100034824 3300005455 Bacteria 3489
156 Ga0070663_100075585 3300005455 Bacteria 2462
157 Ga0070663_100100010 3300005455 Bacteria 2163
158 Ga0070663_100295216 3300005455 Bacteria 1295
159 Ga0070663_100413661 3300005455 Bacteria 1105
160 Ga0070663_101215894 3300005455 Bacteria 662
161 Ga0070678_100046313 3300005456 Bacteria 3117
162 Ga0070678_100151667 3300005456 Bacteria 1867
163 Ga0070662_100007577 3300005457 Bacteria 7043
164 Ga0070662_100023737 3300005457 Bacteria 4217
165 Ga0070662_100037755 3300005457 Bacteria 3426
166 Ga0070662_100044214 3300005457 Bacteria 3189
167 Ga0070662_100078127 3300005457 Bacteria 2458
168 Ga0070662_100084784 3300005457 Bacteria 2367
169 Ga0070662_100105019 3300005457 Bacteria 2144
170 Ga0070662_100120489 3300005457 Bacteria 2010
171 Ga0070662_100255886 3300005457 Bacteria 1409
172 Ga0070662_100260542 3300005457 Bacteria 1397
173 Ga0070681_10055658 3300005458 Bacteria 3938
174 Ga0070681_10100209 3300005458 Bacteria 2843
175 Ga0070681_10105476 3300005458 Bacteria 2760
176 Ga0070681_10208271 3300005458 Bacteria 1872
177 Ga0070681_10548228 3300005458 Bacteria 1070
178 Ga0070681_10722111 3300005458 Unclassified 912
179 Ga0068867_100005872 3300005459 Bacteria 8707
180 Ga0068867_100043538 3300005459 Bacteria 3286
181 Ga0068867_100072637 3300005459 Bacteria 2576
182 Ga0068867_100187884 3300005459 Bacteria 1647
183 Ga0068867_100833129 3300005459 Bacteria 825
184 Ga0070679_100053872 3300005530 Bacteria 4005
185 Ga0070679_100065499 3300005530 Bacteria 3622
186 Ga0070679_100399454 3300005530 Bacteria 1320
187 Ga0070679_100714599 3300005530 Bacteria 945
188 Ga0070684_100034034 3300005535 Bacteria 4354
189 Ga0070684_100393442 3300005535 Bacteria 1277
190 Ga0070684_100534066 3300005535 Bacteria 1088
191 Ga0070684_100917896 3300005535 Bacteria 821
192 Ga0068853_100043655 3300005539 Bacteria 3835
193 Ga0068853_100164084 3300005539 Bacteria 2006
194 Ga0068853_100256988 3300005539 Bacteria 1605
195 Ga0068853_100348365 3300005539 Bacteria 1377
196 Ga0068853_100416899 3300005539 Bacteria 1259
197 Ga0068853_100702015 3300005539 Bacteria 965
198 Ga0068853_100764840 3300005539 Bacteria 924
199 Ga0068853_100805732 3300005539 Bacteria 899
200 Ga0070672_100050522 3300005543 Bacteria 3239
201 Ga0070672_101138081 3300005543 Unclassified 694
202 Ga0070672_101163535 3300005543 Unclassified 686
203 Ga0070672_101205527 3300005543 Bacteria 674
204 Ga0070686_100674287 3300005544 Bacteria 822
205 Ga0070695_101637659 3300005545 Unclassified 538
206 Ga0070693_100004419 3300005547 Bacteria 6645
207 Ga0070693_100039930 3300005547 Bacteria 2632
208 Ga0070693_100094485 3300005547 Bacteria 1809
209 Ga0070665_100058313 3300005548 Bacteria 3871
210 Ga0070665_101491274 3300005548 Bacteria 685
211 Ga0070704_100199854 3300005549 Bacteria 1613
212 Ga0068855_100036876 3300005563 Bacteria 5816
213 Ga0068855_100101200 3300005563 Bacteria 3317
214 Ga0068855_100125957 3300005563 Bacteria 2929
215 Ga0068855_100173397 3300005563 Bacteria 2441
216 Ga0068855_100238189 3300005563 Bacteria 2034
217 Ga0068855_100317365 3300005563 Bacteria 1723
218 Ga0068855_100538057 3300005563 Bacteria 1266
219 Ga0068855_100712021 3300005563 Bacteria 1073
220 Ga0068855_101559331 3300005563 Unclassified 677
221 Ga0070664_100013787 3300005564 Bacteria 6589
222 Ga0070664_100015083 3300005564 Bacteria 6308
223 Ga0070664_100021246 3300005564 Bacteria 5348
224 Ga0070664_100064007 3300005564 Bacteria 3136
225 Ga0070664_100098844 3300005564 Bacteria 2536
226 Ga0070664_100103553 3300005564 Bacteria 2477
227 Ga0070664_100129233 3300005564 Bacteria 2218
228 Ga0070664_100201393 3300005564 Bacteria 1777
229 Ga0070664_100763344 3300005564 Bacteria 903
230 Ga0070664_101223974 3300005564 Unclassified 708
231 Ga0068857_100011113 3300005577 Bacteria 7831
232 Ga0068857_100014994 3300005577 Bacteria 6761
233 Ga0068857_100079040 3300005577 Bacteria 2936
234 Ga0068857_100860494 3300005577 Unclassified 868
235 Ga0068854_100003788 3300005578 Bacteria 9456
236 Ga0068854_100009368 3300005578 Bacteria 6321
237 Ga0068854_100029766 3300005578 Bacteria 3783
238 Ga0068854_100048156 3300005578 Bacteria 3040
239 Ga0068854_100050917 3300005578 Bacteria 2965
240 Ga0068854_100083586 3300005578 Bacteria 2361
241 Ga0068854_100120603 3300005578 Bacteria 1990
242 Ga0068854_100241903 3300005578 Bacteria 1437
243 Ga0068854_100352749 3300005578 Bacteria 1205
244 Ga0068854_101002485 3300005578 Bacteria 740
245 Ga0068856_100012390 3300005614 Bacteria 8258
246 Ga0068856_100232308 3300005614 Bacteria 1859
247 Ga0068856_100360265 3300005614 Bacteria 1473
248 Ga0068856_100601718 3300005614 Bacteria 1120
249 Ga0068856_100667879 3300005614 Bacteria 1060
250 Ga0068856_101231389 3300005614 Bacteria 764
251 Ga0070702_100215112 3300005615 Bacteria 1282
252 Ga0068852_100001493 3300005616 Bacteria 15819
253 Ga0068852_100007008 3300005616 Bacteria 8206
254 Ga0068852_100027596 3300005616 Bacteria 4629
255 Ga0068852_100110434 3300005616 Bacteria 2499
256 Ga0068852_100154078 3300005616 Bacteria 2139
257 Ga0068852_100225805 3300005616 Bacteria 1783
258 Ga0068852_100242673 3300005616 Bacteria 1723
259 Ga0068852_100442953 3300005616 Bacteria 1285
260 Ga0068852_100778816 3300005616 Bacteria 970
261 Ga0068852_101019848 3300005616 Bacteria 846
262 Ga0068852_101054305 3300005616 Unclassified 832
263 Ga0068852_101077468 3300005616 Bacteria 823
264 Ga0068852_101362786 3300005616 Unclassified 731
265 Ga0068859_100017745 3300005617 Bacteria 7154
266 Ga0068859_100030289 3300005617 Bacteria 5430
267 Ga0068859_100345879 3300005617 Bacteria 1581
268 Ga0068859_101166829 3300005617 Unclassified 848
269 Ga0068864_100116149 3300005618 Bacteria 2387
270 Ga0068864_100177216 3300005618 Bacteria 1947
271 Ga0068864_100905428 3300005618 Bacteria 871
272 Ga0068864_101213310 3300005618 Bacteria 753
273 Ga0068866_10003017 3300005718 Bacteria 6953
274 Ga0068866_10005962 3300005718 Bacteria 5069
275 Ga0068866_10259246 3300005718 Bacteria 1068
276 Ga0068861_100665356 3300005719 Bacteria 964
277 Ga0068851_10021386 3300005834 Bacteria 3140
278 Ga0068851_10029996 3300005834 Bacteria 2695
279 Ga0068851_10102656 3300005834 Bacteria 1519
280 Ga0068851_10514790 3300005834 Bacteria 719
281 Ga0068870_10305261 3300005840 Bacteria 1006
282 Ga0068863_100006772 3300005841 Bacteria 11235
283 Ga0068863_100013348 3300005841 Bacteria 7920
284 Ga0068863_100042082 3300005841 Bacteria 4342
285 Ga0068863_101646542 3300005841 Bacteria 651
286 Ga0068858_100000698 3300005842 Bacteria 35076
287 Ga0068858_100044077 3300005842 Bacteria 4136
288 Ga0068858_100103287 3300005842 Bacteria 2659
289 Ga0068858_100405553 3300005842 Bacteria 1310
290 Ga0068860_100082725 3300005843 Bacteria 3053
291 Ga0068860_100159480 3300005843 Bacteria 2174
292 Ga0068860_100413419 3300005843 Bacteria 1336
293 Ga0068860_100445147 3300005843 Bacteria 1287
294 Ga0068860_100495860 3300005843 Bacteria 1219
295 Ga0068862_100033453 3300005844 Bacteria 4346
296 Ga0068862_100564824 3300005844 Bacteria 1088
297 Ga0081539_10016302 3300005985 Bacteria 5320
298 Ga0075364_10092912 3300006051 Bacteria 2003
299 Ga0070712_100117743 3300006175 Bacteria 1994
300 Ga0075366_10238263 3300006195 Bacteria 1109
301 Ga0097621_100142634 3300006237 Bacteria 2048
302 Ga0097621_100239035 3300006237 Bacteria 1587
303 Ga0097621_100855543 3300006237 Unclassified 845
304 Ga0068871_100005013 3300006358 Bacteria 9250
305 Ga0068871_100401815 3300006358 Bacteria 1220
306 Ga0068871_102047904 3300006358 Unclassified 545
307 Ga0068871_102259343 3300006358 Unclassified 519
308 Ga0075428_101138361 3300006844 Bacteria 824
309 Ga0075433_11162179 3300006852 Unclassified 670
310 Ga0068865_100388540 3300006881 Bacteria 1140
311 Ga0068865_101535927 3300006881 Unclassified 597
312 Ga0097620_100017745 3300006931 Bacteria 7154
313 Ga0097620_100030289 3300006931 Bacteria 5430
314 Ga0097620_100345878 3300006931 Bacteria 1581
315 Ga0097620_101166952 3300006931 Unclassified 848
316 Ga0105240_10113761 3300009093 Bacteria 3270
317 Ga0105240_10205037 3300009093 Bacteria 2308
318 Ga0105240_10227141 3300009093 Bacteria 2171
319 Ga0105240_10247614 3300009093 Bacteria 2063
320 Ga0105240_10723845 3300009093 Bacteria 1084
321 Ga0111539_10464272 3300009094 Bacteria 1474
322 Ga0105245_10012575 3300009098 Bacteria 7367
323 Ga0105245_10016987 3300009098 Bacteria 6351
324 Ga0105245_10051551 3300009098 Bacteria 3689
325 Ga0105245_10198428 3300009098 Bacteria 1926
326 Ga0105245_11829666 3300009098 Unclassified 660
327 Ga0105247_10108256 3300009101 Bacteria 1785
328 Ga0114129_10195035 3300009147 Bacteria 2747
329 Ga0114129_12440506 3300009147 Bacteria 626
330 Ga0105243_10022275 3300009148 Bacteria 4813
331 Ga0105243_10046162 3300009148 Bacteria 3425
332 Ga0105243_10364435 3300009148 Bacteria 1331
333 Ga0105241_10113927 3300009174 Bacteria 2168
334 Ga0105241_10116659 3300009174 Bacteria 2144
335 Ga0105241_10127466 3300009174 Bacteria 2057
336 Ga0105241_10919052 3300009174 Bacteria 814
337 Ga0105242_10043810 3300009176 Bacteria 3622
338 Ga0105242_10739686 3300009176 Bacteria 967
339 Ga0105248_10016198 3300009177 Bacteria 8205
340 Ga0105248_10031884 3300009177 Bacteria 5889
341 Ga0105248_10080537 3300009177 Bacteria 3660
342 Ga0105248_10315049 3300009177 Bacteria 1762
343 Ga0105248_10646078 3300009177 Bacteria 1194
344 Ga0105237_10042391 3300009545 Bacteria 4589
345 Ga0105237_10046487 3300009545 Bacteria 4365
346 Ga0105238_10055251 3300009551 Bacteria 3987
347 Ga0105238_10084336 3300009551 Bacteria 3167
348 Ga0105238_10131405 3300009551 Bacteria 2482
349 Ga0105238_10134547 3300009551 Bacteria 2450
350 Ga0105238_10179520 3300009551 Bacteria 2094
351 Ga0105249_10336936 3300009553 Bacteria 1524
352 Ga0105032_103594 3300009979 Unclassified 1343
353 Ga0105239_10054774 3300010375 Bacteria 4376
354 Ga0105239_10295056 3300010375 Bacteria 1825
355 Ga0105239_10865947 3300010375 Bacteria 1036
356 Ga0105246_10079172 3300011119 Bacteria 2336
357 Ga0157373_10019821 3300013100 Bacteria 4893
358 Ga0157373_10020418 3300013100 Bacteria 4814
359 Ga0157373_10052932 3300013100 Bacteria 2887
360 Ga0157373_10057676 3300013100 Bacteria 2754
361 Ga0157373_10065847 3300013100 Bacteria 2564
362 Ga0157373_10104521 3300013100 Bacteria 1992
363 Ga0157373_10113482 3300013100 Bacteria 1904
364 Ga0157373_10150646 3300013100 Bacteria 1636
365 Ga0157373_10244882 3300013100 Bacteria 1268
366 Ga0157373_10274722 3300013100 Bacteria 1193
367 Ga0157371_10011587 3300013102 Bacteria 6777
368 Ga0157371_10072281 3300013102 Bacteria 2442
369 Ga0157371_10078626 3300013102 Bacteria 2336
370 Ga0157371_10087969 3300013102 Bacteria 2199
371 Ga0157371_10121977 3300013102 Bacteria 1853
372 Ga0157371_10167267 3300013102 Bacteria 1571
373 Ga0157371_10180348 3300013102 Bacteria 1511
374 Ga0157371_10237789 3300013102 Bacteria 1310
375 Ga0157371_10323479 3300013102 Bacteria 1119
376 Ga0157371_10620646 3300013102 Bacteria 805
377 Ga0157370_10059811 3300013104 Bacteria 3620
378 Ga0157370_10085743 3300013104 Bacteria 2959
379 Ga0157370_10143871 3300013104 Bacteria 2221
380 Ga0157370_10301670 3300013104 Bacteria 1478
381 Ga0157370_10386634 3300013104 Bacteria 1288
382 Ga0157370_10535413 3300013104 Bacteria 1074
383 Ga0157370_10660370 3300013104 Bacteria 955
384 Ga0157370_10726457 3300013104 Bacteria 906
385 Ga0157370_10975848 3300013104 Bacteria 768
386 Ga0157369_10012892 3300013105 Bacteria 9475
387 Ga0157369_10017591 3300013105 Bacteria 8034
388 Ga0157369_10037223 3300013105 Bacteria 5327
389 Ga0157369_10060124 3300013105 Bacteria 4098
390 Ga0157369_10076714 3300013105 Bacteria 3583
391 Ga0157369_10153916 3300013105 Bacteria 2430
392 Ga0157369_10243536 3300013105 Bacteria 1878
393 Ga0157369_10307348 3300013105 Bacteria 1649
394 Ga0157369_10519354 3300013105 Bacteria 1232
395 Ga0157369_10592772 3300013105 Bacteria 1144
396 Ga0157369_10781988 3300013105 Bacteria 981
397 Ga0157369_11361975 3300013105 Bacteria 723
398 Ga0157374_10014255 3300013296 Bacteria 6952
399 Ga0157374_10021424 3300013296 Bacteria 5751
400 Ga0157374_10053773 3300013296 Bacteria 3754
401 Ga0157374_10495150 3300013296 Bacteria 1226
402 Ga0157374_10717215 3300013296 Bacteria 1014
403 Ga0157374_11378608 3300013296 Bacteria 728
404 Ga0157378_10056711 3300013297 Bacteria 3491
405 Ga0157378_10092163 3300013297 Bacteria 2756
406 Ga0157378_10173979 3300013297 Bacteria 2021
407 Ga0157378_10256171 3300013297 Bacteria 1677
408 Ga0157378_12257592 3300013297 Unclassified 596
409 Ga0163162_10127478 3300013306 Bacteria 2652
410 Ga0163162_10521073 3300013306 Bacteria 1318
411 Ga0157372_10091705 3300013307 Bacteria 3455
412 Ga0157372_10257302 3300013307 Bacteria 2027
413 Ga0157372_10596620 3300013307 Bacteria 1287
414 Ga0157372_10624915 3300013307 Bacteria 1255
415 Ga0157372_11442482 3300013307 Unclassified 793
416 Ga0157372_12787255 3300013307 Unclassified 560
417 Ga0157375_10011784 3300013308 Bacteria 7731
418 Ga0157375_10089713 3300013308 Bacteria 3131
419 Ga0157375_10157437 3300013308 Bacteria 2411
420 Ga0157375_10375982 3300013308 Bacteria 1587
421 Ga0157375_10439445 3300013308 Bacteria 1470
422 Ga0163163_10247810 3300014325 Bacteria 1832
423 Ga0157380_10156030 3300014326 Bacteria 1978
424 Ga0157380_10880062 3300014326 Unclassified 920
425 Ga0157377_10099779 3300014745 Bacteria 1728
426 Ga0157379_10275733 3300014968 Bacteria 1530
427 Ga0157379_11310787 3300014968 Bacteria 699
428 Ga0157376_10172397 3300014969 Bacteria 1971
429 Ga0197907_11482614 3300020069 Unclassified 862
430 Ga0206356_10024764 3300020070 Unclassified 851
431 Ga0206354_10983484 3300020081 Bacteria 1621
432 Ga0206353_11028540 3300020082 Unclassified 1285
433 Ga0213875_10017229 3300021388 Bacteria 3495
434 Ga0207697_10003609 3300025315 Bacteria 7585
435 Ga0207697_10143398 3300025315 Bacteria 1037
436 Ga0207697_10197433 3300025315 Bacteria 884
437 Ga0207656_10013827 3300025321 Bacteria 3095
438 Ga0207656_10043096 3300025321 Bacteria 1923
439 Ga0207656_10091669 3300025321 Bacteria 1380
440 Ga0207656_10456047 3300025321 Bacteria 646
441 Ga0207682_10011969 3300025893 Bacteria 3387
442 Ga0207642_10003539 3300025899 Bacteria 4947
443 Ga0207642_10069729 3300025899 Bacteria 1668
444 Ga0207688_10085601 3300025901 Bacteria 1805
445 Ga0207688_10091085 3300025901 Bacteria 1751
446 Ga0207688_10139536 3300025901 Bacteria 1426
447 Ga0207680_10007734 3300025903 Bacteria 5254
448 Ga0207680_10083888 3300025903 Bacteria 2009
449 Ga0207680_10115470 3300025903 Bacteria 1748
450 Ga0207680_10180663 3300025903 Bacteria 1426
451 Ga0207647_10008591 3300025904 Bacteria 7308
452 Ga0207647_10011971 3300025904 Bacteria 6056
453 Ga0207647_10040161 3300025904 Bacteria 2948
454 Ga0207647_10053242 3300025904 Bacteria 2495
455 Ga0207647_10071415 3300025904 Bacteria 2094
456 Ga0207647_10102165 3300025904 Bacteria 1700
457 Ga0207647_10117603 3300025904 Bacteria 1569
458 Ga0207647_10222512 3300025904 Bacteria 1087
459 Ga0207645_10011068 3300025907 Bacteria 6173
460 Ga0207645_10111789 3300025907 Bacteria 1769
461 Ga0207645_10153918 3300025907 Bacteria 1502
462 Ga0207645_10184349 3300025907 Bacteria 1370
463 Ga0207705_10001770 3300025909 Bacteria 17052
464 Ga0207705_10003609 3300025909 Bacteria 11783
465 Ga0207705_10008044 3300025909 Bacteria 7728
466 Ga0207705_10020054 3300025909 Bacteria 4780
467 Ga0207705_10023323 3300025909 Bacteria 4415
468 Ga0207705_10041566 3300025909 Bacteria 3298
469 Ga0207705_10055577 3300025909 Bacteria 2854
470 Ga0207705_10056918 3300025909 Bacteria 2820
471 Ga0207705_10072045 3300025909 Bacteria 2506
472 Ga0207705_10076353 3300025909 Bacteria 2435
473 Ga0207705_10113471 3300025909 Bacteria 2004
474 Ga0207705_10144538 3300025909 Bacteria 1778
475 Ga0207705_10161566 3300025909 Bacteria 1683
476 Ga0207705_10165226 3300025909 Bacteria 1664
477 Ga0207705_10393668 3300025909 Bacteria 1071
478 Ga0207705_10443424 3300025909 Unclassified 1006
479 Ga0207705_10472226 3300025909 Bacteria 973
480 Ga0207705_10521942 3300025909 Unclassified 923
481 Ga0207705_10550261 3300025909 Bacteria 897
482 Ga0207654_10314783 3300025911 Bacteria 1068
483 Ga0207654_10598607 3300025911 Bacteria 786
484 Ga0207707_10026313 3300025912 Bacteria 5085
485 Ga0207707_10357996 3300025912 Bacteria 1257
486 Ga0207707_10542542 3300025912 Bacteria 989
487 Ga0207707_11034967 3300025912 Bacteria 672
488 Ga0207695_10014363 3300025913 Bacteria 9388
489 Ga0207695_10188590 3300025913 Bacteria 1980
490 Ga0207695_10276154 3300025913 Bacteria 1575
491 Ga0207695_10728165 3300025913 Bacteria 872
492 Ga0207671_10141743 3300025914 Bacteria 1852
493 Ga0207693_10018845 3300025915 Bacteria 5493
494 Ga0207660_10014922 3300025917 Bacteria 5121
495 Ga0207660_10044262 3300025917 Bacteria 3132
496 Ga0207660_10436300 3300025917 Bacteria 1058
497 Ga0207660_10481207 3300025917 Bacteria 1006
498 Ga0207660_10654600 3300025917 Bacteria 856
499 Ga0207662_10068687 3300025918 Bacteria 2140
500 Ga0207657_10006637 3300025919 Bacteria 11976
501 Ga0207657_10009671 3300025919 Bacteria 9675
502 Ga0207657_10012629 3300025919 Bacteria 8325
503 Ga0207657_10013869 3300025919 Bacteria 7886
504 Ga0207657_10016054 3300025919 Bacteria 7228
505 Ga0207657_10045967 3300025919 Bacteria 3827
506 Ga0207657_10048589 3300025919 Bacteria 3703
507 Ga0207657_10049254 3300025919 Bacteria 3673
508 Ga0207657_10056193 3300025919 Bacteria 3397
509 Ga0207657_10060282 3300025919 Bacteria 3257
510 Ga0207657_10069683 3300025919 Bacteria 2983
511 Ga0207657_11106834 3300025919 Bacteria 605
512 Ga0207649_10000609 3300025920 Bacteria 24164
513 Ga0207649_10017146 3300025920 Bacteria 4102
514 Ga0207649_10017742 3300025920 Bacteria 4035
515 Ga0207649_10031567 3300025920 Bacteria 3149
516 Ga0207649_10035183 3300025920 Bacteria 3008
517 Ga0207649_10039402 3300025920 Bacteria 2865
518 Ga0207649_10054934 3300025920 Bacteria 2481
519 Ga0207649_10055222 3300025920 Bacteria 2475
520 Ga0207649_10063970 3300025920 Bacteria 2324
521 Ga0207649_10123450 3300025920 Bacteria 1749
522 Ga0207649_10183202 3300025920 Bacteria 1467
523 Ga0207649_10455561 3300025920 Unclassified 966
524 Ga0207649_10940612 3300025920 Unclassified 679
525 Ga0207649_11596097 3300025920 Unclassified 516
526 Ga0207652_10030413 3300025921 Bacteria 4522
527 Ga0207652_10072922 3300025921 Bacteria 2986
528 Ga0207652_10566221 3300025921 Bacteria 1020
529 Ga0207681_10154873 3300025923 Bacteria 1721
530 Ga0207694_10049494 3300025924 Bacteria 3253
531 Ga0207694_10052285 3300025924 Bacteria 3167
532 Ga0207694_10061259 3300025924 Bacteria 2929
533 Ga0207694_10074543 3300025924 Bacteria 2656
534 Ga0207650_10015641 3300025925 Bacteria 5288
535 Ga0207650_10236036 3300025925 Bacteria 1476
536 Ga0207650_10546808 3300025925 Bacteria 971
537 Ga0207659_10064791 3300025926 Bacteria 2646
538 Ga0207687_10130714 3300025927 Bacteria 1892
539 Ga0207687_10196412 3300025927 Bacteria 1574
540 Ga0207687_10491946 3300025927 Bacteria 1023
541 Ga0207687_11508624 3300025927 Unclassified 577
542 Ga0207644_10005901 3300025931 Bacteria 7986
543 Ga0207644_10010410 3300025931 Bacteria 6127
544 Ga0207644_10064872 3300025931 Bacteria 2654
545 Ga0207644_10167803 3300025931 Bacteria 1711
546 Ga0207690_10021720 3300025932 Bacteria 3984
547 Ga0207690_10040828 3300025932 Bacteria 3036
548 Ga0207690_10057730 3300025932 Bacteria 2623
549 Ga0207690_10096114 3300025932 Bacteria 2106
550 Ga0207690_10111500 3300025932 Bacteria 1971
551 Ga0207690_10113203 3300025932 Bacteria 1958
552 Ga0207690_10116250 3300025932 Bacteria 1934
553 Ga0207690_10142031 3300025932 Bacteria 1770
554 Ga0207690_10172357 3300025932 Bacteria 1622
555 Ga0207690_10207385 3300025932 Bacteria 1492
556 Ga0207690_10258974 3300025932 Bacteria 1347
557 Ga0207690_10379367 3300025932 Bacteria 1123
558 Ga0207690_10580637 3300025932 Bacteria 913
559 Ga0207706_10010928 3300025933 Bacteria 8279
560 Ga0207706_10017233 3300025933 Bacteria 6512
561 Ga0207706_10022481 3300025933 Bacteria 5659
562 Ga0207706_10059992 3300025933 Bacteria 3350
563 Ga0207706_10082822 3300025933 Bacteria 2820
564 Ga0207706_10093332 3300025933 Bacteria 2647
565 Ga0207706_10101119 3300025933 Bacteria 2536
566 Ga0207706_10428635 3300025933 Bacteria 1145
567 Ga0207706_10623912 3300025933 Bacteria 925
568 Ga0207686_10119720 3300025934 Bacteria 1790
569 Ga0207686_10196916 3300025934 Bacteria 1440
570 Ga0207709_10020092 3300025935 Bacteria 3764
571 Ga0207709_10174688 3300025935 Bacteria 1511
572 Ga0207709_10336951 3300025935 Bacteria 1134
573 Ga0207670_11006401 3300025936 Unclassified 701
574 Ga0207669_10147668 3300025937 Bacteria 1642
575 Ga0207669_10154177 3300025937 Bacteria 1613
576 Ga0207669_10155239 3300025937 Bacteria 1609
577 Ga0207669_10264649 3300025937 Bacteria 1288
578 Ga0207669_11141135 3300025937 Unclassified 659
579 Ga0207704_10263280 3300025938 Bacteria 1301
580 Ga0207691_10053748 3300025940 Bacteria 3676
581 Ga0207691_10067449 3300025940 Bacteria 3235
582 Ga0207691_10225294 3300025940 Bacteria 1625
583 Ga0207691_10885742 3300025940 Bacteria 748
584 Ga0207711_10001586 3300025941 Bacteria 20994
585 Ga0207711_10012397 3300025941 Bacteria 7086
586 Ga0207711_10086336 3300025941 Bacteria 2751
587 Ga0207711_10865428 3300025941 Bacteria 841
588 Ga0207661_10014880 3300025944 Bacteria 5708
589 Ga0207661_10029303 3300025944 Bacteria 4226
590 Ga0207661_10043986 3300025944 Bacteria 3526
591 Ga0207661_10284814 3300025944 Bacteria 1478
592 Ga0207661_10452581 3300025944 Bacteria 1169
593 Ga0207679_10016312 3300025945 Bacteria 4931
594 Ga0207679_10020313 3300025945 Bacteria 4481
595 Ga0207679_10024962 3300025945 Bacteria 4104
596 Ga0207679_10036166 3300025945 Bacteria 3500
597 Ga0207679_10074803 3300025945 Bacteria 2568
598 Ga0207679_10075951 3300025945 Bacteria 2551
599 Ga0207679_10111043 3300025945 Bacteria 2164
600 Ga0207679_10188069 3300025945 Bacteria 1714
601 Ga0207679_10761223 3300025945 Bacteria 881
602 Ga0207679_11848047 3300025945 Unclassified 551
603 Ga0207667_10012522 3300025949 Bacteria 9764
604 Ga0207667_10040678 3300025949 Bacteria 4949
605 Ga0207667_10058404 3300025949 Bacteria 4046
606 Ga0207667_10098724 3300025949 Bacteria 3013
607 Ga0207667_10150361 3300025949 Bacteria 2397
608 Ga0207667_10158671 3300025949 Bacteria 2327
609 Ga0207667_10188860 3300025949 Bacteria 2114
610 Ga0207667_10245627 3300025949 Bacteria 1831
611 Ga0207667_10342973 3300025949 Bacteria 1524
612 Ga0207667_10737549 3300025949 Bacteria 985
613 Ga0207667_11073060 3300025949 Bacteria 790
614 Ga0207667_11250403 3300025949 Unclassified 720
615 Ga0207667_11508403 3300025949 Bacteria 643
616 Ga0207651_10001064 3300025960 Bacteria 12172
617 Ga0207651_10017121 3300025960 Bacteria 4271
618 Ga0207651_10162444 3300025960 Bacteria 1752
619 Ga0207651_10177361 3300025960 Bacteria 1686
620 Ga0207668_10248460 3300025972 Bacteria 1443
621 Ga0207668_10279728 3300025972 Bacteria 1368
622 Ga0207640_10006995 3300025981 Bacteria 6208
623 Ga0207640_10011184 3300025981 Bacteria 5075
624 Ga0207640_10020967 3300025981 Bacteria 3886
625 Ga0207640_10025728 3300025981 Bacteria 3566
626 Ga0207640_10119774 3300025981 Bacteria 1883
627 Ga0207640_10160695 3300025981 Bacteria 1662
628 Ga0207640_10166894 3300025981 Bacteria 1636
629 Ga0207640_10201817 3300025981 Bacteria 1508
630 Ga0207640_10207011 3300025981 Bacteria 1491
631 Ga0207640_10286430 3300025981 Bacteria 1297
632 Ga0207640_11106035 3300025981 Bacteria 701
633 Ga0207658_10015410 3300025986 Bacteria 5243
634 Ga0207658_10022103 3300025986 Bacteria 4425
635 Ga0207658_10050500 3300025986 Bacteria 3061
636 Ga0207658_10050773 3300025986 Bacteria 3053
637 Ga0207658_10057410 3300025986 Bacteria 2892
638 Ga0207658_10077272 3300025986 Bacteria 2539
639 Ga0207658_10232161 3300025986 Bacteria 1558
640 Ga0207658_11363023 3300025986 Bacteria 649
641 Ga0207677_10007773 3300026023 Bacteria 5952
642 Ga0207677_10018428 3300026023 Bacteria 4189
643 Ga0207677_10162593 3300026023 Bacteria 1736
644 Ga0207677_10243831 3300026023 Bacteria 1455
645 Ga0207677_10666686 3300026023 Bacteria 920
646 Ga0207703_10001131 3300026035 Bacteria 25163
647 Ga0207703_10309149 3300026035 Bacteria 1444
648 Ga0207703_10346513 3300026035 Bacteria 1367
649 Ga0207639_10005372 3300026041 Bacteria 8660
650 Ga0207639_10035157 3300026041 Bacteria 3707
651 Ga0207639_10075162 3300026041 Bacteria 2656
652 Ga0207639_10094009 3300026041 Bacteria 2406
653 Ga0207639_10152837 3300026041 Bacteria 1935
654 Ga0207639_10160442 3300026041 Bacteria 1894
655 Ga0207639_10258373 3300026041 Bacteria 1522
656 Ga0207639_10287397 3300026041 Bacteria 1449
657 Ga0207639_10470431 3300026041 Bacteria 1144
658 Ga0207639_10578421 3300026041 Bacteria 1034
659 Ga0207678_10008034 3300026067 Bacteria 9300
660 Ga0207678_10008741 3300026067 Bacteria 8914
661 Ga0207678_10018256 3300026067 Bacteria 6160
662 Ga0207678_10034890 3300026067 Bacteria 4381
663 Ga0207678_10049425 3300026067 Bacteria 3634
664 Ga0207678_10077827 3300026067 Bacteria 2840
665 Ga0207678_10083764 3300026067 Bacteria 2728
666 Ga0207678_10094505 3300026067 Bacteria 2554
667 Ga0207678_10097948 3300026067 Bacteria 2506
668 Ga0207678_10199844 3300026067 Bacteria 1709
669 Ga0207702_10005398 3300026078 Bacteria 11196
670 Ga0207702_10007420 3300026078 Bacteria 9358
671 Ga0207702_10011401 3300026078 Bacteria 7410
672 Ga0207702_10023661 3300026078 Bacteria 5095
673 Ga0207702_10250408 3300026078 Bacteria 1663
674 Ga0207702_10437580 3300026078 Bacteria 1267
675 Ga0207702_10486849 3300026078 Bacteria 1201
676 Ga0207641_10005432 3300026088 Bacteria 10876
677 Ga0207641_10010661 3300026088 Bacteria 7540
678 Ga0207641_10020616 3300026088 Bacteria 5416
679 Ga0207641_10646569 3300026088 Bacteria 1038
680 Ga0207641_10679120 3300026088 Bacteria 1013
681 Ga0207641_11553909 3300026088 Bacteria 663
682 Ga0207648_10011594 3300026089 Bacteria 8299
683 Ga0207648_10076673 3300026089 Bacteria 2914
684 Ga0207648_10099037 3300026089 Bacteria 2553
685 Ga0207648_10237119 3300026089 Bacteria 1624
686 Ga0207676_10011103 3300026095 Bacteria 6429
687 Ga0207676_10126804 3300026095 Bacteria 2163
688 Ga0207674_10019429 3300026116 Bacteria 7357
689 Ga0207674_10061064 3300026116 Bacteria 3809
690 Ga0207674_10173578 3300026116 Bacteria 2108
691 Ga0207674_10316547 3300026116 Bacteria 1510
692 Ga0207675_100107740 3300026118 Bacteria 2627
693 Ga0207683_10034084 3300026121 Bacteria 4424
694 Ga0207683_10035825 3300026121 Bacteria 4316
695 Ga0207698_10001495 3300026142 Bacteria 13610
696 Ga0207698_10003511 3300026142 Bacteria 9453
697 Ga0207698_10009252 3300026142 Bacteria 6270
698 Ga0207698_10026189 3300026142 Bacteria 4122
699 Ga0207698_10174290 3300026142 Bacteria 1897
700 Ga0207698_10228234 3300026142 Bacteria 1688
701 Ga0207698_10274743 3300026142 Bacteria 1555
702 Ga0207698_10515931 3300026142 Bacteria 1165
703 Ga0207698_10780335 3300026142 Bacteria 956
704 Ga0207698_11549281 3300026142 Unclassified 678
705 Ga0268266_10108661 3300028379 Bacteria 2455
706 Ga0268266_10913210 3300028379 Bacteria 849
707 Ga0268265_11216891 3300028380 Unclassified 751
708 Ga0268264_10136746 3300028381 Bacteria 2180
709 Ga0268264_10167220 3300028381 Bacteria 1986
710 Ga0268264_10339339 3300028381 Bacteria 1427
711 Ga0268264_10353434 3300028381 Bacteria 1399
712 Ga0316182_1268691 3300030745 Bacteria 1001
713 Ga0307408_100072989 3300031548 Bacteria 2542
714 Ga0307408_100258169 3300031548 Bacteria 1441
715 Ga0307405_10094732 3300031731 Bacteria 1986
716 Ga0307405_10200833 3300031731 Bacteria 1448
717 Ga0307405_10340018 3300031731 Bacteria 1154
718 Ga0307413_10011592 3300031824 Bacteria 4346
719 Ga0307413_11928748 3300031824 Bacteria 531
720 Ga0307410_10004325 3300031852 Bacteria 7325
721 Ga0307410_10017783 3300031852 Bacteria 4278
722 Ga0307410_10019949 3300031852 Bacteria 4090
723 Ga0307410_10058833 3300031852 Bacteria 2621
724 Ga0307410_10135811 3300031852 Bacteria 1813
725 Ga0307410_10189220 3300031852 Bacteria 1564
726 Ga0307410_10356904 3300031852 Bacteria 1170
727 Ga0307410_10720171 3300031852 Bacteria 842
728 Ga0307406_10061210 3300031901 Bacteria 2430
729 Ga0307406_10246739 3300031901 Bacteria 1343
730 Ga0307406_10288701 3300031901 Bacteria 1255
731 Ga0307406_10520247 3300031901 Bacteria 968
732 Ga0307407_10015741 3300031903 Bacteria 3749
733 Ga0307407_10131552 3300031903 Bacteria 1601
734 Ga0307407_10164887 3300031903 Bacteria 1453
735 Ga0307407_10289208 3300031903 Bacteria 1138
736 Ga0307407_10422927 3300031903 Bacteria 961
737 Ga0307412_10171977 3300031911 Bacteria 1621
738 Ga0307412_10539212 3300031911 Bacteria 978
739 Ga0307409_100037602 3300031995 Bacteria 3570
740 Ga0307409_100037694 3300031995 Bacteria 3566
741 Ga0307409_100046604 3300031995 Bacteria 3283
742 Ga0307409_100192794 3300031995 Bacteria 1815
743 Ga0307409_100302593 3300031995 Bacteria 1488
744 Ga0307409_100329347 3300031995 Bacteria 1432
745 Ga0307409_101372419 3300031995 Bacteria 733
746 Ga0307416_100072310 3300032002 Bacteria 2870
747 Ga0307416_100081435 3300032002 Bacteria 2737
748 Ga0307416_100219199 3300032002 Bacteria 1823
749 Ga0307416_100273737 3300032002 Bacteria 1660
750 Ga0307416_100339982 3300032002 Bacteria 1513
751 Ga0307416_100782864 3300032002 Bacteria 1048
752 Ga0307416_100831637 3300032002 Bacteria 1021
753 Ga0307416_101130720 3300032002 Bacteria 888
754 Ga0307414_10024662 3300032004 Bacteria 3839
755 Ga0307414_10792233 3300032004 Bacteria 864
756 Ga0307414_11395623 3300032004 Bacteria 651
757 Ga0307414_11861155 3300032004 Unclassified 562
758 Ga0307411_10001080 3300032005 Bacteria 10587
759 Ga0307411_10015528 3300032005 Bacteria 4281
760 Ga0307411_10218319 3300032005 Bacteria 1477
761 Ga0307411_10723867 3300032005 Bacteria 869
762 Ga0307411_10789598 3300032005 Unclassified 835
763 Ga0307411_10970574 3300032005 Bacteria 759
764 Ga0307415_100102394 3300032126 Bacteria 2104
765 Ga0307415_100263268 3300032126 Bacteria 1408
766 Ga0307415_100363294 3300032126 Bacteria 1223
767 Ga0307415_100628858 3300032126 Bacteria 959
768 Ga0307415_100704632 3300032126 Bacteria 911
769 Ga0307415_100913150 3300032126 Bacteria 810
770 Ga0307415_101324001 3300032126 Bacteria 683
771 Ga0373940_0181648 3300035088 Bacteria 684
772 Ga0373960_0352143 3300035121 Bacteria 559
773 Ga0373942_0262631 3300035207 Unclassified 590
774 Ga0373961_0209969 3300035241 Bacteria 690
775 Ga0373962_0045100 3300035242 Bacteria 1255
776 Ga0373962_0174182 3300035242 Bacteria 716
777 Ga0373931_0637155 3300035691 Bacteria 699
778 Ga0395899_0003159 3300037312 Bacteria 13082
779 Ga0395899_0010009 3300037312 Bacteria 7270
780 Ga0395899_0012795 3300037312 Bacteria 6428
781 Ga0395899_0018141 3300037312 Bacteria 5354
782 Ga0395899_0031153 3300037312 Bacteria 4008
783 Ga0395899_0081035 3300037312 Bacteria 2362
784 Ga0395899_0099940 3300037312 Bacteria 2095
785 Ga0395899_0122223 3300037312 Bacteria 1863
786 Ga0395899_0127942 3300037312 Bacteria 1816
787 Ga0395899_0129289 3300037312 Bacteria 1804
788 Ga0395899_0212738 3300037312 Bacteria 1343
789 Ga0395899_0220931 3300037312 Bacteria 1312
790 Ga0395899_0308682 3300037312 Bacteria 1068
791 Ga0395899_0558200 3300037312 Bacteria 735
792 Ga0395899_0604840 3300037312 Bacteria 698
793 Ga0395900_0003502 3300037418 Bacteria 16945
794 Ga0395900_0008180 3300037418 Bacteria 10762
795 Ga0395900_0011717 3300037418 Bacteria 8965
796 Ga0395900_0015629 3300037418 Bacteria 7737
797 Ga0395900_0041426 3300037418 Bacteria 4748
798 Ga0395900_0055890 3300037418 Bacteria 4064
799 Ga0395900_0069977 3300037418 Bacteria 3607
800 Ga0395900_0086435 3300037418 Bacteria 3223
801 Ga0395900_0104018 3300037418 Bacteria 2917
802 Ga0395900_0120169 3300037418 Bacteria 2696
803 Ga0395900_0160689 3300037418 Bacteria 2292
804 Ga0395900_0236271 3300037418 Bacteria 1835
805 Ga0395900_0272569 3300037418 Bacteria 1686
806 Ga0395900_0302066 3300037418 Bacteria 1586
807 Ga0395900_0310088 3300037418 Bacteria 1561
808 Ga0395900_0321875 3300037418 Bacteria 1526
809 Ga0395900_0436009 3300037418 Bacteria 1269
810 Ga0395900_0460665 3300037418 Unclassified 1226
811 Ga0395900_0616174 3300037418 Bacteria 1024
812 Ga0395900_0631538 3300037418 Unclassified 1009
813 Ga0395900_0994201 3300037418 Unclassified 759
814 Ga0395900_1063387 3300037418 Bacteria 727
815 Ga0395900_1216571 3300037418 Unclassified 668
816 Ga0395900_1218423 3300037418 Unclassified 668
817 Ga0395900_1289512 3300037418 Bacteria 644
818 Ga0395900_1489580 3300037418 Unclassified 589
819 Ga0395900_1656821 3300037418 Bacteria 551
820 Ga0395898_0006138 3300037466 Bacteria 12878
821 Ga0395898_0022087 3300037466 Bacteria 6446
822 Ga0395898_0030146 3300037466 Bacteria 5430
823 Ga0395898_0049474 3300037466 Bacteria 4118
824 Ga0395898_0062485 3300037466 Bacteria 3616
825 Ga0395898_0065673 3300037466 Bacteria 3517
826 Ga0395898_0094720 3300037466 Bacteria 2869
827 Ga0395898_0125150 3300037466 Bacteria 2462
828 Ga0395898_0230467 3300037466 Bacteria 1766
829 Ga0395898_0307288 3300037466 Bacteria 1513
830 Ga0395898_0312866 3300037466 Bacteria 1498
831 Ga0395898_0362865 3300037466 Bacteria 1381
832 Ga0395898_0518375 3300037466 Bacteria 1133
833 Ga0395898_0579674 3300037466 Bacteria 1064
834 Ga0395898_0631625 3300037466 Bacteria 1013
835 Ga0395898_0934765 3300037466 Bacteria 804
836 Ga0395898_1077509 3300037466 Bacteria 737
837 Ga0395898_1269811 3300037466 Unclassified 666
838 Ga0395898_1515586 3300037466 Bacteria 596
839 Ga0395905_0001949 3300037471 Bacteria 23650
840 Ga0395905_0003598 3300037471 Bacteria 16480
841 Ga0395905_0013181 3300037471 Bacteria 7935
842 Ga0395905_0014848 3300037471 Bacteria 7428
843 Ga0395905_0028235 3300037471 Bacteria 5289
844 Ga0395905_0042071 3300037471 Bacteria 4286
845 Ga0395905_0094434 3300037471 Bacteria 2806
846 Ga0395905_0117294 3300037471 Bacteria 2501
847 Ga0395905_0163218 3300037471 Bacteria 2093
848 Ga0395905_0170316 3300037471 Bacteria 2045
849 Ga0395905_0173389 3300037471 Bacteria 2025
850 Ga0395905_0241034 3300037471 Bacteria 1689
851 Ga0395905_0252156 3300037471 Bacteria 1648
852 Ga0395905_0366621 3300037471 Bacteria 1333
853 Ga0395905_0366633 3300037471 Bacteria 1333
854 Ga0395905_0408188 3300037471 Bacteria 1253
855 Ga0395905_0424247 3300037471 Unclassified 1226
856 Ga0395905_0448151 3300037471 Bacteria 1188
857 Ga0395905_0507929 3300037471 Bacteria 1106
858 Ga0395905_0698655 3300037471 Bacteria 916
859 Ga0395905_0698733 3300037471 Bacteria 916
860 Ga0395905_0862450 3300037471 Unclassified 808
861 Ga0395905_0879671 3300037471 Bacteria 799
862 Ga0395905_1395881 3300037471 Unclassified 604
863 Ga0395905_1420272 3300037471 Bacteria 598
864 Ga0436364_0792406 3300037853 Bacteria 3558
865 Ga0395901_0005705 3300038443 Bacteria 12599
866 Ga0395901_0014347 3300038443 Bacteria 8067
867 Ga0395901_0014751 3300038443 Bacteria 7942
868 Ga0395901_0044472 3300038443 Bacteria 4606
869 Ga0395901_0047933 3300038443 Bacteria 4436
870 Ga0395901_0062335 3300038443 Bacteria 3880
871 Ga0395901_0079373 3300038443 Bacteria 3427
872 Ga0395901_0102079 3300038443 Bacteria 3009
873 Ga0395901_0105231 3300038443 Bacteria 2961
874 Ga0395901_0120668 3300038443 Bacteria 2755
875 Ga0395901_0305248 3300038443 Bacteria 1649
876 Ga0395901_0315471 3300038443 Bacteria 1618
877 Ga0395901_0346053 3300038443 Bacteria 1535
878 Ga0395901_0356771 3300038443 Bacteria 1508
879 Ga0395901_0382442 3300038443 Bacteria 1448
880 Ga0395901_0561026 3300038443 Bacteria 1156
881 Ga0395901_0742206 3300038443 Bacteria 975
882 Ga0395901_0849206 3300038443 Bacteria 898
883 Ga0395901_0972360 3300038443 Bacteria 826
884 Ga0395901_1027651 3300038443 Unclassified 798
885 Ga0395901_1308113 3300038443 Bacteria 686
886 Ga0395901_1405396 3300038443 Unclassified 656
887 Ga0395901_1736571 3300038443 Unclassified 574
888 Ga0395901_2157864 3300038443 Bacteria 501
889 Ga0439438_122239 3300041405 Unclassified 626
890 Ga0439432_004519 3300042006 Bacteria 5077
891 Ga0450898_049869 3300042134 Unclassified 807
892 Ga0450899_025489 3300042135 Unclassified 705
893 Ga0439458_0011922 3300042157 Bacteria 1947
894 Ga0439458_0175610 3300042157 Bacteria 580
895 Ga0466972_0012993 3300044658 Bacteria 4183
896 Ga0466972_0165979 3300044658 Unclassified 1037
897 Ga0466972_0251012 3300044658 Bacteria 827
898 Ga0466965_0360342 3300044683 Bacteria 798
899 Ga0466966_0000003 3300044684 Bacteria 233677
900 Ga0466966_0004449 3300044684 Bacteria 9243
901 Ga0466966_0077444 3300044684 Bacteria 2075
902 Ga0466966_0291809 3300044684 Bacteria 980
903 Ga0466966_0302969 3300044684 Bacteria 960
904 Ga0466961_0342246 3300044693 Bacteria 911
905 Ga0466963_0006348 3300044694 Bacteria 6992
906 Ga0466963_0027629 3300044694 Bacteria 3635
907 Ga0466963_0032139 3300044694 Bacteria 3397
908 Ga0466963_0105277 3300044694 Bacteria 1933
909 Ga0466963_0158794 3300044694 Bacteria 1573
910 Ga0466963_0196401 3300044694 Bacteria 1410
911 Ga0466963_0254063 3300044694 Bacteria 1233
912 Ga0466963_0266319 3300044694 Bacteria 1204
913 Ga0466963_0320979 3300044694 Bacteria 1090
914 Ga0466963_0626957 3300044694 Bacteria 759
915 Ga0466963_0646646 3300044694 Bacteria 746
916 Ga0466964_0075537 3300044706 Bacteria 1435
917 Ga0466971_0074134 3300044719 Bacteria 1547
918 Ga0466970_0185014 3300044765 Bacteria 1156
919 Ga0466957_0029232 3300044842 Bacteria 3285
920 Ga0466957_0110500 3300044842 Bacteria 1743
921 Ga0466957_0128913 3300044842 Bacteria 1619
922 Ga0466957_0145538 3300044842 Bacteria 1529
923 Ga0466957_0255018 3300044842 Bacteria 1167
924 Ga0466957_0463131 3300044842 Bacteria 875
925 Ga0466960_0150832 3300044901 Bacteria 1242
926 Ga0466960_0783862 3300044901 Unclassified 576
927 Ga0466959_0299596 3300045049 Bacteria 1101
928 Ga0466959_0836032 3300045049 Bacteria 615
929 Ga0466958_0264914 3300045836 Bacteria 1100
930 Ga0466958_0372521 3300045836 Bacteria 920
931 Ga0466958_0439889 3300045836 Bacteria 844
932 Ga0466967_0043676 3300045976 Bacteria 3882
933 Ga0466967_0083855 3300045976 Bacteria 2883
934 Ga0466967_0085523 3300045976 Bacteria 2855
935 Ga0466967_0162182 3300045976 Bacteria 2099
936 Ga0466967_0216012 3300045976 Bacteria 1820
937 Ga0466967_0360607 3300045976 Bacteria 1408
938 Ga0466967_0599350 3300045976 Bacteria 1087
939 Ga0466967_0625443 3300045976 Bacteria 1063
940 Ga0466967_1344992 3300045976 Unclassified 711
941 Ga0466967_1625837 3300045976 Bacteria 643
942 Ga0495629_0484109 3300046459 Bacteria 836
943 Ga0495584_0469123 3300046491 Unclassified 641
944 Ga0495642_0037967 3300046528 Bacteria 1950
945 Ga0495598_0000969 3300046537 Bacteria 5539
946 Ga0495621_0000609 3300046539 Bacteria 8968
947 Ga0495621_0111745 3300046539 Bacteria 1048
948 Ga0495668_0261016 3300046616 Bacteria 948
949 Ga0495669_0063502 3300046684 Bacteria 1675
950 Ga0495669_0128390 3300046684 Bacteria 1192
951 Ga0495669_0206949 3300046684 Bacteria 939
952 Ga0495669_0250238 3300046684 Bacteria 851
953 Ga0495670_0002361 3300046691 Bacteria 9293
954 Ga0496100_0009195 3300048903 Bacteria 5544
955 Ga0496100_0417061 3300048903 Bacteria 1025
956 Ga0496101_0005978 3300048904 Bacteria 7802
957 Ga0496101_0322017 3300048904 Bacteria 1213
958 Ga0496101_1569938 3300048904 Unclassified 512
959 Ga0496102_0461494 3300048905 Bacteria 1191
960 Ga0496102_0819194 3300048905 Unclassified 853
961 Ga0496103_0011091 3300048906 Bacteria 5337
962 Ga0496104_0205663 3300048907 Bacteria 1880
963 Ga0496104_1052041 3300048907 Unclassified 718
964 Ga0496105_0010892 3300048908 Bacteria 7162
965 Ga0496105_0120864 3300048908 Bacteria 2160
966 Ga0496107_0009344 3300048910 Bacteria 6795
967 Ga0496107_0217249 3300048910 Bacteria 1422
968 Ga0496107_0235021 3300048910 Bacteria 1364
969 Ga0496107_0286131 3300048910 Bacteria 1227
970 Ga0496108_0006649 3300048911 Bacteria 9363
971 Ga0496108_0022816 3300048911 Bacteria 5149
972 Ga0496108_1295035 3300048911 Unclassified 613
973 Ga0496109_0010191 3300048912 Bacteria 8023
974 Ga0496109_0488070 3300048912 Bacteria 1163
975 Ga0496109_0733676 3300048912 Bacteria 926
976 Ga0496109_0756955 3300048912 Unclassified 909
977 Ga0496109_1436497 3300048912 Unclassified 625
978 Ga0496110_0019059 3300048913 Bacteria 5767
979 Ga0496111_0020047 3300048914 Bacteria 4650
980 Ga0496112_0010385 3300048915 Bacteria 8443
981 Ga0496112_0078448 3300048915 Bacteria 3266
982 Ga0496112_0125247 3300048915 Bacteria 2540
983 Ga0496112_0240243 3300048915 Bacteria 1764
984 Ga0496112_0812790 3300048915 Unclassified 859
985 Ga0496113_0325552 3300048916 Bacteria 1232
986 Ga0496113_0683054 3300048916 Bacteria 820
987 Ga0496114_0000069 3300048917 Bacteria 73894
988 Ga0496114_0837090 3300048917 Bacteria 800
989 Ga0501298_003475 3300049521 Bacteria 2440
990 Ga0501040_0677854 3300049576 Unclassified 745
991 Ga0501067_0050652 3300049583 Bacteria 2301
992 Ga0501067_0190404 3300049583 Unclassified 1143
993 Ga0501071_0318593 3300049587 Bacteria 1181
994 Ga0501198_004657 3300049649 Bacteria 1911
995 Ga0501199_003215 3300049650 Bacteria 1559
996 Ga0501209_137532 3300049656 Unclassified 731
997 Ga0501216_010060 3300049660 Bacteria 1516
998 Ga0501217_027089 3300049661 Bacteria 1389
999 Ga0501223_002822 3300049663 Bacteria 3808
1000 Ga0501223_044756 3300049663 Bacteria 859
1001 Ga0501224_007313 3300049664 Bacteria 1609
1002 Ga0501233_033334 3300049668 Bacteria 1176
1003 Ga0501235_002872 3300049669 Bacteria 3713
1004 Ga0501235_027377 3300049669 Bacteria 1279
1005 Ga0501247_063426 3300049677 Unclassified 571
1006 Ga0501221_002960 3300049704 Bacteria 2798
1007 Ga0501225_0021079 3300049705 Bacteria 1801
1008 Ga0501234_019691 3300049707 Bacteria 1072
1009 Ga0501245_034329 3300049708 Bacteria 850
1010 Ga0501262_014071 3300049759 Bacteria 1038
1011 Ga0501263_035112 3300049760 Bacteria 721
1012 Ga0501267_003992 3300049764 Bacteria 1359
1013 Ga0501268_004296 3300049765 Bacteria 2000
1014 Ga0501270_002531 3300049767 Bacteria 1883
1015 Ga0501273_004249 3300049770 Bacteria 1566
1016 Ga0501279_014247 3300049775 Bacteria 1093
1017 nmdc:mga00v17_46877_c1 3300050491 Bacteria 2616
1018 nmdc:mga0k408_304599_c1 3300050493 Bacteria 951
1019 nmdc:mga05p37_1587520_c1 3300050507 Bacteria 645
1020 nmdc:mga08y16_933203_c1 3300050511 Bacteria 852
1021 nmdc:mga0n895_605609_c1 3300050512 Bacteria 1097
1022 nmdc:mga0a205_1473562_c1 3300050515 Unclassified 529
1023 Ga0466962_0000327 3300061719 Bacteria 20387
1024 Ga0466962_0018553 3300061719 Bacteria 3347
1025 Ga0466962_0115810 3300061719 Bacteria 1291
1026 Ga0501204_044804
1027 JGI24736J21556_1031289
1028 JGI24740J21852_10008659
1029 JGI24740J21852_10034115
1030 JGI24739J22299_10009129
1031 JGI24739J22299_10021228
1032 JGI24737J22298_10004177
1033 JGI24737J22298_10032855
1034 JGI24737J22298_10051823
1035 JGI24743J22301_10007370
1036 JGI24743J22301_10031105
1037 JGI24743J22301_10035884
1038 JGI24735J21928_10031903
1039 JGI24735J21928_10132300
1040 JGI24745J21846_1003710
1041 JGI24744J21845_10000111
1042 JGI24742J22300_10015013
1043 Ga0065704_10042887
1044 Ga0065715_10184812
1045 Ga0070658_10005690
1046 Ga0070658_10028246
1047 Ga0070658_10044805
1048 Ga0070658_10049652
1049 Ga0070658_10078042
1050 Ga0070658_10106887
1051 Ga0070658_10114352
1052 Ga0070658_10117686
1053 Ga0070658_10132943
1054 Ga0070658_10265834
1055 Ga0070658_10322902
1056 Ga0070658_10333048
1057 Ga0070658_10347864
1058 Ga0070658_10754517
1059 Ga0070658_10825464
1060 Ga0070658_10827438
1061 Ga0070658_10964448
1062 Ga0070658_11004821
1063 Ga0070658_11034082
1064 Ga0070658_11292408
1065 Ga0070676_10030556
1066 Ga0070676_10057428
1067 Ga0070676_10089920
1068 Ga0070676_10113005
1069 Ga0070676_10117500
1070 Ga0070676_10124527
1071 Ga0070676_10761984
1072 Ga0070683_100005914
1073 Ga0070683_100016035
1074 Ga0070683_100043657
1075 Ga0070683_100116324
1076 Ga0070683_100362861
1077 Ga0070690_100005454
1078 Ga0070690_100011910
1079 Ga0070670_100190759
1080 Ga0070670_100234802
1081 Ga0070670_100578950
1082 Ga0070677_10046990
1083 Ga0068869_100079144
1084 Ga0068869_100385084
1085 Ga0068869_100896723
1086 Ga0070666_10005568
1087 Ga0070666_10016133
1088 Ga0070666_10020416
1089 Ga0070666_10050842
1090 Ga0070666_10376765
1091 Ga0070666_10708590
1092 Ga0070680_100022384
1093 Ga0070680_100161154
1094 Ga0070680_100241907
1095 Ga0070680_100480307
1096 Ga0070680_100749171
1097 Ga0070682_100066675
1098 Ga0070682_100420028
1099 Ga0068868_100007444
1100 Ga0068868_100112598
1101 Ga0068868_100138552
1102 Ga0068868_100259612
1103 Ga0070660_100021004
1104 Ga0070660_100047439
1105 Ga0070660_100068007
1106 Ga0070660_100072096
1107 Ga0070660_100076394
1108 Ga0070660_100163169
1109 Ga0070660_100193964
1110 Ga0070660_100207160
1111 Ga0070660_100215612
1112 Ga0070660_100254180
1113 Ga0070660_100472128
1114 Ga0070660_100960689
1115 Ga0070689_100780444
1116 Ga0070691_10002830
1117 Ga0070687_100030928
1118 Ga0070661_100017415
1119 Ga0070661_100020888
1120 Ga0070661_100024685
1121 Ga0070661_100030553
1122 Ga0070661_100034228
1123 Ga0070661_100052208
1124 Ga0070661_100072325
1125 Ga0070661_100074859
1126 Ga0070661_100215349
1127 Ga0070661_100217775
1128 Ga0070661_100586005
1129 Ga0070661_100740743
1130 Ga0070661_100881392
1131 Ga0070661_101409615
1132 Ga0070692_10031022
1133 Ga0070692_10312758
1134 Ga0070692_10798390
1135 Ga0070668_100151724
1136 Ga0070668_100239632
1137 Ga0070668_100317777
1138 Ga0070668_100493598
1139 Ga0070669_100025211
1140 Ga0070669_100179848
1141 Ga0070675_100045611
1142 Ga0070675_100224953
1143 Ga0070675_100276139
1144 Ga0070671_100007870
1145 Ga0070671_100037184
1146 Ga0070671_100160972
1147 Ga0070674_100018215
1148 Ga0070674_100146977
1149 Ga0070674_100195205
1150 Ga0070674_100248081
1151 Ga0070674_100380828
1152 Ga0070673_100029293
1153 Ga0070673_100074529
1154 Ga0070673_100680556
1155 Ga0070673_100840476
1156 Ga0070673_100888797
1157 Ga0070688_100233135
1158 Ga0070659_100008501
1159 Ga0070659_100008995
1160 Ga0070659_100016125
1161 Ga0070659_100023294
1162 Ga0070659_100029693
1163 Ga0070659_100037137
1164 Ga0070659_100043143
1165 Ga0070659_100053768
1166 Ga0070659_100146067
1167 Ga0070659_100269878
1168 Ga0070659_100403745
1169 Ga0070667_100010950
1170 Ga0070667_100024075
1171 Ga0070667_100046599
1172 Ga0070667_100052622
1173 Ga0070667_100080670
1174 Ga0070667_100103121
1175 Ga0070667_100171884
1176 Ga0070714_100393350
1177 Ga0070663_100009308
1178 Ga0070663_100024579
1179 Ga0070663_100032768
1180 Ga0070663_100034824
1181 Ga0070663_100075585
1182 Ga0070663_100100010
1183 Ga0070663_100295216
1184 Ga0070663_100413661
1185 Ga0070663_101215894
1186 Ga0070678_100046313
1187 Ga0070678_100151667
1188 Ga0070662_100007577
1189 Ga0070662_100023737
1190 Ga0070662_100037755
1191 Ga0070662_100044214
1192 Ga0070662_100078127
1193 Ga0070662_100084784
1194 Ga0070662_100105019
1195 Ga0070662_100120489
1196 Ga0070662_100255886
1197 Ga0070662_100260542
1198 Ga0070681_10055658
1199 Ga0070681_10100209
1200 Ga0070681_10105476
1201 Ga0070681_10208271
1202 Ga0070681_10548228
1203 Ga0070681_10722111
1204 Ga0068867_100005872
1205 Ga0068867_100043538
1206 Ga0068867_100072637
1207 Ga0068867_100187884
1208 Ga0068867_100833129
1209 Ga0070679_100053872
1210 Ga0070679_100065499
1211 Ga0070679_100399454
1212 Ga0070679_100714599
1213 Ga0070684_100034034
1214 Ga0070684_100393442
1215 Ga0070684_100534066
1216 Ga0070684_100917896
1217 Ga0068853_100043655
1218 Ga0068853_100164084
1219 Ga0068853_100256988
1220 Ga0068853_100348365
1221 Ga0068853_100416899
1222 Ga0068853_100702015
1223 Ga0068853_100764840
1224 Ga0068853_100805732
1225 Ga0070672_100050522
1226 Ga0070672_101138081
1227 Ga0070672_101163535
1228 Ga0070672_101205527
1229 Ga0070686_100674287
1230 Ga0070695_101637659
1231 Ga0070693_100004419
1232 Ga0070693_100039930
1233 Ga0070693_100094485
1234 Ga0070665_100058313
1235 Ga0070665_101491274
1236 Ga0070704_100199854
1237 Ga0068855_100036876
1238 Ga0068855_100101200
1239 Ga0068855_100125957
1240 Ga0068855_100173397
1241 Ga0068855_100238189
1242 Ga0068855_100317365
1243 Ga0068855_100538057
1244 Ga0068855_100712021
1245 Ga0068855_101559331
1246 Ga0070664_100013787
1247 Ga0070664_100015083
1248 Ga0070664_100021246
1249 Ga0070664_100064007
1250 Ga0070664_100098844
1251 Ga0070664_100103553
1252 Ga0070664_100129233
1253 Ga0070664_100201393
1254 Ga0070664_100763344
1255 Ga0070664_101223974
1256 Ga0068857_100011113
1257 Ga0068857_100014994
1258 Ga0068857_100079040
1259 Ga0068857_100860494
1260 Ga0068854_100003788
1261 Ga0068854_100009368
1262 Ga0068854_100029766
1263 Ga0068854_100048156
1264 Ga0068854_100050917
1265 Ga0068854_100083586
1266 Ga0068854_100120603
1267 Ga0068854_100241903
1268 Ga0068854_100352749
1269 Ga0068854_101002485
1270 Ga0068856_100012390
1271 Ga0068856_100232308
1272 Ga0068856_100360265
1273 Ga0068856_100601718
1274 Ga0068856_100667879
1275 Ga0068856_101231389
1276 Ga0070702_100215112
1277 Ga0068852_100001493
1278 Ga0068852_100007008
1279 Ga0068852_100027596
1280 Ga0068852_100110434
1281 Ga0068852_100154078
1282 Ga0068852_100225805
1283 Ga0068852_100242673
1284 Ga0068852_100442953
1285 Ga0068852_100778816
1286 Ga0068852_101019848
1287 Ga0068852_101054305
1288 Ga0068852_101077468
1289 Ga0068852_101362786
1290 Ga0068859_100017745
1291 Ga0068859_100030289
1292 Ga0068859_100345879
1293 Ga0068859_101166829
1294 Ga0068864_100116149
1295 Ga0068864_100177216
1296 Ga0068864_100905428
1297 Ga0068864_101213310
1298 Ga0068866_10003017
1299 Ga0068866_10005962
1300 Ga0068866_10259246
1301 Ga0068861_100665356
1302 Ga0068851_10021386
1303 Ga0068851_10029996
1304 Ga0068851_10102656
1305 Ga0068851_10514790
1306 Ga0068870_10305261
1307 Ga0068863_100006772
1308 Ga0068863_100013348
1309 Ga0068863_100042082
1310 Ga0068863_101646542
1311 Ga0068858_100000698
1312 Ga0068858_100044077
1313 Ga0068858_100103287
1314 Ga0068858_100405553
1315 Ga0068860_100082725
1316 Ga0068860_100159480
1317 Ga0068860_100413419
1318 Ga0068860_100445147
1319 Ga0068860_100495860
1320 Ga0068862_100033453
1321 Ga0068862_100564824
1322 Ga0081539_10016302
1323 Ga0075364_10092912
1324 Ga0070712_100117743
1325 Ga0075366_10238263
1326 Ga0097621_100142634
1327 Ga0097621_100239035
1328 Ga0097621_100855543
1329 Ga0068871_100005013
1330 Ga0068871_100401815
1331 Ga0068871_102047904
1332 Ga0068871_102259343
1333 Ga0075428_101138361
1334 Ga0075433_11162179
1335 Ga0068865_100388540
1336 Ga0068865_101535927
1337 Ga0097620_100017745
1338 Ga0097620_100030289
1339 Ga0097620_100345878
1340 Ga0097620_101166952
1341 Ga0105240_10113761
1342 Ga0105240_10205037
1343 Ga0105240_10227141
1344 Ga0105240_10247614
1345 Ga0105240_10723845
1346 Ga0111539_10464272
1347 Ga0105245_10012575
1348 Ga0105245_10016987
1349 Ga0105245_10051551
1350 Ga0105245_10198428
1351 Ga0105245_11829666
1352 Ga0105247_10108256
1353 Ga0114129_10195035
1354 Ga0114129_12440506
1355 Ga0105243_10022275
1356 Ga0105243_10046162
1357 Ga0105243_10364435
1358 Ga0105241_10113927
1359 Ga0105241_10116659
1360 Ga0105241_10127466
1361 Ga0105241_10919052
1362 Ga0105242_10043810
1363 Ga0105242_10739686
1364 Ga0105248_10016198
1365 Ga0105248_10031884
1366 Ga0105248_10080537
1367 Ga0105248_10315049
1368 Ga0105248_10646078
1369 Ga0105237_10042391
1370 Ga0105237_10046487
1371 Ga0105238_10055251
1372 Ga0105238_10084336
1373 Ga0105238_10131405
1374 Ga0105238_10134547
1375 Ga0105238_10179520
1376 Ga0105249_10336936
1377 Ga0105032_103594
1378 Ga0105239_10054774
1379 Ga0105239_10295056
1380 Ga0105239_10865947
1381 Ga0105246_10079172
1382 Ga0157373_10019821
1383 Ga0157373_10020418
1384 Ga0157373_10052932
1385 Ga0157373_10057676
1386 Ga0157373_10065847
1387 Ga0157373_10104521
1388 Ga0157373_10113482
1389 Ga0157373_10150646
1390 Ga0157373_10244882
1391 Ga0157373_10274722
1392 Ga0157371_10011587
1393 Ga0157371_10072281
1394 Ga0157371_10078626
1395 Ga0157371_10087969
1396 Ga0157371_10121977
1397 Ga0157371_10167267
1398 Ga0157371_10180348
1399 Ga0157371_10237789
1400 Ga0157371_10323479
1401 Ga0157371_10620646
1402 Ga0157370_10059811
1403 Ga0157370_10085743
1404 Ga0157370_10143871
1405 Ga0157370_10301670
1406 Ga0157370_10386634
1407 Ga0157370_10535413
1408 Ga0157370_10660370
1409 Ga0157370_10726457
1410 Ga0157370_10975848
1411 Ga0157369_10012892
1412 Ga0157369_10017591
1413 Ga0157369_10037223
1414 Ga0157369_10060124
1415 Ga0157369_10076714
1416 Ga0157369_10153916
1417 Ga0157369_10243536
1418 Ga0157369_10307348
1419 Ga0157369_10519354
1420 Ga0157369_10592772
1421 Ga0157369_10781988
1422 Ga0157369_11361975
1423 Ga0157374_10014255
1424 Ga0157374_10021424
1425 Ga0157374_10053773
1426 Ga0157374_10495150
1427 Ga0157374_10717215
1428 Ga0157374_11378608
1429 Ga0157378_10056711
1430 Ga0157378_10092163
1431 Ga0157378_10173979
1432 Ga0157378_10256171
1433 Ga0157378_12257592
1434 Ga0163162_10127478
1435 Ga0163162_10521073
1436 Ga0157372_10091705
1437 Ga0157372_10257302
1438 Ga0157372_10596620
1439 Ga0157372_10624915
1440 Ga0157372_11442482
1441 Ga0157372_12787255
1442 Ga0157375_10011784
1443 Ga0157375_10089713
1444 Ga0157375_10157437
1445 Ga0157375_10375982
1446 Ga0157375_10439445
1447 Ga0163163_10247810
1448 Ga0157380_10156030
1449 Ga0157380_10880062
1450 Ga0157377_10099779
1451 Ga0157379_10275733
1452 Ga0157379_11310787
1453 Ga0157376_10172397
1454 Ga0197907_11482614
1455 Ga0206356_10024764
1456 Ga0206354_10983484
1457 Ga0206353_11028540
1458 Ga0213875_10017229
1459 Ga0207697_10003609
1460 Ga0207697_10143398
1461 Ga0207697_10197433
1462 Ga0207656_10013827
1463 Ga0207656_10043096
1464 Ga0207656_10091669
1465 Ga0207656_10456047
1466 Ga0207682_10011969
1467 Ga0207642_10003539
1468 Ga0207642_10069729
1469 Ga0207688_10085601
1470 Ga0207688_10091085
1471 Ga0207688_10139536
1472 Ga0207680_10007734
1473 Ga0207680_10083888
1474 Ga0207680_10115470
1475 Ga0207680_10180663
1476 Ga0207647_10008591
1477 Ga0207647_10011971
1478 Ga0207647_10040161
1479 Ga0207647_10053242
1480 Ga0207647_10071415
1481 Ga0207647_10102165
1482 Ga0207647_10117603
1483 Ga0207647_10222512
1484 Ga0207645_10011068
1485 Ga0207645_10111789
1486 Ga0207645_10153918
1487 Ga0207645_10184349
1488 Ga0207705_10001770
1489 Ga0207705_10003609
1490 Ga0207705_10008044
1491 Ga0207705_10020054
1492 Ga0207705_10023323
1493 Ga0207705_10041566
1494 Ga0207705_10055577
1495 Ga0207705_10056918
1496 Ga0207705_10072045
1497 Ga0207705_10076353
1498 Ga0207705_10113471
1499 Ga0207705_10144538
1500 Ga0207705_10161566
1501 Ga0207705_10165226
1502 Ga0207705_10393668
1503 Ga0207705_10443424
1504 Ga0207705_10472226
1505 Ga0207705_10521942
1506 Ga0207705_10550261
1507 Ga0207654_10314783
1508 Ga0207654_10598607
1509 Ga0207707_10026313
1510 Ga0207707_10357996
1511 Ga0207707_10542542
1512 Ga0207707_11034967
1513 Ga0207695_10014363
1514 Ga0207695_10188590
1515 Ga0207695_10276154
1516 Ga0207695_10728165
1517 Ga0207671_10141743
1518 Ga0207693_10018845
1519 Ga0207660_10014922
1520 Ga0207660_10044262
1521 Ga0207660_10436300
1522 Ga0207660_10481207
1523 Ga0207660_10654600
1524 Ga0207662_10068687
1525 Ga0207657_10006637
1526 Ga0207657_10009671
1527 Ga0207657_10012629
1528 Ga0207657_10013869
1529 Ga0207657_10016054
1530 Ga0207657_10045967
1531 Ga0207657_10048589
1532 Ga0207657_10049254
1533 Ga0207657_10056193
1534 Ga0207657_10060282
1535 Ga0207657_10069683
1536 Ga0207657_11106834
1537 Ga0207649_10000609
1538 Ga0207649_10017146
1539 Ga0207649_10017742
1540 Ga0207649_10031567
1541 Ga0207649_10035183
1542 Ga0207649_10039402
1543 Ga0207649_10054934
1544 Ga0207649_10055222
1545 Ga0207649_10063970
1546 Ga0207649_10123450
1547 Ga0207649_10183202
1548 Ga0207649_10455561
1549 Ga0207649_10940612
1550 Ga0207649_11596097
1551 Ga0207652_10030413
1552 Ga0207652_10072922
1553 Ga0207652_10566221
1554 Ga0207681_10154873
1555 Ga0207694_10049494
1556 Ga0207694_10052285
1557 Ga0207694_10061259
1558 Ga0207694_10074543
1559 Ga0207650_10015641
1560 Ga0207650_10236036
1561 Ga0207650_10546808
1562 Ga0207659_10064791
1563 Ga0207687_10130714
1564 Ga0207687_10196412
1565 Ga0207687_10491946
1566 Ga0207687_11508624
1567 Ga0207644_10005901
1568 Ga0207644_10010410
1569 Ga0207644_10064872
1570 Ga0207644_10167803
1571 Ga0207690_10021720
1572 Ga0207690_10040828
1573 Ga0207690_10057730
1574 Ga0207690_10096114
1575 Ga0207690_10111500
1576 Ga0207690_10113203
1577 Ga0207690_10116250
1578 Ga0207690_10142031
1579 Ga0207690_10172357
1580 Ga0207690_10207385
1581 Ga0207690_10258974
1582 Ga0207690_10379367
1583 Ga0207690_10580637
1584 Ga0207706_10010928
1585 Ga0207706_10017233
1586 Ga0207706_10022481
1587 Ga0207706_10059992
1588 Ga0207706_10082822
1589 Ga0207706_10093332
1590 Ga0207706_10101119
1591 Ga0207706_10428635
1592 Ga0207706_10623912
1593 Ga0207686_10119720
1594 Ga0207686_10196916
1595 Ga0207709_10020092
1596 Ga0207709_10174688
1597 Ga0207709_10336951
1598 Ga0207670_11006401
1599 Ga0207669_10147668
1600 Ga0207669_10154177
1601 Ga0207669_10155239
1602 Ga0207669_10264649
1603 Ga0207669_11141135
1604 Ga0207704_10263280
1605 Ga0207691_10053748
1606 Ga0207691_10067449
1607 Ga0207691_10225294
1608 Ga0207691_10885742
1609 Ga0207711_10001586
1610 Ga0207711_10012397
1611 Ga0207711_10086336
1612 Ga0207711_10865428
1613 Ga0207661_10014880
1614 Ga0207661_10029303
1615 Ga0207661_10043986
1616 Ga0207661_10284814
1617 Ga0207661_10452581
1618 Ga0207679_10016312
1619 Ga0207679_10020313
1620 Ga0207679_10024962
1621 Ga0207679_10036166
1622 Ga0207679_10074803
1623 Ga0207679_10075951
1624 Ga0207679_10111043
1625 Ga0207679_10188069
1626 Ga0207679_10761223
1627 Ga0207679_11848047
1628 Ga0207667_10012522
1629 Ga0207667_10040678
1630 Ga0207667_10058404
1631 Ga0207667_10098724
1632 Ga0207667_10150361
1633 Ga0207667_10158671
1634 Ga0207667_10188860
1635 Ga0207667_10245627
1636 Ga0207667_10342973
1637 Ga0207667_10737549
1638 Ga0207667_11073060
1639 Ga0207667_11250403
1640 Ga0207667_11508403
1641 Ga0207651_10001064
1642 Ga0207651_10017121
1643 Ga0207651_10162444
1644 Ga0207651_10177361
1645 Ga0207668_10248460
1646 Ga0207668_10279728
1647 Ga0207640_10006995
1648 Ga0207640_10011184
1649 Ga0207640_10020967
1650 Ga0207640_10025728
1651 Ga0207640_10119774
1652 Ga0207640_10160695
1653 Ga0207640_10166894
1654 Ga0207640_10201817
1655 Ga0207640_10207011
1656 Ga0207640_10286430
1657 Ga0207640_11106035
1658 Ga0207658_10015410
1659 Ga0207658_10022103
1660 Ga0207658_10050500
1661 Ga0207658_10050773
1662 Ga0207658_10057410
1663 Ga0207658_10077272
1664 Ga0207658_10232161
1665 Ga0207658_11363023
1666 Ga0207677_10007773
1667 Ga0207677_10018428
1668 Ga0207677_10162593
1669 Ga0207677_10243831
1670 Ga0207677_10666686
1671 Ga0207703_10001131
1672 Ga0207703_10309149
1673 Ga0207703_10346513
1674 Ga0207639_10005372
1675 Ga0207639_10035157
1676 Ga0207639_10075162
1677 Ga0207639_10094009
1678 Ga0207639_10152837
1679 Ga0207639_10160442
1680 Ga0207639_10258373
1681 Ga0207639_10287397
1682 Ga0207639_10470431
1683 Ga0207639_10578421
1684 Ga0207678_10008034
1685 Ga0207678_10008741
1686 Ga0207678_10018256
1687 Ga0207678_10034890
1688 Ga0207678_10049425
1689 Ga0207678_10077827
1690 Ga0207678_10083764
1691 Ga0207678_10094505
1692 Ga0207678_10097948
1693 Ga0207678_10199844
1694 Ga0207702_10005398
1695 Ga0207702_10007420
1696 Ga0207702_10011401
1697 Ga0207702_10023661
1698 Ga0207702_10250408
1699 Ga0207702_10437580
1700 Ga0207702_10486849
1701 Ga0207641_10005432
1702 Ga0207641_10010661
1703 Ga0207641_10020616
1704 Ga0207641_10646569
1705 Ga0207641_10679120
1706 Ga0207641_11553909
1707 Ga0207648_10011594
1708 Ga0207648_10076673
1709 Ga0207648_10099037
1710 Ga0207648_10237119
1711 Ga0207676_10011103
1712 Ga0207676_10126804
1713 Ga0207674_10019429
1714 Ga0207674_10061064
1715 Ga0207674_10173578
1716 Ga0207674_10316547
1717 Ga0207675_100107740
1718 Ga0207683_10034084
1719 Ga0207683_10035825
1720 Ga0207698_10001495
1721 Ga0207698_10003511
1722 Ga0207698_10009252
1723 Ga0207698_10026189
1724 Ga0207698_10174290
1725 Ga0207698_10228234
1726 Ga0207698_10274743
1727 Ga0207698_10515931
1728 Ga0207698_10780335
1729 Ga0207698_11549281
1730 Ga0268266_10108661
1731 Ga0268266_10913210
1732 Ga0268265_11216891
1733 Ga0268264_10136746
1734 Ga0268264_10167220
1735 Ga0268264_10339339
1736 Ga0268264_10353434
1737 Ga0316182_1268691
1738 Ga0307408_100072989
1739 Ga0307408_100258169
1740 Ga0307405_10094732
1741 Ga0307405_10200833
1742 Ga0307405_10340018
1743 Ga0307413_10011592
1744 Ga0307413_11928748
1745 Ga0307410_10004325
1746 Ga0307410_10017783
1747 Ga0307410_10019949
1748 Ga0307410_10058833
1749 Ga0307410_10135811
1750 Ga0307410_10189220
1751 Ga0307410_10356904
1752 Ga0307410_10720171
1753 Ga0307406_10061210
1754 Ga0307406_10246739
1755 Ga0307406_10288701
1756 Ga0307406_10520247
1757 Ga0307407_10015741
1758 Ga0307407_10131552
1759 Ga0307407_10164887
1760 Ga0307407_10289208
1761 Ga0307407_10422927
1762 Ga0307412_10171977
1763 Ga0307412_10539212
1764 Ga0307409_100037602
1765 Ga0307409_100037694
1766 Ga0307409_100046604
1767 Ga0307409_100192794
1768 Ga0307409_100302593
1769 Ga0307409_100329347
1770 Ga0307409_101372419
1771 Ga0307416_100072310
1772 Ga0307416_100081435
1773 Ga0307416_100219199
1774 Ga0307416_100273737
1775 Ga0307416_100339982
1776 Ga0307416_100782864
1777 Ga0307416_100831637
1778 Ga0307416_101130720
1779 Ga0307414_10024662
1780 Ga0307414_10792233
1781 Ga0307414_11395623
1782 Ga0307414_11861155
1783 Ga0307411_10001080
1784 Ga0307411_10015528
1785 Ga0307411_10218319
1786 Ga0307411_10723867
1787 Ga0307411_10789598
1788 Ga0307411_10970574
1789 Ga0307415_100102394
1790 Ga0307415_100263268
1791 Ga0307415_100363294
1792 Ga0307415_100628858
1793 Ga0307415_100704632
1794 Ga0307415_100913150
1795 Ga0307415_101324001
1796 Ga0373940_0181648
1797 Ga0373960_0352143
1798 Ga0373942_0262631
1799 Ga0373961_0209969
1800 Ga0373962_0045100
1801 Ga0373962_0174182
1802 Ga0373931_0637155
1803 Ga0395899_0003159
1804 Ga0395899_0010009
1805 Ga0395899_0012795
1806 Ga0395899_0018141
1807 Ga0395899_0031153
1808 Ga0395899_0081035
1809 Ga0395899_0099940
1810 Ga0395899_0122223
1811 Ga0395899_0127942
1812 Ga0395899_0129289
1813 Ga0395899_0212738
1814 Ga0395899_0220931
1815 Ga0395899_0308682
1816 Ga0395899_0558200
1817 Ga0395899_0604840
1818 Ga0395900_0003502
1819 Ga0395900_0008180
1820 Ga0395900_0011717
1821 Ga0395900_0015629
1822 Ga0395900_0041426
1823 Ga0395900_0055890
1824 Ga0395900_0069977
1825 Ga0395900_0086435
1826 Ga0395900_0104018
1827 Ga0395900_0120169
1828 Ga0395900_0160689
1829 Ga0395900_0236271
1830 Ga0395900_0272569
1831 Ga0395900_0302066
1832 Ga0395900_0310088
1833 Ga0395900_0321875
1834 Ga0395900_0436009
1835 Ga0395900_0460665
1836 Ga0395900_0616174
1837 Ga0395900_0631538
1838 Ga0395900_0994201
1839 Ga0395900_1063387
1840 Ga0395900_1216571
1841 Ga0395900_1218423
1842 Ga0395900_1289512
1843 Ga0395900_1489580
1844 Ga0395900_1656821
1845 Ga0395898_0006138
1846 Ga0395898_0022087
1847 Ga0395898_0030146
1848 Ga0395898_0049474
1849 Ga0395898_0062485
1850 Ga0395898_0065673
1851 Ga0395898_0094720
1852 Ga0395898_0125150
1853 Ga0395898_0230467
1854 Ga0395898_0307288
1855 Ga0395898_0312866
1856 Ga0395898_0362865
1857 Ga0395898_0518375
1858 Ga0395898_0579674
1859 Ga0395898_0631625
1860 Ga0395898_0934765
1861 Ga0395898_1077509
1862 Ga0395898_1269811
1863 Ga0395898_1515586
1864 Ga0395905_0001949
1865 Ga0395905_0003598
1866 Ga0395905_0013181
1867 Ga0395905_0014848
1868 Ga0395905_0028235
1869 Ga0395905_0042071
1870 Ga0395905_0094434
1871 Ga0395905_0117294
1872 Ga0395905_0163218
1873 Ga0395905_0170316
1874 Ga0395905_0173389
1875 Ga0395905_0241034
1876 Ga0395905_0252156
1877 Ga0395905_0366621
1878 Ga0395905_0366633
1879 Ga0395905_0408188
1880 Ga0395905_0424247
1881 Ga0395905_0448151
1882 Ga0395905_0507929
1883 Ga0395905_0698655
1884 Ga0395905_0698733
1885 Ga0395905_0862450
1886 Ga0395905_0879671
1887 Ga0395905_1395881
1888 Ga0395905_1420272
1889 Ga0436364_0792406
1890 Ga0395901_0005705
1891 Ga0395901_0014347
1892 Ga0395901_0014751
1893 Ga0395901_0044472
1894 Ga0395901_0047933
1895 Ga0395901_0062335
1896 Ga0395901_0079373
1897 Ga0395901_0102079
1898 Ga0395901_0105231
1899 Ga0395901_0120668
1900 Ga0395901_0305248
1901 Ga0395901_0315471
1902 Ga0395901_0346053
1903 Ga0395901_0356771
1904 Ga0395901_0382442
1905 Ga0395901_0561026
1906 Ga0395901_0742206
1907 Ga0395901_0849206
1908 Ga0395901_0972360
1909 Ga0395901_1027651
1910 Ga0395901_1308113
1911 Ga0395901_1405396
1912 Ga0395901_1736571
1913 Ga0395901_2157864
1914 Ga0439438_122239
1915 Ga0439432_004519
1916 Ga0450898_049869
1917 Ga0450899_025489
1918 Ga0439458_0011922
1919 Ga0439458_0175610
1920 Ga0466972_0012993
1921 Ga0466972_0165979
1922 Ga0466972_0251012
1923 Ga0466965_0360342
1924 Ga0466966_0000003
1925 Ga0466966_0004449
1926 Ga0466966_0077444
1927 Ga0466966_0291809
1928 Ga0466966_0302969
1929 Ga0466961_0342246
1930 Ga0466963_0006348
1931 Ga0466963_0027629
1932 Ga0466963_0032139
1933 Ga0466963_0105277
1934 Ga0466963_0158794
1935 Ga0466963_0196401
1936 Ga0466963_0254063
1937 Ga0466963_0266319
1938 Ga0466963_0320979
1939 Ga0466963_0626957
1940 Ga0466963_0646646
1941 Ga0466964_0075537
1942 Ga0466971_0074134
1943 Ga0466970_0185014
1944 Ga0466957_0029232
1945 Ga0466957_0110500
1946 Ga0466957_0128913
1947 Ga0466957_0145538
1948 Ga0466957_0255018
1949 Ga0466957_0463131
1950 Ga0466960_0150832
1951 Ga0466960_0783862
1952 Ga0466959_0299596
1953 Ga0466959_0836032
1954 Ga0466958_0264914
1955 Ga0466958_0372521
1956 Ga0466958_0439889
1957 Ga0466967_0043676
1958 Ga0466967_0083855
1959 Ga0466967_0085523
1960 Ga0466967_0162182
1961 Ga0466967_0216012
1962 Ga0466967_0360607
1963 Ga0466967_0599350
1964 Ga0466967_0625443
1965 Ga0466967_1344992
1966 Ga0466967_1625837
1967 Ga0495629_0484109
1968 Ga0495584_0469123
1969 Ga0495642_0037967
1970 Ga0495598_0000969
1971 Ga0495621_0000609
1972 Ga0495621_0111745
1973 Ga0495668_0261016
1974 Ga0495669_0063502
1975 Ga0495669_0128390
1976 Ga0495669_0206949
1977 Ga0495669_0250238
1978 Ga0495670_0002361
1979 Ga0496100_0009195
1980 Ga0496100_0417061
1981 Ga0496101_0005978
1982 Ga0496101_0322017
1983 Ga0496101_1569938
1984 Ga0496102_0461494
1985 Ga0496102_0819194
1986 Ga0496103_0011091
1987 Ga0496104_0205663
1988 Ga0496104_1052041
1989 Ga0496105_0010892
1990 Ga0496105_0120864
1991 Ga0496107_0009344
1992 Ga0496107_0217249
1993 Ga0496107_0235021
1994 Ga0496107_0286131
1995 Ga0496108_0006649
1996 Ga0496108_0022816
1997 Ga0496108_1295035
1998 Ga0496109_0010191
1999 Ga0496109_0488070
2000 Ga0496109_0733676
2001 Ga0496109_0756955
2002 Ga0496109_1436497
2003 Ga0496110_0019059
2004 Ga0496111_0020047
2005 Ga0496112_0010385
2006 Ga0496112_0078448
2007 Ga0496112_0125247
2008 Ga0496112_0240243
2009 Ga0496112_0812790
2010 Ga0496113_0325552
2011 Ga0496113_0683054
2012 Ga0496114_0000069
2013 Ga0496114_0837090
2014 Ga0501298_003475
2015 Ga0501040_0677854
2016 Ga0501067_0050652
2017 Ga0501067_0190404
2018 Ga0501071_0318593
2019 Ga0501198_004657
2020 Ga0501199_003215
2021 Ga0501209_137532
2022 Ga0501216_010060
2023 Ga0501217_027089
2024 Ga0501223_002822
2025 Ga0501223_044756
2026 Ga0501224_007313
2027 Ga0501233_033334
2028 Ga0501235_002872
2029 Ga0501235_027377
2030 Ga0501247_063426
2031 Ga0501221_002960
2032 Ga0501225_0021079
2033 Ga0501234_019691
2034 Ga0501245_034329
2035 Ga0501262_014071
2036 Ga0501263_035112
2037 Ga0501267_003992
2038 Ga0501268_004296
2039 Ga0501270_002531
2040 Ga0501273_004249
2041 Ga0501279_014247
2042 nmdc:mga00v17_46877_c1
2043 nmdc:mga0k408_304599_c1
2044 nmdc:mga05p37_1587520_c1
2045 nmdc:mga08y16_933203_c1
2046 nmdc:mga0n895_605609_c1
2047 nmdc:mga0a205_1473562_c1
2048 Ga0466962_0000327
2049 Ga0466962_0018553
2050 Ga0466962_0115810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04002

RadC

RadC-like JAB domain

12

124

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h4n-assembly1.cif.gz_A 1.1 angstrom crystal structure of hypothetical protein ba_2335 from bacillus anthracis 0.9317 34 55
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.8807 10 134
6xe9-assembly1.cif.gz_A 10s myosin ii (smooth muscle) 0.8754 32 54
2qlc-assembly5.cif.gz_E the crystal structure of dna repair protein radc from chlorobium tepidum tls 0.8742 10 134
5t98-assembly2.cif.gz_B crystal structure of bugh2awt 0.8652 33 56
ID Description Score Start End Superfamily
af_Q47685_35_158_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9386 16 134 3.40.140.10
af_P25531_100_221_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.905 12 132 3.40.140.10
4h4nA00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.903 34 53 2.60.40.3750
af_P31337_89_213_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.9 8 133 3.40.140.10
af_P31337_89_213_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8933 8 133 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A369RIB7-F1-model_v4 DNA repair protein RadC 0.97 32 134 GO:0006508
GO:0008237
GO:0046872
AF-Q73HE0-F1-model_v4 DNA repair protein RadC, putative 0.9667 32 134 GO:0006508
GO:0008237
GO:0046872
AF-A0A6N6LDC9-F1-model_v4 JAB domain-containing protein 0.9615 32 134 GO:0006508
GO:0008237
GO:0046872
AF-A0A838V4A7-F1-model_v4 MPN domain-containing protein 0.9607 30 134 GO:0006508
GO:0008237
GO:0046872
AF-R5A777-F1-model_v4 RadC-like JAB domain protein 0.9604 10 134 GO:0006508
GO:0008237
GO:0046872

Map