F488510

General Info

Members Datasets Scaffolds Average Seq Length
1026 462 1007 169

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10047832|Ga0070717_100478322
Length 194
Sequence MAPPGRSRDEPTCRGAGFEVVWHVVNTMGQTLPKPAMRPFLPADTPMLAAIFAAAIEQLTGDDYSEAQQEAWTSAADDEEQFGKRLASELTLIATLQNAPIGFAALKGKDHIDMLYVHPSVAGQGVASMLCDALEKLAGSRGAKSLTVDASDNAEEFFKKRGYVARQRNTVTINGEWLANTTMQKTLETGGAQT

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
4 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
5 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
6 2791355199
7 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
8 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
9 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
10 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
11 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
12 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
13 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
14 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
15 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
191 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
198 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
201 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
219 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
220 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
221 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
253 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
254 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
255 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
256 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
257 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
258 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
261 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
267 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
268 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
279 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
280 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
281 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
282 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
283 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
284 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
285 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
286 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
287 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
293 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
294 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
297 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
298 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
299 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
300 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
303 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
304 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
311 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
312 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
317 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
318 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
319 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
322 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
323 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
324 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
325 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
332 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
336 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
367 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
382 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
383 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
384 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
385 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
386 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
387 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
388 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
389 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
390 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
391 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
392 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
393 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
396 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
397 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
398 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
399 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
400 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
401 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
402 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
403 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
404 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
405 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
406 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
407 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
408 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
409 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
410 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
411 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
412 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
413 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
414 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
415 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
416 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
417 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
418 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
419 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
420 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
421 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
422 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
423 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
424 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
425 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
426 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
427 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
428 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
429 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
430 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
431 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
432 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
433 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
434 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
435 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
436 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
437 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
438 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
439 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
440 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
441 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
442 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
443 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
444 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
445 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
446 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
447 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
448 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
449 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
450 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
451 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
452 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
453 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
454 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
455 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
456 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
457 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
458 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
459 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
460 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
461 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
462 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.95
Metatranscriptomes 0.29
Isolates 1.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.23
Nodule 1.17
Rhizoplane 6.53
Rhizosphere 75.34
Stem 0
Stem Tuber 0
Unclassified 6.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1009230 3300000549 Bacteria 1189
2 JGI25406J46586_10020277 3300003203 Bacteria 2691
3 JGI25404J52841_10010652 3300003659 Bacteria 1976
4 Ga0055539_1006928 3300003752 Bacteria 1441
5 Ga0070658_10079749 3300005327 Bacteria 2688
6 Ga0070676_10442116 3300005328 Bacteria 913
7 Ga0070683_100017979 3300005329 Bacteria 6252
8 Ga0070670_100153645 3300005331 Bacteria 1993
9 Ga0070670_100905277 3300005331 Bacteria 800
10 Ga0070670_100956994 3300005331 Bacteria 778
11 Ga0068869_100032826 3300005334 Bacteria 3661
12 Ga0068869_100338894 3300005334 Bacteria 1223
13 Ga0068869_100427552 3300005334 Bacteria 1094
14 Ga0068869_101263053 3300005334 Bacteria 650
15 Ga0070680_100022952 3300005336 Bacteria 4972
16 Ga0070680_100102180 3300005336 Bacteria 2380
17 Ga0068868_100196332 3300005338 Bacteria 1680
18 Ga0068868_101532967 3300005338 Bacteria 625
19 Ga0070660_100009001 3300005339 Bacteria 7004
20 Ga0070660_100675138 3300005339 Bacteria 866
21 Ga0070668_100044429 3300005347 Bacteria 3408
22 Ga0070668_100053645 3300005347 Bacteria 3109
23 Ga0070668_100095017 3300005347 Bacteria 2354
24 Ga0070668_100302823 3300005347 Bacteria 1341
25 Ga0070668_100340656 3300005347 Bacteria 1266
26 Ga0070668_100801997 3300005347 Bacteria 836
27 Ga0070669_100573768 3300005353 Bacteria 943
28 Ga0070669_100832367 3300005353 Bacteria 786
29 Ga0070675_100198699 3300005354 Bacteria 1740
30 Ga0070675_100250222 3300005354 Bacteria 1551
31 Ga0070688_100989195 3300005365 Bacteria 668
32 Ga0070659_100170860 3300005366 Bacteria 1780
33 Ga0070667_100252611 3300005367 Bacteria 1576
34 Ga0070667_100830631 3300005367 Bacteria 859
35 Ga0070709_10041150 3300005434 Bacteria 2846
36 Ga0070709_10505077 3300005434 Bacteria 919
37 Ga0070709_10762168 3300005434 Bacteria 757
38 Ga0070714_100017014 3300005435 Bacteria 5884
39 Ga0070714_100660522 3300005435 Bacteria 1007
40 Ga0070713_100039634 3300005436 Bacteria 3825
41 Ga0070713_100039665 3300005436 Bacteria 3824
42 Ga0070713_100166809 3300005436 Bacteria 1970
43 Ga0070713_100301108 3300005436 Bacteria 1476
44 Ga0070710_10206587 3300005437 Bacteria 1243
45 Ga0070710_10758149 3300005437 Bacteria 690
46 Ga0070711_100026775 3300005439 Bacteria 3782
47 Ga0070711_100129721 3300005439 Bacteria 1876
48 Ga0070711_100344350 3300005439 Bacteria 1197
49 Ga0070711_100533295 3300005439 Bacteria 972
50 Ga0070711_100568053 3300005439 Bacteria 943
51 Ga0070705_100055731 3300005440 Bacteria 2325
52 Ga0070700_100787003 3300005441 Bacteria 765
53 Ga0070694_100091570 3300005444 Bacteria 2134
54 Ga0070708_100037436 3300005445 Bacteria 4232
55 Ga0070663_100011372 3300005455 Bacteria 5584
56 Ga0070663_100118799 3300005455 Bacteria 1994
57 Ga0070663_100250373 3300005455 Bacteria 1402
58 Ga0070663_101540614 3300005455 Bacteria 592
59 Ga0070678_100081317 3300005456 Bacteria 2456
60 Ga0070678_100228987 3300005456 Bacteria 1548
61 Ga0070678_100308280 3300005456 Bacteria 1348
62 Ga0070678_100360525 3300005456 Bacteria 1252
63 Ga0070678_100427483 3300005456 Bacteria 1156
64 Ga0070678_100762777 3300005456 Bacteria 876
65 Ga0070662_100136853 3300005457 Bacteria 1895
66 Ga0070662_100262846 3300005457 Bacteria 1391
67 Ga0070681_10090433 3300005458 Bacteria 3011
68 Ga0068867_100223802 3300005459 Bacteria 1517
69 Ga0068867_101310722 3300005459 Bacteria 669
70 Ga0070706_100092751 3300005467 Bacteria 2802
71 Ga0070706_100757426 3300005467 Bacteria 900
72 Ga0070707_100341021 3300005468 Bacteria 1456
73 Ga0070698_100121433 3300005471 Bacteria 2572
74 Ga0070699_100067546 3300005518 Bacteria 3105
75 Ga0070679_100178201 3300005530 Bacteria 2098
76 Ga0070679_100925303 3300005530 Bacteria 815
77 Ga0070684_100017565 3300005535 Bacteria 5876
78 Ga0070697_100081138 3300005536 Bacteria 2673
79 Ga0070697_100136263 3300005536 Bacteria 2062
80 Ga0068853_100003512 3300005539 Bacteria 11990
81 Ga0068853_100038007 3300005539 Bacteria 4099
82 Ga0068853_100579505 3300005539 Bacteria 1064
83 Ga0068853_101536521 3300005539 Bacteria 645
84 Ga0070672_100301262 3300005543 Bacteria 1359
85 Ga0070672_100314521 3300005543 Bacteria 1330
86 Ga0070672_100601055 3300005543 Bacteria 958
87 Ga0070695_100050568 3300005545 Bacteria 2664
88 Ga0070693_100141790 3300005547 Bacteria 1513
89 Ga0070665_100020092 3300005548 Bacteria 6705
90 Ga0070665_100044801 3300005548 Bacteria 4441
91 Ga0070665_100121513 3300005548 Bacteria 2613
92 Ga0070665_100129052 3300005548 Bacteria 2530
93 Ga0068855_100034352 3300005563 Bacteria 6049
94 Ga0068855_100052116 3300005563 Bacteria 4818
95 Ga0068855_100060251 3300005563 Bacteria 4440
96 Ga0068855_100066133 3300005563 Bacteria 4214
97 Ga0068855_100277369 3300005563 Bacteria 1863
98 Ga0068855_100918505 3300005563 Bacteria 924
99 Ga0068855_101271620 3300005563 Bacteria 763
100 Ga0070664_100110142 3300005564 Bacteria 2402
101 Ga0070664_100306263 3300005564 Bacteria 1437
102 Ga0070664_100415463 3300005564 Bacteria 1232
103 Ga0068857_100025802 3300005577 Bacteria 5174
104 Ga0068857_100321729 3300005577 Bacteria 1428
105 Ga0068857_101579541 3300005577 Bacteria 640
106 Ga0068854_100337050 3300005578 Bacteria 1231
107 Ga0068856_100001102 3300005614 Bacteria 28542
108 Ga0068856_100563789 3300005614 Bacteria 1160
109 Ga0068856_100840094 3300005614 Bacteria 938
110 Ga0070702_100089777 3300005615 Bacteria 1861
111 Ga0070702_100438200 3300005615 Bacteria 945
112 Ga0068852_100154182 3300005616 Bacteria 2138
113 Ga0068852_100203611 3300005616 Bacteria 1874
114 Ga0068852_100600657 3300005616 Bacteria 1105
115 Ga0068852_100609636 3300005616 Bacteria 1096
116 Ga0068864_100268661 3300005618 Bacteria 1589
117 Ga0068866_10315219 3300005718 Bacteria 982
118 Ga0068866_10697487 3300005718 Bacteria 696
119 Ga0068861_100158542 3300005719 Bacteria 1864
120 Ga0068861_100833876 3300005719 Bacteria 868
121 Ga0068861_101363567 3300005719 Bacteria 691
122 Ga0068870_10354276 3300005840 Bacteria 943
123 Ga0068858_100106297 3300005842 Bacteria 2619
124 Ga0068858_100449392 3300005842 Bacteria 1242
125 Ga0068860_100064123 3300005843 Bacteria 3490
126 Ga0068860_100097306 3300005843 Bacteria 2805
127 Ga0068860_101955983 3300005843 Bacteria 608
128 Ga0068862_100222251 3300005844 Bacteria 1710
129 Ga0068862_100344771 3300005844 Bacteria 1380
130 Ga0068862_100363040 3300005844 Bacteria 1346
131 Ga0081455_10031420 3300005937 Bacteria 4806
132 Ga0081455_10038749 3300005937 Bacteria 4218
133 Ga0081455_10094202 3300005937 Bacteria 2420
134 Ga0081455_10210767 3300005937 Bacteria 1448
135 Ga0081540_1002935 3300005983 Bacteria 13720
136 Ga0081540_1006783 3300005983 Bacteria 8275
137 Ga0081540_1007771 3300005983 Bacteria 7590
138 Ga0081540_1008823 3300005983 Bacteria 7001
139 Ga0081540_1014845 3300005983 Bacteria 4960
140 Ga0081540_1018174 3300005983 Bacteria 4325
141 Ga0081540_1047770 3300005983 Bacteria 2149
142 Ga0081540_1061237 3300005983 Bacteria 1795
143 Ga0081540_1075943 3300005983 Bacteria 1533
144 Ga0081539_10000051 3300005985 Bacteria 268337
145 Ga0081539_10006975 3300005985 Bacteria 10492
146 Ga0081539_10026746 3300005985 Bacteria 3671
147 Ga0070717_10001453 3300006028 Bacteria 16347
148 Ga0070717_10047832 3300006028 Bacteria 3506
149 Ga0070717_10292710 3300006028 Bacteria 1446
150 Ga0070717_10956987 3300006028 Bacteria 780
151 Ga0075365_10051655 3300006038 Bacteria 2716
152 Ga0075365_10144370 3300006038 Bacteria 1653
153 Ga0075365_10270849 3300006038 Bacteria 1194
154 Ga0075365_10353105 3300006038 Bacteria 1036
155 Ga0075368_10041214 3300006042 Bacteria 1814
156 Ga0075368_10074001 3300006042 Bacteria 1379
157 Ga0075368_10113844 3300006042 Bacteria 1117
158 Ga0075363_100042880 3300006048 Bacteria 2391
159 Ga0075363_100176068 3300006048 Bacteria 1216
160 Ga0075363_100645583 3300006048 Bacteria 636
161 Ga0075364_10027527 3300006051 Bacteria 3632
162 Ga0075364_10042833 3300006051 Bacteria 2942
163 Ga0075364_10298371 3300006051 Bacteria 1097
164 Ga0070712_100026911 3300006175 Bacteria 3837
165 Ga0070712_100543821 3300006175 Bacteria 978
166 Ga0075362_10027793 3300006177 Bacteria 2424
167 Ga0075367_10144048 3300006178 Bacteria 1477
168 Ga0075367_10212516 3300006178 Bacteria 1210
169 Ga0075367_10408836 3300006178 Bacteria 859
170 Ga0075369_10025566 3300006186 Bacteria 2456
171 Ga0075366_10272145 3300006195 Bacteria 1034
172 Ga0097621_100353294 3300006237 Bacteria 1308
173 Ga0097621_100596997 3300006237 Bacteria 1009
174 Ga0097621_101289526 3300006237 Bacteria 690
175 Ga0075370_10050121 3300006353 Bacteria 2368
176 Ga0075370_10119846 3300006353 Bacteria 1531
177 Ga0068871_100292080 3300006358 Bacteria 1429
178 Ga0068871_100353842 3300006358 Bacteria 1300
179 Ga0068871_100942207 3300006358 Bacteria 802
180 Ga0075428_100082079 3300006844 Bacteria 3517
181 Ga0075434_100205639 3300006871 Bacteria 1989
182 Ga0068865_100329360 3300006881 Bacteria 1231
183 Ga0068865_100383665 3300006881 Bacteria 1147
184 Ga0068865_100836069 3300006881 Bacteria 797
185 Ga0068865_100872705 3300006881 Bacteria 781
186 Ga0075435_100085340 3300007076 Bacteria 2599
187 Ga0099794_10009182 3300007265 Bacteria 4142
188 Ga0099794_10023104 3300007265 Bacteria 2841
189 Ga0099794_10056174 3300007265 Bacteria 1904
190 Ga0099794_10348372 3300007265 Bacteria 770
191 Ga0099795_10031943 3300007788 Bacteria 1817
192 Ga0099795_10158825 3300007788 Bacteria 931
193 Ga0099795_10219694 3300007788 Bacteria 808
194 Ga0105250_10073854 3300009092 Bacteria 1379
195 Ga0105240_10018413 3300009093 Bacteria 9379
196 Ga0105240_10250832 3300009093 Bacteria 2047
197 Ga0105240_10943169 3300009093 Bacteria 926
198 Ga0111539_10124442 3300009094 Bacteria 3022
199 Ga0105245_10270455 3300009098 Bacteria 1657
200 Ga0105245_11627772 3300009098 Bacteria 697
201 Ga0105247_10055868 3300009101 Bacteria 2437
202 Ga0105247_10267360 3300009101 Bacteria 1175
203 Ga0105247_10280664 3300009101 Bacteria 1149
204 Ga0105247_10287271 3300009101 Bacteria 1137
205 Ga0105247_10537868 3300009101 Bacteria 857
206 Ga0114129_10390544 3300009147 Bacteria 1836
207 Ga0114129_11630058 3300009147 Bacteria 789
208 Ga0105243_10150161 3300009148 Bacteria 1998
209 Ga0105243_10154726 3300009148 Bacteria 1971
210 Ga0105243_10502835 3300009148 Bacteria 1149
211 Ga0105243_10885604 3300009148 Bacteria 887
212 Ga0105241_10678064 3300009174 Bacteria 939
213 Ga0105242_10102286 3300009176 Bacteria 2430
214 Ga0105242_10158779 3300009176 Bacteria 1977
215 Ga0105242_10548789 3300009176 Bacteria 1108
216 Ga0105242_10828415 3300009176 Bacteria 918
217 Ga0105248_10103453 3300009177 Bacteria 3210
218 Ga0105248_10381536 3300009177 Bacteria 1587
219 Ga0105248_10464772 3300009177 Bacteria 1426
220 Ga0105248_10693093 3300009177 Bacteria 1149
221 Ga0105248_11131272 3300009177 Bacteria 885
222 Ga0105237_10246838 3300009545 Bacteria 1787
223 Ga0105237_10250684 3300009545 Bacteria 1772
224 Ga0105237_10274405 3300009545 Bacteria 1689
225 Ga0105237_10428271 3300009545 Bacteria 1329
226 Ga0105237_10508256 3300009545 Bacteria 1212
227 Ga0105237_10627059 3300009545 Bacteria 1082
228 Ga0105238_10150745 3300009551 Bacteria 2300
229 Ga0105238_10479435 3300009551 Bacteria 1243
230 Ga0105238_10776827 3300009551 Bacteria 973
231 Ga0105249_10093817 3300009553 Bacteria 2812
232 Ga0105249_10686765 3300009553 Bacteria 1083
233 Ga0105249_10757514 3300009553 Bacteria 1033
234 Ga0105249_12448209 3300009553 Bacteria 594
235 Ga0099796_10059049 3300010159 Bacteria 1354
236 Ga0099796_10278634 3300010159 Bacteria 702
237 Ga0105239_10036703 3300010375 Bacteria 5377
238 Ga0105239_10056258 3300010375 Bacteria 4315
239 Ga0105239_10116383 3300010375 Bacteria 2966
240 Ga0105239_10185057 3300010375 Bacteria 2331
241 Ga0105239_10368977 3300010375 Bacteria 1622
242 Ga0105239_11953304 3300010375 Bacteria 681
243 Ga0105246_10128633 3300011119 Bacteria 1888
244 Ga0105246_10151843 3300011119 Bacteria 1754
245 Ga0105246_10588549 3300011119 Bacteria 959
246 Ga0157370_10123619 3300013104 Bacteria 2416
247 Ga0157370_10661840 3300013104 Bacteria 954
248 Ga0157369_10014981 3300013105 Bacteria 8751
249 Ga0157369_10019914 3300013105 Bacteria 7505
250 Ga0157369_10355342 3300013105 Bacteria 1522
251 Ga0157369_12342463 3300013105 Bacteria 541
252 Ga0157374_10741471 3300013296 Bacteria 997
253 Ga0157378_10069664 3300013297 Bacteria 3156
254 Ga0157378_10100155 3300013297 Bacteria 2645
255 Ga0157378_10345217 3300013297 Bacteria 1453
256 Ga0157378_10683305 3300013297 Bacteria 1045
257 Ga0157378_11024783 3300013297 Bacteria 860
258 Ga0157378_11146833 3300013297 Bacteria 815
259 Ga0163162_10030420 3300013306 Bacteria 5350
260 Ga0163162_10613531 3300013306 Bacteria 1213
261 Ga0163162_10961611 3300013306 Bacteria 965
262 Ga0163162_11150631 3300013306 Bacteria 880
263 Ga0163162_11468530 3300013306 Bacteria 776
264 Ga0157375_11120442 3300013308 Bacteria 922
265 Ga0157375_11497034 3300013308 Bacteria 796
266 Ga0157375_12366936 3300013308 Bacteria 634
267 Ga0163163_10564432 3300014325 Bacteria 1201
268 Ga0163163_10819068 3300014325 Bacteria 994
269 Ga0163163_11315323 3300014325 Bacteria 785
270 Ga0157377_10209679 3300014745 Bacteria 1242
271 Ga0157379_10803549 3300014968 Bacteria 888
272 Ga0157379_11085431 3300014968 Bacteria 766
273 Ga0163161_10172373 3300017792 Bacteria 1655
274 Ga0163161_10311369 3300017792 Bacteria 1242
275 Ga0163161_10480778 3300017792 Bacteria 1008
276 Ga0206356_10635911 3300020070 Bacteria 769
277 Ga0206353_11349222 3300020082 Bacteria 568
278 Ga0213874_10032895 3300021377 Bacteria 1509
279 Ga0213874_10052606 3300021377 Bacteria 1254
280 Ga0213876_10025827 3300021384 Bacteria 3097
281 Ga0213876_10444740 3300021384 Bacteria 689
282 Ga0228598_1074783 3300024227 Bacteria 678
283 Ga0209677_102539 3300025253 Bacteria 6752
284 Ga0209758_1020919 3300025297 Bacteria 3072
285 Ga0207656_10213684 3300025321 Bacteria 936
286 Ga0207642_10325648 3300025899 Bacteria 899
287 Ga0207710_10066554 3300025900 Bacteria 1644
288 Ga0207710_10347655 3300025900 Bacteria 755
289 Ga0207688_10263145 3300025901 Bacteria 1047
290 Ga0207688_10269932 3300025901 Bacteria 1034
291 Ga0207647_10366516 3300025904 Bacteria 815
292 Ga0207685_10253547 3300025905 Bacteria 852
293 Ga0207699_10578041 3300025906 Bacteria 817
294 Ga0207645_10102294 3300025907 Bacteria 1849
295 Ga0207645_10321249 3300025907 Bacteria 1032
296 Ga0207705_10052106 3300025909 Bacteria 2945
297 Ga0207705_10078949 3300025909 Bacteria 2396
298 Ga0207684_10099553 3300025910 Bacteria 2483
299 Ga0207684_10413970 3300025910 Bacteria 1158
300 Ga0207654_10077443 3300025911 Bacteria 1993
301 Ga0207707_10005224 3300025912 Bacteria 11380
302 Ga0207707_10110069 3300025912 Bacteria 2407
303 Ga0207695_10150869 3300025913 Bacteria 2263
304 Ga0207695_10275211 3300025913 Bacteria 1578
305 Ga0207671_10255621 3300025914 Bacteria 1378
306 Ga0207671_10423586 3300025914 Bacteria 1059
307 Ga0207693_10016029 3300025915 Bacteria 5998
308 Ga0207693_10048081 3300025915 Bacteria 3350
309 Ga0207693_10119608 3300025915 Bacteria 2069
310 Ga0207663_10008904 3300025916 Bacteria 5278
311 Ga0207663_10166444 3300025916 Bacteria 1562
312 Ga0207660_10020207 3300025917 Bacteria 4466
313 Ga0207660_10096383 3300025917 Bacteria 2202
314 Ga0207660_10647041 3300025917 Bacteria 862
315 Ga0207657_10120762 3300025919 Bacteria 2156
316 Ga0207657_10633805 3300025919 Bacteria 833
317 Ga0207652_10016767 3300025921 Bacteria 5985
318 Ga0207652_11577688 3300025921 Bacteria 561
319 Ga0207646_10288512 3300025922 Bacteria 1483
320 Ga0207681_10250673 3300025923 Bacteria 1382
321 Ga0207681_10372728 3300025923 Bacteria 1147
322 Ga0207694_10152968 3300025924 Bacteria 1859
323 Ga0207694_10525826 3300025924 Bacteria 991
324 Ga0207650_10648728 3300025925 Bacteria 890
325 Ga0207650_11412129 3300025925 Bacteria 592
326 Ga0207659_10213269 3300025926 Bacteria 1549
327 Ga0207659_10521549 3300025926 Bacteria 1007
328 Ga0207659_11482829 3300025926 Bacteria 580
329 Ga0207659_11597119 3300025926 Bacteria 557
330 Ga0207687_10685226 3300025927 Bacteria 869
331 Ga0207700_10130554 3300025928 Bacteria 2051
332 Ga0207700_10156116 3300025928 Bacteria 1891
333 Ga0207700_10466593 3300025928 Bacteria 1114
334 Ga0207664_10457103 3300025929 Bacteria 1140
335 Ga0207664_11331000 3300025929 Bacteria 638
336 Ga0207644_10143378 3300025931 Bacteria 1842
337 Ga0207690_10048739 3300025932 Bacteria 2819
338 Ga0207690_10359404 3300025932 Bacteria 1153
339 Ga0207690_10686801 3300025932 Bacteria 841
340 Ga0207706_10072973 3300025933 Bacteria 3018
341 Ga0207706_10552858 3300025933 Bacteria 991
342 Ga0207709_10197650 3300025935 Bacteria 1434
343 Ga0207709_10277053 3300025935 Bacteria 1237
344 Ga0207670_10366598 3300025936 Bacteria 1144
345 Ga0207669_10250204 3300025937 Bacteria 1319
346 Ga0207704_10324428 3300025938 Bacteria 1189
347 Ga0207665_10085571 3300025939 Bacteria 2177
348 Ga0207665_10366057 3300025939 Bacteria 1091
349 Ga0207665_10571813 3300025939 Bacteria 880
350 Ga0207691_10309399 3300025940 Bacteria 1356
351 Ga0207711_10046752 3300025941 Bacteria 3698
352 Ga0207711_10351041 3300025941 Bacteria 1366
353 Ga0207689_10041355 3300025942 Bacteria 3814
354 Ga0207689_10311396 3300025942 Bacteria 1306
355 Ga0207689_10777519 3300025942 Bacteria 808
356 Ga0207679_10243490 3300025945 Bacteria 1525
357 Ga0207679_10248660 3300025945 Bacteria 1510
358 Ga0207667_10006683 3300025949 Bacteria 13944
359 Ga0207667_10283365 3300025949 Bacteria 1693
360 Ga0207667_10594352 3300025949 Bacteria 1116
361 Ga0207712_10012948 3300025961 Bacteria 5339
362 Ga0207668_10010526 3300025972 Bacteria 5591
363 Ga0207668_10037590 3300025972 Bacteria 3241
364 Ga0207668_10047779 3300025972 Bacteria 2932
365 Ga0207668_10697619 3300025972 Bacteria 892
366 Ga0207668_11035692 3300025972 Bacteria 734
367 Ga0207668_11274381 3300025972 Bacteria 661
368 Ga0207640_10365564 3300025981 Bacteria 1164
369 Ga0207658_10665146 3300025986 Bacteria 939
370 Ga0207677_10712367 3300026023 Bacteria 892
371 Ga0207703_10097641 3300026035 Bacteria 2483
372 Ga0207703_10526902 3300026035 Bacteria 1112
373 Ga0207703_11477916 3300026035 Bacteria 654
374 Ga0207639_10091196 3300026041 Bacteria 2439
375 Ga0207639_10121012 3300026041 Bacteria 2150
376 Ga0207639_10389903 3300026041 Bacteria 1252
377 Ga0207678_10113826 3300026067 Bacteria 2308
378 Ga0207678_10223993 3300026067 Bacteria 1610
379 Ga0207678_10268474 3300026067 Bacteria 1463
380 Ga0207678_10312257 3300026067 Bacteria 1352
381 Ga0207678_10612757 3300026067 Bacteria 955
382 Ga0207708_10008525 3300026075 Bacteria 7587
383 Ga0207708_11148620 3300026075 Bacteria 678
384 Ga0207702_10001047 3300026078 Bacteria 28331
385 Ga0207702_10228565 3300026078 Bacteria 1737
386 Ga0207702_10501271 3300026078 Bacteria 1184
387 Ga0207641_10400936 3300026088 Bacteria 1317
388 Ga0207648_10089994 3300026089 Bacteria 2681
389 Ga0207648_10416531 3300026089 Bacteria 1219
390 Ga0207648_10551587 3300026089 Bacteria 1059
391 Ga0207676_10243216 3300026095 Bacteria 1615
392 Ga0207676_11133763 3300026095 Bacteria 774
393 Ga0207674_10012072 3300026116 Bacteria 9675
394 Ga0207674_10348965 3300026116 Bacteria 1431
395 Ga0207674_10419768 3300026116 Bacteria 1293
396 Ga0207675_100028411 3300026118 Bacteria 5208
397 Ga0207675_100188181 3300026118 Bacteria 1979
398 Ga0207675_101432763 3300026118 Bacteria 711
399 Ga0207683_10021347 3300026121 Bacteria 5542
400 Ga0207683_10073609 3300026121 Bacteria 3022
401 Ga0207683_10098824 3300026121 Bacteria 2604
402 Ga0207683_10257155 3300026121 Bacteria 1594
403 Ga0207683_10641244 3300026121 Bacteria 984
404 Ga0207683_10863138 3300026121 Bacteria 840
405 Ga0209588_1026891 3300027671 Bacteria 1829
406 Ga0209588_1067060 3300027671 Bacteria 1160
407 Ga0209813_10048772 3300027866 Bacteria 1316
408 Ga0209813_10189949 3300027866 Bacteria 755
409 Ga0207428_10197381 3300027907 Bacteria 1515
410 Ga0207428_10483372 3300027907 Bacteria 901
411 Ga0268266_10002184 3300028379 Bacteria 21420
412 Ga0268266_10060151 3300028379 Bacteria 3274
413 Ga0268266_10153118 3300028379 Bacteria 2080
414 Ga0268266_10249767 3300028379 Bacteria 1640
415 Ga0268266_10251536 3300028379 Bacteria 1635
416 Ga0268266_10958335 3300028379 Bacteria 828
417 Ga0268265_10072126 3300028380 Bacteria 2692
418 Ga0268265_10213468 3300028380 Bacteria 1683
419 Ga0268265_10498035 3300028380 Bacteria 1147
420 Ga0268265_11175410 3300028380 Bacteria 764
421 Ga0268264_10193987 3300028381 Bacteria 1853
422 Ga0265337_1012602 3300028556 Bacteria 2867
423 Ga0265326_10008399 3300028558 Bacteria 3116
424 Ga0265319_1006169 3300028563 Bacteria 5595
425 Ga0265334_10015261 3300028573 Bacteria 3194
426 Ga0265318_10008945 3300028577 Bacteria 4434
427 Ga0265323_10002476 3300028653 Bacteria 8450
428 Ga0265336_10000431 3300028666 Bacteria 25844
429 Ga0307517_10000008 3300028786 Bacteria 243202
430 Ga0307517_10078607 3300028786 Bacteria 2850
431 Ga0307515_10142057 3300028794 Bacteria 2568
432 Ga0265338_10000321 3300028800 Bacteria 87046
433 Ga0265324_10006568 3300029957 Bacteria 4822
434 Ga0265330_10058161 3300031235 Bacteria 1685
435 Ga0265330_10252262 3300031235 Bacteria 743
436 Ga0265332_10065690 3300031238 Bacteria 1548
437 Ga0265325_10020366 3300031241 Bacteria 3656
438 Ga0265340_10007905 3300031247 Bacteria 5765
439 Ga0265339_10021548 3300031249 Bacteria 3747
440 Ga0265339_10100600 3300031249 Bacteria 1505
441 Ga0265339_10241996 3300031249 Bacteria 876
442 Ga0265331_10032416 3300031250 Bacteria 2589
443 Ga0265316_10112992 3300031344 Bacteria 2056
444 Ga0265316_10193425 3300031344 Bacteria 1510
445 Ga0265316_10869292 3300031344 Bacteria 631
446 Ga0307513_10303766 3300031456 Bacteria 1361
447 Ga0307513_10309623 3300031456 Bacteria 1342
448 Ga0307513_10792852 3300031456 Bacteria 653
449 Ga0307408_100152852 3300031548 Bacteria 1824
450 Ga0307508_10001469 3300031616 Bacteria 26436
451 Ga0307508_10052684 3300031616 Bacteria 3613
452 Ga0307508_10154913 3300031616 Bacteria 1895
453 Ga0307508_10199081 3300031616 Bacteria 1604
454 Ga0307508_10293192 3300031616 Bacteria 1220
455 Ga0265314_10001300 3300031711 Bacteria 28304
456 Ga0265314_10081181 3300031711 Bacteria 2138
457 Ga0265342_10032530 3300031712 Bacteria 3216
458 Ga0265342_10266819 3300031712 Bacteria 909
459 Ga0307516_10017964 3300031730 Bacteria 7359
460 Ga0307516_10040779 3300031730 Bacteria 4618
461 Ga0307516_10203791 3300031730 Bacteria 1696
462 Ga0307405_10070040 3300031731 Bacteria 2251
463 Ga0307405_10775690 3300031731 Bacteria 801
464 Ga0307406_10080793 3300031901 Bacteria 2160
465 Ga0307411_10190555 3300032005 Bacteria 1565
466 Ga0307411_10346930 3300032005 Bacteria 1209
467 Ga0307415_100417269 3300032126 Bacteria 1151
468 Ga0307510_10021118 3300033180 Bacteria 7594
469 Ga0307510_10215430 3300033180 Bacteria 1438
470 Ga0373934_0044142 3300035086 Bacteria 1762
471 Ga0373934_0116328 3300035086 Bacteria 1086
472 Ga0373934_0161369 3300035086 Bacteria 919
473 Ga0373952_0114722 3300035092 Bacteria 725
474 Ga0373923_0018239 3300035111 Bacteria 2698
475 Ga0373923_0089817 3300035111 Bacteria 1342
476 Ga0373936_0042259 3300035113 Bacteria 1829
477 Ga0373936_0056361 3300035113 Bacteria 1597
478 Ga0373941_0096687 3300035115 Bacteria 1022
479 Ga0373945_0014945 3300035116 Bacteria 2607
480 Ga0373945_0178031 3300035116 Bacteria 874
481 Ga0373945_0243287 3300035116 Bacteria 758
482 Ga0373953_0001115 3300035117 Bacteria 7602
483 Ga0373954_0005560 3300035118 Bacteria 5458
484 Ga0373954_0027484 3300035118 Bacteria 2612
485 Ga0373954_0065815 3300035118 Bacteria 1715
486 Ga0373956_0000298 3300035119 Bacteria 20024
487 Ga0373956_0033906 3300035119 Bacteria 2247
488 Ga0373957_0001343 3300035120 Bacteria 6603
489 Ga0373957_0023830 3300035120 Bacteria 2192
490 Ga0373943_0002164 3300035170 Bacteria 8932
491 Ga0373943_0008246 3300035170 Bacteria 4676
492 Ga0373946_0013431 3300035171 Bacteria 3079
493 Ga0373946_0482912 3300035171 Bacteria 634
494 Ga0373955_0004260 3300035172 Bacteria 6318
495 Ga0373955_0130494 3300035172 Bacteria 1467
496 Ga0373942_0068932 3300035207 Bacteria 1029
497 Ga0373924_0004379 3300035410 Bacteria 4927
498 Ga0373924_0073751 3300035410 Bacteria 1443
499 Ga0373924_0096122 3300035410 Bacteria 1271
500 Ga0373931_0001282 3300035691 Bacteria 10731
501 Ga0373931_0132728 3300035691 Bacteria 1435
502 Ga0373935_0000186 3300035692 Bacteria 29290
503 Ga0373935_0010424 3300035692 Bacteria 5573
504 Ga0373935_0090898 3300035692 Bacteria 1999
505 Ga0373935_0212816 3300035692 Bacteria 1340
506 Ga0373935_0817078 3300035692 Bacteria 689
507 Ga0373927_0001401 3300035695 Bacteria 18162
508 Ga0373927_0002108 3300035695 Bacteria 14684
509 Ga0373927_0004095 3300035695 Bacteria 10272
510 Ga0373927_0023017 3300035695 Bacteria 4081
511 Ga0373927_0087741 3300035695 Bacteria 2019
512 Ga0373927_0113572 3300035695 Bacteria 1765
513 Ga0373927_0163659 3300035695 Bacteria 1458
514 Ga0373933_0000368 3300035724 Bacteria 28785
515 Ga0373947_0001325 3300035725 Bacteria 15237
516 Ga0373947_0003597 3300035725 Bacteria 9141
517 Ga0373947_0024113 3300035725 Bacteria 3543
518 Ga0373947_0089206 3300035725 Bacteria 1920
519 Ga0373947_0457516 3300035725 Bacteria 865
520 Ga0373947_0584674 3300035725 Bacteria 761
521 Ga0373937_0009543 3300036401 Bacteria 8442
522 Ga0373937_0115123 3300036401 Bacteria 2503
523 Ga0373937_0791555 3300036401 Bacteria 896
524 Ga0372808_034869 3300036459 Bacteria 722
525 Ga0373925_0002553 3300037068 Bacteria 14496
526 Ga0373925_0006241 3300037068 Bacteria 8794
527 Ga0373925_0037874 3300037068 Bacteria 3562
528 Ga0373925_0047807 3300037068 Bacteria 3186
529 Ga0373925_0051335 3300037068 Bacteria 3078
530 Ga0373925_0253610 3300037068 Bacteria 1411
531 Ga0373925_0260018 3300037068 Bacteria 1394
532 Ga0373925_0518173 3300037068 Bacteria 980
533 Ga0395899_0089491 3300037312 Bacteria 2233
534 Ga0395899_0137482 3300037312 Bacteria 1741
535 Ga0395900_0000820 3300037418 Bacteria 41179
536 Ga0395900_0181596 3300037418 Bacteria 2138
537 Ga0395900_0908025 3300037418 Bacteria 804
538 Ga0395898_0114094 3300037466 Bacteria 2589
539 Ga0395898_0309154 3300037466 Bacteria 1508
540 Ga0395898_0321370 3300037466 Bacteria 1476
541 Ga0395905_0100918 3300037471 Bacteria 2710
542 Ga0395905_0399577 3300037471 Bacteria 1269
543 Ga0395905_0761596 3300037471 Bacteria 871
544 Ga0395905_0779759 3300037471 Bacteria 859
545 Ga0436364_0385142 3300037853 Bacteria 674
546 Ga0436364_1460540 3300037853 Bacteria 3250
547 Ga0395901_0051601 3300038443 Bacteria 4277
548 Ga0395901_0102492 3300038443 Bacteria 3004
549 Ga0395901_0158993 3300038443 Bacteria 2373
550 Ga0395901_1391837 3300038443 Bacteria 660
551 Ga0436365_0103592 3300039437 Bacteria 616
552 Ga0436365_0510664 3300039437 Bacteria 655
553 Ga0436365_0609277 3300039437 Bacteria 1089
554 Ga0436365_0735123 3300039437 Bacteria 2322
555 Ga0436365_0990941 3300039437 Bacteria 5991
556 Ga0436365_1617397 3300039437 Bacteria 1328
557 Ga0436360_0202328 3300039438 Bacteria 4827
558 Ga0436360_0310567 3300039438 Bacteria 608
559 Ga0436360_0593081 3300039438 Bacteria 1979
560 Ga0436360_0947574 3300039438 Bacteria 1550
561 Ga0436360_1159963 3300039438 Bacteria 704
562 Ga0436360_1365633 3300039438 Bacteria 817
563 Ga0436360_1376600 3300039438 Bacteria 4137
564 Ga0436361_0023933 3300039447 Bacteria 2105
565 Ga0436363_0951156 3300039450 Bacteria 1398
566 Ga0436363_1200350 3300039450 Bacteria 1547
567 Ga0436362_1182516 3300039453 Bacteria 770
568 Ga0439465_0027021 3300041413 Bacteria 1816
569 Ga0451791_0227239 3300041451 Bacteria 636
570 Ga0451791_1046831 3300041451 Bacteria 814
571 Ga0451793_0175087 3300041452 Bacteria 559
572 Ga0451797_1036343 3300041453 Bacteria 941
573 Ga0451802_0491935 3300041460 Bacteria 585
574 Ga0451802_1397736 3300041460 Bacteria 729
575 Ga0451837_1228415 3300041494 Bacteria 591
576 Ga0451853_2172712 3300041512 Bacteria 682
577 Ga0439458_0056731 3300042157 Bacteria 973
578 Ga0439459_0004861 3300042438 Bacteria 2182
579 Ga0466966_0057074 3300044684 Bacteria 2469
580 Ga0466966_0229282 3300044684 Bacteria 1121
581 Ga0466968_0383344 3300044735 Bacteria 687
582 Ga0466959_0159592 3300045049 Bacteria 1586
583 Ga0466967_0840694 3300045976 Bacteria 912
584 Ga0495617_017617 3300046452 Bacteria 2414
585 Ga0495592_0001299 3300046454 Bacteria 17352
586 Ga0495592_0098492 3300046454 Bacteria 2086
587 Ga0495603_0001707 3300046455 Bacteria 12934
588 Ga0495603_0002520 3300046455 Bacteria 10781
589 Ga0495603_0025039 3300046455 Bacteria 3609
590 Ga0495603_0108439 3300046455 Bacteria 1620
591 Ga0495629_0000606 3300046459 Bacteria 29232
592 Ga0495629_0012153 3300046459 Bacteria 6240
593 Ga0495629_0188199 3300046459 Bacteria 1429
594 Ga0495638_0046286 3300046460 Bacteria 2734
595 Ga0495638_0455007 3300046460 Bacteria 653
596 Ga0495638_0492508 3300046460 Bacteria 619
597 Ga0495651_0031188 3300046462 Bacteria 4158
598 Ga0495651_0034272 3300046462 Bacteria 3957
599 Ga0495653_0035879 3300046463 Bacteria 3910
600 Ga0495653_0053884 3300046463 Bacteria 3075
601 Ga0495650_0108601 3300046471 Bacteria 1033
602 Ga0495580_0001307 3300046472 Bacteria 21998
603 Ga0495580_0075345 3300046472 Bacteria 2354
604 Ga0495580_0135889 3300046472 Bacteria 1705
605 Ga0495580_0235487 3300046472 Bacteria 1256
606 Ga0495639_0000136 3300046475 Bacteria 37792
607 Ga0495662_0000392 3300046476 Bacteria 19571
608 Ga0495662_0001286 3300046476 Bacteria 12410
609 Ga0495664_0000270 3300046477 Bacteria 24785
610 Ga0495664_0009869 3300046477 Bacteria 5354
611 Ga0495664_0010089 3300046477 Bacteria 5298
612 Ga0495664_0055223 3300046477 Bacteria 2363
613 Ga0495664_0061267 3300046477 Bacteria 2241
614 Ga0495664_0094961 3300046477 Bacteria 1795
615 Ga0495664_0136765 3300046477 Bacteria 1485
616 Ga0495664_0228519 3300046477 Bacteria 1126
617 Ga0495584_0061716 3300046491 Bacteria 1884
618 Ga0495585_0087422 3300046492 Bacteria 1682
619 Ga0495594_0000843 3300046499 Bacteria 15801
620 Ga0495594_0059578 3300046499 Bacteria 2112
621 Ga0495596_0149365 3300046500 Bacteria 908
622 Ga0495607_0356540 3300046501 Bacteria 674
623 Ga0495583_0191397 3300046506 Bacteria 834
624 Ga0495583_0265526 3300046506 Bacteria 686
625 Ga0495606_0003785 3300046507 Bacteria 15720
626 Ga0495606_0130863 3300046507 Bacteria 1492
627 Ga0495606_0193050 3300046507 Bacteria 1166
628 Ga0495608_0008627 3300046511 Bacteria 7136
629 Ga0495610_0102076 3300046512 Bacteria 1283
630 Ga0495610_0191172 3300046512 Bacteria 845
631 Ga0495616_0077966 3300046513 Bacteria 1590
632 Ga0495618_0001241 3300046514 Bacteria 17254
633 Ga0495618_0214507 3300046514 Bacteria 1216
634 Ga0495620_0058290 3300046515 Bacteria 1617
635 Ga0495628_0053564 3300046516 Bacteria 3183
636 Ga0495628_0085243 3300046516 Bacteria 2451
637 Ga0495628_0435215 3300046516 Bacteria 954
638 Ga0495630_0235212 3300046517 Bacteria 1400
639 Ga0495630_0285172 3300046517 Bacteria 1262
640 Ga0495631_0286002 3300046518 Bacteria 702
641 Ga0495632_0124882 3300046519 Bacteria 1200
642 Ga0495644_0112986 3300046523 Bacteria 1031
643 Ga0495644_0196056 3300046523 Bacteria 778
644 Ga0495648_0005884 3300046524 Bacteria 10080
645 Ga0495666_0025780 3300046526 Bacteria 2903
646 Ga0495666_0162264 3300046526 Bacteria 1036
647 Ga0495652_0082944 3300046529 Bacteria 2640
648 Ga0495652_0101851 3300046529 Bacteria 2327
649 Ga0495652_0194649 3300046529 Bacteria 1544
650 Ga0495652_0268062 3300046529 Bacteria 1256
651 Ga0495652_0620996 3300046529 Bacteria 735
652 Ga0495665_0000026 3300046531 Bacteria 56855
653 Ga0495665_0005893 3300046531 Bacteria 6598
654 Ga0495640_0008255 3300046533 Bacteria 8173
655 Ga0495640_0019925 3300046533 Bacteria 4946
656 Ga0495640_0032516 3300046533 Bacteria 3715
657 Ga0495640_0038540 3300046533 Bacteria 3361
658 Ga0495640_0089605 3300046533 Bacteria 2031
659 Ga0495640_0312686 3300046533 Bacteria 974
660 Ga0495586_0109545 3300046535 Bacteria 1536
661 Ga0495587_0019713 3300046536 Bacteria 4171
662 Ga0495587_0081199 3300046536 Bacteria 1878
663 Ga0495598_0005787 3300046537 Bacteria 2761
664 Ga0495598_0094724 3300046537 Bacteria 979
665 Ga0495598_0343710 3300046537 Bacteria 573
666 Ga0495621_0014542 3300046539 Bacteria 2492
667 Ga0495621_0095710 3300046539 Bacteria 1125
668 Ga0495597_0230225 3300046542 Bacteria 733
669 Ga0495645_0007214 3300046543 Bacteria 7736
670 Ga0495645_0013176 3300046543 Bacteria 5845
671 Ga0495645_0035707 3300046543 Bacteria 3623
672 Ga0495645_0150289 3300046543 Bacteria 1619
673 Ga0495645_0378859 3300046543 Bacteria 906
674 Ga0495622_0002841 3300046557 Bacteria 8260
675 Ga0495633_0096722 3300046558 Bacteria 1371
676 Ga0495633_0115874 3300046558 Bacteria 1242
677 Ga0495667_0028023 3300046559 Bacteria 3793
678 Ga0495667_0047064 3300046559 Bacteria 2850
679 Ga0495667_0048749 3300046559 Bacteria 2796
680 Ga0495667_0113143 3300046559 Bacteria 1754
681 Ga0495667_0128776 3300046559 Bacteria 1633
682 Ga0495656_0057916 3300046615 Bacteria 1679
683 Ga0495656_0236232 3300046615 Bacteria 919
684 Ga0495656_0334263 3300046615 Bacteria 782
685 Ga0495668_0268273 3300046616 Bacteria 935
686 Ga0495668_0341131 3300046616 Bacteria 822
687 Ga0495634_0000634 3300046642 Bacteria 34163
688 Ga0495634_0023387 3300046642 Bacteria 4344
689 Ga0495634_0042420 3300046642 Bacteria 3086
690 Ga0495634_0043498 3300046642 Bacteria 3043
691 Ga0495611_0094639 3300046648 Bacteria 1382
692 Ga0495611_0255654 3300046648 Bacteria 812
693 Ga0495611_0419225 3300046648 Bacteria 611
694 Ga0495625_0217787 3300046660 Bacteria 1252
695 Ga0495625_0370258 3300046660 Bacteria 901
696 Ga0495625_0526124 3300046660 Bacteria 719
697 Ga0495635_0000827 3300046663 Bacteria 20282
698 Ga0495635_0001564 3300046663 Bacteria 15359
699 Ga0495635_0002063 3300046663 Bacteria 13613
700 Ga0495635_0137115 3300046663 Bacteria 1667
701 Ga0495588_0050578 3300046674 Bacteria 2138
702 Ga0495588_0358914 3300046674 Bacteria 766
703 Ga0495657_0032998 3300046675 Bacteria 3608
704 Ga0495657_0042292 3300046675 Bacteria 3112
705 Ga0495657_0150903 3300046675 Bacteria 1443
706 Ga0495657_0258231 3300046675 Bacteria 1047
707 Ga0495599_0074009 3300046678 Bacteria 2126
708 Ga0495599_0167839 3300046678 Bacteria 1355
709 Ga0495599_0311306 3300046678 Bacteria 949
710 Ga0495623_0004722 3300046679 Bacteria 8951
711 Ga0495623_0039351 3300046679 Bacteria 3022
712 Ga0495646_0026783 3300046680 Bacteria 3618
713 Ga0495646_0054824 3300046680 Bacteria 2396
714 Ga0495646_0209439 3300046680 Bacteria 1058
715 Ga0495658_0002383 3300046683 Bacteria 9484
716 Ga0495669_0032965 3300046684 Bacteria 2279
717 Ga0495669_0108934 3300046684 Bacteria 1292
718 Ga0495669_0182944 3300046684 Bacteria 999
719 Ga0495613_0017331 3300046689 Bacteria 5367
720 Ga0495613_0025652 3300046689 Bacteria 4392
721 Ga0495613_0072434 3300046689 Bacteria 2511
722 Ga0495613_0082704 3300046689 Bacteria 2332
723 Ga0495624_0000201 3300046690 Bacteria 45984
724 Ga0495624_0013947 3300046690 Bacteria 5471
725 Ga0495670_0242639 3300046691 Bacteria 959
726 Ga0495671_0374117 3300046692 Bacteria 683
727 Ga0495649_0229220 3300046694 Bacteria 959
728 Ga0495589_0431725 3300046794 Bacteria 603
729 Ga0495600_0024231 3300046809 Bacteria 3905
730 Ga0495600_0025302 3300046809 Bacteria 3825
731 Ga0495600_0075575 3300046809 Bacteria 2200
732 Ga0495600_0379276 3300046809 Bacteria 882
733 Ga0495581_0000828 3300047315 Bacteria 16501
734 Ga0495581_0036031 3300047315 Bacteria 2862
735 Ga0495581_0452719 3300047315 Bacteria 747
736 Ga0495604_0052770 3300047317 Bacteria 3146
737 Ga0495604_0119901 3300047317 Bacteria 1905
738 Ga0495604_0879966 3300047317 Bacteria 560
739 Ga0495674_0002806 3300047319 Bacteria 16925
740 Ga0495674_0070830 3300047319 Bacteria 3012
741 Ga0495674_0076190 3300047319 Bacteria 2885
742 Ga0495674_0455893 3300047319 Bacteria 1027
743 Ga0495674_0907565 3300047319 Bacteria 680
744 Ga0495672_0016840 3300047320 Bacteria 4905
745 Ga0495672_0036995 3300047320 Bacteria 2991
746 Ga0495672_0064097 3300047320 Bacteria 2105
747 Ga0495676_0018819 3300047321 Bacteria 6087
748 Ga0495676_0127854 3300047321 Bacteria 1839
749 Ga0495676_0218246 3300047321 Bacteria 1316
750 Ga0495680_0068454 3300047322 Bacteria 2712
751 Ga0495680_0434811 3300047322 Bacteria 900
752 Ga0495680_0497209 3300047322 Bacteria 828
753 Ga0495675_0130176 3300047444 Bacteria 1564
754 Ga0495675_0713985 3300047444 Bacteria 560
755 Ga0495677_0025572 3300047445 Bacteria 2142
756 Ga0495677_0069072 3300047445 Bacteria 1316
757 Ga0495673_0026878 3300047469 Bacteria 2745
758 Ga0495673_0105254 3300047469 Bacteria 1135
759 Ga0495681_0157067 3300047470 Bacteria 950
760 Ga0495684_0002851 3300047471 Bacteria 13604
761 Ga0495684_0004084 3300047471 Bacteria 11397
762 Ga0495684_0034305 3300047471 Bacteria 3893
763 Ga0495684_0051065 3300047471 Bacteria 3156
764 Ga0495686_0076032 3300047472 Bacteria 2058
765 Ga0495686_0334789 3300047472 Bacteria 826
766 Ga0495593_0000282 3300047673 Bacteria 27666
767 Ga0495593_0001509 3300047673 Bacteria 13687
768 Ga0495593_0071261 3300047673 Bacteria 1805
769 Ga0495602_0089153 3300048088 Bacteria 2565
770 Ga0495602_0221809 3300048088 Bacteria 1426
771 Ga0495602_0744782 3300048088 Bacteria 662
772 Ga0495614_0016341 3300048089 Bacteria 3231
773 Ga0495614_0084256 3300048089 Bacteria 1379
774 Ga0496100_0110399 3300048903 Bacteria 1909
775 Ga0496100_0189176 3300048903 Bacteria 1493
776 Ga0496100_0342336 3300048903 Bacteria 1128
777 Ga0496100_0417110 3300048903 Bacteria 1025
778 Ga0496100_0963612 3300048903 Bacteria 671
779 Ga0496101_0194247 3300048904 Bacteria 1567
780 Ga0496101_0296917 3300048904 Bacteria 1265
781 Ga0496101_0333774 3300048904 Bacteria 1190
782 Ga0496102_0008807 3300048905 Bacteria 8657
783 Ga0496102_0099366 3300048905 Bacteria 2701
784 Ga0496102_0191576 3300048905 Bacteria 1927
785 Ga0496102_0344613 3300048905 Bacteria 1403
786 Ga0496102_0663711 3300048905 Bacteria 966
787 Ga0496103_0044481 3300048906 Bacteria 2736
788 Ga0496103_0105501 3300048906 Bacteria 1787
789 Ga0496103_0386032 3300048906 Bacteria 900
790 Ga0496104_0257040 3300048907 Bacteria 1659
791 Ga0496104_0450104 3300048907 Bacteria 1199
792 Ga0496104_1126915 3300048907 Bacteria 688
793 Ga0496105_0079259 3300048908 Bacteria 2712
794 Ga0496106_0069840 3300048909 Bacteria 2682
795 Ga0496106_0323858 3300048909 Bacteria 1237
796 Ga0496106_0518655 3300048909 Bacteria 957
797 Ga0496107_0151120 3300048910 Bacteria 1718
798 Ga0496107_0253210 3300048910 Bacteria 1310
799 Ga0496107_0254912 3300048910 Bacteria 1305
800 Ga0496107_0377745 3300048910 Bacteria 1054
801 Ga0496108_0181500 3300048911 Bacteria 1823
802 Ga0496108_0789013 3300048911 Bacteria 820
803 Ga0496108_1063475 3300048911 Bacteria 689
804 Ga0496109_0151869 3300048912 Bacteria 2168
805 Ga0496109_0521919 3300048912 Bacteria 1121
806 Ga0496109_0758475 3300048912 Bacteria 908
807 Ga0496109_1003953 3300048912 Bacteria 772
808 Ga0496109_1015126 3300048912 Bacteria 767
809 Ga0496109_1079124 3300048912 Bacteria 740
810 Ga0496109_1110391 3300048912 Bacteria 728
811 Ga0496110_0260504 3300048913 Bacteria 1578
812 Ga0496110_0535726 3300048913 Bacteria 1065
813 Ga0496111_0188051 3300048914 Bacteria 1535
814 Ga0496111_0480752 3300048914 Bacteria 915
815 Ga0496112_0000004 3300048915 Bacteria 553294
816 Ga0496112_0191499 3300048915 Bacteria 2007
817 Ga0496112_0273967 3300048915 Bacteria 1635
818 Ga0496112_0313284 3300048915 Bacteria 1514
819 Ga0496112_0678446 3300048915 Bacteria 959
820 Ga0496113_0144862 3300048916 Bacteria 1871
821 Ga0496113_0253806 3300048916 Bacteria 1404
822 Ga0496113_0318662 3300048916 Bacteria 1246
823 Ga0496113_0395239 3300048916 Bacteria 1110
824 Ga0496113_0831487 3300048916 Bacteria 733
825 Ga0496114_0234728 3300048917 Bacteria 1612
826 Ga0496114_0256196 3300048917 Bacteria 1540
827 Ga0496114_0581675 3300048917 Bacteria 988
828 Ga0496114_0625973 3300048917 Bacteria 948
829 Ga0496114_1091143 3300048917 Bacteria 683
830 Ga0496115_0000864 3300048918 Bacteria 22018
831 Ga0496115_0008261 3300048918 Bacteria 7694
832 Ga0496115_0074212 3300048918 Bacteria 2762
833 Ga0496115_0206686 3300048918 Bacteria 1622
834 Ga0496115_1164900 3300048918 Bacteria 581
835 Ga0496117_0049280 3300048920 Bacteria 2998
836 Ga0496117_0285350 3300048920 Bacteria 882
837 Ga0496118_0214194 3300048921 Bacteria 1127
838 Ga0496121_0000657 3300048924 Bacteria 64819
839 Ga0496121_0002279 3300048924 Bacteria 29850
840 Ga0496121_0184644 3300048924 Bacteria 1501
841 Ga0496121_0358223 3300048924 Bacteria 969
842 Ga0496124_0139856 3300048927 Bacteria 1912
843 Ga0496124_0454716 3300048927 Bacteria 872
844 Ga0496125_0000060 3300048928 Bacteria 264143
845 Ga0496125_0000838 3300048928 Bacteria 49466
846 Ga0496125_0096787 3300048928 Bacteria 2190
847 Ga0496125_0124092 3300048928 Bacteria 1834
848 Ga0496125_0173128 3300048928 Bacteria 1448
849 Ga0496125_0407700 3300048928 Bacteria 792
850 Ga0496126_0009539 3300048929 Bacteria 10296
851 Ga0496126_0028827 3300048929 Bacteria 5283
852 Ga0496126_0041794 3300048929 Bacteria 4239
853 Ga0496126_0050977 3300048929 Bacteria 3771
854 Ga0496126_0071312 3300048929 Bacteria 3092
855 Ga0496126_0118516 3300048929 Bacteria 2298
856 Ga0496126_0121857 3300048929 Bacteria 2261
857 Ga0496126_0141964 3300048929 Bacteria 2066
858 Ga0496126_0253973 3300048929 Bacteria 1464
859 Ga0496126_0378151 3300048929 Bacteria 1153
860 Ga0496126_0544304 3300048929 Bacteria 922
861 Ga0496126_0585165 3300048929 Bacteria 881
862 Ga0496126_0736047 3300048929 Bacteria 763
863 Ga0496126_0926954 3300048929 Bacteria 658
864 Ga0495678_048806 3300049459 Bacteria 1649
865 Ga0501031_0004192 3300049568 Bacteria 9316
866 Ga0501031_0260182 3300049568 Bacteria 1128
867 Ga0501032_0000216 3300049569 Bacteria 47842
868 Ga0501033_0000344 3300049570 Bacteria 44238
869 Ga0501034_0000100 3300049571 Bacteria 159536
870 Ga0501036_0000010 3300049572 Bacteria 163304
871 Ga0501036_0254617 3300049572 Bacteria 1471
872 Ga0501037_0000704 3300049573 Bacteria 25447
873 Ga0501038_0000350 3300049574 Bacteria 39547
874 Ga0501039_0001013 3300049575 Bacteria 20468
875 Ga0501042_0046127 3300049578 Bacteria 3107
876 Ga0501043_0000106 3300049579 Bacteria 77699
877 Ga0501046_0008451 3300049580 Bacteria 8979
878 Ga0501047_0000493 3300049581 Bacteria 42827
879 Ga0501047_0030357 3300049581 Bacteria 5211
880 Ga0501048_0000233 3300049582 Bacteria 36758
881 Ga0501067_0000098 3300049583 Bacteria 50026
882 Ga0501068_0001545 3300049584 Bacteria 12233
883 Ga0501069_0013785 3300049585 Bacteria 4313
884 Ga0501070_0013036 3300049586 Bacteria 7006
885 Ga0501072_0014911 3300049588 Bacteria 5957
886 Ga0501073_0002056 3300049589 Bacteria 15034
887 Ga0501073_0234204 3300049589 Bacteria 1268
888 Ga0501074_0000382 3300049590 Bacteria 26289
889 Ga0501075_0347285 3300049591 Bacteria 1131
890 Ga0501076_0216016 3300049592 Bacteria 1567
891 Ga0501076_0878615 3300049592 Bacteria 739
892 Ga0501079_0003159 3300049741 Bacteria 12078
893 Ga0501080_0001033 3300049742 Bacteria 22925
894 Ga0501081_0421035 3300049743 Bacteria 990
895 Ga0501083_0000116 3300049744 Bacteria 54656
896 Ga0501035_0000496 3300049822 Bacteria 44296
897 Ga0501044_0000857 3300049823 Bacteria 36575
898 Ga0501044_0929485 3300049823 Bacteria 744
899 Ga0501045_0009479 3300049824 Bacteria 6814
900 nmdc:mga03683_231732_c1 3300050489 Bacteria 854
901 nmdc:mga03n38_123037_c1 3300050490 Bacteria 1277
902 nmdc:mga03n38_438369_c1 3300050490 Bacteria 725
903 nmdc:mga03n38_522756_c1 3300050490 Bacteria 668
904 nmdc:mga03n38_879_c1 3300050490 Bacteria 8082
905 nmdc:mga00v17_212530_c1 3300050491 Bacteria 1252
906 nmdc:mga00v17_296458_c1 3300050491 Bacteria 1050
907 nmdc:mga00v17_79840_c1 3300050491 Bacteria 2041
908 nmdc:mga0yw44_141738_c1 3300050492 Bacteria 1563
909 nmdc:mga0yw44_206608_c1 3300050492 Bacteria 1298
910 nmdc:mga0yw44_41086_c1 3300050492 Bacteria 2751
911 nmdc:mga0yw44_697476_c1 3300050492 Bacteria 690
912 nmdc:mga0k408_504339_c1 3300050493 Bacteria 717
913 nmdc:mga06z11_387043_c1 3300050494 Bacteria 841
914 nmdc:mga06z11_425970_c1 3300050494 Bacteria 800
915 nmdc:mga04h51_113182_c1 3300050495 Bacteria 1003
916 nmdc:mga04h51_155132_c1 3300050495 Bacteria 877
917 nmdc:mga04h51_51228_c1 3300050495 Bacteria 1386
918 nmdc:mga07m45_14924_c3 3300050496 Bacteria 815
919 nmdc:mga07m45_15435_c1 3300050496 Bacteria 4078
920 nmdc:mga07m45_27449_c2 3300050496 Bacteria 2151
921 nmdc:mga07m45_470175_c1 3300050496 Bacteria 729
922 nmdc:mga05p37_204769_c1 3300050507 Bacteria 2387
923 nmdc:mga0qj67_788636_c1 3300050509 Bacteria 752
924 nmdc:mga08y16_172584_c1 3300050511 Bacteria 2246
925 nmdc:mga08y16_563261_c1 3300050511 Bacteria 1152
926 nmdc:mga0n895_207458_c1 3300050512 Bacteria 1990
927 nmdc:mga0n895_318403_c1 3300050512 Bacteria 1576
928 nmdc:mga0rr50_6187_c1 3300050513 Bacteria 7251
929 nmdc:mga0a205_586453_c1 3300050515 Bacteria 968
930 nmdc:mga0sz30_54510_c1 3300050516 Bacteria 1701
931 Ga0495601_0000669 3300053077 Bacteria 18279
932 Ga0495601_0038409 3300053077 Bacteria 2995
933 Ga0495601_0062625 3300053077 Bacteria 2363
934 Ga0495612_0000705 3300053078 Bacteria 13533
935 Ga0495612_0009691 3300053078 Bacteria 3902
936 Ga0495612_0046962 3300053078 Bacteria 1769
937 Ga0495612_0193636 3300053078 Bacteria 895
938 Ga0500610_0076687 3300053079 Bacteria 1743
939 Ga0500635_0116069 3300053080 Bacteria 998
940 Ga0495595_0002356 3300053084 Bacteria 7361
941 Ga0495595_0003182 3300053084 Bacteria 6513
942 Ga0495595_0062517 3300053084 Bacteria 1746
943 Ga0495595_0063936 3300053084 Bacteria 1728
944 Ga0495619_0001272 3300053085 Bacteria 16550
945 Ga0495619_0003981 3300053085 Bacteria 9472
946 Ga0495619_0005518 3300053085 Bacteria 8026
947 Ga0495619_0054575 3300053085 Bacteria 2645
948 Ga0495619_0082024 3300053085 Bacteria 2172
949 Ga0495619_0182542 3300053085 Bacteria 1452
950 Ga0495619_0247274 3300053085 Bacteria 1236
951 Ga0500578_0261975 3300053086 Bacteria 1038
952 Ga0500578_0277836 3300053086 Bacteria 1000
953 Ga0500643_071899 3300053087 Bacteria 959
954 Ga0500646_0114676 3300053090 Bacteria 860
955 Ga0500647_0057667 3300053091 Bacteria 1867
956 Ga0500583_0046518 3300053092 Bacteria 1996
957 Ga0500651_0012062 3300053093 Bacteria 5227
958 Ga0500651_0155903 3300053093 Bacteria 1368
959 Ga0500566_0023277 3300053094 Bacteria 3636
960 Ga0500566_0036289 3300053094 Bacteria 2860
961 Ga0500640_196022 3300053095 Bacteria 711
962 Ga0500641_0005790 3300053096 Bacteria 4377
963 Ga0500641_0009175 3300053096 Bacteria 3551
964 Ga0500648_319765 3300053097 Bacteria 662
965 Ga0500554_003144 3300053102 Bacteria 3340
966 Ga0500554_025708 3300053102 Bacteria 1683
967 Ga0500569_100380 3300053109 Bacteria 948
968 Ga0500572_006052 3300053111 Bacteria 2760
969 Ga0500595_001946 3300053119 Bacteria 10634
970 Ga0500595_003152 3300053119 Bacteria 7809
971 Ga0500595_003802 3300053119 Bacteria 6943
972 Ga0500595_031417 3300053119 Bacteria 1782
973 Ga0500608_043784 3300053122 Bacteria 2149
974 Ga0500614_008936 3300053123 Bacteria 2131
975 Ga0500621_105201 3300053126 Bacteria 1109
976 Ga0500642_0009138 3300053130 Bacteria 3424
977 Ga0500642_0147886 3300053130 Bacteria 1102
978 Ga0500652_000003 3300053131 Bacteria 221528
979 Ga0500655_023115 3300053133 Bacteria 1173
980 Ga0500658_0429950 3300053134 Bacteria 603
981 Ga0500559_0000429 3300053136 Bacteria 29737
982 Ga0500559_0100123 3300053136 Bacteria 1334
983 Ga0500561_0181401 3300053137 Bacteria 663
984 Ga0500577_0000233 3300053142 Bacteria 14734
985 Ga0500588_0082423 3300053146 Bacteria 1078
986 Ga0500589_027705 3300053147 Bacteria 2632
987 Ga0500589_297538 3300053147 Bacteria 572
988 Ga0500603_001397 3300053150 Bacteria 5511
989 Ga0500603_021048 3300053150 Bacteria 1600
990 Ga0500622_0245400 3300053156 Bacteria 789
991 Ga0500627_0268735 3300053158 Bacteria 751
992 Ga0500630_000205 3300053159 Bacteria 22843
993 Ga0500634_0080241 3300053161 Bacteria 1683
994 Ga0500638_002898 3300053162 Bacteria 6177
995 Ga0500638_087796 3300053162 Bacteria 1468
996 Ga0500639_000020 3300053163 Bacteria 102959
997 Ga0500636_0041125 3300053177 Bacteria 2734
998 Ga0500636_0415263 3300053177 Bacteria 619
999 Ga0500637_0000291 3300053178 Bacteria 18816
1000 Ga0500637_0011540 3300053178 Bacteria 4574
1001 Ga0500611_074263 3300053727 Bacteria 835
1002 Ga0500596_004671 3300053735 Bacteria 2491
1003 Ga0500601_002043 3300053737 Bacteria 2168
1004 Ga0501084_0011693 3300054114 Bacteria 7266
1005 Ga0501084_0493557 3300054114 Bacteria 1035
1006 Ga0500661_004256 3300055283 Bacteria 2676
1007 Ga0501082_0008641 3300060353 Bacteria 8781

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006028 Ga0070717_10956987 Ga0070717_109569872 155
2 3300007265 Ga0099794_10348372 Ga0099794_103483721 156
3 3300005455 Ga0070663_100011372 Ga0070663_1000113722 157
4 3300035695 Ga0373927_0087741 Ga0373927_0087741_22_498 157
5 3300046477 Ga0495664_0228519 Ga0495664_0228519_240_713 157
6 3300048906 Ga0496103_0386032 Ga0496103_0386032_13_486 157
7 3300048912 Ga0496109_1110391 Ga0496109_1110391_66_539 157
8 3300048915 Ga0496112_0678446 Ga0496112_0678446_92_604 157
9 3300005347 Ga0070668_100801997 Ga0070668_1008019971 158
10 3300006358 Ga0068871_100292080 Ga0068871_1002920802 158
11 3300009101 Ga0105247_10055868 Ga0105247_100558682 158
12 3300025900 Ga0207710_10347655 Ga0207710_103476551 158
13 3300025972 Ga0207668_11035692 Ga0207668_110356923 158
14 3300026035 Ga0207703_10526902 Ga0207703_105269023 158
15 3300026035 Ga0207703_11477916 Ga0207703_114779162 158
16 3300046616 Ga0495668_0268273 Ga0495668_0268273_386_862 158
17 3300053096 Ga0500641_0009175 Ga0500641_0009175_158_670 158
18 3300021377 Ga0213874_10032895 Ga0213874_100328952 159
19 3300035692 Ga0373935_0817078 Ga0373935_0817078_41_553 159
20 3300048917 Ga0496114_0234728 Ga0496114_0234728_96_608 159
21 iso_pu_bacteria 2517093001 2517102583 159
22 iso_pu_bacteria 2841957949 2841961016 159
23 iso_pu_bacteria 8056673599 8056676973 159
24 3300025939 Ga0207665_10366057 Ga0207665_103660572 160
25 3300039437 Ga0436365_0510664 Ga0436365_0510664_54_536 160
26 3300048914 Ga0496111_0480752 Ga0496111_0480752_303_785 160
27 iso_pu_bacteria 8006926726 8006931029 160
28 3300047315 Ga0495581_0452719 Ga0495581_0452719_240_725 161
29 3300049572 Ga0501036_0254617 Ga0501036_0254617_576_1064 161
30 3300049581 Ga0501047_0030357 Ga0501047_0030357_43_531 161
31 3300005563 Ga0068855_101271620 Ga0068855_1012716202 162
32 3300031616 Ga0307508_10001469 Ga0307508_1000146914 162
33 3300031616 Ga0307508_10293192 Ga0307508_102931922 163
34 3300031730 Ga0307516_10203791 Ga0307516_102037912 163
35 3300037312 Ga0395899_0137482 Ga0395899_0137482_342_833 163
36 3300037418 Ga0395900_0000820 Ga0395900_0000820_22866_23357 163
37 3300037418 Ga0395900_0181596 Ga0395900_0181596_1350_1841 163
38 3300037466 Ga0395898_0114094 Ga0395898_0114094_165_656 163
39 3300037471 Ga0395905_0399577 Ga0395905_0399577_709_1200 163
40 3300038443 Ga0395901_0102492 Ga0395901_0102492_877_1368 163
41 3300045976 Ga0466967_0840694 Ga0466967_0840694_26_517 163
42 3300048927 Ga0496124_0139856 Ga0496124_0139856_198_698 163
43 3300048929 Ga0496126_0926954 Ga0496126_0926954_132_632 163
44 3300005435 Ga0070714_100660522 Ga0070714_1006605222 164
45 3300005436 Ga0070713_100039665 Ga0070713_1000396652 164
46 3300006028 Ga0070717_10292710 Ga0070717_102927102 164
47 3300009093 Ga0105240_10250832 Ga0105240_102508322 164
48 3300009545 Ga0105237_10274405 Ga0105237_102744052 164
49 3300013104 Ga0157370_10123619 Ga0157370_101236192 164
50 3300013105 Ga0157369_10019914 Ga0157369_100199145 164
51 3300013105 Ga0157369_12342463 Ga0157369_123424631 164
52 3300020070 Ga0206356_10635911 Ga0206356_106359112 164
53 3300020082 Ga0206353_11349222 Ga0206353_113492221 164
54 3300021384 Ga0213876_10444740 Ga0213876_104447402 164
55 3300025904 Ga0207647_10366516 Ga0207647_103665162 164
56 3300025913 Ga0207695_10150869 Ga0207695_101508692 164
57 3300025928 Ga0207700_10156116 Ga0207700_101561162 164
58 3300025929 Ga0207664_10457103 Ga0207664_104571032 164
59 3300037312 Ga0395899_0089491 Ga0395899_0089491_1407_1901 164
60 3300039437 Ga0436365_0609277 Ga0436365_0609277_140_634 164
61 3300046477 Ga0495664_0055223 Ga0495664_0055223_58_552 164
62 3300048929 Ga0496126_0028827 Ga0496126_0028827_2551_3045 164
63 3300053096 Ga0500641_0005790 Ga0500641_0005790_1814_2326 164
64 3300005467 Ga0070706_100757426 Ga0070706_1007574262 165
65 3300005536 Ga0070697_100081138 Ga0070697_1000811382 165
66 3300038443 Ga0395901_0051601 Ga0395901_0051601_3704_4201 165
67 3300048929 Ga0496126_0585165 Ga0496126_0585165_181_678 165
68 iso_pu_bacteria 2791355199 2793080586 165
69 iso_pu_bacteria 2889033259 2889039361 165
70 3300003203 JGI25406J46586_10020277 JGI25406J46586_100202771 166
71 3300005530 Ga0070679_100178201 Ga0070679_1001782012 166
72 3300005530 Ga0070679_100925303 Ga0070679_1009253031 166
73 3300005985 Ga0081539_10006975 Ga0081539_100069757 166
74 3300006038 Ga0075365_10051655 Ga0075365_100516552 166
75 3300006871 Ga0075434_100205639 Ga0075434_1002056392 166
76 3300007076 Ga0075435_100085340 Ga0075435_1000853402 166
77 3300009551 Ga0105238_10479435 Ga0105238_104794353 166
78 3300024227 Ga0228598_1074783 Ga0228598_10747832 166
79 3300025921 Ga0207652_11577688 Ga0207652_115776881 166
80 3300028556 Ga0265337_1012602 Ga0265337_10126024 166
81 3300028558 Ga0265326_10008399 Ga0265326_100083993 166
82 3300028563 Ga0265319_1006169 Ga0265319_10061693 166
83 3300028573 Ga0265334_10015261 Ga0265334_100152615 166
84 3300028577 Ga0265318_10008945 Ga0265318_100089453 166
85 3300028653 Ga0265323_10002476 Ga0265323_100024766 166
86 3300028666 Ga0265336_10000431 Ga0265336_1000043122 166
87 3300028800 Ga0265338_10000321 Ga0265338_1000032166 166
88 3300029957 Ga0265324_10006568 Ga0265324_100065682 166
89 3300035086 Ga0373934_0161369 Ga0373934_0161369_329_835 166
90 3300035113 Ga0373936_0056361 Ga0373936_0056361_425_931 166
91 3300035170 Ga0373943_0002164 Ga0373943_0002164_7671_8177 166
92 3300035171 Ga0373946_0013431 Ga0373946_0013431_2283_2789 166
93 3300035172 Ga0373955_0130494 Ga0373955_0130494_703_1209 166
94 3300035410 Ga0373924_0073751 Ga0373924_0073751_575_1081 166
95 3300035692 Ga0373935_0010424 Ga0373935_0010424_1753_2259 166
96 3300035695 Ga0373927_0002108 Ga0373927_0002108_4621_5127 166
97 3300035725 Ga0373947_0003597 Ga0373947_0003597_69_575 166
98 3300037068 Ga0373925_0006241 Ga0373925_0006241_1795_2301 166
99 3300037068 Ga0373925_0051335 Ga0373925_0051335_2521_3027 166
100 3300039438 Ga0436360_0947574 Ga0436360_0947574_899_1399 166
101 3300046463 Ga0495653_0035879 Ga0495653_0035879_1226_1732 166
102 3300046472 Ga0495580_0075345 Ga0495580_0075345_104_610 166
103 3300046476 Ga0495662_0001286 Ga0495662_0001286_2343_2849 166
104 3300046477 Ga0495664_0000270 Ga0495664_0000270_14111_14617 166
105 3300046514 Ga0495618_0001241 Ga0495618_0001241_14244_14750 166
106 3300046516 Ga0495628_0435215 Ga0495628_0435215_148_654 166
107 3300046526 Ga0495666_0025780 Ga0495666_0025780_1013_1519 166
108 3300046531 Ga0495665_0005893 Ga0495665_0005893_5420_5926 166
109 3300046533 Ga0495640_0008255 Ga0495640_0008255_2278_2784 166
110 3300046533 Ga0495640_0038540 Ga0495640_0038540_326_832 166
111 3300046535 Ga0495586_0109545 Ga0495586_0109545_242_748 166
112 3300046543 Ga0495645_0007214 Ga0495645_0007214_6232_6738 166
113 3300046642 Ga0495634_0043498 Ga0495634_0043498_2521_3027 166
114 3300046663 Ga0495635_0001564 Ga0495635_0001564_12369_12875 166
115 3300046680 Ga0495646_0026783 Ga0495646_0026783_1232_1738 166
116 3300046689 Ga0495613_0017331 Ga0495613_0017331_1761_2267 166
117 3300046690 Ga0495624_0013947 Ga0495624_0013947_3250_3756 166
118 3300047315 Ga0495581_0036031 Ga0495581_0036031_674_1180 166
119 3300047317 Ga0495604_0119901 Ga0495604_0119901_1184_1690 166
120 3300047319 Ga0495674_0002806 Ga0495674_0002806_2872_3378 166
121 3300047321 Ga0495676_0127854 Ga0495676_0127854_524_1030 166
122 3300047471 Ga0495684_0002851 Ga0495684_0002851_9834_10340 166
123 3300047471 Ga0495684_0004084 Ga0495684_0004084_269_775 166
124 3300047673 Ga0495593_0071261 Ga0495593_0071261_662_1168 166
125 3300048089 Ga0495614_0084256 Ga0495614_0084256_402_908 166
126 3300049568 Ga0501031_0004192 Ga0501031_0004192_7805_8305 166
127 3300049569 Ga0501032_0000216 Ga0501032_0000216_11323_11823 166
128 3300049570 Ga0501033_0000344 Ga0501033_0000344_24974_25474 166
129 3300049571 Ga0501034_0000100 Ga0501034_0000100_71721_72221 166
130 3300049572 Ga0501036_0000010 Ga0501036_0000010_13650_14150 166
131 3300049573 Ga0501037_0000704 Ga0501037_0000704_16298_16798 166
132 3300049574 Ga0501038_0000350 Ga0501038_0000350_37274_37774 166
133 3300049575 Ga0501039_0001013 Ga0501039_0001013_13740_14240 166
134 3300049578 Ga0501042_0046127 Ga0501042_0046127_1777_2277 166
135 3300049579 Ga0501043_0000106 Ga0501043_0000106_20935_21435 166
136 3300049580 Ga0501046_0008451 Ga0501046_0008451_3750_4250 166
137 3300049581 Ga0501047_0000493 Ga0501047_0000493_23691_24191 166
138 3300049582 Ga0501048_0000233 Ga0501048_0000233_10302_10802 166
139 3300049583 Ga0501067_0000098 Ga0501067_0000098_10292_10792 166
140 3300049584 Ga0501068_0001545 Ga0501068_0001545_224_724 166
141 3300049585 Ga0501069_0013785 Ga0501069_0013785_133_633 166
142 3300049586 Ga0501070_0013036 Ga0501070_0013036_4089_4589 166
143 3300049588 Ga0501072_0014911 Ga0501072_0014911_328_828 166
144 3300049589 Ga0501073_0002056 Ga0501073_0002056_9640_10140 166
145 3300049589 Ga0501073_0234204 Ga0501073_0234204_228_728 166
146 3300049590 Ga0501074_0000382 Ga0501074_0000382_21142_21642 166
147 3300049592 Ga0501076_0878615 Ga0501076_0878615_124_624 166
148 3300049741 Ga0501079_0003159 Ga0501079_0003159_692_1192 166
149 3300049742 Ga0501080_0001033 Ga0501080_0001033_13229_13729 166
150 3300049743 Ga0501081_0421035 Ga0501081_0421035_385_885 166
151 3300049744 Ga0501083_0000116 Ga0501083_0000116_18719_19219 166
152 3300049822 Ga0501035_0000496 Ga0501035_0000496_30719_31219 166
153 3300049823 Ga0501044_0000857 Ga0501044_0000857_17156_17656 166
154 3300049823 Ga0501044_0929485 Ga0501044_0929485_183_686 166
155 3300049824 Ga0501045_0009479 Ga0501045_0009479_4451_4951 166
156 3300050512 nmdc:mga0n895_207458_c1 nmdc:mga0n895_207458_c1_1134_1637 166
157 3300050513 nmdc:mga0rr50_6187_c1 nmdc:mga0rr50_6187_c1_1399_1902 166
158 3300053077 Ga0495601_0000669 Ga0495601_0000669_6219_6725 166
159 3300053078 Ga0495612_0000705 Ga0495612_0000705_8151_8657 166
160 3300053085 Ga0495619_0005518 Ga0495619_0005518_6172_6678 166
161 3300054114 Ga0501084_0011693 Ga0501084_0011693_2213_2713 166
162 3300060353 Ga0501082_0008641 Ga0501082_0008641_1744_2244 166
163 iso_pu_bacteria 2513237098 2513676621 166
164 iso_pu_bacteria 2513237141 2513889982 166
165 iso_pu_bacteria 2524023210 2524471052 166
166 iso_pu_bacteria 2721755755 2723846590 166
167 iso_pu_bacteria 2874604998 2874605630 166
168 iso_pu_bacteria 2876808645 2876814672 166
169 iso_pu_bacteria 2879110137 2879115918 166
170 iso_pu_bacteria 2885383462 2885389424 166
171 iso_pu_bacteria 2903768456 2903771896 166
172 iso_pu_bacteria 2922361189 2922365791 166
173 iso_pu_bacteria 8006964411 8006969715 166
174 iso_pu_bacteria 8006984368 8006987841 166
175 iso_pu_bacteria 8056681323 8056689269 166
176 3300003752 Ga0055539_1006928 Ga0055539_10069282 167
177 3300005985 Ga0081539_10026746 Ga0081539_100267462 167
178 3300006028 Ga0070717_10047832 Ga0070717_100478322 167
179 3300009177 Ga0105248_10464772 Ga0105248_104647722 167
180 3300009551 Ga0105238_10150745 Ga0105238_101507453 167
181 3300010375 Ga0105239_10056258 Ga0105239_100562585 167
182 3300013297 Ga0157378_10345217 Ga0157378_103452172 167
183 3300025253 Ga0209677_102539 Ga0209677_1025396 167
184 3300025928 Ga0207700_10466593 Ga0207700_104665933 167
185 3300036459 Ga0372808_034869 Ga0372808_034869_122_625 167
186 3300039437 Ga0436365_0103592 Ga0436365_0103592_56_559 167
187 3300039437 Ga0436365_1617397 Ga0436365_1617397_127_630 167
188 3300039450 Ga0436363_1200350 Ga0436363_1200350_318_821 167
189 3300044684 Ga0466966_0057074 Ga0466966_0057074_1661_2176 167
190 3300044735 Ga0466968_0383344 Ga0466968_0383344_134_649 167
191 3300045049 Ga0466959_0159592 Ga0466959_0159592_267_782 167
192 3300048911 Ga0496108_0789013 Ga0496108_0789013_197_700 167
193 3300048928 Ga0496125_0000060 Ga0496125_0000060_101652_102164 167
194 3300048928 Ga0496125_0000838 Ga0496125_0000838_32856_33368 167
195 3300048928 Ga0496125_0096787 Ga0496125_0096787_734_1237 167
196 3300048928 Ga0496125_0124092 Ga0496125_0124092_618_1121 167
197 3300053091 Ga0500647_0057667 Ga0500647_0057667_1073_1576 167
198 3300053094 Ga0500566_0036289 Ga0500566_0036289_694_1197 167
199 3300053095 Ga0500640_196022 Ga0500640_196022_134_637 167
200 3300053097 Ga0500648_319765 Ga0500648_319765_31_534 167
201 3300053111 Ga0500572_006052 Ga0500572_006052_677_1180 167
202 3300053122 Ga0500608_043784 Ga0500608_043784_986_1489 167
203 3300053123 Ga0500614_008936 Ga0500614_008936_261_764 167
204 3300053136 Ga0500559_0000429 Ga0500559_0000429_20545_21048 167
205 3300053142 Ga0500577_0000233 Ga0500577_0000233_9021_9527 167
206 3300053150 Ga0500603_001397 Ga0500603_001397_650_1153 167
207 3300053159 Ga0500630_000205 Ga0500630_000205_5977_6480 167
208 3300053162 Ga0500638_087796 Ga0500638_087796_125_628 167
209 3300053163 Ga0500639_000020 Ga0500639_000020_37552_38055 167
210 3300053735 Ga0500596_004671 Ga0500596_004671_347_850 167
211 3300053737 Ga0500601_002043 Ga0500601_002043_454_957 167
212 3300003659 JGI25404J52841_10010652 JGI25404J52841_100106521 168
213 3300005334 Ga0068869_100338894 Ga0068869_1003388941 168
214 3300005347 Ga0070668_100302823 Ga0070668_1003028231 168
215 3300005434 Ga0070709_10762168 Ga0070709_107621682 168
216 3300005437 Ga0070710_10206587 Ga0070710_102065872 168
217 3300005439 Ga0070711_100026775 Ga0070711_1000267753 168
218 3300005563 Ga0068855_100277369 Ga0068855_1002773692 168
219 3300005718 Ga0068866_10697487 Ga0068866_106974872 168
220 3300005719 Ga0068861_100833876 Ga0068861_1008338762 168
221 3300005937 Ga0081455_10038749 Ga0081455_100387493 168
222 3300005937 Ga0081455_10094202 Ga0081455_100942023 168
223 3300005937 Ga0081455_10210767 Ga0081455_102107672 168
224 3300005983 Ga0081540_1002935 Ga0081540_100293514 168
225 3300005983 Ga0081540_1006783 Ga0081540_10067838 168
226 3300005983 Ga0081540_1007771 Ga0081540_10077715 168
227 3300005983 Ga0081540_1014845 Ga0081540_10148455 168
228 3300005983 Ga0081540_1047770 Ga0081540_10477703 168
229 3300005983 Ga0081540_1061237 Ga0081540_10612373 168
230 3300005983 Ga0081540_1075943 Ga0081540_10759433 168
231 3300006175 Ga0070712_100026911 Ga0070712_1000269113 168
232 3300006881 Ga0068865_100383665 Ga0068865_1003836652 168
233 3300009176 Ga0105242_10102286 Ga0105242_101022863 168
234 3300025911 Ga0207654_10077443 Ga0207654_100774431 168
235 3300025915 Ga0207693_10016029 Ga0207693_100160293 168
236 3300025916 Ga0207663_10008904 Ga0207663_100089043 168
237 3300025938 Ga0207704_10324428 Ga0207704_103244283 168
238 3300025939 Ga0207665_10085571 Ga0207665_100855713 168
239 3300025939 Ga0207665_10571813 Ga0207665_105718132 168
240 3300025942 Ga0207689_10311396 Ga0207689_103113963 168
241 3300035116 Ga0373945_0243287 Ga0373945_0243287_34_540 168
242 3300035695 Ga0373927_0113572 Ga0373927_0113572_600_1106 168
243 3300035725 Ga0373947_0024113 Ga0373947_0024113_344_850 168
244 3300037068 Ga0373925_0047807 Ga0373925_0047807_1319_1825 168
245 3300046472 Ga0495580_0135889 Ga0495580_0135889_664_1170 168
246 3300046507 Ga0495606_0130863 Ga0495606_0130863_569_1075 168
247 3300046518 Ga0495631_0286002 Ga0495631_0286002_98_604 168
248 3300046615 Ga0495656_0236232 Ga0495656_0236232_27_533 168
249 3300046674 Ga0495588_0358914 Ga0495588_0358914_67_573 168
250 3300048903 Ga0496100_0110399 Ga0496100_0110399_1233_1739 168
251 3300048904 Ga0496101_0194247 Ga0496101_0194247_380_886 168
252 3300048909 Ga0496106_0069840 Ga0496106_0069840_438_944 168
253 3300048917 Ga0496114_0256196 Ga0496114_0256196_677_1183 168
254 3300048917 Ga0496114_0581675 Ga0496114_0581675_36_542 168
255 3300048918 Ga0496115_0206686 Ga0496115_0206686_858_1364 168
256 3300048929 Ga0496126_0041794 Ga0496126_0041794_141_647 168
257 3300048929 Ga0496126_0141964 Ga0496126_0141964_22_528 168
258 3300048929 Ga0496126_0378151 Ga0496126_0378151_75_584 168
259 3300005331 Ga0070670_100905277 Ga0070670_1009052771 169
260 3300005334 Ga0068869_101263053 Ga0068869_1012630531 169
261 3300005336 Ga0070680_100022952 Ga0070680_1000229525 169
262 3300005366 Ga0070659_100170860 Ga0070659_1001708602 169
263 3300005456 Ga0070678_100228987 Ga0070678_1002289872 169
264 3300005456 Ga0070678_100762777 Ga0070678_1007627771 169
265 3300005539 Ga0068853_100579505 Ga0068853_1005795052 169
266 3300005543 Ga0070672_100601055 Ga0070672_1006010552 169
267 3300005563 Ga0068855_100060251 Ga0068855_1000602511 169
268 3300005563 Ga0068855_100066133 Ga0068855_1000661335 169
269 3300005577 Ga0068857_101579541 Ga0068857_1015795411 169
270 3300005614 Ga0068856_100563789 Ga0068856_1005637892 169
271 3300005615 Ga0070702_100089777 Ga0070702_1000897771 169
272 3300005616 Ga0068852_100600657 Ga0068852_1006006572 169
273 3300005840 Ga0068870_10354276 Ga0068870_103542763 169
274 3300005842 Ga0068858_100449392 Ga0068858_1004493922 169
275 3300005843 Ga0068860_101955983 Ga0068860_1019559831 169
276 3300005937 Ga0081455_10031420 Ga0081455_100314202 169
277 3300006038 Ga0075365_10270849 Ga0075365_102708492 169
278 3300006048 Ga0075363_100645583 Ga0075363_1006455832 169
279 3300006237 Ga0097621_100353294 Ga0097621_1003532943 169
280 3300006237 Ga0097621_100596997 Ga0097621_1005969972 169
281 3300006237 Ga0097621_101289526 Ga0097621_1012895261 169
282 3300006358 Ga0068871_100942207 Ga0068871_1009422073 169
283 3300007788 Ga0099795_10031943 Ga0099795_100319432 169
284 3300009101 Ga0105247_10280664 Ga0105247_102806643 169
285 3300009148 Ga0105243_10502835 Ga0105243_105028351 169
286 3300009176 Ga0105242_10158779 Ga0105242_101587792 169
287 3300009177 Ga0105248_11131272 Ga0105248_111312722 169
288 3300009545 Ga0105237_10250684 Ga0105237_102506843 169
289 3300009545 Ga0105237_10627059 Ga0105237_106270592 169
290 3300009553 Ga0105249_10686765 Ga0105249_106867652 169
291 3300010159 Ga0099796_10059049 Ga0099796_100590491 169
292 3300010375 Ga0105239_10368977 Ga0105239_103689772 169
293 3300010375 Ga0105239_11953304 Ga0105239_119533042 169
294 3300011119 Ga0105246_10151843 Ga0105246_101518432 169
295 3300011119 Ga0105246_10588549 Ga0105246_105885493 169
296 3300013104 Ga0157370_10661840 Ga0157370_106618402 169
297 3300013105 Ga0157369_10355342 Ga0157369_103553423 169
298 3300013297 Ga0157378_10683305 Ga0157378_106833052 169
299 3300013306 Ga0163162_10613531 Ga0163162_106135312 169
300 3300013306 Ga0163162_11468530 Ga0163162_114685301 169
301 3300014325 Ga0163163_10564432 Ga0163163_105644322 169
302 3300017792 Ga0163161_10172373 Ga0163161_101723732 169
303 3300017792 Ga0163161_10480778 Ga0163161_104807783 169
304 3300025907 Ga0207645_10102294 Ga0207645_101022942 169
305 3300025914 Ga0207671_10423586 Ga0207671_104235862 169
306 3300025917 Ga0207660_10096383 Ga0207660_100963832 169
307 3300025925 Ga0207650_10648728 Ga0207650_106487283 169
308 3300025932 Ga0207690_10048739 Ga0207690_100487393 169
309 3300025941 Ga0207711_10351041 Ga0207711_103510411 169
310 3300025942 Ga0207689_10777519 Ga0207689_107775191 169
311 3300025949 Ga0207667_10594352 Ga0207667_105943523 169
312 3300025972 Ga0207668_10697619 Ga0207668_106976192 169
313 3300026041 Ga0207639_10389903 Ga0207639_103899032 169
314 3300026078 Ga0207702_10501271 Ga0207702_105012712 169
315 3300026089 Ga0207648_10551587 Ga0207648_105515872 169
316 3300026121 Ga0207683_10021347 Ga0207683_100213472 169
317 3300026121 Ga0207683_10641244 Ga0207683_106412442 169
318 3300028379 Ga0268266_10251536 Ga0268266_102515362 169
319 3300028380 Ga0268265_10498035 Ga0268265_104980353 169
320 3300028786 Ga0307517_10000008 Ga0307517_10000008203 169
321 3300028794 Ga0307515_10142057 Ga0307515_101420572 169
322 3300031344 Ga0265316_10112992 Ga0265316_101129922 169
323 3300031456 Ga0307513_10303766 Ga0307513_103037662 169
324 3300031456 Ga0307513_10309623 Ga0307513_103096233 169
325 3300031548 Ga0307408_100152852 Ga0307408_1001528523 169
326 3300031616 Ga0307508_10052684 Ga0307508_100526842 169
327 3300031730 Ga0307516_10017964 Ga0307516_100179642 169
328 3300031730 Ga0307516_10040779 Ga0307516_100407795 169
329 3300032005 Ga0307411_10346930 Ga0307411_103469302 169
330 3300032126 Ga0307415_100417269 Ga0307415_1004172692 169
331 3300033180 Ga0307510_10215430 Ga0307510_102154302 169
332 3300035092 Ga0373952_0114722 Ga0373952_0114722_62_571 169
333 3300035115 Ga0373941_0096687 Ga0373941_0096687_435_944 169
334 3300035171 Ga0373946_0482912 Ga0373946_0482912_86_595 169
335 3300035691 Ga0373931_0001282 Ga0373931_0001282_4396_4905 169
336 3300035725 Ga0373947_0584674 Ga0373947_0584674_52_561 169
337 3300036401 Ga0373937_0791555 Ga0373937_0791555_185_694 169
338 3300037068 Ga0373925_0518173 Ga0373925_0518173_15_524 169
339 3300037466 Ga0395898_0309154 Ga0395898_0309154_633_1142 169
340 3300037466 Ga0395898_0321370 Ga0395898_0321370_624_1136 169
341 3300037471 Ga0395905_0761596 Ga0395905_0761596_306_818 169
342 3300037471 Ga0395905_0779759 Ga0395905_0779759_283_792 169
343 3300038443 Ga0395901_1391837 Ga0395901_1391837_124_636 169
344 3300039438 Ga0436360_0202328 Ga0436360_0202328_2538_3047 169
345 3300039438 Ga0436360_0310567 Ga0436360_0310567_37_546 169
346 3300039438 Ga0436360_0593081 Ga0436360_0593081_625_1134 169
347 3300039438 Ga0436360_1159963 Ga0436360_1159963_52_561 169
348 3300039438 Ga0436360_1365633 Ga0436360_1365633_43_555 169
349 3300039447 Ga0436361_0023933 Ga0436361_0023933_1114_1623 169
350 3300044684 Ga0466966_0229282 Ga0466966_0229282_498_1007 169
351 3300046460 Ga0495638_0455007 Ga0495638_0455007_109_618 169
352 3300046477 Ga0495664_0094961 Ga0495664_0094961_69_578 169
353 3300046507 Ga0495606_0193050 Ga0495606_0193050_56_565 169
354 3300046517 Ga0495630_0235212 Ga0495630_0235212_12_521 169
355 3300046537 Ga0495598_0343710 Ga0495598_0343710_10_519 169
356 3300046543 Ga0495645_0378859 Ga0495645_0378859_111_620 169
357 3300046559 Ga0495667_0113143 Ga0495667_0113143_897_1406 169
358 3300046675 Ga0495657_0258231 Ga0495657_0258231_349_858 169
359 3300046684 Ga0495669_0108934 Ga0495669_0108934_667_1176 169
360 3300047319 Ga0495674_0907565 Ga0495674_0907565_59_568 169
361 3300047320 Ga0495672_0036995 Ga0495672_0036995_1414_1923 169
362 3300047320 Ga0495672_0064097 Ga0495672_0064097_34_543 169
363 3300048903 Ga0496100_0417110 Ga0496100_0417110_215_724 169
364 3300048904 Ga0496101_0333774 Ga0496101_0333774_250_759 169
365 3300048905 Ga0496102_0191576 Ga0496102_0191576_557_1066 169
366 3300048907 Ga0496104_1126915 Ga0496104_1126915_90_599 169
367 3300048908 Ga0496105_0079259 Ga0496105_0079259_183_692 169
368 3300048910 Ga0496107_0253210 Ga0496107_0253210_22_531 169
369 3300048911 Ga0496108_0181500 Ga0496108_0181500_1122_1631 169
370 3300048912 Ga0496109_1079124 Ga0496109_1079124_93_602 169
371 3300048913 Ga0496110_0260504 Ga0496110_0260504_557_1066 169
372 3300048914 Ga0496111_0188051 Ga0496111_0188051_171_680 169
373 3300048916 Ga0496113_0253806 Ga0496113_0253806_370_879 169
374 3300048916 Ga0496113_0395239 Ga0496113_0395239_276_785 169
375 3300048918 Ga0496115_0008261 Ga0496115_0008261_451_960 169
376 3300048918 Ga0496115_0074212 Ga0496115_0074212_1180_1689 169
377 3300048918 Ga0496115_1164900 Ga0496115_1164900_18_527 169
378 3300048920 Ga0496117_0049280 Ga0496117_0049280_77_586 169
379 3300048921 Ga0496118_0214194 Ga0496118_0214194_50_559 169
380 3300048924 Ga0496121_0002279 Ga0496121_0002279_2831_3340 169
381 3300048924 Ga0496121_0184644 Ga0496121_0184644_19_531 169
382 3300048929 Ga0496126_0050977 Ga0496126_0050977_504_1013 169
383 3300049568 Ga0501031_0260182 Ga0501031_0260182_71_580 169
384 3300049591 Ga0501075_0347285 Ga0501075_0347285_381_890 169
385 3300049592 Ga0501076_0216016 Ga0501076_0216016_41_550 169
386 3300050490 nmdc:mga03n38_123037_c1 nmdc:mga03n38_123037_c1_174_683 169
387 3300050490 nmdc:mga03n38_522756_c1 nmdc:mga03n38_522756_c1_26_535 169
388 3300050492 nmdc:mga0yw44_697476_c1 nmdc:mga0yw44_697476_c1_141_650 169
389 3300050495 nmdc:mga04h51_155132_c1 nmdc:mga04h51_155132_c1_344_853 169
390 3300053077 Ga0495601_0062625 Ga0495601_0062625_787_1296 169
391 3300053079 Ga0500610_0076687 Ga0500610_0076687_550_1059 169
392 3300053084 Ga0495595_0062517 Ga0495595_0062517_825_1334 169
393 3300053085 Ga0495619_0054575 Ga0495619_0054575_537_1046 169
394 3300053085 Ga0495619_0182542 Ga0495619_0182542_660_1169 169
395 3300053085 Ga0495619_0247274 Ga0495619_0247274_55_564 169
396 3300053086 Ga0500578_0261975 Ga0500578_0261975_366_875 169
397 3300053093 Ga0500651_0012062 Ga0500651_0012062_252_761 169
398 3300053093 Ga0500651_0155903 Ga0500651_0155903_795_1304 169
399 3300053119 Ga0500595_003802 Ga0500595_003802_2306_2815 169
400 3300053119 Ga0500595_031417 Ga0500595_031417_1091_1600 169
401 3300053130 Ga0500642_0009138 Ga0500642_0009138_171_680 169
402 3300053131 Ga0500652_000003 Ga0500652_000003_35446_35958 169
403 3300053136 Ga0500559_0100123 Ga0500559_0100123_667_1179 169
404 3300053156 Ga0500622_0245400 Ga0500622_0245400_184_693 169
405 3300053158 Ga0500627_0268735 Ga0500627_0268735_17_526 169
406 3300053177 Ga0500636_0415263 Ga0500636_0415263_79_591 169
407 3300054114 Ga0501084_0493557 Ga0501084_0493557_117_626 169
408 3300000549 LJQas_1009230 LJQas_10092303 170
409 3300005327 Ga0070658_10079749 Ga0070658_100797493 170
410 3300005328 Ga0070676_10442116 Ga0070676_104421161 170
411 3300005329 Ga0070683_100017979 Ga0070683_1000179796 170
412 3300005331 Ga0070670_100153645 Ga0070670_1001536452 170
413 3300005331 Ga0070670_100956994 Ga0070670_1009569941 170
414 3300005334 Ga0068869_100032826 Ga0068869_1000328264 170
415 3300005334 Ga0068869_100427552 Ga0068869_1004275521 170
416 3300005336 Ga0070680_100102180 Ga0070680_1001021803 170
417 3300005338 Ga0068868_100196332 Ga0068868_1001963322 170
418 3300005338 Ga0068868_101532967 Ga0068868_1015329671 170
419 3300005339 Ga0070660_100009001 Ga0070660_1000090018 170
420 3300005339 Ga0070660_100675138 Ga0070660_1006751382 170
421 3300005347 Ga0070668_100044429 Ga0070668_1000444292 170
422 3300005347 Ga0070668_100053645 Ga0070668_1000536452 170
423 3300005347 Ga0070668_100095017 Ga0070668_1000950172 170
424 3300005347 Ga0070668_100340656 Ga0070668_1003406561 170
425 3300005353 Ga0070669_100573768 Ga0070669_1005737682 170
426 3300005353 Ga0070669_100832367 Ga0070669_1008323672 170
427 3300005354 Ga0070675_100198699 Ga0070675_1001986992 170
428 3300005354 Ga0070675_100250222 Ga0070675_1002502222 170
429 3300005365 Ga0070688_100989195 Ga0070688_1009891951 170
430 3300005367 Ga0070667_100252611 Ga0070667_1002526111 170
431 3300005367 Ga0070667_100830631 Ga0070667_1008306312 170
432 3300005434 Ga0070709_10041150 Ga0070709_100411502 170
433 3300005434 Ga0070709_10505077 Ga0070709_105050772 170
434 3300005435 Ga0070714_100017014 Ga0070714_1000170142 170
435 3300005436 Ga0070713_100039634 Ga0070713_1000396345 170
436 3300005436 Ga0070713_100166809 Ga0070713_1001668092 170
437 3300005436 Ga0070713_100301108 Ga0070713_1003011082 170
438 3300005437 Ga0070710_10758149 Ga0070710_107581492 170
439 3300005439 Ga0070711_100129721 Ga0070711_1001297212 170
440 3300005439 Ga0070711_100344350 Ga0070711_1003443501 170
441 3300005439 Ga0070711_100533295 Ga0070711_1005332953 170
442 3300005439 Ga0070711_100568053 Ga0070711_1005680531 170
443 3300005440 Ga0070705_100055731 Ga0070705_1000557312 170
444 3300005441 Ga0070700_100787003 Ga0070700_1007870031 170
445 3300005444 Ga0070694_100091570 Ga0070694_1000915702 170
446 3300005445 Ga0070708_100037436 Ga0070708_1000374363 170
447 3300005455 Ga0070663_100118799 Ga0070663_1001187992 170
448 3300005455 Ga0070663_100250373 Ga0070663_1002503732 170
449 3300005455 Ga0070663_101540614 Ga0070663_1015406141 170
450 3300005456 Ga0070678_100081317 Ga0070678_1000813172 170
451 3300005456 Ga0070678_100308280 Ga0070678_1003082802 170
452 3300005456 Ga0070678_100360525 Ga0070678_1003605251 170
453 3300005456 Ga0070678_100427483 Ga0070678_1004274832 170
454 3300005457 Ga0070662_100136853 Ga0070662_1001368532 170
455 3300005457 Ga0070662_100262846 Ga0070662_1002628462 170
456 3300005458 Ga0070681_10090433 Ga0070681_100904333 170
457 3300005459 Ga0068867_100223802 Ga0068867_1002238022 170
458 3300005459 Ga0068867_101310722 Ga0068867_1013107221 170
459 3300005467 Ga0070706_100092751 Ga0070706_1000927512 170
460 3300005468 Ga0070707_100341021 Ga0070707_1003410211 170
461 3300005471 Ga0070698_100121433 Ga0070698_1001214332 170
462 3300005518 Ga0070699_100067546 Ga0070699_1000675462 170
463 3300005535 Ga0070684_100017565 Ga0070684_1000175655 170
464 3300005536 Ga0070697_100136263 Ga0070697_1001362632 170
465 3300005539 Ga0068853_100003512 Ga0068853_1000035129 170
466 3300005539 Ga0068853_100038007 Ga0068853_1000380072 170
467 3300005539 Ga0068853_101536521 Ga0068853_1015365211 170
468 3300005543 Ga0070672_100301262 Ga0070672_1003012622 170
469 3300005543 Ga0070672_100314521 Ga0070672_1003145212 170
470 3300005545 Ga0070695_100050568 Ga0070695_1000505682 170
471 3300005547 Ga0070693_100141790 Ga0070693_1001417901 170
472 3300005548 Ga0070665_100020092 Ga0070665_1000200923 170
473 3300005548 Ga0070665_100044801 Ga0070665_1000448013 170
474 3300005548 Ga0070665_100121513 Ga0070665_1001215131 170
475 3300005548 Ga0070665_100129052 Ga0070665_1001290522 170
476 3300005563 Ga0068855_100034352 Ga0068855_1000343525 170
477 3300005563 Ga0068855_100052116 Ga0068855_1000521165 170
478 3300005563 Ga0068855_100918505 Ga0068855_1009185051 170
479 3300005564 Ga0070664_100110142 Ga0070664_1001101422 170
480 3300005564 Ga0070664_100306263 Ga0070664_1003062632 170
481 3300005564 Ga0070664_100415463 Ga0070664_1004154633 170
482 3300005577 Ga0068857_100025802 Ga0068857_1000258024 170
483 3300005577 Ga0068857_100321729 Ga0068857_1003217293 170
484 3300005578 Ga0068854_100337050 Ga0068854_1003370502 170
485 3300005614 Ga0068856_100001102 Ga0068856_10000110220 170
486 3300005614 Ga0068856_100840094 Ga0068856_1008400942 170
487 3300005615 Ga0070702_100438200 Ga0070702_1004382001 170
488 3300005616 Ga0068852_100154182 Ga0068852_1001541823 170
489 3300005616 Ga0068852_100203611 Ga0068852_1002036112 170
490 3300005616 Ga0068852_100609636 Ga0068852_1006096362 170
491 3300005618 Ga0068864_100268661 Ga0068864_1002686612 170
492 3300005718 Ga0068866_10315219 Ga0068866_103152192 170
493 3300005719 Ga0068861_100158542 Ga0068861_1001585422 170
494 3300005719 Ga0068861_101363567 Ga0068861_1013635671 170
495 3300005842 Ga0068858_100106297 Ga0068858_1001062972 170
496 3300005843 Ga0068860_100064123 Ga0068860_1000641232 170
497 3300005843 Ga0068860_100097306 Ga0068860_1000973062 170
498 3300005844 Ga0068862_100222251 Ga0068862_1002222512 170
499 3300005844 Ga0068862_100344771 Ga0068862_1003447711 170
500 3300005844 Ga0068862_100363040 Ga0068862_1003630401 170
501 3300005983 Ga0081540_1008823 Ga0081540_10088236 170
502 3300005983 Ga0081540_1018174 Ga0081540_10181743 170
503 3300005985 Ga0081539_10000051 Ga0081539_1000005148 170
504 3300006028 Ga0070717_10001453 Ga0070717_100014539 170
505 3300006038 Ga0075365_10144370 Ga0075365_101443703 170
506 3300006038 Ga0075365_10353105 Ga0075365_103531053 170
507 3300006042 Ga0075368_10041214 Ga0075368_100412142 170
508 3300006042 Ga0075368_10074001 Ga0075368_100740012 170
509 3300006042 Ga0075368_10113844 Ga0075368_101138443 170
510 3300006048 Ga0075363_100042880 Ga0075363_1000428802 170
511 3300006048 Ga0075363_100176068 Ga0075363_1001760683 170
512 3300006051 Ga0075364_10027527 Ga0075364_100275273 170
513 3300006051 Ga0075364_10042833 Ga0075364_100428332 170
514 3300006051 Ga0075364_10298371 Ga0075364_102983712 170
515 3300006175 Ga0070712_100543821 Ga0070712_1005438211 170
516 3300006177 Ga0075362_10027793 Ga0075362_100277932 170
517 3300006178 Ga0075367_10144048 Ga0075367_101440482 170
518 3300006178 Ga0075367_10212516 Ga0075367_102125162 170
519 3300006178 Ga0075367_10408836 Ga0075367_104088362 170
520 3300006186 Ga0075369_10025566 Ga0075369_100255662 170
521 3300006195 Ga0075366_10272145 Ga0075366_102721453 170
522 3300006353 Ga0075370_10050121 Ga0075370_100501212 170
523 3300006353 Ga0075370_10119846 Ga0075370_101198463 170
524 3300006358 Ga0068871_100353842 Ga0068871_1003538422 170
525 3300006844 Ga0075428_100082079 Ga0075428_1000820792 170
526 3300006881 Ga0068865_100329360 Ga0068865_1003293602 170
527 3300006881 Ga0068865_100836069 Ga0068865_1008360692 170
528 3300006881 Ga0068865_100872705 Ga0068865_1008727052 170
529 3300007265 Ga0099794_10009182 Ga0099794_100091826 170
530 3300007265 Ga0099794_10023104 Ga0099794_100231043 170
531 3300007265 Ga0099794_10056174 Ga0099794_100561743 170
532 3300007788 Ga0099795_10158825 Ga0099795_101588251 170
533 3300007788 Ga0099795_10219694 Ga0099795_102196942 170
534 3300009092 Ga0105250_10073854 Ga0105250_100738541 170
535 3300009093 Ga0105240_10018413 Ga0105240_100184134 170
536 3300009093 Ga0105240_10943169 Ga0105240_109431692 170
537 3300009094 Ga0111539_10124442 Ga0111539_101244422 170
538 3300009098 Ga0105245_10270455 Ga0105245_102704553 170
539 3300009098 Ga0105245_11627772 Ga0105245_116277722 170
540 3300009101 Ga0105247_10267360 Ga0105247_102673602 170
541 3300009101 Ga0105247_10287271 Ga0105247_102872711 170
542 3300009101 Ga0105247_10537868 Ga0105247_105378683 170
543 3300009147 Ga0114129_10390544 Ga0114129_103905443 170
544 3300009147 Ga0114129_11630058 Ga0114129_116300582 170
545 3300009148 Ga0105243_10150161 Ga0105243_101501613 170
546 3300009148 Ga0105243_10154726 Ga0105243_101547263 170
547 3300009148 Ga0105243_10885604 Ga0105243_108856043 170
548 3300009174 Ga0105241_10678064 Ga0105241_106780642 170
549 3300009176 Ga0105242_10548789 Ga0105242_105487892 170
550 3300009176 Ga0105242_10828415 Ga0105242_108284152 170
551 3300009177 Ga0105248_10103453 Ga0105248_101034535 170
552 3300009177 Ga0105248_10381536 Ga0105248_103815362 170
553 3300009177 Ga0105248_10693093 Ga0105248_106930932 170
554 3300009545 Ga0105237_10246838 Ga0105237_102468382 170
555 3300009545 Ga0105237_10428271 Ga0105237_104282712 170
556 3300009545 Ga0105237_10508256 Ga0105237_105082562 170
557 3300009551 Ga0105238_10776827 Ga0105238_107768271 170
558 3300009553 Ga0105249_10093817 Ga0105249_100938172 170
559 3300009553 Ga0105249_10757514 Ga0105249_107575142 170
560 3300009553 Ga0105249_12448209 Ga0105249_124482091 170
561 3300010159 Ga0099796_10278634 Ga0099796_102786342 170
562 3300010375 Ga0105239_10036703 Ga0105239_100367035 170
563 3300010375 Ga0105239_10116383 Ga0105239_101163832 170
564 3300010375 Ga0105239_10185057 Ga0105239_101850573 170
565 3300011119 Ga0105246_10128633 Ga0105246_101286333 170
566 3300013105 Ga0157369_10014981 Ga0157369_100149813 170
567 3300013296 Ga0157374_10741471 Ga0157374_107414711 170
568 3300013297 Ga0157378_10069664 Ga0157378_100696643 170
569 3300013297 Ga0157378_10100155 Ga0157378_101001552 170
570 3300013297 Ga0157378_11024783 Ga0157378_110247832 170
571 3300013297 Ga0157378_11146833 Ga0157378_111468332 170
572 3300013306 Ga0163162_10030420 Ga0163162_100304202 170
573 3300013306 Ga0163162_10961611 Ga0163162_109616113 170
574 3300013306 Ga0163162_11150631 Ga0163162_111506312 170
575 3300013308 Ga0157375_11120442 Ga0157375_111204423 170
576 3300013308 Ga0157375_11497034 Ga0157375_114970343 170
577 3300013308 Ga0157375_12366936 Ga0157375_123669361 170
578 3300014325 Ga0163163_10819068 Ga0163163_108190683 170
579 3300014325 Ga0163163_11315323 Ga0163163_113153232 170
580 3300014745 Ga0157377_10209679 Ga0157377_102096793 170
581 3300014968 Ga0157379_10803549 Ga0157379_108035492 170
582 3300014968 Ga0157379_11085431 Ga0157379_110854311 170
583 3300017792 Ga0163161_10311369 Ga0163161_103113692 170
584 3300021377 Ga0213874_10052606 Ga0213874_100526062 170
585 3300021384 Ga0213876_10025827 Ga0213876_100258272 170
586 3300025297 Ga0209758_1020919 Ga0209758_10209193 170
587 3300025321 Ga0207656_10213684 Ga0207656_102136842 170
588 3300025899 Ga0207642_10325648 Ga0207642_103256482 170
589 3300025900 Ga0207710_10066554 Ga0207710_100665543 170
590 3300025901 Ga0207688_10263145 Ga0207688_102631451 170
591 3300025901 Ga0207688_10269932 Ga0207688_102699322 170
592 3300025905 Ga0207685_10253547 Ga0207685_102535471 170
593 3300025906 Ga0207699_10578041 Ga0207699_105780412 170
594 3300025907 Ga0207645_10321249 Ga0207645_103212492 170
595 3300025909 Ga0207705_10052106 Ga0207705_100521063 170
596 3300025909 Ga0207705_10078949 Ga0207705_100789492 170
597 3300025910 Ga0207684_10099553 Ga0207684_100995532 170
598 3300025910 Ga0207684_10413970 Ga0207684_104139703 170
599 3300025912 Ga0207707_10005224 Ga0207707_100052245 170
600 3300025912 Ga0207707_10110069 Ga0207707_101100692 170
601 3300025913 Ga0207695_10275211 Ga0207695_102752113 170
602 3300025914 Ga0207671_10255621 Ga0207671_102556212 170
603 3300025915 Ga0207693_10048081 Ga0207693_100480813 170
604 3300025915 Ga0207693_10119608 Ga0207693_101196082 170
605 3300025916 Ga0207663_10166444 Ga0207663_101664443 170
606 3300025917 Ga0207660_10020207 Ga0207660_100202075 170
607 3300025917 Ga0207660_10647041 Ga0207660_106470412 170
608 3300025919 Ga0207657_10120762 Ga0207657_101207623 170
609 3300025919 Ga0207657_10633805 Ga0207657_106338052 170
610 3300025921 Ga0207652_10016767 Ga0207652_100167675 170
611 3300025922 Ga0207646_10288512 Ga0207646_102885123 170
612 3300025923 Ga0207681_10250673 Ga0207681_102506732 170
613 3300025923 Ga0207681_10372728 Ga0207681_103727282 170
614 3300025924 Ga0207694_10152968 Ga0207694_101529682 170
615 3300025924 Ga0207694_10525826 Ga0207694_105258262 170
616 3300025925 Ga0207650_11412129 Ga0207650_114121291 170
617 3300025926 Ga0207659_10213269 Ga0207659_102132692 170
618 3300025926 Ga0207659_10521549 Ga0207659_105215492 170
619 3300025926 Ga0207659_11482829 Ga0207659_114828291 170
620 3300025926 Ga0207659_11597119 Ga0207659_115971191 170
621 3300025927 Ga0207687_10685226 Ga0207687_106852262 170
622 3300025928 Ga0207700_10130554 Ga0207700_101305542 170
623 3300025929 Ga0207664_11331000 Ga0207664_113310002 170
624 3300025931 Ga0207644_10143378 Ga0207644_101433782 170
625 3300025932 Ga0207690_10359404 Ga0207690_103594043 170
626 3300025932 Ga0207690_10686801 Ga0207690_106868013 170
627 3300025933 Ga0207706_10072973 Ga0207706_100729732 170
628 3300025933 Ga0207706_10552858 Ga0207706_105528583 170
629 3300025935 Ga0207709_10197650 Ga0207709_101976503 170
630 3300025935 Ga0207709_10277053 Ga0207709_102770533 170
631 3300025936 Ga0207670_10366598 Ga0207670_103665983 170
632 3300025937 Ga0207669_10250204 Ga0207669_102502042 170
633 3300025940 Ga0207691_10309399 Ga0207691_103093993 170
634 3300025941 Ga0207711_10046752 Ga0207711_100467525 170
635 3300025942 Ga0207689_10041355 Ga0207689_100413554 170
636 3300025945 Ga0207679_10243490 Ga0207679_102434903 170
637 3300025945 Ga0207679_10248660 Ga0207679_102486602 170
638 3300025949 Ga0207667_10006683 Ga0207667_100066832 170
639 3300025949 Ga0207667_10283365 Ga0207667_102833653 170
640 3300025961 Ga0207712_10012948 Ga0207712_100129485 170
641 3300025972 Ga0207668_10010526 Ga0207668_100105262 170
642 3300025972 Ga0207668_10037590 Ga0207668_100375902 170
643 3300025972 Ga0207668_10047779 Ga0207668_100477793 170
644 3300025972 Ga0207668_11274381 Ga0207668_112743811 170
645 3300025981 Ga0207640_10365564 Ga0207640_103655642 170
646 3300025986 Ga0207658_10665146 Ga0207658_106651462 170
647 3300026023 Ga0207677_10712367 Ga0207677_107123671 170
648 3300026035 Ga0207703_10097641 Ga0207703_100976412 170
649 3300026041 Ga0207639_10091196 Ga0207639_100911962 170
650 3300026041 Ga0207639_10121012 Ga0207639_101210122 170
651 3300026067 Ga0207678_10113826 Ga0207678_101138262 170
652 3300026067 Ga0207678_10223993 Ga0207678_102239933 170
653 3300026067 Ga0207678_10268474 Ga0207678_102684743 170
654 3300026067 Ga0207678_10312257 Ga0207678_103122573 170
655 3300026067 Ga0207678_10612757 Ga0207678_106127572 170
656 3300026075 Ga0207708_10008525 Ga0207708_100085256 170
657 3300026075 Ga0207708_11148620 Ga0207708_111486202 170
658 3300026078 Ga0207702_10001047 Ga0207702_100010478 170
659 3300026078 Ga0207702_10228565 Ga0207702_102285653 170
660 3300026088 Ga0207641_10400936 Ga0207641_104009362 170
661 3300026089 Ga0207648_10089994 Ga0207648_100899942 170
662 3300026089 Ga0207648_10416531 Ga0207648_104165313 170
663 3300026095 Ga0207676_10243216 Ga0207676_102432163 170
664 3300026095 Ga0207676_11133763 Ga0207676_111337632 170
665 3300026116 Ga0207674_10012072 Ga0207674_100120727 170
666 3300026116 Ga0207674_10348965 Ga0207674_103489652 170
667 3300026116 Ga0207674_10419768 Ga0207674_104197682 170
668 3300026118 Ga0207675_100028411 Ga0207675_1000284115 170
669 3300026118 Ga0207675_100188181 Ga0207675_1001881813 170
670 3300026118 Ga0207675_101432763 Ga0207675_1014327631 170
671 3300026121 Ga0207683_10073609 Ga0207683_100736093 170
672 3300026121 Ga0207683_10098824 Ga0207683_100988242 170
673 3300026121 Ga0207683_10257155 Ga0207683_102571552 170
674 3300026121 Ga0207683_10863138 Ga0207683_108631383 170
675 3300027671 Ga0209588_1026891 Ga0209588_10268912 170
676 3300027671 Ga0209588_1067060 Ga0209588_10670603 170
677 3300027866 Ga0209813_10048772 Ga0209813_100487722 170
678 3300027866 Ga0209813_10189949 Ga0209813_101899492 170
679 3300027907 Ga0207428_10197381 Ga0207428_101973812 170
680 3300027907 Ga0207428_10483372 Ga0207428_104833722 170
681 3300028379 Ga0268266_10002184 Ga0268266_1000218413 170
682 3300028379 Ga0268266_10060151 Ga0268266_100601514 170
683 3300028379 Ga0268266_10153118 Ga0268266_101531182 170
684 3300028379 Ga0268266_10249767 Ga0268266_102497672 170
685 3300028379 Ga0268266_10958335 Ga0268266_109583353 170
686 3300028380 Ga0268265_10072126 Ga0268265_100721262 170
687 3300028380 Ga0268265_10213468 Ga0268265_102134683 170
688 3300028380 Ga0268265_11175410 Ga0268265_111754103 170
689 3300028381 Ga0268264_10193987 Ga0268264_101939872 170
690 3300028786 Ga0307517_10078607 Ga0307517_100786073 170
691 3300031235 Ga0265330_10058161 Ga0265330_100581613 170
692 3300031235 Ga0265330_10252262 Ga0265330_102522622 170
693 3300031238 Ga0265332_10065690 Ga0265332_100656903 170
694 3300031241 Ga0265325_10020366 Ga0265325_100203662 170
695 3300031247 Ga0265340_10007905 Ga0265340_100079055 170
696 3300031249 Ga0265339_10021548 Ga0265339_100215483 170
697 3300031249 Ga0265339_10100600 Ga0265339_101006001 170
698 3300031249 Ga0265339_10241996 Ga0265339_102419961 170
699 3300031250 Ga0265331_10032416 Ga0265331_100324162 170
700 3300031344 Ga0265316_10193425 Ga0265316_101934253 170
701 3300031344 Ga0265316_10869292 Ga0265316_108692922 170
702 3300031456 Ga0307513_10792852 Ga0307513_107928522 170
703 3300031616 Ga0307508_10154913 Ga0307508_101549133 170
704 3300031616 Ga0307508_10199081 Ga0307508_101990813 170
705 3300031711 Ga0265314_10001300 Ga0265314_1000130010 170
706 3300031711 Ga0265314_10081181 Ga0265314_100811813 170
707 3300031712 Ga0265342_10032530 Ga0265342_100325302 170
708 3300031712 Ga0265342_10266819 Ga0265342_102668192 170
709 3300031731 Ga0307405_10070040 Ga0307405_100700402 170
710 3300031731 Ga0307405_10775690 Ga0307405_107756901 170
711 3300031901 Ga0307406_10080793 Ga0307406_100807933 170
712 3300032005 Ga0307411_10190555 Ga0307411_101905552 170
713 3300033180 Ga0307510_10021118 Ga0307510_100211187 170
714 3300035086 Ga0373934_0044142 Ga0373934_0044142_720_1232 170
715 3300035086 Ga0373934_0116328 Ga0373934_0116328_37_549 170
716 3300035111 Ga0373923_0018239 Ga0373923_0018239_1934_2446 170
717 3300035111 Ga0373923_0089817 Ga0373923_0089817_693_1205 170
718 3300035113 Ga0373936_0042259 Ga0373936_0042259_586_1098 170
719 3300035116 Ga0373945_0014945 Ga0373945_0014945_530_1042 170
720 3300035116 Ga0373945_0178031 Ga0373945_0178031_61_573 170
721 3300035117 Ga0373953_0001115 Ga0373953_0001115_4511_5023 170
722 3300035118 Ga0373954_0005560 Ga0373954_0005560_2636_3148 170
723 3300035118 Ga0373954_0027484 Ga0373954_0027484_309_821 170
724 3300035118 Ga0373954_0065815 Ga0373954_0065815_245_757 170
725 3300035119 Ga0373956_0000298 Ga0373956_0000298_10349_10861 170
726 3300035119 Ga0373956_0033906 Ga0373956_0033906_1025_1537 170
727 3300035120 Ga0373957_0001343 Ga0373957_0001343_135_647 170
728 3300035120 Ga0373957_0023830 Ga0373957_0023830_422_934 170
729 3300035170 Ga0373943_0008246 Ga0373943_0008246_1127_1639 170
730 3300035172 Ga0373955_0004260 Ga0373955_0004260_5685_6197 170
731 3300035207 Ga0373942_0068932 Ga0373942_0068932_45_560 170
732 3300035410 Ga0373924_0004379 Ga0373924_0004379_3596_4108 170
733 3300035410 Ga0373924_0096122 Ga0373924_0096122_268_780 170
734 3300035691 Ga0373931_0132728 Ga0373931_0132728_826_1338 170
735 3300035692 Ga0373935_0000186 Ga0373935_0000186_11386_11898 170
736 3300035692 Ga0373935_0090898 Ga0373935_0090898_1398_1910 170
737 3300035692 Ga0373935_0212816 Ga0373935_0212816_586_1098 170
738 3300035695 Ga0373927_0001401 Ga0373927_0001401_9953_10465 170
739 3300035695 Ga0373927_0004095 Ga0373927_0004095_9444_9956 170
740 3300035695 Ga0373927_0023017 Ga0373927_0023017_1537_2049 170
741 3300035695 Ga0373927_0163659 Ga0373927_0163659_235_747 170
742 3300035724 Ga0373933_0000368 Ga0373933_0000368_6413_6925 170
743 3300035725 Ga0373947_0001325 Ga0373947_0001325_9828_10340 170
744 3300035725 Ga0373947_0089206 Ga0373947_0089206_138_650 170
745 3300035725 Ga0373947_0457516 Ga0373947_0457516_50_562 170
746 3300036401 Ga0373937_0009543 Ga0373937_0009543_3925_4437 170
747 3300036401 Ga0373937_0115123 Ga0373937_0115123_712_1224 170
748 3300037068 Ga0373925_0002553 Ga0373925_0002553_293_805 170
749 3300037068 Ga0373925_0037874 Ga0373925_0037874_1224_1736 170
750 3300037068 Ga0373925_0253610 Ga0373925_0253610_190_702 170
751 3300037068 Ga0373925_0260018 Ga0373925_0260018_233_745 170
752 3300037418 Ga0395900_0908025 Ga0395900_0908025_75_587 170
753 3300037471 Ga0395905_0100918 Ga0395905_0100918_1217_1729 170
754 3300037853 Ga0436364_0385142 Ga0436364_0385142_82_594 170
755 3300037853 Ga0436364_1460540 Ga0436364_1460540_2438_2950 170
756 3300038443 Ga0395901_0158993 Ga0395901_0158993_17_529 170
757 3300039437 Ga0436365_0735123 Ga0436365_0735123_440_952 170
758 3300039437 Ga0436365_0990941 Ga0436365_0990941_4860_5372 170
759 3300039438 Ga0436360_1376600 Ga0436360_1376600_1296_1808 170
760 3300039450 Ga0436363_0951156 Ga0436363_0951156_264_776 170
761 3300039453 Ga0436362_1182516 Ga0436362_1182516_103_615 170
762 3300041413 Ga0439465_0027021 Ga0439465_0027021_977_1489 170
763 3300041451 Ga0451791_0227239 Ga0451791_0227239_25_537 170
764 3300041451 Ga0451791_1046831 Ga0451791_1046831_205_717 170
765 3300041452 Ga0451793_0175087 Ga0451793_0175087_10_522 170
766 3300041453 Ga0451797_1036343 Ga0451797_1036343_335_847 170
767 3300041460 Ga0451802_0491935 Ga0451802_0491935_18_530 170
768 3300041460 Ga0451802_1397736 Ga0451802_1397736_43_555 170
769 3300041494 Ga0451837_1228415 Ga0451837_1228415_68_580 170
770 3300041512 Ga0451853_2172712 Ga0451853_2172712_89_601 170
771 3300042157 Ga0439458_0056731 Ga0439458_0056731_23_535 170
772 3300042438 Ga0439459_0004861 Ga0439459_0004861_234_746 170
773 3300046452 Ga0495617_017617 Ga0495617_017617_1022_1534 170
774 3300046454 Ga0495592_0001299 Ga0495592_0001299_2530_3042 170
775 3300046454 Ga0495592_0098492 Ga0495592_0098492_1436_1948 170
776 3300046455 Ga0495603_0001707 Ga0495603_0001707_7278_7790 170
777 3300046455 Ga0495603_0002520 Ga0495603_0002520_2893_3405 170
778 3300046455 Ga0495603_0025039 Ga0495603_0025039_1886_2398 170
779 3300046455 Ga0495603_0108439 Ga0495603_0108439_387_899 170
780 3300046459 Ga0495629_0000606 Ga0495629_0000606_19938_20450 170
781 3300046459 Ga0495629_0012153 Ga0495629_0012153_559_1071 170
782 3300046459 Ga0495629_0188199 Ga0495629_0188199_672_1184 170
783 3300046460 Ga0495638_0046286 Ga0495638_0046286_1290_1802 170
784 3300046460 Ga0495638_0492508 Ga0495638_0492508_92_604 170
785 3300046462 Ga0495651_0031188 Ga0495651_0031188_188_700 170
786 3300046462 Ga0495651_0034272 Ga0495651_0034272_2087_2599 170
787 3300046463 Ga0495653_0053884 Ga0495653_0053884_139_651 170
788 3300046471 Ga0495650_0108601 Ga0495650_0108601_59_571 170
789 3300046472 Ga0495580_0001307 Ga0495580_0001307_13187_13699 170
790 3300046472 Ga0495580_0235487 Ga0495580_0235487_88_600 170
791 3300046475 Ga0495639_0000136 Ga0495639_0000136_8783_9295 170
792 3300046476 Ga0495662_0000392 Ga0495662_0000392_8355_8867 170
793 3300046477 Ga0495664_0009869 Ga0495664_0009869_2468_2980 170
794 3300046477 Ga0495664_0010089 Ga0495664_0010089_678_1190 170
795 3300046477 Ga0495664_0061267 Ga0495664_0061267_427_939 170
796 3300046477 Ga0495664_0136765 Ga0495664_0136765_758_1270 170
797 3300046491 Ga0495584_0061716 Ga0495584_0061716_141_653 170
798 3300046492 Ga0495585_0087422 Ga0495585_0087422_911_1423 170
799 3300046499 Ga0495594_0000843 Ga0495594_0000843_6667_7179 170
800 3300046499 Ga0495594_0059578 Ga0495594_0059578_193_705 170
801 3300046500 Ga0495596_0149365 Ga0495596_0149365_382_894 170
802 3300046501 Ga0495607_0356540 Ga0495607_0356540_23_535 170
803 3300046506 Ga0495583_0191397 Ga0495583_0191397_227_739 170
804 3300046506 Ga0495583_0265526 Ga0495583_0265526_75_587 170
805 3300046507 Ga0495606_0003785 Ga0495606_0003785_6050_6562 170
806 3300046511 Ga0495608_0008627 Ga0495608_0008627_5887_6399 170
807 3300046512 Ga0495610_0102076 Ga0495610_0102076_103_615 170
808 3300046512 Ga0495610_0191172 Ga0495610_0191172_100_612 170
809 3300046513 Ga0495616_0077966 Ga0495616_0077966_166_678 170
810 3300046514 Ga0495618_0214507 Ga0495618_0214507_420_932 170
811 3300046515 Ga0495620_0058290 Ga0495620_0058290_336_848 170
812 3300046516 Ga0495628_0053564 Ga0495628_0053564_574_1086 170
813 3300046516 Ga0495628_0085243 Ga0495628_0085243_485_997 170
814 3300046517 Ga0495630_0285172 Ga0495630_0285172_509_1021 170
815 3300046519 Ga0495632_0124882 Ga0495632_0124882_240_752 170
816 3300046523 Ga0495644_0112986 Ga0495644_0112986_161_673 170
817 3300046523 Ga0495644_0196056 Ga0495644_0196056_86_598 170
818 3300046524 Ga0495648_0005884 Ga0495648_0005884_4466_4978 170
819 3300046526 Ga0495666_0162264 Ga0495666_0162264_63_575 170
820 3300046529 Ga0495652_0082944 Ga0495652_0082944_1587_2099 170
821 3300046529 Ga0495652_0101851 Ga0495652_0101851_738_1250 170
822 3300046529 Ga0495652_0194649 Ga0495652_0194649_375_887 170
823 3300046529 Ga0495652_0268062 Ga0495652_0268062_297_809 170
824 3300046529 Ga0495652_0620996 Ga0495652_0620996_161_673 170
825 3300046531 Ga0495665_0000026 Ga0495665_0000026_31593_32105 170
826 3300046533 Ga0495640_0019925 Ga0495640_0019925_2903_3415 170
827 3300046533 Ga0495640_0032516 Ga0495640_0032516_625_1137 170
828 3300046533 Ga0495640_0089605 Ga0495640_0089605_172_684 170
829 3300046533 Ga0495640_0312686 Ga0495640_0312686_433_945 170
830 3300046536 Ga0495587_0019713 Ga0495587_0019713_3207_3719 170
831 3300046536 Ga0495587_0081199 Ga0495587_0081199_1356_1868 170
832 3300046537 Ga0495598_0005787 Ga0495598_0005787_2204_2716 170
833 3300046537 Ga0495598_0094724 Ga0495598_0094724_289_801 170
834 3300046539 Ga0495621_0014542 Ga0495621_0014542_1699_2211 170
835 3300046539 Ga0495621_0095710 Ga0495621_0095710_547_1059 170
836 3300046542 Ga0495597_0230225 Ga0495597_0230225_22_534 170
837 3300046543 Ga0495645_0013176 Ga0495645_0013176_2407_2919 170
838 3300046543 Ga0495645_0035707 Ga0495645_0035707_1227_1739 170
839 3300046543 Ga0495645_0150289 Ga0495645_0150289_468_980 170
840 3300046557 Ga0495622_0002841 Ga0495622_0002841_4486_4998 170
841 3300046558 Ga0495633_0096722 Ga0495633_0096722_303_815 170
842 3300046558 Ga0495633_0115874 Ga0495633_0115874_541_1053 170
843 3300046559 Ga0495667_0028023 Ga0495667_0028023_1308_1820 170
844 3300046559 Ga0495667_0047064 Ga0495667_0047064_1290_1802 170
845 3300046559 Ga0495667_0048749 Ga0495667_0048749_38_550 170
846 3300046559 Ga0495667_0128776 Ga0495667_0128776_80_592 170
847 3300046615 Ga0495656_0057916 Ga0495656_0057916_862_1374 170
848 3300046615 Ga0495656_0334263 Ga0495656_0334263_46_558 170
849 3300046616 Ga0495668_0341131 Ga0495668_0341131_217_729 170
850 3300046642 Ga0495634_0000634 Ga0495634_0000634_24766_25278 170
851 3300046642 Ga0495634_0023387 Ga0495634_0023387_2166_2678 170
852 3300046642 Ga0495634_0042420 Ga0495634_0042420_317_829 170
853 3300046648 Ga0495611_0094639 Ga0495611_0094639_300_812 170
854 3300046648 Ga0495611_0255654 Ga0495611_0255654_243_755 170
855 3300046648 Ga0495611_0419225 Ga0495611_0419225_31_543 170
856 3300046660 Ga0495625_0217787 Ga0495625_0217787_28_540 170
857 3300046660 Ga0495625_0370258 Ga0495625_0370258_174_686 170
858 3300046660 Ga0495625_0526124 Ga0495625_0526124_74_586 170
859 3300046663 Ga0495635_0000827 Ga0495635_0000827_9549_10061 170
860 3300046663 Ga0495635_0002063 Ga0495635_0002063_5886_6398 170
861 3300046663 Ga0495635_0137115 Ga0495635_0137115_729_1241 170
862 3300046674 Ga0495588_0050578 Ga0495588_0050578_680_1192 170
863 3300046675 Ga0495657_0032998 Ga0495657_0032998_250_762 170
864 3300046675 Ga0495657_0042292 Ga0495657_0042292_1686_2198 170
865 3300046675 Ga0495657_0150903 Ga0495657_0150903_526_1038 170
866 3300046678 Ga0495599_0074009 Ga0495599_0074009_738_1250 170
867 3300046678 Ga0495599_0167839 Ga0495599_0167839_284_796 170
868 3300046678 Ga0495599_0311306 Ga0495599_0311306_258_770 170
869 3300046679 Ga0495623_0004722 Ga0495623_0004722_2553_3065 170
870 3300046679 Ga0495623_0039351 Ga0495623_0039351_1428_1940 170
871 3300046680 Ga0495646_0054824 Ga0495646_0054824_362_874 170
872 3300046680 Ga0495646_0209439 Ga0495646_0209439_481_993 170
873 3300046683 Ga0495658_0002383 Ga0495658_0002383_5695_6207 170
874 3300046684 Ga0495669_0032965 Ga0495669_0032965_1552_2064 170
875 3300046684 Ga0495669_0182944 Ga0495669_0182944_424_936 170
876 3300046689 Ga0495613_0025652 Ga0495613_0025652_2572_3084 170
877 3300046689 Ga0495613_0072434 Ga0495613_0072434_694_1206 170
878 3300046689 Ga0495613_0082704 Ga0495613_0082704_27_539 170
879 3300046690 Ga0495624_0000201 Ga0495624_0000201_9631_10143 170
880 3300046691 Ga0495670_0242639 Ga0495670_0242639_301_813 170
881 3300046692 Ga0495671_0374117 Ga0495671_0374117_55_567 170
882 3300046694 Ga0495649_0229220 Ga0495649_0229220_214_726 170
883 3300046794 Ga0495589_0431725 Ga0495589_0431725_20_532 170
884 3300046809 Ga0495600_0024231 Ga0495600_0024231_1522_2034 170
885 3300046809 Ga0495600_0025302 Ga0495600_0025302_122_634 170
886 3300046809 Ga0495600_0075575 Ga0495600_0075575_1472_1984 170
887 3300046809 Ga0495600_0379276 Ga0495600_0379276_331_843 170
888 3300047315 Ga0495581_0000828 Ga0495581_0000828_9993_10505 170
889 3300047317 Ga0495604_0052770 Ga0495604_0052770_956_1468 170
890 3300047317 Ga0495604_0879966 Ga0495604_0879966_38_550 170
891 3300047319 Ga0495674_0070830 Ga0495674_0070830_2464_2976 170
892 3300047319 Ga0495674_0076190 Ga0495674_0076190_1702_2214 170
893 3300047319 Ga0495674_0455893 Ga0495674_0455893_366_878 170
894 3300047320 Ga0495672_0016840 Ga0495672_0016840_3024_3536 170
895 3300047321 Ga0495676_0018819 Ga0495676_0018819_529_1041 170
896 3300047321 Ga0495676_0218246 Ga0495676_0218246_317_829 170
897 3300047322 Ga0495680_0068454 Ga0495680_0068454_554_1066 170
898 3300047322 Ga0495680_0434811 Ga0495680_0434811_139_651 170
899 3300047322 Ga0495680_0497209 Ga0495680_0497209_285_797 170
900 3300047444 Ga0495675_0130176 Ga0495675_0130176_712_1224 170
901 3300047444 Ga0495675_0713985 Ga0495675_0713985_38_550 170
902 3300047445 Ga0495677_0025572 Ga0495677_0025572_264_776 170
903 3300047445 Ga0495677_0069072 Ga0495677_0069072_441_953 170
904 3300047469 Ga0495673_0026878 Ga0495673_0026878_1643_2155 170
905 3300047469 Ga0495673_0105254 Ga0495673_0105254_222_734 170
906 3300047470 Ga0495681_0157067 Ga0495681_0157067_168_680 170
907 3300047471 Ga0495684_0034305 Ga0495684_0034305_1280_1792 170
908 3300047471 Ga0495684_0051065 Ga0495684_0051065_2249_2761 170
909 3300047472 Ga0495686_0076032 Ga0495686_0076032_1099_1611 170
910 3300047472 Ga0495686_0334789 Ga0495686_0334789_146_658 170
911 3300047673 Ga0495593_0000282 Ga0495593_0000282_20495_21007 170
912 3300047673 Ga0495593_0001509 Ga0495593_0001509_416_928 170
913 3300048088 Ga0495602_0089153 Ga0495602_0089153_312_824 170
914 3300048088 Ga0495602_0221809 Ga0495602_0221809_38_550 170
915 3300048088 Ga0495602_0744782 Ga0495602_0744782_23_535 170
916 3300048089 Ga0495614_0016341 Ga0495614_0016341_1678_2190 170
917 3300048903 Ga0496100_0189176 Ga0496100_0189176_674_1186 170
918 3300048903 Ga0496100_0342336 Ga0496100_0342336_53_565 170
919 3300048903 Ga0496100_0963612 Ga0496100_0963612_79_591 170
920 3300048904 Ga0496101_0296917 Ga0496101_0296917_703_1215 170
921 3300048905 Ga0496102_0008807 Ga0496102_0008807_5108_5620 170
922 3300048905 Ga0496102_0099366 Ga0496102_0099366_825_1337 170
923 3300048905 Ga0496102_0344613 Ga0496102_0344613_222_734 170
924 3300048905 Ga0496102_0663711 Ga0496102_0663711_309_821 170
925 3300048906 Ga0496103_0044481 Ga0496103_0044481_1261_1773 170
926 3300048906 Ga0496103_0105501 Ga0496103_0105501_716_1228 170
927 3300048907 Ga0496104_0257040 Ga0496104_0257040_1132_1644 170
928 3300048907 Ga0496104_0450104 Ga0496104_0450104_18_530 170
929 3300048909 Ga0496106_0323858 Ga0496106_0323858_357_869 170
930 3300048909 Ga0496106_0518655 Ga0496106_0518655_246_758 170
931 3300048910 Ga0496107_0151120 Ga0496107_0151120_1141_1653 170
932 3300048910 Ga0496107_0254912 Ga0496107_0254912_562_1074 170
933 3300048910 Ga0496107_0377745 Ga0496107_0377745_441_953 170
934 3300048911 Ga0496108_1063475 Ga0496108_1063475_156_668 170
935 3300048912 Ga0496109_0151869 Ga0496109_0151869_258_770 170
936 3300048912 Ga0496109_0521919 Ga0496109_0521919_133_645 170
937 3300048912 Ga0496109_0758475 Ga0496109_0758475_28_540 170
938 3300048912 Ga0496109_1003953 Ga0496109_1003953_164_676 170
939 3300048912 Ga0496109_1015126 Ga0496109_1015126_103_615 170
940 3300048913 Ga0496110_0535726 Ga0496110_0535726_282_794 170
941 3300048915 Ga0496112_0000004 Ga0496112_0000004_394385_394897 170
942 3300048915 Ga0496112_0191499 Ga0496112_0191499_1400_1912 170
943 3300048915 Ga0496112_0273967 Ga0496112_0273967_1033_1545 170
944 3300048915 Ga0496112_0313284 Ga0496112_0313284_820_1332 170
945 3300048916 Ga0496113_0144862 Ga0496113_0144862_66_578 170
946 3300048916 Ga0496113_0318662 Ga0496113_0318662_159_671 170
947 3300048916 Ga0496113_0831487 Ga0496113_0831487_16_528 170
948 3300048917 Ga0496114_0625973 Ga0496114_0625973_219_731 170
949 3300048917 Ga0496114_1091143 Ga0496114_1091143_15_527 170
950 3300048918 Ga0496115_0000864 Ga0496115_0000864_1707_2219 170
951 3300048920 Ga0496117_0285350 Ga0496117_0285350_96_608 170
952 3300048924 Ga0496121_0000657 Ga0496121_0000657_59142_59654 170
953 3300048924 Ga0496121_0358223 Ga0496121_0358223_355_867 170
954 3300048927 Ga0496124_0454716 Ga0496124_0454716_83_595 170
955 3300048928 Ga0496125_0173128 Ga0496125_0173128_605_1117 170
956 3300048928 Ga0496125_0407700 Ga0496125_0407700_171_683 170
957 3300048929 Ga0496126_0009539 Ga0496126_0009539_2135_2647 170
958 3300048929 Ga0496126_0071312 Ga0496126_0071312_844_1356 170
959 3300048929 Ga0496126_0118516 Ga0496126_0118516_713_1225 170
960 3300048929 Ga0496126_0121857 Ga0496126_0121857_202_714 170
961 3300048929 Ga0496126_0253973 Ga0496126_0253973_128_640 170
962 3300048929 Ga0496126_0544304 Ga0496126_0544304_62_574 170
963 3300048929 Ga0496126_0736047 Ga0496126_0736047_103_615 170
964 3300049459 Ga0495678_048806 Ga0495678_048806_323_835 170
965 3300050489 nmdc:mga03683_231732_c1 nmdc:mga03683_231732_c1_136_648 170
966 3300050490 nmdc:mga03n38_438369_c1 nmdc:mga03n38_438369_c1_36_548 170
967 3300050490 nmdc:mga03n38_879_c1 nmdc:mga03n38_879_c1_5188_5700 170
968 3300050491 nmdc:mga00v17_212530_c1 nmdc:mga00v17_212530_c1_488_1000 170
969 3300050491 nmdc:mga00v17_296458_c1 nmdc:mga00v17_296458_c1_220_732 170
970 3300050491 nmdc:mga00v17_79840_c1 nmdc:mga00v17_79840_c1_562_1074 170
971 3300050492 nmdc:mga0yw44_141738_c1 nmdc:mga0yw44_141738_c1_483_995 170
972 3300050492 nmdc:mga0yw44_206608_c1 nmdc:mga0yw44_206608_c1_710_1222 170
973 3300050492 nmdc:mga0yw44_41086_c1 nmdc:mga0yw44_41086_c1_562_1074 170
974 3300050493 nmdc:mga0k408_504339_c1 nmdc:mga0k408_504339_c1_130_642 170
975 3300050494 nmdc:mga06z11_387043_c1 nmdc:mga06z11_387043_c1_59_571 170
976 3300050494 nmdc:mga06z11_425970_c1 nmdc:mga06z11_425970_c1_192_704 170
977 3300050495 nmdc:mga04h51_113182_c1 nmdc:mga04h51_113182_c1_107_619 170
978 3300050495 nmdc:mga04h51_51228_c1 nmdc:mga04h51_51228_c1_108_620 170
979 3300050496 nmdc:mga07m45_14924_c3 nmdc:mga07m45_14924_c3_55_567 170
980 3300050496 nmdc:mga07m45_15435_c1 nmdc:mga07m45_15435_c1_2414_2926 170
981 3300050496 nmdc:mga07m45_27449_c2 nmdc:mga07m45_27449_c2_263_775 170
982 3300050496 nmdc:mga07m45_470175_c1 nmdc:mga07m45_470175_c1_184_696 170
983 3300050507 nmdc:mga05p37_204769_c1 nmdc:mga05p37_204769_c1_1782_2300 170
984 3300050509 nmdc:mga0qj67_788636_c1 nmdc:mga0qj67_788636_c1_124_636 170
985 3300050511 nmdc:mga08y16_172584_c1 nmdc:mga08y16_172584_c1_1693_2205 170
986 3300050511 nmdc:mga08y16_563261_c1 nmdc:mga08y16_563261_c1_148_660 170
987 3300050512 nmdc:mga0n895_318403_c1 nmdc:mga0n895_318403_c1_462_974 170
988 3300050515 nmdc:mga0a205_586453_c1 nmdc:mga0a205_586453_c1_165_677 170
989 3300050516 nmdc:mga0sz30_54510_c1 nmdc:mga0sz30_54510_c1_200_712 170
990 3300053077 Ga0495601_0038409 Ga0495601_0038409_224_736 170
991 3300053078 Ga0495612_0009691 Ga0495612_0009691_940_1452 170
992 3300053078 Ga0495612_0046962 Ga0495612_0046962_252_764 170
993 3300053078 Ga0495612_0193636 Ga0495612_0193636_86_598 170
994 3300053080 Ga0500635_0116069 Ga0500635_0116069_152_664 170
995 3300053084 Ga0495595_0002356 Ga0495595_0002356_6839_7351 170
996 3300053084 Ga0495595_0003182 Ga0495595_0003182_4112_4624 170
997 3300053084 Ga0495595_0063936 Ga0495595_0063936_213_725 170
998 3300053085 Ga0495619_0001272 Ga0495619_0001272_13674_14186 170
999 3300053085 Ga0495619_0003981 Ga0495619_0003981_5230_5742 170
1000 3300053085 Ga0495619_0082024 Ga0495619_0082024_940_1452 170
1001 3300053086 Ga0500578_0277836 Ga0500578_0277836_285_797 170
1002 3300053087 Ga0500643_071899 Ga0500643_071899_329_841 170
1003 3300053090 Ga0500646_0114676 Ga0500646_0114676_119_631 170
1004 3300053092 Ga0500583_0046518 Ga0500583_0046518_955_1467 170
1005 3300053094 Ga0500566_0023277 Ga0500566_0023277_3108_3620 170
1006 3300053102 Ga0500554_003144 Ga0500554_003144_1420_1932 170
1007 3300053102 Ga0500554_025708 Ga0500554_025708_293_805 170
1008 3300053109 Ga0500569_100380 Ga0500569_100380_240_752 170
1009 3300053119 Ga0500595_001946 Ga0500595_001946_5959_6471 170
1010 3300053119 Ga0500595_003152 Ga0500595_003152_1382_1894 170
1011 3300053126 Ga0500621_105201 Ga0500621_105201_428_940 170
1012 3300053130 Ga0500642_0147886 Ga0500642_0147886_164_676 170
1013 3300053133 Ga0500655_023115 Ga0500655_023115_98_610 170
1014 3300053134 Ga0500658_0429950 Ga0500658_0429950_76_588 170
1015 3300053137 Ga0500561_0181401 Ga0500561_0181401_93_605 170
1016 3300053146 Ga0500588_0082423 Ga0500588_0082423_381_893 170
1017 3300053147 Ga0500589_027705 Ga0500589_027705_1403_1915 170
1018 3300053147 Ga0500589_297538 Ga0500589_297538_12_524 170
1019 3300053150 Ga0500603_021048 Ga0500603_021048_708_1220 170
1020 3300053161 Ga0500634_0080241 Ga0500634_0080241_322_834 170
1021 3300053162 Ga0500638_002898 Ga0500638_002898_4811_5323 170
1022 3300053177 Ga0500636_0041125 Ga0500636_0041125_1551_2063 170
1023 3300053178 Ga0500637_0000291 Ga0500637_0000291_14645_15157 170
1024 3300053178 Ga0500637_0011540 Ga0500637_0011540_3981_4493 170
1025 3300053727 Ga0500611_074263 Ga0500611_074263_33_545 170
1026 3300055283 Ga0500661_004256 Ga0500661_004256_809_1321 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

87

165

0.85

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

60

187

0.83

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

53

163

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiw-assembly1.cif.gz_A crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris 0.9601 1 160
2fiw-assembly1.cif.gz_A crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris 0.9542 1 160
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.8906 7 160
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8534 61 159
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.8469 62 159
ID Description Score Start End Superfamily
2fiwA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9922 7 160 3.40.630.30
af_Q47158_1_148_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9646 6 159 3.40.630.30
2fiwA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9607 7 160 3.40.630.30
af_Q47158_1_148_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9457 6 159 3.40.630.30
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9343 84 142 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A0B4XLZ9-F1-model_v4 N-acetyltransferase domain-containing protein 0.983 7 162 GO:0016747
AF-A0A7V2H0L0-F1-model_v4 GNAT family N-acetyltransferase 0.9802 9 161 GO:0016747
AF-A0A2A4ZWG1-F1-model_v4 GNAT family N-acetyltransferase 0.9775 9 160 GO:0016747
AF-A0A2E7TP31-F1-model_v4 GNAT family N-acetyltransferase 0.9771 6 161 GO:0016747
AF-A0A846DGZ9-F1-model_v4 GNAT family N-acetyltransferase 0.977 9 161 GO:0016747

Feature Viewer

pLDDT pTM Quality
91.23 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map