F488510
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1026 | 462 | 1007 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10047832|Ga0070717_100478322 |
| Length | 194 |
| Sequence | MAPPGRSRDEPTCRGAGFEVVWHVVNTMGQTLPKPAMRPFLPADTPMLAAIFAAAIEQLTGDDYSEAQQEAWTSAADDEEQFGKRLASELTLIATLQNAPIGFAALKGKDHIDMLYVHPSVAGQGVASMLCDALEKLAGSRGAKSLTVDASDNAEEFFKKRGYVARQRNTVTINGEWLANTTMQKTLETGGAQT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 3 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 4 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 5 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 6 | 2791355199 | |||
| 7 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 8 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 9 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 10 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 11 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 12 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 13 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 14 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 15 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 16 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 17 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 126 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 198 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 219 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 252 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 253 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 254 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 259 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 260 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 261 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 264 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 360 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 361 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 362 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 363 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 364 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 365 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 366 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 398 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 400 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 401 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 402 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 403 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 404 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 411 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 414 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 415 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 418 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 419 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 420 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 421 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 422 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 423 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 425 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 426 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 427 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 428 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 429 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 430 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 431 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 432 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 433 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 434 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 435 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 436 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 437 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 439 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 440 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 441 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 442 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 443 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 444 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 445 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 446 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 447 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 448 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 450 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 452 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 453 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 454 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 455 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 456 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 457 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 459 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 460 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 461 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 462 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.95 |
| Metatranscriptomes | 0.29 |
| Isolates | 1.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.23 |
| Nodule | 1.17 |
| Rhizoplane | 6.53 |
| Rhizosphere | 75.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1009230 | 3300000549 | Bacteria | 1189 |
| 2 | JGI25406J46586_10020277 | 3300003203 | Bacteria | 2691 |
| 3 | JGI25404J52841_10010652 | 3300003659 | Bacteria | 1976 |
| 4 | Ga0055539_1006928 | 3300003752 | Bacteria | 1441 |
| 5 | Ga0070658_10079749 | 3300005327 | Bacteria | 2688 |
| 6 | Ga0070676_10442116 | 3300005328 | Bacteria | 913 |
| 7 | Ga0070683_100017979 | 3300005329 | Bacteria | 6252 |
| 8 | Ga0070670_100153645 | 3300005331 | Bacteria | 1993 |
| 9 | Ga0070670_100905277 | 3300005331 | Bacteria | 800 |
| 10 | Ga0070670_100956994 | 3300005331 | Bacteria | 778 |
| 11 | Ga0068869_100032826 | 3300005334 | Bacteria | 3661 |
| 12 | Ga0068869_100338894 | 3300005334 | Bacteria | 1223 |
| 13 | Ga0068869_100427552 | 3300005334 | Bacteria | 1094 |
| 14 | Ga0068869_101263053 | 3300005334 | Bacteria | 650 |
| 15 | Ga0070680_100022952 | 3300005336 | Bacteria | 4972 |
| 16 | Ga0070680_100102180 | 3300005336 | Bacteria | 2380 |
| 17 | Ga0068868_100196332 | 3300005338 | Bacteria | 1680 |
| 18 | Ga0068868_101532967 | 3300005338 | Bacteria | 625 |
| 19 | Ga0070660_100009001 | 3300005339 | Bacteria | 7004 |
| 20 | Ga0070660_100675138 | 3300005339 | Bacteria | 866 |
| 21 | Ga0070668_100044429 | 3300005347 | Bacteria | 3408 |
| 22 | Ga0070668_100053645 | 3300005347 | Bacteria | 3109 |
| 23 | Ga0070668_100095017 | 3300005347 | Bacteria | 2354 |
| 24 | Ga0070668_100302823 | 3300005347 | Bacteria | 1341 |
| 25 | Ga0070668_100340656 | 3300005347 | Bacteria | 1266 |
| 26 | Ga0070668_100801997 | 3300005347 | Bacteria | 836 |
| 27 | Ga0070669_100573768 | 3300005353 | Bacteria | 943 |
| 28 | Ga0070669_100832367 | 3300005353 | Bacteria | 786 |
| 29 | Ga0070675_100198699 | 3300005354 | Bacteria | 1740 |
| 30 | Ga0070675_100250222 | 3300005354 | Bacteria | 1551 |
| 31 | Ga0070688_100989195 | 3300005365 | Bacteria | 668 |
| 32 | Ga0070659_100170860 | 3300005366 | Bacteria | 1780 |
| 33 | Ga0070667_100252611 | 3300005367 | Bacteria | 1576 |
| 34 | Ga0070667_100830631 | 3300005367 | Bacteria | 859 |
| 35 | Ga0070709_10041150 | 3300005434 | Bacteria | 2846 |
| 36 | Ga0070709_10505077 | 3300005434 | Bacteria | 919 |
| 37 | Ga0070709_10762168 | 3300005434 | Bacteria | 757 |
| 38 | Ga0070714_100017014 | 3300005435 | Bacteria | 5884 |
| 39 | Ga0070714_100660522 | 3300005435 | Bacteria | 1007 |
| 40 | Ga0070713_100039634 | 3300005436 | Bacteria | 3825 |
| 41 | Ga0070713_100039665 | 3300005436 | Bacteria | 3824 |
| 42 | Ga0070713_100166809 | 3300005436 | Bacteria | 1970 |
| 43 | Ga0070713_100301108 | 3300005436 | Bacteria | 1476 |
| 44 | Ga0070710_10206587 | 3300005437 | Bacteria | 1243 |
| 45 | Ga0070710_10758149 | 3300005437 | Bacteria | 690 |
| 46 | Ga0070711_100026775 | 3300005439 | Bacteria | 3782 |
| 47 | Ga0070711_100129721 | 3300005439 | Bacteria | 1876 |
| 48 | Ga0070711_100344350 | 3300005439 | Bacteria | 1197 |
| 49 | Ga0070711_100533295 | 3300005439 | Bacteria | 972 |
| 50 | Ga0070711_100568053 | 3300005439 | Bacteria | 943 |
| 51 | Ga0070705_100055731 | 3300005440 | Bacteria | 2325 |
| 52 | Ga0070700_100787003 | 3300005441 | Bacteria | 765 |
| 53 | Ga0070694_100091570 | 3300005444 | Bacteria | 2134 |
| 54 | Ga0070708_100037436 | 3300005445 | Bacteria | 4232 |
| 55 | Ga0070663_100011372 | 3300005455 | Bacteria | 5584 |
| 56 | Ga0070663_100118799 | 3300005455 | Bacteria | 1994 |
| 57 | Ga0070663_100250373 | 3300005455 | Bacteria | 1402 |
| 58 | Ga0070663_101540614 | 3300005455 | Bacteria | 592 |
| 59 | Ga0070678_100081317 | 3300005456 | Bacteria | 2456 |
| 60 | Ga0070678_100228987 | 3300005456 | Bacteria | 1548 |
| 61 | Ga0070678_100308280 | 3300005456 | Bacteria | 1348 |
| 62 | Ga0070678_100360525 | 3300005456 | Bacteria | 1252 |
| 63 | Ga0070678_100427483 | 3300005456 | Bacteria | 1156 |
| 64 | Ga0070678_100762777 | 3300005456 | Bacteria | 876 |
| 65 | Ga0070662_100136853 | 3300005457 | Bacteria | 1895 |
| 66 | Ga0070662_100262846 | 3300005457 | Bacteria | 1391 |
| 67 | Ga0070681_10090433 | 3300005458 | Bacteria | 3011 |
| 68 | Ga0068867_100223802 | 3300005459 | Bacteria | 1517 |
| 69 | Ga0068867_101310722 | 3300005459 | Bacteria | 669 |
| 70 | Ga0070706_100092751 | 3300005467 | Bacteria | 2802 |
| 71 | Ga0070706_100757426 | 3300005467 | Bacteria | 900 |
| 72 | Ga0070707_100341021 | 3300005468 | Bacteria | 1456 |
| 73 | Ga0070698_100121433 | 3300005471 | Bacteria | 2572 |
| 74 | Ga0070699_100067546 | 3300005518 | Bacteria | 3105 |
| 75 | Ga0070679_100178201 | 3300005530 | Bacteria | 2098 |
| 76 | Ga0070679_100925303 | 3300005530 | Bacteria | 815 |
| 77 | Ga0070684_100017565 | 3300005535 | Bacteria | 5876 |
| 78 | Ga0070697_100081138 | 3300005536 | Bacteria | 2673 |
| 79 | Ga0070697_100136263 | 3300005536 | Bacteria | 2062 |
| 80 | Ga0068853_100003512 | 3300005539 | Bacteria | 11990 |
| 81 | Ga0068853_100038007 | 3300005539 | Bacteria | 4099 |
| 82 | Ga0068853_100579505 | 3300005539 | Bacteria | 1064 |
| 83 | Ga0068853_101536521 | 3300005539 | Bacteria | 645 |
| 84 | Ga0070672_100301262 | 3300005543 | Bacteria | 1359 |
| 85 | Ga0070672_100314521 | 3300005543 | Bacteria | 1330 |
| 86 | Ga0070672_100601055 | 3300005543 | Bacteria | 958 |
| 87 | Ga0070695_100050568 | 3300005545 | Bacteria | 2664 |
| 88 | Ga0070693_100141790 | 3300005547 | Bacteria | 1513 |
| 89 | Ga0070665_100020092 | 3300005548 | Bacteria | 6705 |
| 90 | Ga0070665_100044801 | 3300005548 | Bacteria | 4441 |
| 91 | Ga0070665_100121513 | 3300005548 | Bacteria | 2613 |
| 92 | Ga0070665_100129052 | 3300005548 | Bacteria | 2530 |
| 93 | Ga0068855_100034352 | 3300005563 | Bacteria | 6049 |
| 94 | Ga0068855_100052116 | 3300005563 | Bacteria | 4818 |
| 95 | Ga0068855_100060251 | 3300005563 | Bacteria | 4440 |
| 96 | Ga0068855_100066133 | 3300005563 | Bacteria | 4214 |
| 97 | Ga0068855_100277369 | 3300005563 | Bacteria | 1863 |
| 98 | Ga0068855_100918505 | 3300005563 | Bacteria | 924 |
| 99 | Ga0068855_101271620 | 3300005563 | Bacteria | 763 |
| 100 | Ga0070664_100110142 | 3300005564 | Bacteria | 2402 |
| 101 | Ga0070664_100306263 | 3300005564 | Bacteria | 1437 |
| 102 | Ga0070664_100415463 | 3300005564 | Bacteria | 1232 |
| 103 | Ga0068857_100025802 | 3300005577 | Bacteria | 5174 |
| 104 | Ga0068857_100321729 | 3300005577 | Bacteria | 1428 |
| 105 | Ga0068857_101579541 | 3300005577 | Bacteria | 640 |
| 106 | Ga0068854_100337050 | 3300005578 | Bacteria | 1231 |
| 107 | Ga0068856_100001102 | 3300005614 | Bacteria | 28542 |
| 108 | Ga0068856_100563789 | 3300005614 | Bacteria | 1160 |
| 109 | Ga0068856_100840094 | 3300005614 | Bacteria | 938 |
| 110 | Ga0070702_100089777 | 3300005615 | Bacteria | 1861 |
| 111 | Ga0070702_100438200 | 3300005615 | Bacteria | 945 |
| 112 | Ga0068852_100154182 | 3300005616 | Bacteria | 2138 |
| 113 | Ga0068852_100203611 | 3300005616 | Bacteria | 1874 |
| 114 | Ga0068852_100600657 | 3300005616 | Bacteria | 1105 |
| 115 | Ga0068852_100609636 | 3300005616 | Bacteria | 1096 |
| 116 | Ga0068864_100268661 | 3300005618 | Bacteria | 1589 |
| 117 | Ga0068866_10315219 | 3300005718 | Bacteria | 982 |
| 118 | Ga0068866_10697487 | 3300005718 | Bacteria | 696 |
| 119 | Ga0068861_100158542 | 3300005719 | Bacteria | 1864 |
| 120 | Ga0068861_100833876 | 3300005719 | Bacteria | 868 |
| 121 | Ga0068861_101363567 | 3300005719 | Bacteria | 691 |
| 122 | Ga0068870_10354276 | 3300005840 | Bacteria | 943 |
| 123 | Ga0068858_100106297 | 3300005842 | Bacteria | 2619 |
| 124 | Ga0068858_100449392 | 3300005842 | Bacteria | 1242 |
| 125 | Ga0068860_100064123 | 3300005843 | Bacteria | 3490 |
| 126 | Ga0068860_100097306 | 3300005843 | Bacteria | 2805 |
| 127 | Ga0068860_101955983 | 3300005843 | Bacteria | 608 |
| 128 | Ga0068862_100222251 | 3300005844 | Bacteria | 1710 |
| 129 | Ga0068862_100344771 | 3300005844 | Bacteria | 1380 |
| 130 | Ga0068862_100363040 | 3300005844 | Bacteria | 1346 |
| 131 | Ga0081455_10031420 | 3300005937 | Bacteria | 4806 |
| 132 | Ga0081455_10038749 | 3300005937 | Bacteria | 4218 |
| 133 | Ga0081455_10094202 | 3300005937 | Bacteria | 2420 |
| 134 | Ga0081455_10210767 | 3300005937 | Bacteria | 1448 |
| 135 | Ga0081540_1002935 | 3300005983 | Bacteria | 13720 |
| 136 | Ga0081540_1006783 | 3300005983 | Bacteria | 8275 |
| 137 | Ga0081540_1007771 | 3300005983 | Bacteria | 7590 |
| 138 | Ga0081540_1008823 | 3300005983 | Bacteria | 7001 |
| 139 | Ga0081540_1014845 | 3300005983 | Bacteria | 4960 |
| 140 | Ga0081540_1018174 | 3300005983 | Bacteria | 4325 |
| 141 | Ga0081540_1047770 | 3300005983 | Bacteria | 2149 |
| 142 | Ga0081540_1061237 | 3300005983 | Bacteria | 1795 |
| 143 | Ga0081540_1075943 | 3300005983 | Bacteria | 1533 |
| 144 | Ga0081539_10000051 | 3300005985 | Bacteria | 268337 |
| 145 | Ga0081539_10006975 | 3300005985 | Bacteria | 10492 |
| 146 | Ga0081539_10026746 | 3300005985 | Bacteria | 3671 |
| 147 | Ga0070717_10001453 | 3300006028 | Bacteria | 16347 |
| 148 | Ga0070717_10047832 | 3300006028 | Bacteria | 3506 |
| 149 | Ga0070717_10292710 | 3300006028 | Bacteria | 1446 |
| 150 | Ga0070717_10956987 | 3300006028 | Bacteria | 780 |
| 151 | Ga0075365_10051655 | 3300006038 | Bacteria | 2716 |
| 152 | Ga0075365_10144370 | 3300006038 | Bacteria | 1653 |
| 153 | Ga0075365_10270849 | 3300006038 | Bacteria | 1194 |
| 154 | Ga0075365_10353105 | 3300006038 | Bacteria | 1036 |
| 155 | Ga0075368_10041214 | 3300006042 | Bacteria | 1814 |
| 156 | Ga0075368_10074001 | 3300006042 | Bacteria | 1379 |
| 157 | Ga0075368_10113844 | 3300006042 | Bacteria | 1117 |
| 158 | Ga0075363_100042880 | 3300006048 | Bacteria | 2391 |
| 159 | Ga0075363_100176068 | 3300006048 | Bacteria | 1216 |
| 160 | Ga0075363_100645583 | 3300006048 | Bacteria | 636 |
| 161 | Ga0075364_10027527 | 3300006051 | Bacteria | 3632 |
| 162 | Ga0075364_10042833 | 3300006051 | Bacteria | 2942 |
| 163 | Ga0075364_10298371 | 3300006051 | Bacteria | 1097 |
| 164 | Ga0070712_100026911 | 3300006175 | Bacteria | 3837 |
| 165 | Ga0070712_100543821 | 3300006175 | Bacteria | 978 |
| 166 | Ga0075362_10027793 | 3300006177 | Bacteria | 2424 |
| 167 | Ga0075367_10144048 | 3300006178 | Bacteria | 1477 |
| 168 | Ga0075367_10212516 | 3300006178 | Bacteria | 1210 |
| 169 | Ga0075367_10408836 | 3300006178 | Bacteria | 859 |
| 170 | Ga0075369_10025566 | 3300006186 | Bacteria | 2456 |
| 171 | Ga0075366_10272145 | 3300006195 | Bacteria | 1034 |
| 172 | Ga0097621_100353294 | 3300006237 | Bacteria | 1308 |
| 173 | Ga0097621_100596997 | 3300006237 | Bacteria | 1009 |
| 174 | Ga0097621_101289526 | 3300006237 | Bacteria | 690 |
| 175 | Ga0075370_10050121 | 3300006353 | Bacteria | 2368 |
| 176 | Ga0075370_10119846 | 3300006353 | Bacteria | 1531 |
| 177 | Ga0068871_100292080 | 3300006358 | Bacteria | 1429 |
| 178 | Ga0068871_100353842 | 3300006358 | Bacteria | 1300 |
| 179 | Ga0068871_100942207 | 3300006358 | Bacteria | 802 |
| 180 | Ga0075428_100082079 | 3300006844 | Bacteria | 3517 |
| 181 | Ga0075434_100205639 | 3300006871 | Bacteria | 1989 |
| 182 | Ga0068865_100329360 | 3300006881 | Bacteria | 1231 |
| 183 | Ga0068865_100383665 | 3300006881 | Bacteria | 1147 |
| 184 | Ga0068865_100836069 | 3300006881 | Bacteria | 797 |
| 185 | Ga0068865_100872705 | 3300006881 | Bacteria | 781 |
| 186 | Ga0075435_100085340 | 3300007076 | Bacteria | 2599 |
| 187 | Ga0099794_10009182 | 3300007265 | Bacteria | 4142 |
| 188 | Ga0099794_10023104 | 3300007265 | Bacteria | 2841 |
| 189 | Ga0099794_10056174 | 3300007265 | Bacteria | 1904 |
| 190 | Ga0099794_10348372 | 3300007265 | Bacteria | 770 |
| 191 | Ga0099795_10031943 | 3300007788 | Bacteria | 1817 |
| 192 | Ga0099795_10158825 | 3300007788 | Bacteria | 931 |
| 193 | Ga0099795_10219694 | 3300007788 | Bacteria | 808 |
| 194 | Ga0105250_10073854 | 3300009092 | Bacteria | 1379 |
| 195 | Ga0105240_10018413 | 3300009093 | Bacteria | 9379 |
| 196 | Ga0105240_10250832 | 3300009093 | Bacteria | 2047 |
| 197 | Ga0105240_10943169 | 3300009093 | Bacteria | 926 |
| 198 | Ga0111539_10124442 | 3300009094 | Bacteria | 3022 |
| 199 | Ga0105245_10270455 | 3300009098 | Bacteria | 1657 |
| 200 | Ga0105245_11627772 | 3300009098 | Bacteria | 697 |
| 201 | Ga0105247_10055868 | 3300009101 | Bacteria | 2437 |
| 202 | Ga0105247_10267360 | 3300009101 | Bacteria | 1175 |
| 203 | Ga0105247_10280664 | 3300009101 | Bacteria | 1149 |
| 204 | Ga0105247_10287271 | 3300009101 | Bacteria | 1137 |
| 205 | Ga0105247_10537868 | 3300009101 | Bacteria | 857 |
| 206 | Ga0114129_10390544 | 3300009147 | Bacteria | 1836 |
| 207 | Ga0114129_11630058 | 3300009147 | Bacteria | 789 |
| 208 | Ga0105243_10150161 | 3300009148 | Bacteria | 1998 |
| 209 | Ga0105243_10154726 | 3300009148 | Bacteria | 1971 |
| 210 | Ga0105243_10502835 | 3300009148 | Bacteria | 1149 |
| 211 | Ga0105243_10885604 | 3300009148 | Bacteria | 887 |
| 212 | Ga0105241_10678064 | 3300009174 | Bacteria | 939 |
| 213 | Ga0105242_10102286 | 3300009176 | Bacteria | 2430 |
| 214 | Ga0105242_10158779 | 3300009176 | Bacteria | 1977 |
| 215 | Ga0105242_10548789 | 3300009176 | Bacteria | 1108 |
| 216 | Ga0105242_10828415 | 3300009176 | Bacteria | 918 |
| 217 | Ga0105248_10103453 | 3300009177 | Bacteria | 3210 |
| 218 | Ga0105248_10381536 | 3300009177 | Bacteria | 1587 |
| 219 | Ga0105248_10464772 | 3300009177 | Bacteria | 1426 |
| 220 | Ga0105248_10693093 | 3300009177 | Bacteria | 1149 |
| 221 | Ga0105248_11131272 | 3300009177 | Bacteria | 885 |
| 222 | Ga0105237_10246838 | 3300009545 | Bacteria | 1787 |
| 223 | Ga0105237_10250684 | 3300009545 | Bacteria | 1772 |
| 224 | Ga0105237_10274405 | 3300009545 | Bacteria | 1689 |
| 225 | Ga0105237_10428271 | 3300009545 | Bacteria | 1329 |
| 226 | Ga0105237_10508256 | 3300009545 | Bacteria | 1212 |
| 227 | Ga0105237_10627059 | 3300009545 | Bacteria | 1082 |
| 228 | Ga0105238_10150745 | 3300009551 | Bacteria | 2300 |
| 229 | Ga0105238_10479435 | 3300009551 | Bacteria | 1243 |
| 230 | Ga0105238_10776827 | 3300009551 | Bacteria | 973 |
| 231 | Ga0105249_10093817 | 3300009553 | Bacteria | 2812 |
| 232 | Ga0105249_10686765 | 3300009553 | Bacteria | 1083 |
| 233 | Ga0105249_10757514 | 3300009553 | Bacteria | 1033 |
| 234 | Ga0105249_12448209 | 3300009553 | Bacteria | 594 |
| 235 | Ga0099796_10059049 | 3300010159 | Bacteria | 1354 |
| 236 | Ga0099796_10278634 | 3300010159 | Bacteria | 702 |
| 237 | Ga0105239_10036703 | 3300010375 | Bacteria | 5377 |
| 238 | Ga0105239_10056258 | 3300010375 | Bacteria | 4315 |
| 239 | Ga0105239_10116383 | 3300010375 | Bacteria | 2966 |
| 240 | Ga0105239_10185057 | 3300010375 | Bacteria | 2331 |
| 241 | Ga0105239_10368977 | 3300010375 | Bacteria | 1622 |
| 242 | Ga0105239_11953304 | 3300010375 | Bacteria | 681 |
| 243 | Ga0105246_10128633 | 3300011119 | Bacteria | 1888 |
| 244 | Ga0105246_10151843 | 3300011119 | Bacteria | 1754 |
| 245 | Ga0105246_10588549 | 3300011119 | Bacteria | 959 |
| 246 | Ga0157370_10123619 | 3300013104 | Bacteria | 2416 |
| 247 | Ga0157370_10661840 | 3300013104 | Bacteria | 954 |
| 248 | Ga0157369_10014981 | 3300013105 | Bacteria | 8751 |
| 249 | Ga0157369_10019914 | 3300013105 | Bacteria | 7505 |
| 250 | Ga0157369_10355342 | 3300013105 | Bacteria | 1522 |
| 251 | Ga0157369_12342463 | 3300013105 | Bacteria | 541 |
| 252 | Ga0157374_10741471 | 3300013296 | Bacteria | 997 |
| 253 | Ga0157378_10069664 | 3300013297 | Bacteria | 3156 |
| 254 | Ga0157378_10100155 | 3300013297 | Bacteria | 2645 |
| 255 | Ga0157378_10345217 | 3300013297 | Bacteria | 1453 |
| 256 | Ga0157378_10683305 | 3300013297 | Bacteria | 1045 |
| 257 | Ga0157378_11024783 | 3300013297 | Bacteria | 860 |
| 258 | Ga0157378_11146833 | 3300013297 | Bacteria | 815 |
| 259 | Ga0163162_10030420 | 3300013306 | Bacteria | 5350 |
| 260 | Ga0163162_10613531 | 3300013306 | Bacteria | 1213 |
| 261 | Ga0163162_10961611 | 3300013306 | Bacteria | 965 |
| 262 | Ga0163162_11150631 | 3300013306 | Bacteria | 880 |
| 263 | Ga0163162_11468530 | 3300013306 | Bacteria | 776 |
| 264 | Ga0157375_11120442 | 3300013308 | Bacteria | 922 |
| 265 | Ga0157375_11497034 | 3300013308 | Bacteria | 796 |
| 266 | Ga0157375_12366936 | 3300013308 | Bacteria | 634 |
| 267 | Ga0163163_10564432 | 3300014325 | Bacteria | 1201 |
| 268 | Ga0163163_10819068 | 3300014325 | Bacteria | 994 |
| 269 | Ga0163163_11315323 | 3300014325 | Bacteria | 785 |
| 270 | Ga0157377_10209679 | 3300014745 | Bacteria | 1242 |
| 271 | Ga0157379_10803549 | 3300014968 | Bacteria | 888 |
| 272 | Ga0157379_11085431 | 3300014968 | Bacteria | 766 |
| 273 | Ga0163161_10172373 | 3300017792 | Bacteria | 1655 |
| 274 | Ga0163161_10311369 | 3300017792 | Bacteria | 1242 |
| 275 | Ga0163161_10480778 | 3300017792 | Bacteria | 1008 |
| 276 | Ga0206356_10635911 | 3300020070 | Bacteria | 769 |
| 277 | Ga0206353_11349222 | 3300020082 | Bacteria | 568 |
| 278 | Ga0213874_10032895 | 3300021377 | Bacteria | 1509 |
| 279 | Ga0213874_10052606 | 3300021377 | Bacteria | 1254 |
| 280 | Ga0213876_10025827 | 3300021384 | Bacteria | 3097 |
| 281 | Ga0213876_10444740 | 3300021384 | Bacteria | 689 |
| 282 | Ga0228598_1074783 | 3300024227 | Bacteria | 678 |
| 283 | Ga0209677_102539 | 3300025253 | Bacteria | 6752 |
| 284 | Ga0209758_1020919 | 3300025297 | Bacteria | 3072 |
| 285 | Ga0207656_10213684 | 3300025321 | Bacteria | 936 |
| 286 | Ga0207642_10325648 | 3300025899 | Bacteria | 899 |
| 287 | Ga0207710_10066554 | 3300025900 | Bacteria | 1644 |
| 288 | Ga0207710_10347655 | 3300025900 | Bacteria | 755 |
| 289 | Ga0207688_10263145 | 3300025901 | Bacteria | 1047 |
| 290 | Ga0207688_10269932 | 3300025901 | Bacteria | 1034 |
| 291 | Ga0207647_10366516 | 3300025904 | Bacteria | 815 |
| 292 | Ga0207685_10253547 | 3300025905 | Bacteria | 852 |
| 293 | Ga0207699_10578041 | 3300025906 | Bacteria | 817 |
| 294 | Ga0207645_10102294 | 3300025907 | Bacteria | 1849 |
| 295 | Ga0207645_10321249 | 3300025907 | Bacteria | 1032 |
| 296 | Ga0207705_10052106 | 3300025909 | Bacteria | 2945 |
| 297 | Ga0207705_10078949 | 3300025909 | Bacteria | 2396 |
| 298 | Ga0207684_10099553 | 3300025910 | Bacteria | 2483 |
| 299 | Ga0207684_10413970 | 3300025910 | Bacteria | 1158 |
| 300 | Ga0207654_10077443 | 3300025911 | Bacteria | 1993 |
| 301 | Ga0207707_10005224 | 3300025912 | Bacteria | 11380 |
| 302 | Ga0207707_10110069 | 3300025912 | Bacteria | 2407 |
| 303 | Ga0207695_10150869 | 3300025913 | Bacteria | 2263 |
| 304 | Ga0207695_10275211 | 3300025913 | Bacteria | 1578 |
| 305 | Ga0207671_10255621 | 3300025914 | Bacteria | 1378 |
| 306 | Ga0207671_10423586 | 3300025914 | Bacteria | 1059 |
| 307 | Ga0207693_10016029 | 3300025915 | Bacteria | 5998 |
| 308 | Ga0207693_10048081 | 3300025915 | Bacteria | 3350 |
| 309 | Ga0207693_10119608 | 3300025915 | Bacteria | 2069 |
| 310 | Ga0207663_10008904 | 3300025916 | Bacteria | 5278 |
| 311 | Ga0207663_10166444 | 3300025916 | Bacteria | 1562 |
| 312 | Ga0207660_10020207 | 3300025917 | Bacteria | 4466 |
| 313 | Ga0207660_10096383 | 3300025917 | Bacteria | 2202 |
| 314 | Ga0207660_10647041 | 3300025917 | Bacteria | 862 |
| 315 | Ga0207657_10120762 | 3300025919 | Bacteria | 2156 |
| 316 | Ga0207657_10633805 | 3300025919 | Bacteria | 833 |
| 317 | Ga0207652_10016767 | 3300025921 | Bacteria | 5985 |
| 318 | Ga0207652_11577688 | 3300025921 | Bacteria | 561 |
| 319 | Ga0207646_10288512 | 3300025922 | Bacteria | 1483 |
| 320 | Ga0207681_10250673 | 3300025923 | Bacteria | 1382 |
| 321 | Ga0207681_10372728 | 3300025923 | Bacteria | 1147 |
| 322 | Ga0207694_10152968 | 3300025924 | Bacteria | 1859 |
| 323 | Ga0207694_10525826 | 3300025924 | Bacteria | 991 |
| 324 | Ga0207650_10648728 | 3300025925 | Bacteria | 890 |
| 325 | Ga0207650_11412129 | 3300025925 | Bacteria | 592 |
| 326 | Ga0207659_10213269 | 3300025926 | Bacteria | 1549 |
| 327 | Ga0207659_10521549 | 3300025926 | Bacteria | 1007 |
| 328 | Ga0207659_11482829 | 3300025926 | Bacteria | 580 |
| 329 | Ga0207659_11597119 | 3300025926 | Bacteria | 557 |
| 330 | Ga0207687_10685226 | 3300025927 | Bacteria | 869 |
| 331 | Ga0207700_10130554 | 3300025928 | Bacteria | 2051 |
| 332 | Ga0207700_10156116 | 3300025928 | Bacteria | 1891 |
| 333 | Ga0207700_10466593 | 3300025928 | Bacteria | 1114 |
| 334 | Ga0207664_10457103 | 3300025929 | Bacteria | 1140 |
| 335 | Ga0207664_11331000 | 3300025929 | Bacteria | 638 |
| 336 | Ga0207644_10143378 | 3300025931 | Bacteria | 1842 |
| 337 | Ga0207690_10048739 | 3300025932 | Bacteria | 2819 |
| 338 | Ga0207690_10359404 | 3300025932 | Bacteria | 1153 |
| 339 | Ga0207690_10686801 | 3300025932 | Bacteria | 841 |
| 340 | Ga0207706_10072973 | 3300025933 | Bacteria | 3018 |
| 341 | Ga0207706_10552858 | 3300025933 | Bacteria | 991 |
| 342 | Ga0207709_10197650 | 3300025935 | Bacteria | 1434 |
| 343 | Ga0207709_10277053 | 3300025935 | Bacteria | 1237 |
| 344 | Ga0207670_10366598 | 3300025936 | Bacteria | 1144 |
| 345 | Ga0207669_10250204 | 3300025937 | Bacteria | 1319 |
| 346 | Ga0207704_10324428 | 3300025938 | Bacteria | 1189 |
| 347 | Ga0207665_10085571 | 3300025939 | Bacteria | 2177 |
| 348 | Ga0207665_10366057 | 3300025939 | Bacteria | 1091 |
| 349 | Ga0207665_10571813 | 3300025939 | Bacteria | 880 |
| 350 | Ga0207691_10309399 | 3300025940 | Bacteria | 1356 |
| 351 | Ga0207711_10046752 | 3300025941 | Bacteria | 3698 |
| 352 | Ga0207711_10351041 | 3300025941 | Bacteria | 1366 |
| 353 | Ga0207689_10041355 | 3300025942 | Bacteria | 3814 |
| 354 | Ga0207689_10311396 | 3300025942 | Bacteria | 1306 |
| 355 | Ga0207689_10777519 | 3300025942 | Bacteria | 808 |
| 356 | Ga0207679_10243490 | 3300025945 | Bacteria | 1525 |
| 357 | Ga0207679_10248660 | 3300025945 | Bacteria | 1510 |
| 358 | Ga0207667_10006683 | 3300025949 | Bacteria | 13944 |
| 359 | Ga0207667_10283365 | 3300025949 | Bacteria | 1693 |
| 360 | Ga0207667_10594352 | 3300025949 | Bacteria | 1116 |
| 361 | Ga0207712_10012948 | 3300025961 | Bacteria | 5339 |
| 362 | Ga0207668_10010526 | 3300025972 | Bacteria | 5591 |
| 363 | Ga0207668_10037590 | 3300025972 | Bacteria | 3241 |
| 364 | Ga0207668_10047779 | 3300025972 | Bacteria | 2932 |
| 365 | Ga0207668_10697619 | 3300025972 | Bacteria | 892 |
| 366 | Ga0207668_11035692 | 3300025972 | Bacteria | 734 |
| 367 | Ga0207668_11274381 | 3300025972 | Bacteria | 661 |
| 368 | Ga0207640_10365564 | 3300025981 | Bacteria | 1164 |
| 369 | Ga0207658_10665146 | 3300025986 | Bacteria | 939 |
| 370 | Ga0207677_10712367 | 3300026023 | Bacteria | 892 |
| 371 | Ga0207703_10097641 | 3300026035 | Bacteria | 2483 |
| 372 | Ga0207703_10526902 | 3300026035 | Bacteria | 1112 |
| 373 | Ga0207703_11477916 | 3300026035 | Bacteria | 654 |
| 374 | Ga0207639_10091196 | 3300026041 | Bacteria | 2439 |
| 375 | Ga0207639_10121012 | 3300026041 | Bacteria | 2150 |
| 376 | Ga0207639_10389903 | 3300026041 | Bacteria | 1252 |
| 377 | Ga0207678_10113826 | 3300026067 | Bacteria | 2308 |
| 378 | Ga0207678_10223993 | 3300026067 | Bacteria | 1610 |
| 379 | Ga0207678_10268474 | 3300026067 | Bacteria | 1463 |
| 380 | Ga0207678_10312257 | 3300026067 | Bacteria | 1352 |
| 381 | Ga0207678_10612757 | 3300026067 | Bacteria | 955 |
| 382 | Ga0207708_10008525 | 3300026075 | Bacteria | 7587 |
| 383 | Ga0207708_11148620 | 3300026075 | Bacteria | 678 |
| 384 | Ga0207702_10001047 | 3300026078 | Bacteria | 28331 |
| 385 | Ga0207702_10228565 | 3300026078 | Bacteria | 1737 |
| 386 | Ga0207702_10501271 | 3300026078 | Bacteria | 1184 |
| 387 | Ga0207641_10400936 | 3300026088 | Bacteria | 1317 |
| 388 | Ga0207648_10089994 | 3300026089 | Bacteria | 2681 |
| 389 | Ga0207648_10416531 | 3300026089 | Bacteria | 1219 |
| 390 | Ga0207648_10551587 | 3300026089 | Bacteria | 1059 |
| 391 | Ga0207676_10243216 | 3300026095 | Bacteria | 1615 |
| 392 | Ga0207676_11133763 | 3300026095 | Bacteria | 774 |
| 393 | Ga0207674_10012072 | 3300026116 | Bacteria | 9675 |
| 394 | Ga0207674_10348965 | 3300026116 | Bacteria | 1431 |
| 395 | Ga0207674_10419768 | 3300026116 | Bacteria | 1293 |
| 396 | Ga0207675_100028411 | 3300026118 | Bacteria | 5208 |
| 397 | Ga0207675_100188181 | 3300026118 | Bacteria | 1979 |
| 398 | Ga0207675_101432763 | 3300026118 | Bacteria | 711 |
| 399 | Ga0207683_10021347 | 3300026121 | Bacteria | 5542 |
| 400 | Ga0207683_10073609 | 3300026121 | Bacteria | 3022 |
| 401 | Ga0207683_10098824 | 3300026121 | Bacteria | 2604 |
| 402 | Ga0207683_10257155 | 3300026121 | Bacteria | 1594 |
| 403 | Ga0207683_10641244 | 3300026121 | Bacteria | 984 |
| 404 | Ga0207683_10863138 | 3300026121 | Bacteria | 840 |
| 405 | Ga0209588_1026891 | 3300027671 | Bacteria | 1829 |
| 406 | Ga0209588_1067060 | 3300027671 | Bacteria | 1160 |
| 407 | Ga0209813_10048772 | 3300027866 | Bacteria | 1316 |
| 408 | Ga0209813_10189949 | 3300027866 | Bacteria | 755 |
| 409 | Ga0207428_10197381 | 3300027907 | Bacteria | 1515 |
| 410 | Ga0207428_10483372 | 3300027907 | Bacteria | 901 |
| 411 | Ga0268266_10002184 | 3300028379 | Bacteria | 21420 |
| 412 | Ga0268266_10060151 | 3300028379 | Bacteria | 3274 |
| 413 | Ga0268266_10153118 | 3300028379 | Bacteria | 2080 |
| 414 | Ga0268266_10249767 | 3300028379 | Bacteria | 1640 |
| 415 | Ga0268266_10251536 | 3300028379 | Bacteria | 1635 |
| 416 | Ga0268266_10958335 | 3300028379 | Bacteria | 828 |
| 417 | Ga0268265_10072126 | 3300028380 | Bacteria | 2692 |
| 418 | Ga0268265_10213468 | 3300028380 | Bacteria | 1683 |
| 419 | Ga0268265_10498035 | 3300028380 | Bacteria | 1147 |
| 420 | Ga0268265_11175410 | 3300028380 | Bacteria | 764 |
| 421 | Ga0268264_10193987 | 3300028381 | Bacteria | 1853 |
| 422 | Ga0265337_1012602 | 3300028556 | Bacteria | 2867 |
| 423 | Ga0265326_10008399 | 3300028558 | Bacteria | 3116 |
| 424 | Ga0265319_1006169 | 3300028563 | Bacteria | 5595 |
| 425 | Ga0265334_10015261 | 3300028573 | Bacteria | 3194 |
| 426 | Ga0265318_10008945 | 3300028577 | Bacteria | 4434 |
| 427 | Ga0265323_10002476 | 3300028653 | Bacteria | 8450 |
| 428 | Ga0265336_10000431 | 3300028666 | Bacteria | 25844 |
| 429 | Ga0307517_10000008 | 3300028786 | Bacteria | 243202 |
| 430 | Ga0307517_10078607 | 3300028786 | Bacteria | 2850 |
| 431 | Ga0307515_10142057 | 3300028794 | Bacteria | 2568 |
| 432 | Ga0265338_10000321 | 3300028800 | Bacteria | 87046 |
| 433 | Ga0265324_10006568 | 3300029957 | Bacteria | 4822 |
| 434 | Ga0265330_10058161 | 3300031235 | Bacteria | 1685 |
| 435 | Ga0265330_10252262 | 3300031235 | Bacteria | 743 |
| 436 | Ga0265332_10065690 | 3300031238 | Bacteria | 1548 |
| 437 | Ga0265325_10020366 | 3300031241 | Bacteria | 3656 |
| 438 | Ga0265340_10007905 | 3300031247 | Bacteria | 5765 |
| 439 | Ga0265339_10021548 | 3300031249 | Bacteria | 3747 |
| 440 | Ga0265339_10100600 | 3300031249 | Bacteria | 1505 |
| 441 | Ga0265339_10241996 | 3300031249 | Bacteria | 876 |
| 442 | Ga0265331_10032416 | 3300031250 | Bacteria | 2589 |
| 443 | Ga0265316_10112992 | 3300031344 | Bacteria | 2056 |
| 444 | Ga0265316_10193425 | 3300031344 | Bacteria | 1510 |
| 445 | Ga0265316_10869292 | 3300031344 | Bacteria | 631 |
| 446 | Ga0307513_10303766 | 3300031456 | Bacteria | 1361 |
| 447 | Ga0307513_10309623 | 3300031456 | Bacteria | 1342 |
| 448 | Ga0307513_10792852 | 3300031456 | Bacteria | 653 |
| 449 | Ga0307408_100152852 | 3300031548 | Bacteria | 1824 |
| 450 | Ga0307508_10001469 | 3300031616 | Bacteria | 26436 |
| 451 | Ga0307508_10052684 | 3300031616 | Bacteria | 3613 |
| 452 | Ga0307508_10154913 | 3300031616 | Bacteria | 1895 |
| 453 | Ga0307508_10199081 | 3300031616 | Bacteria | 1604 |
| 454 | Ga0307508_10293192 | 3300031616 | Bacteria | 1220 |
| 455 | Ga0265314_10001300 | 3300031711 | Bacteria | 28304 |
| 456 | Ga0265314_10081181 | 3300031711 | Bacteria | 2138 |
| 457 | Ga0265342_10032530 | 3300031712 | Bacteria | 3216 |
| 458 | Ga0265342_10266819 | 3300031712 | Bacteria | 909 |
| 459 | Ga0307516_10017964 | 3300031730 | Bacteria | 7359 |
| 460 | Ga0307516_10040779 | 3300031730 | Bacteria | 4618 |
| 461 | Ga0307516_10203791 | 3300031730 | Bacteria | 1696 |
| 462 | Ga0307405_10070040 | 3300031731 | Bacteria | 2251 |
| 463 | Ga0307405_10775690 | 3300031731 | Bacteria | 801 |
| 464 | Ga0307406_10080793 | 3300031901 | Bacteria | 2160 |
| 465 | Ga0307411_10190555 | 3300032005 | Bacteria | 1565 |
| 466 | Ga0307411_10346930 | 3300032005 | Bacteria | 1209 |
| 467 | Ga0307415_100417269 | 3300032126 | Bacteria | 1151 |
| 468 | Ga0307510_10021118 | 3300033180 | Bacteria | 7594 |
| 469 | Ga0307510_10215430 | 3300033180 | Bacteria | 1438 |
| 470 | Ga0373934_0044142 | 3300035086 | Bacteria | 1762 |
| 471 | Ga0373934_0116328 | 3300035086 | Bacteria | 1086 |
| 472 | Ga0373934_0161369 | 3300035086 | Bacteria | 919 |
| 473 | Ga0373952_0114722 | 3300035092 | Bacteria | 725 |
| 474 | Ga0373923_0018239 | 3300035111 | Bacteria | 2698 |
| 475 | Ga0373923_0089817 | 3300035111 | Bacteria | 1342 |
| 476 | Ga0373936_0042259 | 3300035113 | Bacteria | 1829 |
| 477 | Ga0373936_0056361 | 3300035113 | Bacteria | 1597 |
| 478 | Ga0373941_0096687 | 3300035115 | Bacteria | 1022 |
| 479 | Ga0373945_0014945 | 3300035116 | Bacteria | 2607 |
| 480 | Ga0373945_0178031 | 3300035116 | Bacteria | 874 |
| 481 | Ga0373945_0243287 | 3300035116 | Bacteria | 758 |
| 482 | Ga0373953_0001115 | 3300035117 | Bacteria | 7602 |
| 483 | Ga0373954_0005560 | 3300035118 | Bacteria | 5458 |
| 484 | Ga0373954_0027484 | 3300035118 | Bacteria | 2612 |
| 485 | Ga0373954_0065815 | 3300035118 | Bacteria | 1715 |
| 486 | Ga0373956_0000298 | 3300035119 | Bacteria | 20024 |
| 487 | Ga0373956_0033906 | 3300035119 | Bacteria | 2247 |
| 488 | Ga0373957_0001343 | 3300035120 | Bacteria | 6603 |
| 489 | Ga0373957_0023830 | 3300035120 | Bacteria | 2192 |
| 490 | Ga0373943_0002164 | 3300035170 | Bacteria | 8932 |
| 491 | Ga0373943_0008246 | 3300035170 | Bacteria | 4676 |
| 492 | Ga0373946_0013431 | 3300035171 | Bacteria | 3079 |
| 493 | Ga0373946_0482912 | 3300035171 | Bacteria | 634 |
| 494 | Ga0373955_0004260 | 3300035172 | Bacteria | 6318 |
| 495 | Ga0373955_0130494 | 3300035172 | Bacteria | 1467 |
| 496 | Ga0373942_0068932 | 3300035207 | Bacteria | 1029 |
| 497 | Ga0373924_0004379 | 3300035410 | Bacteria | 4927 |
| 498 | Ga0373924_0073751 | 3300035410 | Bacteria | 1443 |
| 499 | Ga0373924_0096122 | 3300035410 | Bacteria | 1271 |
| 500 | Ga0373931_0001282 | 3300035691 | Bacteria | 10731 |
| 501 | Ga0373931_0132728 | 3300035691 | Bacteria | 1435 |
| 502 | Ga0373935_0000186 | 3300035692 | Bacteria | 29290 |
| 503 | Ga0373935_0010424 | 3300035692 | Bacteria | 5573 |
| 504 | Ga0373935_0090898 | 3300035692 | Bacteria | 1999 |
| 505 | Ga0373935_0212816 | 3300035692 | Bacteria | 1340 |
| 506 | Ga0373935_0817078 | 3300035692 | Bacteria | 689 |
| 507 | Ga0373927_0001401 | 3300035695 | Bacteria | 18162 |
| 508 | Ga0373927_0002108 | 3300035695 | Bacteria | 14684 |
| 509 | Ga0373927_0004095 | 3300035695 | Bacteria | 10272 |
| 510 | Ga0373927_0023017 | 3300035695 | Bacteria | 4081 |
| 511 | Ga0373927_0087741 | 3300035695 | Bacteria | 2019 |
| 512 | Ga0373927_0113572 | 3300035695 | Bacteria | 1765 |
| 513 | Ga0373927_0163659 | 3300035695 | Bacteria | 1458 |
| 514 | Ga0373933_0000368 | 3300035724 | Bacteria | 28785 |
| 515 | Ga0373947_0001325 | 3300035725 | Bacteria | 15237 |
| 516 | Ga0373947_0003597 | 3300035725 | Bacteria | 9141 |
| 517 | Ga0373947_0024113 | 3300035725 | Bacteria | 3543 |
| 518 | Ga0373947_0089206 | 3300035725 | Bacteria | 1920 |
| 519 | Ga0373947_0457516 | 3300035725 | Bacteria | 865 |
| 520 | Ga0373947_0584674 | 3300035725 | Bacteria | 761 |
| 521 | Ga0373937_0009543 | 3300036401 | Bacteria | 8442 |
| 522 | Ga0373937_0115123 | 3300036401 | Bacteria | 2503 |
| 523 | Ga0373937_0791555 | 3300036401 | Bacteria | 896 |
| 524 | Ga0372808_034869 | 3300036459 | Bacteria | 722 |
| 525 | Ga0373925_0002553 | 3300037068 | Bacteria | 14496 |
| 526 | Ga0373925_0006241 | 3300037068 | Bacteria | 8794 |
| 527 | Ga0373925_0037874 | 3300037068 | Bacteria | 3562 |
| 528 | Ga0373925_0047807 | 3300037068 | Bacteria | 3186 |
| 529 | Ga0373925_0051335 | 3300037068 | Bacteria | 3078 |
| 530 | Ga0373925_0253610 | 3300037068 | Bacteria | 1411 |
| 531 | Ga0373925_0260018 | 3300037068 | Bacteria | 1394 |
| 532 | Ga0373925_0518173 | 3300037068 | Bacteria | 980 |
| 533 | Ga0395899_0089491 | 3300037312 | Bacteria | 2233 |
| 534 | Ga0395899_0137482 | 3300037312 | Bacteria | 1741 |
| 535 | Ga0395900_0000820 | 3300037418 | Bacteria | 41179 |
| 536 | Ga0395900_0181596 | 3300037418 | Bacteria | 2138 |
| 537 | Ga0395900_0908025 | 3300037418 | Bacteria | 804 |
| 538 | Ga0395898_0114094 | 3300037466 | Bacteria | 2589 |
| 539 | Ga0395898_0309154 | 3300037466 | Bacteria | 1508 |
| 540 | Ga0395898_0321370 | 3300037466 | Bacteria | 1476 |
| 541 | Ga0395905_0100918 | 3300037471 | Bacteria | 2710 |
| 542 | Ga0395905_0399577 | 3300037471 | Bacteria | 1269 |
| 543 | Ga0395905_0761596 | 3300037471 | Bacteria | 871 |
| 544 | Ga0395905_0779759 | 3300037471 | Bacteria | 859 |
| 545 | Ga0436364_0385142 | 3300037853 | Bacteria | 674 |
| 546 | Ga0436364_1460540 | 3300037853 | Bacteria | 3250 |
| 547 | Ga0395901_0051601 | 3300038443 | Bacteria | 4277 |
| 548 | Ga0395901_0102492 | 3300038443 | Bacteria | 3004 |
| 549 | Ga0395901_0158993 | 3300038443 | Bacteria | 2373 |
| 550 | Ga0395901_1391837 | 3300038443 | Bacteria | 660 |
| 551 | Ga0436365_0103592 | 3300039437 | Bacteria | 616 |
| 552 | Ga0436365_0510664 | 3300039437 | Bacteria | 655 |
| 553 | Ga0436365_0609277 | 3300039437 | Bacteria | 1089 |
| 554 | Ga0436365_0735123 | 3300039437 | Bacteria | 2322 |
| 555 | Ga0436365_0990941 | 3300039437 | Bacteria | 5991 |
| 556 | Ga0436365_1617397 | 3300039437 | Bacteria | 1328 |
| 557 | Ga0436360_0202328 | 3300039438 | Bacteria | 4827 |
| 558 | Ga0436360_0310567 | 3300039438 | Bacteria | 608 |
| 559 | Ga0436360_0593081 | 3300039438 | Bacteria | 1979 |
| 560 | Ga0436360_0947574 | 3300039438 | Bacteria | 1550 |
| 561 | Ga0436360_1159963 | 3300039438 | Bacteria | 704 |
| 562 | Ga0436360_1365633 | 3300039438 | Bacteria | 817 |
| 563 | Ga0436360_1376600 | 3300039438 | Bacteria | 4137 |
| 564 | Ga0436361_0023933 | 3300039447 | Bacteria | 2105 |
| 565 | Ga0436363_0951156 | 3300039450 | Bacteria | 1398 |
| 566 | Ga0436363_1200350 | 3300039450 | Bacteria | 1547 |
| 567 | Ga0436362_1182516 | 3300039453 | Bacteria | 770 |
| 568 | Ga0439465_0027021 | 3300041413 | Bacteria | 1816 |
| 569 | Ga0451791_0227239 | 3300041451 | Bacteria | 636 |
| 570 | Ga0451791_1046831 | 3300041451 | Bacteria | 814 |
| 571 | Ga0451793_0175087 | 3300041452 | Bacteria | 559 |
| 572 | Ga0451797_1036343 | 3300041453 | Bacteria | 941 |
| 573 | Ga0451802_0491935 | 3300041460 | Bacteria | 585 |
| 574 | Ga0451802_1397736 | 3300041460 | Bacteria | 729 |
| 575 | Ga0451837_1228415 | 3300041494 | Bacteria | 591 |
| 576 | Ga0451853_2172712 | 3300041512 | Bacteria | 682 |
| 577 | Ga0439458_0056731 | 3300042157 | Bacteria | 973 |
| 578 | Ga0439459_0004861 | 3300042438 | Bacteria | 2182 |
| 579 | Ga0466966_0057074 | 3300044684 | Bacteria | 2469 |
| 580 | Ga0466966_0229282 | 3300044684 | Bacteria | 1121 |
| 581 | Ga0466968_0383344 | 3300044735 | Bacteria | 687 |
| 582 | Ga0466959_0159592 | 3300045049 | Bacteria | 1586 |
| 583 | Ga0466967_0840694 | 3300045976 | Bacteria | 912 |
| 584 | Ga0495617_017617 | 3300046452 | Bacteria | 2414 |
| 585 | Ga0495592_0001299 | 3300046454 | Bacteria | 17352 |
| 586 | Ga0495592_0098492 | 3300046454 | Bacteria | 2086 |
| 587 | Ga0495603_0001707 | 3300046455 | Bacteria | 12934 |
| 588 | Ga0495603_0002520 | 3300046455 | Bacteria | 10781 |
| 589 | Ga0495603_0025039 | 3300046455 | Bacteria | 3609 |
| 590 | Ga0495603_0108439 | 3300046455 | Bacteria | 1620 |
| 591 | Ga0495629_0000606 | 3300046459 | Bacteria | 29232 |
| 592 | Ga0495629_0012153 | 3300046459 | Bacteria | 6240 |
| 593 | Ga0495629_0188199 | 3300046459 | Bacteria | 1429 |
| 594 | Ga0495638_0046286 | 3300046460 | Bacteria | 2734 |
| 595 | Ga0495638_0455007 | 3300046460 | Bacteria | 653 |
| 596 | Ga0495638_0492508 | 3300046460 | Bacteria | 619 |
| 597 | Ga0495651_0031188 | 3300046462 | Bacteria | 4158 |
| 598 | Ga0495651_0034272 | 3300046462 | Bacteria | 3957 |
| 599 | Ga0495653_0035879 | 3300046463 | Bacteria | 3910 |
| 600 | Ga0495653_0053884 | 3300046463 | Bacteria | 3075 |
| 601 | Ga0495650_0108601 | 3300046471 | Bacteria | 1033 |
| 602 | Ga0495580_0001307 | 3300046472 | Bacteria | 21998 |
| 603 | Ga0495580_0075345 | 3300046472 | Bacteria | 2354 |
| 604 | Ga0495580_0135889 | 3300046472 | Bacteria | 1705 |
| 605 | Ga0495580_0235487 | 3300046472 | Bacteria | 1256 |
| 606 | Ga0495639_0000136 | 3300046475 | Bacteria | 37792 |
| 607 | Ga0495662_0000392 | 3300046476 | Bacteria | 19571 |
| 608 | Ga0495662_0001286 | 3300046476 | Bacteria | 12410 |
| 609 | Ga0495664_0000270 | 3300046477 | Bacteria | 24785 |
| 610 | Ga0495664_0009869 | 3300046477 | Bacteria | 5354 |
| 611 | Ga0495664_0010089 | 3300046477 | Bacteria | 5298 |
| 612 | Ga0495664_0055223 | 3300046477 | Bacteria | 2363 |
| 613 | Ga0495664_0061267 | 3300046477 | Bacteria | 2241 |
| 614 | Ga0495664_0094961 | 3300046477 | Bacteria | 1795 |
| 615 | Ga0495664_0136765 | 3300046477 | Bacteria | 1485 |
| 616 | Ga0495664_0228519 | 3300046477 | Bacteria | 1126 |
| 617 | Ga0495584_0061716 | 3300046491 | Bacteria | 1884 |
| 618 | Ga0495585_0087422 | 3300046492 | Bacteria | 1682 |
| 619 | Ga0495594_0000843 | 3300046499 | Bacteria | 15801 |
| 620 | Ga0495594_0059578 | 3300046499 | Bacteria | 2112 |
| 621 | Ga0495596_0149365 | 3300046500 | Bacteria | 908 |
| 622 | Ga0495607_0356540 | 3300046501 | Bacteria | 674 |
| 623 | Ga0495583_0191397 | 3300046506 | Bacteria | 834 |
| 624 | Ga0495583_0265526 | 3300046506 | Bacteria | 686 |
| 625 | Ga0495606_0003785 | 3300046507 | Bacteria | 15720 |
| 626 | Ga0495606_0130863 | 3300046507 | Bacteria | 1492 |
| 627 | Ga0495606_0193050 | 3300046507 | Bacteria | 1166 |
| 628 | Ga0495608_0008627 | 3300046511 | Bacteria | 7136 |
| 629 | Ga0495610_0102076 | 3300046512 | Bacteria | 1283 |
| 630 | Ga0495610_0191172 | 3300046512 | Bacteria | 845 |
| 631 | Ga0495616_0077966 | 3300046513 | Bacteria | 1590 |
| 632 | Ga0495618_0001241 | 3300046514 | Bacteria | 17254 |
| 633 | Ga0495618_0214507 | 3300046514 | Bacteria | 1216 |
| 634 | Ga0495620_0058290 | 3300046515 | Bacteria | 1617 |
| 635 | Ga0495628_0053564 | 3300046516 | Bacteria | 3183 |
| 636 | Ga0495628_0085243 | 3300046516 | Bacteria | 2451 |
| 637 | Ga0495628_0435215 | 3300046516 | Bacteria | 954 |
| 638 | Ga0495630_0235212 | 3300046517 | Bacteria | 1400 |
| 639 | Ga0495630_0285172 | 3300046517 | Bacteria | 1262 |
| 640 | Ga0495631_0286002 | 3300046518 | Bacteria | 702 |
| 641 | Ga0495632_0124882 | 3300046519 | Bacteria | 1200 |
| 642 | Ga0495644_0112986 | 3300046523 | Bacteria | 1031 |
| 643 | Ga0495644_0196056 | 3300046523 | Bacteria | 778 |
| 644 | Ga0495648_0005884 | 3300046524 | Bacteria | 10080 |
| 645 | Ga0495666_0025780 | 3300046526 | Bacteria | 2903 |
| 646 | Ga0495666_0162264 | 3300046526 | Bacteria | 1036 |
| 647 | Ga0495652_0082944 | 3300046529 | Bacteria | 2640 |
| 648 | Ga0495652_0101851 | 3300046529 | Bacteria | 2327 |
| 649 | Ga0495652_0194649 | 3300046529 | Bacteria | 1544 |
| 650 | Ga0495652_0268062 | 3300046529 | Bacteria | 1256 |
| 651 | Ga0495652_0620996 | 3300046529 | Bacteria | 735 |
| 652 | Ga0495665_0000026 | 3300046531 | Bacteria | 56855 |
| 653 | Ga0495665_0005893 | 3300046531 | Bacteria | 6598 |
| 654 | Ga0495640_0008255 | 3300046533 | Bacteria | 8173 |
| 655 | Ga0495640_0019925 | 3300046533 | Bacteria | 4946 |
| 656 | Ga0495640_0032516 | 3300046533 | Bacteria | 3715 |
| 657 | Ga0495640_0038540 | 3300046533 | Bacteria | 3361 |
| 658 | Ga0495640_0089605 | 3300046533 | Bacteria | 2031 |
| 659 | Ga0495640_0312686 | 3300046533 | Bacteria | 974 |
| 660 | Ga0495586_0109545 | 3300046535 | Bacteria | 1536 |
| 661 | Ga0495587_0019713 | 3300046536 | Bacteria | 4171 |
| 662 | Ga0495587_0081199 | 3300046536 | Bacteria | 1878 |
| 663 | Ga0495598_0005787 | 3300046537 | Bacteria | 2761 |
| 664 | Ga0495598_0094724 | 3300046537 | Bacteria | 979 |
| 665 | Ga0495598_0343710 | 3300046537 | Bacteria | 573 |
| 666 | Ga0495621_0014542 | 3300046539 | Bacteria | 2492 |
| 667 | Ga0495621_0095710 | 3300046539 | Bacteria | 1125 |
| 668 | Ga0495597_0230225 | 3300046542 | Bacteria | 733 |
| 669 | Ga0495645_0007214 | 3300046543 | Bacteria | 7736 |
| 670 | Ga0495645_0013176 | 3300046543 | Bacteria | 5845 |
| 671 | Ga0495645_0035707 | 3300046543 | Bacteria | 3623 |
| 672 | Ga0495645_0150289 | 3300046543 | Bacteria | 1619 |
| 673 | Ga0495645_0378859 | 3300046543 | Bacteria | 906 |
| 674 | Ga0495622_0002841 | 3300046557 | Bacteria | 8260 |
| 675 | Ga0495633_0096722 | 3300046558 | Bacteria | 1371 |
| 676 | Ga0495633_0115874 | 3300046558 | Bacteria | 1242 |
| 677 | Ga0495667_0028023 | 3300046559 | Bacteria | 3793 |
| 678 | Ga0495667_0047064 | 3300046559 | Bacteria | 2850 |
| 679 | Ga0495667_0048749 | 3300046559 | Bacteria | 2796 |
| 680 | Ga0495667_0113143 | 3300046559 | Bacteria | 1754 |
| 681 | Ga0495667_0128776 | 3300046559 | Bacteria | 1633 |
| 682 | Ga0495656_0057916 | 3300046615 | Bacteria | 1679 |
| 683 | Ga0495656_0236232 | 3300046615 | Bacteria | 919 |
| 684 | Ga0495656_0334263 | 3300046615 | Bacteria | 782 |
| 685 | Ga0495668_0268273 | 3300046616 | Bacteria | 935 |
| 686 | Ga0495668_0341131 | 3300046616 | Bacteria | 822 |
| 687 | Ga0495634_0000634 | 3300046642 | Bacteria | 34163 |
| 688 | Ga0495634_0023387 | 3300046642 | Bacteria | 4344 |
| 689 | Ga0495634_0042420 | 3300046642 | Bacteria | 3086 |
| 690 | Ga0495634_0043498 | 3300046642 | Bacteria | 3043 |
| 691 | Ga0495611_0094639 | 3300046648 | Bacteria | 1382 |
| 692 | Ga0495611_0255654 | 3300046648 | Bacteria | 812 |
| 693 | Ga0495611_0419225 | 3300046648 | Bacteria | 611 |
| 694 | Ga0495625_0217787 | 3300046660 | Bacteria | 1252 |
| 695 | Ga0495625_0370258 | 3300046660 | Bacteria | 901 |
| 696 | Ga0495625_0526124 | 3300046660 | Bacteria | 719 |
| 697 | Ga0495635_0000827 | 3300046663 | Bacteria | 20282 |
| 698 | Ga0495635_0001564 | 3300046663 | Bacteria | 15359 |
| 699 | Ga0495635_0002063 | 3300046663 | Bacteria | 13613 |
| 700 | Ga0495635_0137115 | 3300046663 | Bacteria | 1667 |
| 701 | Ga0495588_0050578 | 3300046674 | Bacteria | 2138 |
| 702 | Ga0495588_0358914 | 3300046674 | Bacteria | 766 |
| 703 | Ga0495657_0032998 | 3300046675 | Bacteria | 3608 |
| 704 | Ga0495657_0042292 | 3300046675 | Bacteria | 3112 |
| 705 | Ga0495657_0150903 | 3300046675 | Bacteria | 1443 |
| 706 | Ga0495657_0258231 | 3300046675 | Bacteria | 1047 |
| 707 | Ga0495599_0074009 | 3300046678 | Bacteria | 2126 |
| 708 | Ga0495599_0167839 | 3300046678 | Bacteria | 1355 |
| 709 | Ga0495599_0311306 | 3300046678 | Bacteria | 949 |
| 710 | Ga0495623_0004722 | 3300046679 | Bacteria | 8951 |
| 711 | Ga0495623_0039351 | 3300046679 | Bacteria | 3022 |
| 712 | Ga0495646_0026783 | 3300046680 | Bacteria | 3618 |
| 713 | Ga0495646_0054824 | 3300046680 | Bacteria | 2396 |
| 714 | Ga0495646_0209439 | 3300046680 | Bacteria | 1058 |
| 715 | Ga0495658_0002383 | 3300046683 | Bacteria | 9484 |
| 716 | Ga0495669_0032965 | 3300046684 | Bacteria | 2279 |
| 717 | Ga0495669_0108934 | 3300046684 | Bacteria | 1292 |
| 718 | Ga0495669_0182944 | 3300046684 | Bacteria | 999 |
| 719 | Ga0495613_0017331 | 3300046689 | Bacteria | 5367 |
| 720 | Ga0495613_0025652 | 3300046689 | Bacteria | 4392 |
| 721 | Ga0495613_0072434 | 3300046689 | Bacteria | 2511 |
| 722 | Ga0495613_0082704 | 3300046689 | Bacteria | 2332 |
| 723 | Ga0495624_0000201 | 3300046690 | Bacteria | 45984 |
| 724 | Ga0495624_0013947 | 3300046690 | Bacteria | 5471 |
| 725 | Ga0495670_0242639 | 3300046691 | Bacteria | 959 |
| 726 | Ga0495671_0374117 | 3300046692 | Bacteria | 683 |
| 727 | Ga0495649_0229220 | 3300046694 | Bacteria | 959 |
| 728 | Ga0495589_0431725 | 3300046794 | Bacteria | 603 |
| 729 | Ga0495600_0024231 | 3300046809 | Bacteria | 3905 |
| 730 | Ga0495600_0025302 | 3300046809 | Bacteria | 3825 |
| 731 | Ga0495600_0075575 | 3300046809 | Bacteria | 2200 |
| 732 | Ga0495600_0379276 | 3300046809 | Bacteria | 882 |
| 733 | Ga0495581_0000828 | 3300047315 | Bacteria | 16501 |
| 734 | Ga0495581_0036031 | 3300047315 | Bacteria | 2862 |
| 735 | Ga0495581_0452719 | 3300047315 | Bacteria | 747 |
| 736 | Ga0495604_0052770 | 3300047317 | Bacteria | 3146 |
| 737 | Ga0495604_0119901 | 3300047317 | Bacteria | 1905 |
| 738 | Ga0495604_0879966 | 3300047317 | Bacteria | 560 |
| 739 | Ga0495674_0002806 | 3300047319 | Bacteria | 16925 |
| 740 | Ga0495674_0070830 | 3300047319 | Bacteria | 3012 |
| 741 | Ga0495674_0076190 | 3300047319 | Bacteria | 2885 |
| 742 | Ga0495674_0455893 | 3300047319 | Bacteria | 1027 |
| 743 | Ga0495674_0907565 | 3300047319 | Bacteria | 680 |
| 744 | Ga0495672_0016840 | 3300047320 | Bacteria | 4905 |
| 745 | Ga0495672_0036995 | 3300047320 | Bacteria | 2991 |
| 746 | Ga0495672_0064097 | 3300047320 | Bacteria | 2105 |
| 747 | Ga0495676_0018819 | 3300047321 | Bacteria | 6087 |
| 748 | Ga0495676_0127854 | 3300047321 | Bacteria | 1839 |
| 749 | Ga0495676_0218246 | 3300047321 | Bacteria | 1316 |
| 750 | Ga0495680_0068454 | 3300047322 | Bacteria | 2712 |
| 751 | Ga0495680_0434811 | 3300047322 | Bacteria | 900 |
| 752 | Ga0495680_0497209 | 3300047322 | Bacteria | 828 |
| 753 | Ga0495675_0130176 | 3300047444 | Bacteria | 1564 |
| 754 | Ga0495675_0713985 | 3300047444 | Bacteria | 560 |
| 755 | Ga0495677_0025572 | 3300047445 | Bacteria | 2142 |
| 756 | Ga0495677_0069072 | 3300047445 | Bacteria | 1316 |
| 757 | Ga0495673_0026878 | 3300047469 | Bacteria | 2745 |
| 758 | Ga0495673_0105254 | 3300047469 | Bacteria | 1135 |
| 759 | Ga0495681_0157067 | 3300047470 | Bacteria | 950 |
| 760 | Ga0495684_0002851 | 3300047471 | Bacteria | 13604 |
| 761 | Ga0495684_0004084 | 3300047471 | Bacteria | 11397 |
| 762 | Ga0495684_0034305 | 3300047471 | Bacteria | 3893 |
| 763 | Ga0495684_0051065 | 3300047471 | Bacteria | 3156 |
| 764 | Ga0495686_0076032 | 3300047472 | Bacteria | 2058 |
| 765 | Ga0495686_0334789 | 3300047472 | Bacteria | 826 |
| 766 | Ga0495593_0000282 | 3300047673 | Bacteria | 27666 |
| 767 | Ga0495593_0001509 | 3300047673 | Bacteria | 13687 |
| 768 | Ga0495593_0071261 | 3300047673 | Bacteria | 1805 |
| 769 | Ga0495602_0089153 | 3300048088 | Bacteria | 2565 |
| 770 | Ga0495602_0221809 | 3300048088 | Bacteria | 1426 |
| 771 | Ga0495602_0744782 | 3300048088 | Bacteria | 662 |
| 772 | Ga0495614_0016341 | 3300048089 | Bacteria | 3231 |
| 773 | Ga0495614_0084256 | 3300048089 | Bacteria | 1379 |
| 774 | Ga0496100_0110399 | 3300048903 | Bacteria | 1909 |
| 775 | Ga0496100_0189176 | 3300048903 | Bacteria | 1493 |
| 776 | Ga0496100_0342336 | 3300048903 | Bacteria | 1128 |
| 777 | Ga0496100_0417110 | 3300048903 | Bacteria | 1025 |
| 778 | Ga0496100_0963612 | 3300048903 | Bacteria | 671 |
| 779 | Ga0496101_0194247 | 3300048904 | Bacteria | 1567 |
| 780 | Ga0496101_0296917 | 3300048904 | Bacteria | 1265 |
| 781 | Ga0496101_0333774 | 3300048904 | Bacteria | 1190 |
| 782 | Ga0496102_0008807 | 3300048905 | Bacteria | 8657 |
| 783 | Ga0496102_0099366 | 3300048905 | Bacteria | 2701 |
| 784 | Ga0496102_0191576 | 3300048905 | Bacteria | 1927 |
| 785 | Ga0496102_0344613 | 3300048905 | Bacteria | 1403 |
| 786 | Ga0496102_0663711 | 3300048905 | Bacteria | 966 |
| 787 | Ga0496103_0044481 | 3300048906 | Bacteria | 2736 |
| 788 | Ga0496103_0105501 | 3300048906 | Bacteria | 1787 |
| 789 | Ga0496103_0386032 | 3300048906 | Bacteria | 900 |
| 790 | Ga0496104_0257040 | 3300048907 | Bacteria | 1659 |
| 791 | Ga0496104_0450104 | 3300048907 | Bacteria | 1199 |
| 792 | Ga0496104_1126915 | 3300048907 | Bacteria | 688 |
| 793 | Ga0496105_0079259 | 3300048908 | Bacteria | 2712 |
| 794 | Ga0496106_0069840 | 3300048909 | Bacteria | 2682 |
| 795 | Ga0496106_0323858 | 3300048909 | Bacteria | 1237 |
| 796 | Ga0496106_0518655 | 3300048909 | Bacteria | 957 |
| 797 | Ga0496107_0151120 | 3300048910 | Bacteria | 1718 |
| 798 | Ga0496107_0253210 | 3300048910 | Bacteria | 1310 |
| 799 | Ga0496107_0254912 | 3300048910 | Bacteria | 1305 |
| 800 | Ga0496107_0377745 | 3300048910 | Bacteria | 1054 |
| 801 | Ga0496108_0181500 | 3300048911 | Bacteria | 1823 |
| 802 | Ga0496108_0789013 | 3300048911 | Bacteria | 820 |
| 803 | Ga0496108_1063475 | 3300048911 | Bacteria | 689 |
| 804 | Ga0496109_0151869 | 3300048912 | Bacteria | 2168 |
| 805 | Ga0496109_0521919 | 3300048912 | Bacteria | 1121 |
| 806 | Ga0496109_0758475 | 3300048912 | Bacteria | 908 |
| 807 | Ga0496109_1003953 | 3300048912 | Bacteria | 772 |
| 808 | Ga0496109_1015126 | 3300048912 | Bacteria | 767 |
| 809 | Ga0496109_1079124 | 3300048912 | Bacteria | 740 |
| 810 | Ga0496109_1110391 | 3300048912 | Bacteria | 728 |
| 811 | Ga0496110_0260504 | 3300048913 | Bacteria | 1578 |
| 812 | Ga0496110_0535726 | 3300048913 | Bacteria | 1065 |
| 813 | Ga0496111_0188051 | 3300048914 | Bacteria | 1535 |
| 814 | Ga0496111_0480752 | 3300048914 | Bacteria | 915 |
| 815 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 816 | Ga0496112_0191499 | 3300048915 | Bacteria | 2007 |
| 817 | Ga0496112_0273967 | 3300048915 | Bacteria | 1635 |
| 818 | Ga0496112_0313284 | 3300048915 | Bacteria | 1514 |
| 819 | Ga0496112_0678446 | 3300048915 | Bacteria | 959 |
| 820 | Ga0496113_0144862 | 3300048916 | Bacteria | 1871 |
| 821 | Ga0496113_0253806 | 3300048916 | Bacteria | 1404 |
| 822 | Ga0496113_0318662 | 3300048916 | Bacteria | 1246 |
| 823 | Ga0496113_0395239 | 3300048916 | Bacteria | 1110 |
| 824 | Ga0496113_0831487 | 3300048916 | Bacteria | 733 |
| 825 | Ga0496114_0234728 | 3300048917 | Bacteria | 1612 |
| 826 | Ga0496114_0256196 | 3300048917 | Bacteria | 1540 |
| 827 | Ga0496114_0581675 | 3300048917 | Bacteria | 988 |
| 828 | Ga0496114_0625973 | 3300048917 | Bacteria | 948 |
| 829 | Ga0496114_1091143 | 3300048917 | Bacteria | 683 |
| 830 | Ga0496115_0000864 | 3300048918 | Bacteria | 22018 |
| 831 | Ga0496115_0008261 | 3300048918 | Bacteria | 7694 |
| 832 | Ga0496115_0074212 | 3300048918 | Bacteria | 2762 |
| 833 | Ga0496115_0206686 | 3300048918 | Bacteria | 1622 |
| 834 | Ga0496115_1164900 | 3300048918 | Bacteria | 581 |
| 835 | Ga0496117_0049280 | 3300048920 | Bacteria | 2998 |
| 836 | Ga0496117_0285350 | 3300048920 | Bacteria | 882 |
| 837 | Ga0496118_0214194 | 3300048921 | Bacteria | 1127 |
| 838 | Ga0496121_0000657 | 3300048924 | Bacteria | 64819 |
| 839 | Ga0496121_0002279 | 3300048924 | Bacteria | 29850 |
| 840 | Ga0496121_0184644 | 3300048924 | Bacteria | 1501 |
| 841 | Ga0496121_0358223 | 3300048924 | Bacteria | 969 |
| 842 | Ga0496124_0139856 | 3300048927 | Bacteria | 1912 |
| 843 | Ga0496124_0454716 | 3300048927 | Bacteria | 872 |
| 844 | Ga0496125_0000060 | 3300048928 | Bacteria | 264143 |
| 845 | Ga0496125_0000838 | 3300048928 | Bacteria | 49466 |
| 846 | Ga0496125_0096787 | 3300048928 | Bacteria | 2190 |
| 847 | Ga0496125_0124092 | 3300048928 | Bacteria | 1834 |
| 848 | Ga0496125_0173128 | 3300048928 | Bacteria | 1448 |
| 849 | Ga0496125_0407700 | 3300048928 | Bacteria | 792 |
| 850 | Ga0496126_0009539 | 3300048929 | Bacteria | 10296 |
| 851 | Ga0496126_0028827 | 3300048929 | Bacteria | 5283 |
| 852 | Ga0496126_0041794 | 3300048929 | Bacteria | 4239 |
| 853 | Ga0496126_0050977 | 3300048929 | Bacteria | 3771 |
| 854 | Ga0496126_0071312 | 3300048929 | Bacteria | 3092 |
| 855 | Ga0496126_0118516 | 3300048929 | Bacteria | 2298 |
| 856 | Ga0496126_0121857 | 3300048929 | Bacteria | 2261 |
| 857 | Ga0496126_0141964 | 3300048929 | Bacteria | 2066 |
| 858 | Ga0496126_0253973 | 3300048929 | Bacteria | 1464 |
| 859 | Ga0496126_0378151 | 3300048929 | Bacteria | 1153 |
| 860 | Ga0496126_0544304 | 3300048929 | Bacteria | 922 |
| 861 | Ga0496126_0585165 | 3300048929 | Bacteria | 881 |
| 862 | Ga0496126_0736047 | 3300048929 | Bacteria | 763 |
| 863 | Ga0496126_0926954 | 3300048929 | Bacteria | 658 |
| 864 | Ga0495678_048806 | 3300049459 | Bacteria | 1649 |
| 865 | Ga0501031_0004192 | 3300049568 | Bacteria | 9316 |
| 866 | Ga0501031_0260182 | 3300049568 | Bacteria | 1128 |
| 867 | Ga0501032_0000216 | 3300049569 | Bacteria | 47842 |
| 868 | Ga0501033_0000344 | 3300049570 | Bacteria | 44238 |
| 869 | Ga0501034_0000100 | 3300049571 | Bacteria | 159536 |
| 870 | Ga0501036_0000010 | 3300049572 | Bacteria | 163304 |
| 871 | Ga0501036_0254617 | 3300049572 | Bacteria | 1471 |
| 872 | Ga0501037_0000704 | 3300049573 | Bacteria | 25447 |
| 873 | Ga0501038_0000350 | 3300049574 | Bacteria | 39547 |
| 874 | Ga0501039_0001013 | 3300049575 | Bacteria | 20468 |
| 875 | Ga0501042_0046127 | 3300049578 | Bacteria | 3107 |
| 876 | Ga0501043_0000106 | 3300049579 | Bacteria | 77699 |
| 877 | Ga0501046_0008451 | 3300049580 | Bacteria | 8979 |
| 878 | Ga0501047_0000493 | 3300049581 | Bacteria | 42827 |
| 879 | Ga0501047_0030357 | 3300049581 | Bacteria | 5211 |
| 880 | Ga0501048_0000233 | 3300049582 | Bacteria | 36758 |
| 881 | Ga0501067_0000098 | 3300049583 | Bacteria | 50026 |
| 882 | Ga0501068_0001545 | 3300049584 | Bacteria | 12233 |
| 883 | Ga0501069_0013785 | 3300049585 | Bacteria | 4313 |
| 884 | Ga0501070_0013036 | 3300049586 | Bacteria | 7006 |
| 885 | Ga0501072_0014911 | 3300049588 | Bacteria | 5957 |
| 886 | Ga0501073_0002056 | 3300049589 | Bacteria | 15034 |
| 887 | Ga0501073_0234204 | 3300049589 | Bacteria | 1268 |
| 888 | Ga0501074_0000382 | 3300049590 | Bacteria | 26289 |
| 889 | Ga0501075_0347285 | 3300049591 | Bacteria | 1131 |
| 890 | Ga0501076_0216016 | 3300049592 | Bacteria | 1567 |
| 891 | Ga0501076_0878615 | 3300049592 | Bacteria | 739 |
| 892 | Ga0501079_0003159 | 3300049741 | Bacteria | 12078 |
| 893 | Ga0501080_0001033 | 3300049742 | Bacteria | 22925 |
| 894 | Ga0501081_0421035 | 3300049743 | Bacteria | 990 |
| 895 | Ga0501083_0000116 | 3300049744 | Bacteria | 54656 |
| 896 | Ga0501035_0000496 | 3300049822 | Bacteria | 44296 |
| 897 | Ga0501044_0000857 | 3300049823 | Bacteria | 36575 |
| 898 | Ga0501044_0929485 | 3300049823 | Bacteria | 744 |
| 899 | Ga0501045_0009479 | 3300049824 | Bacteria | 6814 |
| 900 | nmdc:mga03683_231732_c1 | 3300050489 | Bacteria | 854 |
| 901 | nmdc:mga03n38_123037_c1 | 3300050490 | Bacteria | 1277 |
| 902 | nmdc:mga03n38_438369_c1 | 3300050490 | Bacteria | 725 |
| 903 | nmdc:mga03n38_522756_c1 | 3300050490 | Bacteria | 668 |
| 904 | nmdc:mga03n38_879_c1 | 3300050490 | Bacteria | 8082 |
| 905 | nmdc:mga00v17_212530_c1 | 3300050491 | Bacteria | 1252 |
| 906 | nmdc:mga00v17_296458_c1 | 3300050491 | Bacteria | 1050 |
| 907 | nmdc:mga00v17_79840_c1 | 3300050491 | Bacteria | 2041 |
| 908 | nmdc:mga0yw44_141738_c1 | 3300050492 | Bacteria | 1563 |
| 909 | nmdc:mga0yw44_206608_c1 | 3300050492 | Bacteria | 1298 |
| 910 | nmdc:mga0yw44_41086_c1 | 3300050492 | Bacteria | 2751 |
| 911 | nmdc:mga0yw44_697476_c1 | 3300050492 | Bacteria | 690 |
| 912 | nmdc:mga0k408_504339_c1 | 3300050493 | Bacteria | 717 |
| 913 | nmdc:mga06z11_387043_c1 | 3300050494 | Bacteria | 841 |
| 914 | nmdc:mga06z11_425970_c1 | 3300050494 | Bacteria | 800 |
| 915 | nmdc:mga04h51_113182_c1 | 3300050495 | Bacteria | 1003 |
| 916 | nmdc:mga04h51_155132_c1 | 3300050495 | Bacteria | 877 |
| 917 | nmdc:mga04h51_51228_c1 | 3300050495 | Bacteria | 1386 |
| 918 | nmdc:mga07m45_14924_c3 | 3300050496 | Bacteria | 815 |
| 919 | nmdc:mga07m45_15435_c1 | 3300050496 | Bacteria | 4078 |
| 920 | nmdc:mga07m45_27449_c2 | 3300050496 | Bacteria | 2151 |
| 921 | nmdc:mga07m45_470175_c1 | 3300050496 | Bacteria | 729 |
| 922 | nmdc:mga05p37_204769_c1 | 3300050507 | Bacteria | 2387 |
| 923 | nmdc:mga0qj67_788636_c1 | 3300050509 | Bacteria | 752 |
| 924 | nmdc:mga08y16_172584_c1 | 3300050511 | Bacteria | 2246 |
| 925 | nmdc:mga08y16_563261_c1 | 3300050511 | Bacteria | 1152 |
| 926 | nmdc:mga0n895_207458_c1 | 3300050512 | Bacteria | 1990 |
| 927 | nmdc:mga0n895_318403_c1 | 3300050512 | Bacteria | 1576 |
| 928 | nmdc:mga0rr50_6187_c1 | 3300050513 | Bacteria | 7251 |
| 929 | nmdc:mga0a205_586453_c1 | 3300050515 | Bacteria | 968 |
| 930 | nmdc:mga0sz30_54510_c1 | 3300050516 | Bacteria | 1701 |
| 931 | Ga0495601_0000669 | 3300053077 | Bacteria | 18279 |
| 932 | Ga0495601_0038409 | 3300053077 | Bacteria | 2995 |
| 933 | Ga0495601_0062625 | 3300053077 | Bacteria | 2363 |
| 934 | Ga0495612_0000705 | 3300053078 | Bacteria | 13533 |
| 935 | Ga0495612_0009691 | 3300053078 | Bacteria | 3902 |
| 936 | Ga0495612_0046962 | 3300053078 | Bacteria | 1769 |
| 937 | Ga0495612_0193636 | 3300053078 | Bacteria | 895 |
| 938 | Ga0500610_0076687 | 3300053079 | Bacteria | 1743 |
| 939 | Ga0500635_0116069 | 3300053080 | Bacteria | 998 |
| 940 | Ga0495595_0002356 | 3300053084 | Bacteria | 7361 |
| 941 | Ga0495595_0003182 | 3300053084 | Bacteria | 6513 |
| 942 | Ga0495595_0062517 | 3300053084 | Bacteria | 1746 |
| 943 | Ga0495595_0063936 | 3300053084 | Bacteria | 1728 |
| 944 | Ga0495619_0001272 | 3300053085 | Bacteria | 16550 |
| 945 | Ga0495619_0003981 | 3300053085 | Bacteria | 9472 |
| 946 | Ga0495619_0005518 | 3300053085 | Bacteria | 8026 |
| 947 | Ga0495619_0054575 | 3300053085 | Bacteria | 2645 |
| 948 | Ga0495619_0082024 | 3300053085 | Bacteria | 2172 |
| 949 | Ga0495619_0182542 | 3300053085 | Bacteria | 1452 |
| 950 | Ga0495619_0247274 | 3300053085 | Bacteria | 1236 |
| 951 | Ga0500578_0261975 | 3300053086 | Bacteria | 1038 |
| 952 | Ga0500578_0277836 | 3300053086 | Bacteria | 1000 |
| 953 | Ga0500643_071899 | 3300053087 | Bacteria | 959 |
| 954 | Ga0500646_0114676 | 3300053090 | Bacteria | 860 |
| 955 | Ga0500647_0057667 | 3300053091 | Bacteria | 1867 |
| 956 | Ga0500583_0046518 | 3300053092 | Bacteria | 1996 |
| 957 | Ga0500651_0012062 | 3300053093 | Bacteria | 5227 |
| 958 | Ga0500651_0155903 | 3300053093 | Bacteria | 1368 |
| 959 | Ga0500566_0023277 | 3300053094 | Bacteria | 3636 |
| 960 | Ga0500566_0036289 | 3300053094 | Bacteria | 2860 |
| 961 | Ga0500640_196022 | 3300053095 | Bacteria | 711 |
| 962 | Ga0500641_0005790 | 3300053096 | Bacteria | 4377 |
| 963 | Ga0500641_0009175 | 3300053096 | Bacteria | 3551 |
| 964 | Ga0500648_319765 | 3300053097 | Bacteria | 662 |
| 965 | Ga0500554_003144 | 3300053102 | Bacteria | 3340 |
| 966 | Ga0500554_025708 | 3300053102 | Bacteria | 1683 |
| 967 | Ga0500569_100380 | 3300053109 | Bacteria | 948 |
| 968 | Ga0500572_006052 | 3300053111 | Bacteria | 2760 |
| 969 | Ga0500595_001946 | 3300053119 | Bacteria | 10634 |
| 970 | Ga0500595_003152 | 3300053119 | Bacteria | 7809 |
| 971 | Ga0500595_003802 | 3300053119 | Bacteria | 6943 |
| 972 | Ga0500595_031417 | 3300053119 | Bacteria | 1782 |
| 973 | Ga0500608_043784 | 3300053122 | Bacteria | 2149 |
| 974 | Ga0500614_008936 | 3300053123 | Bacteria | 2131 |
| 975 | Ga0500621_105201 | 3300053126 | Bacteria | 1109 |
| 976 | Ga0500642_0009138 | 3300053130 | Bacteria | 3424 |
| 977 | Ga0500642_0147886 | 3300053130 | Bacteria | 1102 |
| 978 | Ga0500652_000003 | 3300053131 | Bacteria | 221528 |
| 979 | Ga0500655_023115 | 3300053133 | Bacteria | 1173 |
| 980 | Ga0500658_0429950 | 3300053134 | Bacteria | 603 |
| 981 | Ga0500559_0000429 | 3300053136 | Bacteria | 29737 |
| 982 | Ga0500559_0100123 | 3300053136 | Bacteria | 1334 |
| 983 | Ga0500561_0181401 | 3300053137 | Bacteria | 663 |
| 984 | Ga0500577_0000233 | 3300053142 | Bacteria | 14734 |
| 985 | Ga0500588_0082423 | 3300053146 | Bacteria | 1078 |
| 986 | Ga0500589_027705 | 3300053147 | Bacteria | 2632 |
| 987 | Ga0500589_297538 | 3300053147 | Bacteria | 572 |
| 988 | Ga0500603_001397 | 3300053150 | Bacteria | 5511 |
| 989 | Ga0500603_021048 | 3300053150 | Bacteria | 1600 |
| 990 | Ga0500622_0245400 | 3300053156 | Bacteria | 789 |
| 991 | Ga0500627_0268735 | 3300053158 | Bacteria | 751 |
| 992 | Ga0500630_000205 | 3300053159 | Bacteria | 22843 |
| 993 | Ga0500634_0080241 | 3300053161 | Bacteria | 1683 |
| 994 | Ga0500638_002898 | 3300053162 | Bacteria | 6177 |
| 995 | Ga0500638_087796 | 3300053162 | Bacteria | 1468 |
| 996 | Ga0500639_000020 | 3300053163 | Bacteria | 102959 |
| 997 | Ga0500636_0041125 | 3300053177 | Bacteria | 2734 |
| 998 | Ga0500636_0415263 | 3300053177 | Bacteria | 619 |
| 999 | Ga0500637_0000291 | 3300053178 | Bacteria | 18816 |
| 1000 | Ga0500637_0011540 | 3300053178 | Bacteria | 4574 |
| 1001 | Ga0500611_074263 | 3300053727 | Bacteria | 835 |
| 1002 | Ga0500596_004671 | 3300053735 | Bacteria | 2491 |
| 1003 | Ga0500601_002043 | 3300053737 | Bacteria | 2168 |
| 1004 | Ga0501084_0011693 | 3300054114 | Bacteria | 7266 |
| 1005 | Ga0501084_0493557 | 3300054114 | Bacteria | 1035 |
| 1006 | Ga0500661_004256 | 3300055283 | Bacteria | 2676 |
| 1007 | Ga0501082_0008641 | 3300060353 | Bacteria | 8781 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006028 | Ga0070717_10956987 | Ga0070717_109569872 | 155 |
| 2 | 3300007265 | Ga0099794_10348372 | Ga0099794_103483721 | 156 |
| 3 | 3300005455 | Ga0070663_100011372 | Ga0070663_1000113722 | 157 |
| 4 | 3300035695 | Ga0373927_0087741 | Ga0373927_0087741_22_498 | 157 |
| 5 | 3300046477 | Ga0495664_0228519 | Ga0495664_0228519_240_713 | 157 |
| 6 | 3300048906 | Ga0496103_0386032 | Ga0496103_0386032_13_486 | 157 |
| 7 | 3300048912 | Ga0496109_1110391 | Ga0496109_1110391_66_539 | 157 |
| 8 | 3300048915 | Ga0496112_0678446 | Ga0496112_0678446_92_604 | 157 |
| 9 | 3300005347 | Ga0070668_100801997 | Ga0070668_1008019971 | 158 |
| 10 | 3300006358 | Ga0068871_100292080 | Ga0068871_1002920802 | 158 |
| 11 | 3300009101 | Ga0105247_10055868 | Ga0105247_100558682 | 158 |
| 12 | 3300025900 | Ga0207710_10347655 | Ga0207710_103476551 | 158 |
| 13 | 3300025972 | Ga0207668_11035692 | Ga0207668_110356923 | 158 |
| 14 | 3300026035 | Ga0207703_10526902 | Ga0207703_105269023 | 158 |
| 15 | 3300026035 | Ga0207703_11477916 | Ga0207703_114779162 | 158 |
| 16 | 3300046616 | Ga0495668_0268273 | Ga0495668_0268273_386_862 | 158 |
| 17 | 3300053096 | Ga0500641_0009175 | Ga0500641_0009175_158_670 | 158 |
| 18 | 3300021377 | Ga0213874_10032895 | Ga0213874_100328952 | 159 |
| 19 | 3300035692 | Ga0373935_0817078 | Ga0373935_0817078_41_553 | 159 |
| 20 | 3300048917 | Ga0496114_0234728 | Ga0496114_0234728_96_608 | 159 |
| 21 | iso_pu_bacteria | 2517093001 | 2517102583 | 159 |
| 22 | iso_pu_bacteria | 2841957949 | 2841961016 | 159 |
| 23 | iso_pu_bacteria | 8056673599 | 8056676973 | 159 |
| 24 | 3300025939 | Ga0207665_10366057 | Ga0207665_103660572 | 160 |
| 25 | 3300039437 | Ga0436365_0510664 | Ga0436365_0510664_54_536 | 160 |
| 26 | 3300048914 | Ga0496111_0480752 | Ga0496111_0480752_303_785 | 160 |
| 27 | iso_pu_bacteria | 8006926726 | 8006931029 | 160 |
| 28 | 3300047315 | Ga0495581_0452719 | Ga0495581_0452719_240_725 | 161 |
| 29 | 3300049572 | Ga0501036_0254617 | Ga0501036_0254617_576_1064 | 161 |
| 30 | 3300049581 | Ga0501047_0030357 | Ga0501047_0030357_43_531 | 161 |
| 31 | 3300005563 | Ga0068855_101271620 | Ga0068855_1012716202 | 162 |
| 32 | 3300031616 | Ga0307508_10001469 | Ga0307508_1000146914 | 162 |
| 33 | 3300031616 | Ga0307508_10293192 | Ga0307508_102931922 | 163 |
| 34 | 3300031730 | Ga0307516_10203791 | Ga0307516_102037912 | 163 |
| 35 | 3300037312 | Ga0395899_0137482 | Ga0395899_0137482_342_833 | 163 |
| 36 | 3300037418 | Ga0395900_0000820 | Ga0395900_0000820_22866_23357 | 163 |
| 37 | 3300037418 | Ga0395900_0181596 | Ga0395900_0181596_1350_1841 | 163 |
| 38 | 3300037466 | Ga0395898_0114094 | Ga0395898_0114094_165_656 | 163 |
| 39 | 3300037471 | Ga0395905_0399577 | Ga0395905_0399577_709_1200 | 163 |
| 40 | 3300038443 | Ga0395901_0102492 | Ga0395901_0102492_877_1368 | 163 |
| 41 | 3300045976 | Ga0466967_0840694 | Ga0466967_0840694_26_517 | 163 |
| 42 | 3300048927 | Ga0496124_0139856 | Ga0496124_0139856_198_698 | 163 |
| 43 | 3300048929 | Ga0496126_0926954 | Ga0496126_0926954_132_632 | 163 |
| 44 | 3300005435 | Ga0070714_100660522 | Ga0070714_1006605222 | 164 |
| 45 | 3300005436 | Ga0070713_100039665 | Ga0070713_1000396652 | 164 |
| 46 | 3300006028 | Ga0070717_10292710 | Ga0070717_102927102 | 164 |
| 47 | 3300009093 | Ga0105240_10250832 | Ga0105240_102508322 | 164 |
| 48 | 3300009545 | Ga0105237_10274405 | Ga0105237_102744052 | 164 |
| 49 | 3300013104 | Ga0157370_10123619 | Ga0157370_101236192 | 164 |
| 50 | 3300013105 | Ga0157369_10019914 | Ga0157369_100199145 | 164 |
| 51 | 3300013105 | Ga0157369_12342463 | Ga0157369_123424631 | 164 |
| 52 | 3300020070 | Ga0206356_10635911 | Ga0206356_106359112 | 164 |
| 53 | 3300020082 | Ga0206353_11349222 | Ga0206353_113492221 | 164 |
| 54 | 3300021384 | Ga0213876_10444740 | Ga0213876_104447402 | 164 |
| 55 | 3300025904 | Ga0207647_10366516 | Ga0207647_103665162 | 164 |
| 56 | 3300025913 | Ga0207695_10150869 | Ga0207695_101508692 | 164 |
| 57 | 3300025928 | Ga0207700_10156116 | Ga0207700_101561162 | 164 |
| 58 | 3300025929 | Ga0207664_10457103 | Ga0207664_104571032 | 164 |
| 59 | 3300037312 | Ga0395899_0089491 | Ga0395899_0089491_1407_1901 | 164 |
| 60 | 3300039437 | Ga0436365_0609277 | Ga0436365_0609277_140_634 | 164 |
| 61 | 3300046477 | Ga0495664_0055223 | Ga0495664_0055223_58_552 | 164 |
| 62 | 3300048929 | Ga0496126_0028827 | Ga0496126_0028827_2551_3045 | 164 |
| 63 | 3300053096 | Ga0500641_0005790 | Ga0500641_0005790_1814_2326 | 164 |
| 64 | 3300005467 | Ga0070706_100757426 | Ga0070706_1007574262 | 165 |
| 65 | 3300005536 | Ga0070697_100081138 | Ga0070697_1000811382 | 165 |
| 66 | 3300038443 | Ga0395901_0051601 | Ga0395901_0051601_3704_4201 | 165 |
| 67 | 3300048929 | Ga0496126_0585165 | Ga0496126_0585165_181_678 | 165 |
| 68 | iso_pu_bacteria | 2791355199 | 2793080586 | 165 |
| 69 | iso_pu_bacteria | 2889033259 | 2889039361 | 165 |
| 70 | 3300003203 | JGI25406J46586_10020277 | JGI25406J46586_100202771 | 166 |
| 71 | 3300005530 | Ga0070679_100178201 | Ga0070679_1001782012 | 166 |
| 72 | 3300005530 | Ga0070679_100925303 | Ga0070679_1009253031 | 166 |
| 73 | 3300005985 | Ga0081539_10006975 | Ga0081539_100069757 | 166 |
| 74 | 3300006038 | Ga0075365_10051655 | Ga0075365_100516552 | 166 |
| 75 | 3300006871 | Ga0075434_100205639 | Ga0075434_1002056392 | 166 |
| 76 | 3300007076 | Ga0075435_100085340 | Ga0075435_1000853402 | 166 |
| 77 | 3300009551 | Ga0105238_10479435 | Ga0105238_104794353 | 166 |
| 78 | 3300024227 | Ga0228598_1074783 | Ga0228598_10747832 | 166 |
| 79 | 3300025921 | Ga0207652_11577688 | Ga0207652_115776881 | 166 |
| 80 | 3300028556 | Ga0265337_1012602 | Ga0265337_10126024 | 166 |
| 81 | 3300028558 | Ga0265326_10008399 | Ga0265326_100083993 | 166 |
| 82 | 3300028563 | Ga0265319_1006169 | Ga0265319_10061693 | 166 |
| 83 | 3300028573 | Ga0265334_10015261 | Ga0265334_100152615 | 166 |
| 84 | 3300028577 | Ga0265318_10008945 | Ga0265318_100089453 | 166 |
| 85 | 3300028653 | Ga0265323_10002476 | Ga0265323_100024766 | 166 |
| 86 | 3300028666 | Ga0265336_10000431 | Ga0265336_1000043122 | 166 |
| 87 | 3300028800 | Ga0265338_10000321 | Ga0265338_1000032166 | 166 |
| 88 | 3300029957 | Ga0265324_10006568 | Ga0265324_100065682 | 166 |
| 89 | 3300035086 | Ga0373934_0161369 | Ga0373934_0161369_329_835 | 166 |
| 90 | 3300035113 | Ga0373936_0056361 | Ga0373936_0056361_425_931 | 166 |
| 91 | 3300035170 | Ga0373943_0002164 | Ga0373943_0002164_7671_8177 | 166 |
| 92 | 3300035171 | Ga0373946_0013431 | Ga0373946_0013431_2283_2789 | 166 |
| 93 | 3300035172 | Ga0373955_0130494 | Ga0373955_0130494_703_1209 | 166 |
| 94 | 3300035410 | Ga0373924_0073751 | Ga0373924_0073751_575_1081 | 166 |
| 95 | 3300035692 | Ga0373935_0010424 | Ga0373935_0010424_1753_2259 | 166 |
| 96 | 3300035695 | Ga0373927_0002108 | Ga0373927_0002108_4621_5127 | 166 |
| 97 | 3300035725 | Ga0373947_0003597 | Ga0373947_0003597_69_575 | 166 |
| 98 | 3300037068 | Ga0373925_0006241 | Ga0373925_0006241_1795_2301 | 166 |
| 99 | 3300037068 | Ga0373925_0051335 | Ga0373925_0051335_2521_3027 | 166 |
| 100 | 3300039438 | Ga0436360_0947574 | Ga0436360_0947574_899_1399 | 166 |
| 101 | 3300046463 | Ga0495653_0035879 | Ga0495653_0035879_1226_1732 | 166 |
| 102 | 3300046472 | Ga0495580_0075345 | Ga0495580_0075345_104_610 | 166 |
| 103 | 3300046476 | Ga0495662_0001286 | Ga0495662_0001286_2343_2849 | 166 |
| 104 | 3300046477 | Ga0495664_0000270 | Ga0495664_0000270_14111_14617 | 166 |
| 105 | 3300046514 | Ga0495618_0001241 | Ga0495618_0001241_14244_14750 | 166 |
| 106 | 3300046516 | Ga0495628_0435215 | Ga0495628_0435215_148_654 | 166 |
| 107 | 3300046526 | Ga0495666_0025780 | Ga0495666_0025780_1013_1519 | 166 |
| 108 | 3300046531 | Ga0495665_0005893 | Ga0495665_0005893_5420_5926 | 166 |
| 109 | 3300046533 | Ga0495640_0008255 | Ga0495640_0008255_2278_2784 | 166 |
| 110 | 3300046533 | Ga0495640_0038540 | Ga0495640_0038540_326_832 | 166 |
| 111 | 3300046535 | Ga0495586_0109545 | Ga0495586_0109545_242_748 | 166 |
| 112 | 3300046543 | Ga0495645_0007214 | Ga0495645_0007214_6232_6738 | 166 |
| 113 | 3300046642 | Ga0495634_0043498 | Ga0495634_0043498_2521_3027 | 166 |
| 114 | 3300046663 | Ga0495635_0001564 | Ga0495635_0001564_12369_12875 | 166 |
| 115 | 3300046680 | Ga0495646_0026783 | Ga0495646_0026783_1232_1738 | 166 |
| 116 | 3300046689 | Ga0495613_0017331 | Ga0495613_0017331_1761_2267 | 166 |
| 117 | 3300046690 | Ga0495624_0013947 | Ga0495624_0013947_3250_3756 | 166 |
| 118 | 3300047315 | Ga0495581_0036031 | Ga0495581_0036031_674_1180 | 166 |
| 119 | 3300047317 | Ga0495604_0119901 | Ga0495604_0119901_1184_1690 | 166 |
| 120 | 3300047319 | Ga0495674_0002806 | Ga0495674_0002806_2872_3378 | 166 |
| 121 | 3300047321 | Ga0495676_0127854 | Ga0495676_0127854_524_1030 | 166 |
| 122 | 3300047471 | Ga0495684_0002851 | Ga0495684_0002851_9834_10340 | 166 |
| 123 | 3300047471 | Ga0495684_0004084 | Ga0495684_0004084_269_775 | 166 |
| 124 | 3300047673 | Ga0495593_0071261 | Ga0495593_0071261_662_1168 | 166 |
| 125 | 3300048089 | Ga0495614_0084256 | Ga0495614_0084256_402_908 | 166 |
| 126 | 3300049568 | Ga0501031_0004192 | Ga0501031_0004192_7805_8305 | 166 |
| 127 | 3300049569 | Ga0501032_0000216 | Ga0501032_0000216_11323_11823 | 166 |
| 128 | 3300049570 | Ga0501033_0000344 | Ga0501033_0000344_24974_25474 | 166 |
| 129 | 3300049571 | Ga0501034_0000100 | Ga0501034_0000100_71721_72221 | 166 |
| 130 | 3300049572 | Ga0501036_0000010 | Ga0501036_0000010_13650_14150 | 166 |
| 131 | 3300049573 | Ga0501037_0000704 | Ga0501037_0000704_16298_16798 | 166 |
| 132 | 3300049574 | Ga0501038_0000350 | Ga0501038_0000350_37274_37774 | 166 |
| 133 | 3300049575 | Ga0501039_0001013 | Ga0501039_0001013_13740_14240 | 166 |
| 134 | 3300049578 | Ga0501042_0046127 | Ga0501042_0046127_1777_2277 | 166 |
| 135 | 3300049579 | Ga0501043_0000106 | Ga0501043_0000106_20935_21435 | 166 |
| 136 | 3300049580 | Ga0501046_0008451 | Ga0501046_0008451_3750_4250 | 166 |
| 137 | 3300049581 | Ga0501047_0000493 | Ga0501047_0000493_23691_24191 | 166 |
| 138 | 3300049582 | Ga0501048_0000233 | Ga0501048_0000233_10302_10802 | 166 |
| 139 | 3300049583 | Ga0501067_0000098 | Ga0501067_0000098_10292_10792 | 166 |
| 140 | 3300049584 | Ga0501068_0001545 | Ga0501068_0001545_224_724 | 166 |
| 141 | 3300049585 | Ga0501069_0013785 | Ga0501069_0013785_133_633 | 166 |
| 142 | 3300049586 | Ga0501070_0013036 | Ga0501070_0013036_4089_4589 | 166 |
| 143 | 3300049588 | Ga0501072_0014911 | Ga0501072_0014911_328_828 | 166 |
| 144 | 3300049589 | Ga0501073_0002056 | Ga0501073_0002056_9640_10140 | 166 |
| 145 | 3300049589 | Ga0501073_0234204 | Ga0501073_0234204_228_728 | 166 |
| 146 | 3300049590 | Ga0501074_0000382 | Ga0501074_0000382_21142_21642 | 166 |
| 147 | 3300049592 | Ga0501076_0878615 | Ga0501076_0878615_124_624 | 166 |
| 148 | 3300049741 | Ga0501079_0003159 | Ga0501079_0003159_692_1192 | 166 |
| 149 | 3300049742 | Ga0501080_0001033 | Ga0501080_0001033_13229_13729 | 166 |
| 150 | 3300049743 | Ga0501081_0421035 | Ga0501081_0421035_385_885 | 166 |
| 151 | 3300049744 | Ga0501083_0000116 | Ga0501083_0000116_18719_19219 | 166 |
| 152 | 3300049822 | Ga0501035_0000496 | Ga0501035_0000496_30719_31219 | 166 |
| 153 | 3300049823 | Ga0501044_0000857 | Ga0501044_0000857_17156_17656 | 166 |
| 154 | 3300049823 | Ga0501044_0929485 | Ga0501044_0929485_183_686 | 166 |
| 155 | 3300049824 | Ga0501045_0009479 | Ga0501045_0009479_4451_4951 | 166 |
| 156 | 3300050512 | nmdc:mga0n895_207458_c1 | nmdc:mga0n895_207458_c1_1134_1637 | 166 |
| 157 | 3300050513 | nmdc:mga0rr50_6187_c1 | nmdc:mga0rr50_6187_c1_1399_1902 | 166 |
| 158 | 3300053077 | Ga0495601_0000669 | Ga0495601_0000669_6219_6725 | 166 |
| 159 | 3300053078 | Ga0495612_0000705 | Ga0495612_0000705_8151_8657 | 166 |
| 160 | 3300053085 | Ga0495619_0005518 | Ga0495619_0005518_6172_6678 | 166 |
| 161 | 3300054114 | Ga0501084_0011693 | Ga0501084_0011693_2213_2713 | 166 |
| 162 | 3300060353 | Ga0501082_0008641 | Ga0501082_0008641_1744_2244 | 166 |
| 163 | iso_pu_bacteria | 2513237098 | 2513676621 | 166 |
| 164 | iso_pu_bacteria | 2513237141 | 2513889982 | 166 |
| 165 | iso_pu_bacteria | 2524023210 | 2524471052 | 166 |
| 166 | iso_pu_bacteria | 2721755755 | 2723846590 | 166 |
| 167 | iso_pu_bacteria | 2874604998 | 2874605630 | 166 |
| 168 | iso_pu_bacteria | 2876808645 | 2876814672 | 166 |
| 169 | iso_pu_bacteria | 2879110137 | 2879115918 | 166 |
| 170 | iso_pu_bacteria | 2885383462 | 2885389424 | 166 |
| 171 | iso_pu_bacteria | 2903768456 | 2903771896 | 166 |
| 172 | iso_pu_bacteria | 2922361189 | 2922365791 | 166 |
| 173 | iso_pu_bacteria | 8006964411 | 8006969715 | 166 |
| 174 | iso_pu_bacteria | 8006984368 | 8006987841 | 166 |
| 175 | iso_pu_bacteria | 8056681323 | 8056689269 | 166 |
| 176 | 3300003752 | Ga0055539_1006928 | Ga0055539_10069282 | 167 |
| 177 | 3300005985 | Ga0081539_10026746 | Ga0081539_100267462 | 167 |
| 178 | 3300006028 | Ga0070717_10047832 | Ga0070717_100478322 | 167 |
| 179 | 3300009177 | Ga0105248_10464772 | Ga0105248_104647722 | 167 |
| 180 | 3300009551 | Ga0105238_10150745 | Ga0105238_101507453 | 167 |
| 181 | 3300010375 | Ga0105239_10056258 | Ga0105239_100562585 | 167 |
| 182 | 3300013297 | Ga0157378_10345217 | Ga0157378_103452172 | 167 |
| 183 | 3300025253 | Ga0209677_102539 | Ga0209677_1025396 | 167 |
| 184 | 3300025928 | Ga0207700_10466593 | Ga0207700_104665933 | 167 |
| 185 | 3300036459 | Ga0372808_034869 | Ga0372808_034869_122_625 | 167 |
| 186 | 3300039437 | Ga0436365_0103592 | Ga0436365_0103592_56_559 | 167 |
| 187 | 3300039437 | Ga0436365_1617397 | Ga0436365_1617397_127_630 | 167 |
| 188 | 3300039450 | Ga0436363_1200350 | Ga0436363_1200350_318_821 | 167 |
| 189 | 3300044684 | Ga0466966_0057074 | Ga0466966_0057074_1661_2176 | 167 |
| 190 | 3300044735 | Ga0466968_0383344 | Ga0466968_0383344_134_649 | 167 |
| 191 | 3300045049 | Ga0466959_0159592 | Ga0466959_0159592_267_782 | 167 |
| 192 | 3300048911 | Ga0496108_0789013 | Ga0496108_0789013_197_700 | 167 |
| 193 | 3300048928 | Ga0496125_0000060 | Ga0496125_0000060_101652_102164 | 167 |
| 194 | 3300048928 | Ga0496125_0000838 | Ga0496125_0000838_32856_33368 | 167 |
| 195 | 3300048928 | Ga0496125_0096787 | Ga0496125_0096787_734_1237 | 167 |
| 196 | 3300048928 | Ga0496125_0124092 | Ga0496125_0124092_618_1121 | 167 |
| 197 | 3300053091 | Ga0500647_0057667 | Ga0500647_0057667_1073_1576 | 167 |
| 198 | 3300053094 | Ga0500566_0036289 | Ga0500566_0036289_694_1197 | 167 |
| 199 | 3300053095 | Ga0500640_196022 | Ga0500640_196022_134_637 | 167 |
| 200 | 3300053097 | Ga0500648_319765 | Ga0500648_319765_31_534 | 167 |
| 201 | 3300053111 | Ga0500572_006052 | Ga0500572_006052_677_1180 | 167 |
| 202 | 3300053122 | Ga0500608_043784 | Ga0500608_043784_986_1489 | 167 |
| 203 | 3300053123 | Ga0500614_008936 | Ga0500614_008936_261_764 | 167 |
| 204 | 3300053136 | Ga0500559_0000429 | Ga0500559_0000429_20545_21048 | 167 |
| 205 | 3300053142 | Ga0500577_0000233 | Ga0500577_0000233_9021_9527 | 167 |
| 206 | 3300053150 | Ga0500603_001397 | Ga0500603_001397_650_1153 | 167 |
| 207 | 3300053159 | Ga0500630_000205 | Ga0500630_000205_5977_6480 | 167 |
| 208 | 3300053162 | Ga0500638_087796 | Ga0500638_087796_125_628 | 167 |
| 209 | 3300053163 | Ga0500639_000020 | Ga0500639_000020_37552_38055 | 167 |
| 210 | 3300053735 | Ga0500596_004671 | Ga0500596_004671_347_850 | 167 |
| 211 | 3300053737 | Ga0500601_002043 | Ga0500601_002043_454_957 | 167 |
| 212 | 3300003659 | JGI25404J52841_10010652 | JGI25404J52841_100106521 | 168 |
| 213 | 3300005334 | Ga0068869_100338894 | Ga0068869_1003388941 | 168 |
| 214 | 3300005347 | Ga0070668_100302823 | Ga0070668_1003028231 | 168 |
| 215 | 3300005434 | Ga0070709_10762168 | Ga0070709_107621682 | 168 |
| 216 | 3300005437 | Ga0070710_10206587 | Ga0070710_102065872 | 168 |
| 217 | 3300005439 | Ga0070711_100026775 | Ga0070711_1000267753 | 168 |
| 218 | 3300005563 | Ga0068855_100277369 | Ga0068855_1002773692 | 168 |
| 219 | 3300005718 | Ga0068866_10697487 | Ga0068866_106974872 | 168 |
| 220 | 3300005719 | Ga0068861_100833876 | Ga0068861_1008338762 | 168 |
| 221 | 3300005937 | Ga0081455_10038749 | Ga0081455_100387493 | 168 |
| 222 | 3300005937 | Ga0081455_10094202 | Ga0081455_100942023 | 168 |
| 223 | 3300005937 | Ga0081455_10210767 | Ga0081455_102107672 | 168 |
| 224 | 3300005983 | Ga0081540_1002935 | Ga0081540_100293514 | 168 |
| 225 | 3300005983 | Ga0081540_1006783 | Ga0081540_10067838 | 168 |
| 226 | 3300005983 | Ga0081540_1007771 | Ga0081540_10077715 | 168 |
| 227 | 3300005983 | Ga0081540_1014845 | Ga0081540_10148455 | 168 |
| 228 | 3300005983 | Ga0081540_1047770 | Ga0081540_10477703 | 168 |
| 229 | 3300005983 | Ga0081540_1061237 | Ga0081540_10612373 | 168 |
| 230 | 3300005983 | Ga0081540_1075943 | Ga0081540_10759433 | 168 |
| 231 | 3300006175 | Ga0070712_100026911 | Ga0070712_1000269113 | 168 |
| 232 | 3300006881 | Ga0068865_100383665 | Ga0068865_1003836652 | 168 |
| 233 | 3300009176 | Ga0105242_10102286 | Ga0105242_101022863 | 168 |
| 234 | 3300025911 | Ga0207654_10077443 | Ga0207654_100774431 | 168 |
| 235 | 3300025915 | Ga0207693_10016029 | Ga0207693_100160293 | 168 |
| 236 | 3300025916 | Ga0207663_10008904 | Ga0207663_100089043 | 168 |
| 237 | 3300025938 | Ga0207704_10324428 | Ga0207704_103244283 | 168 |
| 238 | 3300025939 | Ga0207665_10085571 | Ga0207665_100855713 | 168 |
| 239 | 3300025939 | Ga0207665_10571813 | Ga0207665_105718132 | 168 |
| 240 | 3300025942 | Ga0207689_10311396 | Ga0207689_103113963 | 168 |
| 241 | 3300035116 | Ga0373945_0243287 | Ga0373945_0243287_34_540 | 168 |
| 242 | 3300035695 | Ga0373927_0113572 | Ga0373927_0113572_600_1106 | 168 |
| 243 | 3300035725 | Ga0373947_0024113 | Ga0373947_0024113_344_850 | 168 |
| 244 | 3300037068 | Ga0373925_0047807 | Ga0373925_0047807_1319_1825 | 168 |
| 245 | 3300046472 | Ga0495580_0135889 | Ga0495580_0135889_664_1170 | 168 |
| 246 | 3300046507 | Ga0495606_0130863 | Ga0495606_0130863_569_1075 | 168 |
| 247 | 3300046518 | Ga0495631_0286002 | Ga0495631_0286002_98_604 | 168 |
| 248 | 3300046615 | Ga0495656_0236232 | Ga0495656_0236232_27_533 | 168 |
| 249 | 3300046674 | Ga0495588_0358914 | Ga0495588_0358914_67_573 | 168 |
| 250 | 3300048903 | Ga0496100_0110399 | Ga0496100_0110399_1233_1739 | 168 |
| 251 | 3300048904 | Ga0496101_0194247 | Ga0496101_0194247_380_886 | 168 |
| 252 | 3300048909 | Ga0496106_0069840 | Ga0496106_0069840_438_944 | 168 |
| 253 | 3300048917 | Ga0496114_0256196 | Ga0496114_0256196_677_1183 | 168 |
| 254 | 3300048917 | Ga0496114_0581675 | Ga0496114_0581675_36_542 | 168 |
| 255 | 3300048918 | Ga0496115_0206686 | Ga0496115_0206686_858_1364 | 168 |
| 256 | 3300048929 | Ga0496126_0041794 | Ga0496126_0041794_141_647 | 168 |
| 257 | 3300048929 | Ga0496126_0141964 | Ga0496126_0141964_22_528 | 168 |
| 258 | 3300048929 | Ga0496126_0378151 | Ga0496126_0378151_75_584 | 168 |
| 259 | 3300005331 | Ga0070670_100905277 | Ga0070670_1009052771 | 169 |
| 260 | 3300005334 | Ga0068869_101263053 | Ga0068869_1012630531 | 169 |
| 261 | 3300005336 | Ga0070680_100022952 | Ga0070680_1000229525 | 169 |
| 262 | 3300005366 | Ga0070659_100170860 | Ga0070659_1001708602 | 169 |
| 263 | 3300005456 | Ga0070678_100228987 | Ga0070678_1002289872 | 169 |
| 264 | 3300005456 | Ga0070678_100762777 | Ga0070678_1007627771 | 169 |
| 265 | 3300005539 | Ga0068853_100579505 | Ga0068853_1005795052 | 169 |
| 266 | 3300005543 | Ga0070672_100601055 | Ga0070672_1006010552 | 169 |
| 267 | 3300005563 | Ga0068855_100060251 | Ga0068855_1000602511 | 169 |
| 268 | 3300005563 | Ga0068855_100066133 | Ga0068855_1000661335 | 169 |
| 269 | 3300005577 | Ga0068857_101579541 | Ga0068857_1015795411 | 169 |
| 270 | 3300005614 | Ga0068856_100563789 | Ga0068856_1005637892 | 169 |
| 271 | 3300005615 | Ga0070702_100089777 | Ga0070702_1000897771 | 169 |
| 272 | 3300005616 | Ga0068852_100600657 | Ga0068852_1006006572 | 169 |
| 273 | 3300005840 | Ga0068870_10354276 | Ga0068870_103542763 | 169 |
| 274 | 3300005842 | Ga0068858_100449392 | Ga0068858_1004493922 | 169 |
| 275 | 3300005843 | Ga0068860_101955983 | Ga0068860_1019559831 | 169 |
| 276 | 3300005937 | Ga0081455_10031420 | Ga0081455_100314202 | 169 |
| 277 | 3300006038 | Ga0075365_10270849 | Ga0075365_102708492 | 169 |
| 278 | 3300006048 | Ga0075363_100645583 | Ga0075363_1006455832 | 169 |
| 279 | 3300006237 | Ga0097621_100353294 | Ga0097621_1003532943 | 169 |
| 280 | 3300006237 | Ga0097621_100596997 | Ga0097621_1005969972 | 169 |
| 281 | 3300006237 | Ga0097621_101289526 | Ga0097621_1012895261 | 169 |
| 282 | 3300006358 | Ga0068871_100942207 | Ga0068871_1009422073 | 169 |
| 283 | 3300007788 | Ga0099795_10031943 | Ga0099795_100319432 | 169 |
| 284 | 3300009101 | Ga0105247_10280664 | Ga0105247_102806643 | 169 |
| 285 | 3300009148 | Ga0105243_10502835 | Ga0105243_105028351 | 169 |
| 286 | 3300009176 | Ga0105242_10158779 | Ga0105242_101587792 | 169 |
| 287 | 3300009177 | Ga0105248_11131272 | Ga0105248_111312722 | 169 |
| 288 | 3300009545 | Ga0105237_10250684 | Ga0105237_102506843 | 169 |
| 289 | 3300009545 | Ga0105237_10627059 | Ga0105237_106270592 | 169 |
| 290 | 3300009553 | Ga0105249_10686765 | Ga0105249_106867652 | 169 |
| 291 | 3300010159 | Ga0099796_10059049 | Ga0099796_100590491 | 169 |
| 292 | 3300010375 | Ga0105239_10368977 | Ga0105239_103689772 | 169 |
| 293 | 3300010375 | Ga0105239_11953304 | Ga0105239_119533042 | 169 |
| 294 | 3300011119 | Ga0105246_10151843 | Ga0105246_101518432 | 169 |
| 295 | 3300011119 | Ga0105246_10588549 | Ga0105246_105885493 | 169 |
| 296 | 3300013104 | Ga0157370_10661840 | Ga0157370_106618402 | 169 |
| 297 | 3300013105 | Ga0157369_10355342 | Ga0157369_103553423 | 169 |
| 298 | 3300013297 | Ga0157378_10683305 | Ga0157378_106833052 | 169 |
| 299 | 3300013306 | Ga0163162_10613531 | Ga0163162_106135312 | 169 |
| 300 | 3300013306 | Ga0163162_11468530 | Ga0163162_114685301 | 169 |
| 301 | 3300014325 | Ga0163163_10564432 | Ga0163163_105644322 | 169 |
| 302 | 3300017792 | Ga0163161_10172373 | Ga0163161_101723732 | 169 |
| 303 | 3300017792 | Ga0163161_10480778 | Ga0163161_104807783 | 169 |
| 304 | 3300025907 | Ga0207645_10102294 | Ga0207645_101022942 | 169 |
| 305 | 3300025914 | Ga0207671_10423586 | Ga0207671_104235862 | 169 |
| 306 | 3300025917 | Ga0207660_10096383 | Ga0207660_100963832 | 169 |
| 307 | 3300025925 | Ga0207650_10648728 | Ga0207650_106487283 | 169 |
| 308 | 3300025932 | Ga0207690_10048739 | Ga0207690_100487393 | 169 |
| 309 | 3300025941 | Ga0207711_10351041 | Ga0207711_103510411 | 169 |
| 310 | 3300025942 | Ga0207689_10777519 | Ga0207689_107775191 | 169 |
| 311 | 3300025949 | Ga0207667_10594352 | Ga0207667_105943523 | 169 |
| 312 | 3300025972 | Ga0207668_10697619 | Ga0207668_106976192 | 169 |
| 313 | 3300026041 | Ga0207639_10389903 | Ga0207639_103899032 | 169 |
| 314 | 3300026078 | Ga0207702_10501271 | Ga0207702_105012712 | 169 |
| 315 | 3300026089 | Ga0207648_10551587 | Ga0207648_105515872 | 169 |
| 316 | 3300026121 | Ga0207683_10021347 | Ga0207683_100213472 | 169 |
| 317 | 3300026121 | Ga0207683_10641244 | Ga0207683_106412442 | 169 |
| 318 | 3300028379 | Ga0268266_10251536 | Ga0268266_102515362 | 169 |
| 319 | 3300028380 | Ga0268265_10498035 | Ga0268265_104980353 | 169 |
| 320 | 3300028786 | Ga0307517_10000008 | Ga0307517_10000008203 | 169 |
| 321 | 3300028794 | Ga0307515_10142057 | Ga0307515_101420572 | 169 |
| 322 | 3300031344 | Ga0265316_10112992 | Ga0265316_101129922 | 169 |
| 323 | 3300031456 | Ga0307513_10303766 | Ga0307513_103037662 | 169 |
| 324 | 3300031456 | Ga0307513_10309623 | Ga0307513_103096233 | 169 |
| 325 | 3300031548 | Ga0307408_100152852 | Ga0307408_1001528523 | 169 |
| 326 | 3300031616 | Ga0307508_10052684 | Ga0307508_100526842 | 169 |
| 327 | 3300031730 | Ga0307516_10017964 | Ga0307516_100179642 | 169 |
| 328 | 3300031730 | Ga0307516_10040779 | Ga0307516_100407795 | 169 |
| 329 | 3300032005 | Ga0307411_10346930 | Ga0307411_103469302 | 169 |
| 330 | 3300032126 | Ga0307415_100417269 | Ga0307415_1004172692 | 169 |
| 331 | 3300033180 | Ga0307510_10215430 | Ga0307510_102154302 | 169 |
| 332 | 3300035092 | Ga0373952_0114722 | Ga0373952_0114722_62_571 | 169 |
| 333 | 3300035115 | Ga0373941_0096687 | Ga0373941_0096687_435_944 | 169 |
| 334 | 3300035171 | Ga0373946_0482912 | Ga0373946_0482912_86_595 | 169 |
| 335 | 3300035691 | Ga0373931_0001282 | Ga0373931_0001282_4396_4905 | 169 |
| 336 | 3300035725 | Ga0373947_0584674 | Ga0373947_0584674_52_561 | 169 |
| 337 | 3300036401 | Ga0373937_0791555 | Ga0373937_0791555_185_694 | 169 |
| 338 | 3300037068 | Ga0373925_0518173 | Ga0373925_0518173_15_524 | 169 |
| 339 | 3300037466 | Ga0395898_0309154 | Ga0395898_0309154_633_1142 | 169 |
| 340 | 3300037466 | Ga0395898_0321370 | Ga0395898_0321370_624_1136 | 169 |
| 341 | 3300037471 | Ga0395905_0761596 | Ga0395905_0761596_306_818 | 169 |
| 342 | 3300037471 | Ga0395905_0779759 | Ga0395905_0779759_283_792 | 169 |
| 343 | 3300038443 | Ga0395901_1391837 | Ga0395901_1391837_124_636 | 169 |
| 344 | 3300039438 | Ga0436360_0202328 | Ga0436360_0202328_2538_3047 | 169 |
| 345 | 3300039438 | Ga0436360_0310567 | Ga0436360_0310567_37_546 | 169 |
| 346 | 3300039438 | Ga0436360_0593081 | Ga0436360_0593081_625_1134 | 169 |
| 347 | 3300039438 | Ga0436360_1159963 | Ga0436360_1159963_52_561 | 169 |
| 348 | 3300039438 | Ga0436360_1365633 | Ga0436360_1365633_43_555 | 169 |
| 349 | 3300039447 | Ga0436361_0023933 | Ga0436361_0023933_1114_1623 | 169 |
| 350 | 3300044684 | Ga0466966_0229282 | Ga0466966_0229282_498_1007 | 169 |
| 351 | 3300046460 | Ga0495638_0455007 | Ga0495638_0455007_109_618 | 169 |
| 352 | 3300046477 | Ga0495664_0094961 | Ga0495664_0094961_69_578 | 169 |
| 353 | 3300046507 | Ga0495606_0193050 | Ga0495606_0193050_56_565 | 169 |
| 354 | 3300046517 | Ga0495630_0235212 | Ga0495630_0235212_12_521 | 169 |
| 355 | 3300046537 | Ga0495598_0343710 | Ga0495598_0343710_10_519 | 169 |
| 356 | 3300046543 | Ga0495645_0378859 | Ga0495645_0378859_111_620 | 169 |
| 357 | 3300046559 | Ga0495667_0113143 | Ga0495667_0113143_897_1406 | 169 |
| 358 | 3300046675 | Ga0495657_0258231 | Ga0495657_0258231_349_858 | 169 |
| 359 | 3300046684 | Ga0495669_0108934 | Ga0495669_0108934_667_1176 | 169 |
| 360 | 3300047319 | Ga0495674_0907565 | Ga0495674_0907565_59_568 | 169 |
| 361 | 3300047320 | Ga0495672_0036995 | Ga0495672_0036995_1414_1923 | 169 |
| 362 | 3300047320 | Ga0495672_0064097 | Ga0495672_0064097_34_543 | 169 |
| 363 | 3300048903 | Ga0496100_0417110 | Ga0496100_0417110_215_724 | 169 |
| 364 | 3300048904 | Ga0496101_0333774 | Ga0496101_0333774_250_759 | 169 |
| 365 | 3300048905 | Ga0496102_0191576 | Ga0496102_0191576_557_1066 | 169 |
| 366 | 3300048907 | Ga0496104_1126915 | Ga0496104_1126915_90_599 | 169 |
| 367 | 3300048908 | Ga0496105_0079259 | Ga0496105_0079259_183_692 | 169 |
| 368 | 3300048910 | Ga0496107_0253210 | Ga0496107_0253210_22_531 | 169 |
| 369 | 3300048911 | Ga0496108_0181500 | Ga0496108_0181500_1122_1631 | 169 |
| 370 | 3300048912 | Ga0496109_1079124 | Ga0496109_1079124_93_602 | 169 |
| 371 | 3300048913 | Ga0496110_0260504 | Ga0496110_0260504_557_1066 | 169 |
| 372 | 3300048914 | Ga0496111_0188051 | Ga0496111_0188051_171_680 | 169 |
| 373 | 3300048916 | Ga0496113_0253806 | Ga0496113_0253806_370_879 | 169 |
| 374 | 3300048916 | Ga0496113_0395239 | Ga0496113_0395239_276_785 | 169 |
| 375 | 3300048918 | Ga0496115_0008261 | Ga0496115_0008261_451_960 | 169 |
| 376 | 3300048918 | Ga0496115_0074212 | Ga0496115_0074212_1180_1689 | 169 |
| 377 | 3300048918 | Ga0496115_1164900 | Ga0496115_1164900_18_527 | 169 |
| 378 | 3300048920 | Ga0496117_0049280 | Ga0496117_0049280_77_586 | 169 |
| 379 | 3300048921 | Ga0496118_0214194 | Ga0496118_0214194_50_559 | 169 |
| 380 | 3300048924 | Ga0496121_0002279 | Ga0496121_0002279_2831_3340 | 169 |
| 381 | 3300048924 | Ga0496121_0184644 | Ga0496121_0184644_19_531 | 169 |
| 382 | 3300048929 | Ga0496126_0050977 | Ga0496126_0050977_504_1013 | 169 |
| 383 | 3300049568 | Ga0501031_0260182 | Ga0501031_0260182_71_580 | 169 |
| 384 | 3300049591 | Ga0501075_0347285 | Ga0501075_0347285_381_890 | 169 |
| 385 | 3300049592 | Ga0501076_0216016 | Ga0501076_0216016_41_550 | 169 |
| 386 | 3300050490 | nmdc:mga03n38_123037_c1 | nmdc:mga03n38_123037_c1_174_683 | 169 |
| 387 | 3300050490 | nmdc:mga03n38_522756_c1 | nmdc:mga03n38_522756_c1_26_535 | 169 |
| 388 | 3300050492 | nmdc:mga0yw44_697476_c1 | nmdc:mga0yw44_697476_c1_141_650 | 169 |
| 389 | 3300050495 | nmdc:mga04h51_155132_c1 | nmdc:mga04h51_155132_c1_344_853 | 169 |
| 390 | 3300053077 | Ga0495601_0062625 | Ga0495601_0062625_787_1296 | 169 |
| 391 | 3300053079 | Ga0500610_0076687 | Ga0500610_0076687_550_1059 | 169 |
| 392 | 3300053084 | Ga0495595_0062517 | Ga0495595_0062517_825_1334 | 169 |
| 393 | 3300053085 | Ga0495619_0054575 | Ga0495619_0054575_537_1046 | 169 |
| 394 | 3300053085 | Ga0495619_0182542 | Ga0495619_0182542_660_1169 | 169 |
| 395 | 3300053085 | Ga0495619_0247274 | Ga0495619_0247274_55_564 | 169 |
| 396 | 3300053086 | Ga0500578_0261975 | Ga0500578_0261975_366_875 | 169 |
| 397 | 3300053093 | Ga0500651_0012062 | Ga0500651_0012062_252_761 | 169 |
| 398 | 3300053093 | Ga0500651_0155903 | Ga0500651_0155903_795_1304 | 169 |
| 399 | 3300053119 | Ga0500595_003802 | Ga0500595_003802_2306_2815 | 169 |
| 400 | 3300053119 | Ga0500595_031417 | Ga0500595_031417_1091_1600 | 169 |
| 401 | 3300053130 | Ga0500642_0009138 | Ga0500642_0009138_171_680 | 169 |
| 402 | 3300053131 | Ga0500652_000003 | Ga0500652_000003_35446_35958 | 169 |
| 403 | 3300053136 | Ga0500559_0100123 | Ga0500559_0100123_667_1179 | 169 |
| 404 | 3300053156 | Ga0500622_0245400 | Ga0500622_0245400_184_693 | 169 |
| 405 | 3300053158 | Ga0500627_0268735 | Ga0500627_0268735_17_526 | 169 |
| 406 | 3300053177 | Ga0500636_0415263 | Ga0500636_0415263_79_591 | 169 |
| 407 | 3300054114 | Ga0501084_0493557 | Ga0501084_0493557_117_626 | 169 |
| 408 | 3300000549 | LJQas_1009230 | LJQas_10092303 | 170 |
| 409 | 3300005327 | Ga0070658_10079749 | Ga0070658_100797493 | 170 |
| 410 | 3300005328 | Ga0070676_10442116 | Ga0070676_104421161 | 170 |
| 411 | 3300005329 | Ga0070683_100017979 | Ga0070683_1000179796 | 170 |
| 412 | 3300005331 | Ga0070670_100153645 | Ga0070670_1001536452 | 170 |
| 413 | 3300005331 | Ga0070670_100956994 | Ga0070670_1009569941 | 170 |
| 414 | 3300005334 | Ga0068869_100032826 | Ga0068869_1000328264 | 170 |
| 415 | 3300005334 | Ga0068869_100427552 | Ga0068869_1004275521 | 170 |
| 416 | 3300005336 | Ga0070680_100102180 | Ga0070680_1001021803 | 170 |
| 417 | 3300005338 | Ga0068868_100196332 | Ga0068868_1001963322 | 170 |
| 418 | 3300005338 | Ga0068868_101532967 | Ga0068868_1015329671 | 170 |
| 419 | 3300005339 | Ga0070660_100009001 | Ga0070660_1000090018 | 170 |
| 420 | 3300005339 | Ga0070660_100675138 | Ga0070660_1006751382 | 170 |
| 421 | 3300005347 | Ga0070668_100044429 | Ga0070668_1000444292 | 170 |
| 422 | 3300005347 | Ga0070668_100053645 | Ga0070668_1000536452 | 170 |
| 423 | 3300005347 | Ga0070668_100095017 | Ga0070668_1000950172 | 170 |
| 424 | 3300005347 | Ga0070668_100340656 | Ga0070668_1003406561 | 170 |
| 425 | 3300005353 | Ga0070669_100573768 | Ga0070669_1005737682 | 170 |
| 426 | 3300005353 | Ga0070669_100832367 | Ga0070669_1008323672 | 170 |
| 427 | 3300005354 | Ga0070675_100198699 | Ga0070675_1001986992 | 170 |
| 428 | 3300005354 | Ga0070675_100250222 | Ga0070675_1002502222 | 170 |
| 429 | 3300005365 | Ga0070688_100989195 | Ga0070688_1009891951 | 170 |
| 430 | 3300005367 | Ga0070667_100252611 | Ga0070667_1002526111 | 170 |
| 431 | 3300005367 | Ga0070667_100830631 | Ga0070667_1008306312 | 170 |
| 432 | 3300005434 | Ga0070709_10041150 | Ga0070709_100411502 | 170 |
| 433 | 3300005434 | Ga0070709_10505077 | Ga0070709_105050772 | 170 |
| 434 | 3300005435 | Ga0070714_100017014 | Ga0070714_1000170142 | 170 |
| 435 | 3300005436 | Ga0070713_100039634 | Ga0070713_1000396345 | 170 |
| 436 | 3300005436 | Ga0070713_100166809 | Ga0070713_1001668092 | 170 |
| 437 | 3300005436 | Ga0070713_100301108 | Ga0070713_1003011082 | 170 |
| 438 | 3300005437 | Ga0070710_10758149 | Ga0070710_107581492 | 170 |
| 439 | 3300005439 | Ga0070711_100129721 | Ga0070711_1001297212 | 170 |
| 440 | 3300005439 | Ga0070711_100344350 | Ga0070711_1003443501 | 170 |
| 441 | 3300005439 | Ga0070711_100533295 | Ga0070711_1005332953 | 170 |
| 442 | 3300005439 | Ga0070711_100568053 | Ga0070711_1005680531 | 170 |
| 443 | 3300005440 | Ga0070705_100055731 | Ga0070705_1000557312 | 170 |
| 444 | 3300005441 | Ga0070700_100787003 | Ga0070700_1007870031 | 170 |
| 445 | 3300005444 | Ga0070694_100091570 | Ga0070694_1000915702 | 170 |
| 446 | 3300005445 | Ga0070708_100037436 | Ga0070708_1000374363 | 170 |
| 447 | 3300005455 | Ga0070663_100118799 | Ga0070663_1001187992 | 170 |
| 448 | 3300005455 | Ga0070663_100250373 | Ga0070663_1002503732 | 170 |
| 449 | 3300005455 | Ga0070663_101540614 | Ga0070663_1015406141 | 170 |
| 450 | 3300005456 | Ga0070678_100081317 | Ga0070678_1000813172 | 170 |
| 451 | 3300005456 | Ga0070678_100308280 | Ga0070678_1003082802 | 170 |
| 452 | 3300005456 | Ga0070678_100360525 | Ga0070678_1003605251 | 170 |
| 453 | 3300005456 | Ga0070678_100427483 | Ga0070678_1004274832 | 170 |
| 454 | 3300005457 | Ga0070662_100136853 | Ga0070662_1001368532 | 170 |
| 455 | 3300005457 | Ga0070662_100262846 | Ga0070662_1002628462 | 170 |
| 456 | 3300005458 | Ga0070681_10090433 | Ga0070681_100904333 | 170 |
| 457 | 3300005459 | Ga0068867_100223802 | Ga0068867_1002238022 | 170 |
| 458 | 3300005459 | Ga0068867_101310722 | Ga0068867_1013107221 | 170 |
| 459 | 3300005467 | Ga0070706_100092751 | Ga0070706_1000927512 | 170 |
| 460 | 3300005468 | Ga0070707_100341021 | Ga0070707_1003410211 | 170 |
| 461 | 3300005471 | Ga0070698_100121433 | Ga0070698_1001214332 | 170 |
| 462 | 3300005518 | Ga0070699_100067546 | Ga0070699_1000675462 | 170 |
| 463 | 3300005535 | Ga0070684_100017565 | Ga0070684_1000175655 | 170 |
| 464 | 3300005536 | Ga0070697_100136263 | Ga0070697_1001362632 | 170 |
| 465 | 3300005539 | Ga0068853_100003512 | Ga0068853_1000035129 | 170 |
| 466 | 3300005539 | Ga0068853_100038007 | Ga0068853_1000380072 | 170 |
| 467 | 3300005539 | Ga0068853_101536521 | Ga0068853_1015365211 | 170 |
| 468 | 3300005543 | Ga0070672_100301262 | Ga0070672_1003012622 | 170 |
| 469 | 3300005543 | Ga0070672_100314521 | Ga0070672_1003145212 | 170 |
| 470 | 3300005545 | Ga0070695_100050568 | Ga0070695_1000505682 | 170 |
| 471 | 3300005547 | Ga0070693_100141790 | Ga0070693_1001417901 | 170 |
| 472 | 3300005548 | Ga0070665_100020092 | Ga0070665_1000200923 | 170 |
| 473 | 3300005548 | Ga0070665_100044801 | Ga0070665_1000448013 | 170 |
| 474 | 3300005548 | Ga0070665_100121513 | Ga0070665_1001215131 | 170 |
| 475 | 3300005548 | Ga0070665_100129052 | Ga0070665_1001290522 | 170 |
| 476 | 3300005563 | Ga0068855_100034352 | Ga0068855_1000343525 | 170 |
| 477 | 3300005563 | Ga0068855_100052116 | Ga0068855_1000521165 | 170 |
| 478 | 3300005563 | Ga0068855_100918505 | Ga0068855_1009185051 | 170 |
| 479 | 3300005564 | Ga0070664_100110142 | Ga0070664_1001101422 | 170 |
| 480 | 3300005564 | Ga0070664_100306263 | Ga0070664_1003062632 | 170 |
| 481 | 3300005564 | Ga0070664_100415463 | Ga0070664_1004154633 | 170 |
| 482 | 3300005577 | Ga0068857_100025802 | Ga0068857_1000258024 | 170 |
| 483 | 3300005577 | Ga0068857_100321729 | Ga0068857_1003217293 | 170 |
| 484 | 3300005578 | Ga0068854_100337050 | Ga0068854_1003370502 | 170 |
| 485 | 3300005614 | Ga0068856_100001102 | Ga0068856_10000110220 | 170 |
| 486 | 3300005614 | Ga0068856_100840094 | Ga0068856_1008400942 | 170 |
| 487 | 3300005615 | Ga0070702_100438200 | Ga0070702_1004382001 | 170 |
| 488 | 3300005616 | Ga0068852_100154182 | Ga0068852_1001541823 | 170 |
| 489 | 3300005616 | Ga0068852_100203611 | Ga0068852_1002036112 | 170 |
| 490 | 3300005616 | Ga0068852_100609636 | Ga0068852_1006096362 | 170 |
| 491 | 3300005618 | Ga0068864_100268661 | Ga0068864_1002686612 | 170 |
| 492 | 3300005718 | Ga0068866_10315219 | Ga0068866_103152192 | 170 |
| 493 | 3300005719 | Ga0068861_100158542 | Ga0068861_1001585422 | 170 |
| 494 | 3300005719 | Ga0068861_101363567 | Ga0068861_1013635671 | 170 |
| 495 | 3300005842 | Ga0068858_100106297 | Ga0068858_1001062972 | 170 |
| 496 | 3300005843 | Ga0068860_100064123 | Ga0068860_1000641232 | 170 |
| 497 | 3300005843 | Ga0068860_100097306 | Ga0068860_1000973062 | 170 |
| 498 | 3300005844 | Ga0068862_100222251 | Ga0068862_1002222512 | 170 |
| 499 | 3300005844 | Ga0068862_100344771 | Ga0068862_1003447711 | 170 |
| 500 | 3300005844 | Ga0068862_100363040 | Ga0068862_1003630401 | 170 |
| 501 | 3300005983 | Ga0081540_1008823 | Ga0081540_10088236 | 170 |
| 502 | 3300005983 | Ga0081540_1018174 | Ga0081540_10181743 | 170 |
| 503 | 3300005985 | Ga0081539_10000051 | Ga0081539_1000005148 | 170 |
| 504 | 3300006028 | Ga0070717_10001453 | Ga0070717_100014539 | 170 |
| 505 | 3300006038 | Ga0075365_10144370 | Ga0075365_101443703 | 170 |
| 506 | 3300006038 | Ga0075365_10353105 | Ga0075365_103531053 | 170 |
| 507 | 3300006042 | Ga0075368_10041214 | Ga0075368_100412142 | 170 |
| 508 | 3300006042 | Ga0075368_10074001 | Ga0075368_100740012 | 170 |
| 509 | 3300006042 | Ga0075368_10113844 | Ga0075368_101138443 | 170 |
| 510 | 3300006048 | Ga0075363_100042880 | Ga0075363_1000428802 | 170 |
| 511 | 3300006048 | Ga0075363_100176068 | Ga0075363_1001760683 | 170 |
| 512 | 3300006051 | Ga0075364_10027527 | Ga0075364_100275273 | 170 |
| 513 | 3300006051 | Ga0075364_10042833 | Ga0075364_100428332 | 170 |
| 514 | 3300006051 | Ga0075364_10298371 | Ga0075364_102983712 | 170 |
| 515 | 3300006175 | Ga0070712_100543821 | Ga0070712_1005438211 | 170 |
| 516 | 3300006177 | Ga0075362_10027793 | Ga0075362_100277932 | 170 |
| 517 | 3300006178 | Ga0075367_10144048 | Ga0075367_101440482 | 170 |
| 518 | 3300006178 | Ga0075367_10212516 | Ga0075367_102125162 | 170 |
| 519 | 3300006178 | Ga0075367_10408836 | Ga0075367_104088362 | 170 |
| 520 | 3300006186 | Ga0075369_10025566 | Ga0075369_100255662 | 170 |
| 521 | 3300006195 | Ga0075366_10272145 | Ga0075366_102721453 | 170 |
| 522 | 3300006353 | Ga0075370_10050121 | Ga0075370_100501212 | 170 |
| 523 | 3300006353 | Ga0075370_10119846 | Ga0075370_101198463 | 170 |
| 524 | 3300006358 | Ga0068871_100353842 | Ga0068871_1003538422 | 170 |
| 525 | 3300006844 | Ga0075428_100082079 | Ga0075428_1000820792 | 170 |
| 526 | 3300006881 | Ga0068865_100329360 | Ga0068865_1003293602 | 170 |
| 527 | 3300006881 | Ga0068865_100836069 | Ga0068865_1008360692 | 170 |
| 528 | 3300006881 | Ga0068865_100872705 | Ga0068865_1008727052 | 170 |
| 529 | 3300007265 | Ga0099794_10009182 | Ga0099794_100091826 | 170 |
| 530 | 3300007265 | Ga0099794_10023104 | Ga0099794_100231043 | 170 |
| 531 | 3300007265 | Ga0099794_10056174 | Ga0099794_100561743 | 170 |
| 532 | 3300007788 | Ga0099795_10158825 | Ga0099795_101588251 | 170 |
| 533 | 3300007788 | Ga0099795_10219694 | Ga0099795_102196942 | 170 |
| 534 | 3300009092 | Ga0105250_10073854 | Ga0105250_100738541 | 170 |
| 535 | 3300009093 | Ga0105240_10018413 | Ga0105240_100184134 | 170 |
| 536 | 3300009093 | Ga0105240_10943169 | Ga0105240_109431692 | 170 |
| 537 | 3300009094 | Ga0111539_10124442 | Ga0111539_101244422 | 170 |
| 538 | 3300009098 | Ga0105245_10270455 | Ga0105245_102704553 | 170 |
| 539 | 3300009098 | Ga0105245_11627772 | Ga0105245_116277722 | 170 |
| 540 | 3300009101 | Ga0105247_10267360 | Ga0105247_102673602 | 170 |
| 541 | 3300009101 | Ga0105247_10287271 | Ga0105247_102872711 | 170 |
| 542 | 3300009101 | Ga0105247_10537868 | Ga0105247_105378683 | 170 |
| 543 | 3300009147 | Ga0114129_10390544 | Ga0114129_103905443 | 170 |
| 544 | 3300009147 | Ga0114129_11630058 | Ga0114129_116300582 | 170 |
| 545 | 3300009148 | Ga0105243_10150161 | Ga0105243_101501613 | 170 |
| 546 | 3300009148 | Ga0105243_10154726 | Ga0105243_101547263 | 170 |
| 547 | 3300009148 | Ga0105243_10885604 | Ga0105243_108856043 | 170 |
| 548 | 3300009174 | Ga0105241_10678064 | Ga0105241_106780642 | 170 |
| 549 | 3300009176 | Ga0105242_10548789 | Ga0105242_105487892 | 170 |
| 550 | 3300009176 | Ga0105242_10828415 | Ga0105242_108284152 | 170 |
| 551 | 3300009177 | Ga0105248_10103453 | Ga0105248_101034535 | 170 |
| 552 | 3300009177 | Ga0105248_10381536 | Ga0105248_103815362 | 170 |
| 553 | 3300009177 | Ga0105248_10693093 | Ga0105248_106930932 | 170 |
| 554 | 3300009545 | Ga0105237_10246838 | Ga0105237_102468382 | 170 |
| 555 | 3300009545 | Ga0105237_10428271 | Ga0105237_104282712 | 170 |
| 556 | 3300009545 | Ga0105237_10508256 | Ga0105237_105082562 | 170 |
| 557 | 3300009551 | Ga0105238_10776827 | Ga0105238_107768271 | 170 |
| 558 | 3300009553 | Ga0105249_10093817 | Ga0105249_100938172 | 170 |
| 559 | 3300009553 | Ga0105249_10757514 | Ga0105249_107575142 | 170 |
| 560 | 3300009553 | Ga0105249_12448209 | Ga0105249_124482091 | 170 |
| 561 | 3300010159 | Ga0099796_10278634 | Ga0099796_102786342 | 170 |
| 562 | 3300010375 | Ga0105239_10036703 | Ga0105239_100367035 | 170 |
| 563 | 3300010375 | Ga0105239_10116383 | Ga0105239_101163832 | 170 |
| 564 | 3300010375 | Ga0105239_10185057 | Ga0105239_101850573 | 170 |
| 565 | 3300011119 | Ga0105246_10128633 | Ga0105246_101286333 | 170 |
| 566 | 3300013105 | Ga0157369_10014981 | Ga0157369_100149813 | 170 |
| 567 | 3300013296 | Ga0157374_10741471 | Ga0157374_107414711 | 170 |
| 568 | 3300013297 | Ga0157378_10069664 | Ga0157378_100696643 | 170 |
| 569 | 3300013297 | Ga0157378_10100155 | Ga0157378_101001552 | 170 |
| 570 | 3300013297 | Ga0157378_11024783 | Ga0157378_110247832 | 170 |
| 571 | 3300013297 | Ga0157378_11146833 | Ga0157378_111468332 | 170 |
| 572 | 3300013306 | Ga0163162_10030420 | Ga0163162_100304202 | 170 |
| 573 | 3300013306 | Ga0163162_10961611 | Ga0163162_109616113 | 170 |
| 574 | 3300013306 | Ga0163162_11150631 | Ga0163162_111506312 | 170 |
| 575 | 3300013308 | Ga0157375_11120442 | Ga0157375_111204423 | 170 |
| 576 | 3300013308 | Ga0157375_11497034 | Ga0157375_114970343 | 170 |
| 577 | 3300013308 | Ga0157375_12366936 | Ga0157375_123669361 | 170 |
| 578 | 3300014325 | Ga0163163_10819068 | Ga0163163_108190683 | 170 |
| 579 | 3300014325 | Ga0163163_11315323 | Ga0163163_113153232 | 170 |
| 580 | 3300014745 | Ga0157377_10209679 | Ga0157377_102096793 | 170 |
| 581 | 3300014968 | Ga0157379_10803549 | Ga0157379_108035492 | 170 |
| 582 | 3300014968 | Ga0157379_11085431 | Ga0157379_110854311 | 170 |
| 583 | 3300017792 | Ga0163161_10311369 | Ga0163161_103113692 | 170 |
| 584 | 3300021377 | Ga0213874_10052606 | Ga0213874_100526062 | 170 |
| 585 | 3300021384 | Ga0213876_10025827 | Ga0213876_100258272 | 170 |
| 586 | 3300025297 | Ga0209758_1020919 | Ga0209758_10209193 | 170 |
| 587 | 3300025321 | Ga0207656_10213684 | Ga0207656_102136842 | 170 |
| 588 | 3300025899 | Ga0207642_10325648 | Ga0207642_103256482 | 170 |
| 589 | 3300025900 | Ga0207710_10066554 | Ga0207710_100665543 | 170 |
| 590 | 3300025901 | Ga0207688_10263145 | Ga0207688_102631451 | 170 |
| 591 | 3300025901 | Ga0207688_10269932 | Ga0207688_102699322 | 170 |
| 592 | 3300025905 | Ga0207685_10253547 | Ga0207685_102535471 | 170 |
| 593 | 3300025906 | Ga0207699_10578041 | Ga0207699_105780412 | 170 |
| 594 | 3300025907 | Ga0207645_10321249 | Ga0207645_103212492 | 170 |
| 595 | 3300025909 | Ga0207705_10052106 | Ga0207705_100521063 | 170 |
| 596 | 3300025909 | Ga0207705_10078949 | Ga0207705_100789492 | 170 |
| 597 | 3300025910 | Ga0207684_10099553 | Ga0207684_100995532 | 170 |
| 598 | 3300025910 | Ga0207684_10413970 | Ga0207684_104139703 | 170 |
| 599 | 3300025912 | Ga0207707_10005224 | Ga0207707_100052245 | 170 |
| 600 | 3300025912 | Ga0207707_10110069 | Ga0207707_101100692 | 170 |
| 601 | 3300025913 | Ga0207695_10275211 | Ga0207695_102752113 | 170 |
| 602 | 3300025914 | Ga0207671_10255621 | Ga0207671_102556212 | 170 |
| 603 | 3300025915 | Ga0207693_10048081 | Ga0207693_100480813 | 170 |
| 604 | 3300025915 | Ga0207693_10119608 | Ga0207693_101196082 | 170 |
| 605 | 3300025916 | Ga0207663_10166444 | Ga0207663_101664443 | 170 |
| 606 | 3300025917 | Ga0207660_10020207 | Ga0207660_100202075 | 170 |
| 607 | 3300025917 | Ga0207660_10647041 | Ga0207660_106470412 | 170 |
| 608 | 3300025919 | Ga0207657_10120762 | Ga0207657_101207623 | 170 |
| 609 | 3300025919 | Ga0207657_10633805 | Ga0207657_106338052 | 170 |
| 610 | 3300025921 | Ga0207652_10016767 | Ga0207652_100167675 | 170 |
| 611 | 3300025922 | Ga0207646_10288512 | Ga0207646_102885123 | 170 |
| 612 | 3300025923 | Ga0207681_10250673 | Ga0207681_102506732 | 170 |
| 613 | 3300025923 | Ga0207681_10372728 | Ga0207681_103727282 | 170 |
| 614 | 3300025924 | Ga0207694_10152968 | Ga0207694_101529682 | 170 |
| 615 | 3300025924 | Ga0207694_10525826 | Ga0207694_105258262 | 170 |
| 616 | 3300025925 | Ga0207650_11412129 | Ga0207650_114121291 | 170 |
| 617 | 3300025926 | Ga0207659_10213269 | Ga0207659_102132692 | 170 |
| 618 | 3300025926 | Ga0207659_10521549 | Ga0207659_105215492 | 170 |
| 619 | 3300025926 | Ga0207659_11482829 | Ga0207659_114828291 | 170 |
| 620 | 3300025926 | Ga0207659_11597119 | Ga0207659_115971191 | 170 |
| 621 | 3300025927 | Ga0207687_10685226 | Ga0207687_106852262 | 170 |
| 622 | 3300025928 | Ga0207700_10130554 | Ga0207700_101305542 | 170 |
| 623 | 3300025929 | Ga0207664_11331000 | Ga0207664_113310002 | 170 |
| 624 | 3300025931 | Ga0207644_10143378 | Ga0207644_101433782 | 170 |
| 625 | 3300025932 | Ga0207690_10359404 | Ga0207690_103594043 | 170 |
| 626 | 3300025932 | Ga0207690_10686801 | Ga0207690_106868013 | 170 |
| 627 | 3300025933 | Ga0207706_10072973 | Ga0207706_100729732 | 170 |
| 628 | 3300025933 | Ga0207706_10552858 | Ga0207706_105528583 | 170 |
| 629 | 3300025935 | Ga0207709_10197650 | Ga0207709_101976503 | 170 |
| 630 | 3300025935 | Ga0207709_10277053 | Ga0207709_102770533 | 170 |
| 631 | 3300025936 | Ga0207670_10366598 | Ga0207670_103665983 | 170 |
| 632 | 3300025937 | Ga0207669_10250204 | Ga0207669_102502042 | 170 |
| 633 | 3300025940 | Ga0207691_10309399 | Ga0207691_103093993 | 170 |
| 634 | 3300025941 | Ga0207711_10046752 | Ga0207711_100467525 | 170 |
| 635 | 3300025942 | Ga0207689_10041355 | Ga0207689_100413554 | 170 |
| 636 | 3300025945 | Ga0207679_10243490 | Ga0207679_102434903 | 170 |
| 637 | 3300025945 | Ga0207679_10248660 | Ga0207679_102486602 | 170 |
| 638 | 3300025949 | Ga0207667_10006683 | Ga0207667_100066832 | 170 |
| 639 | 3300025949 | Ga0207667_10283365 | Ga0207667_102833653 | 170 |
| 640 | 3300025961 | Ga0207712_10012948 | Ga0207712_100129485 | 170 |
| 641 | 3300025972 | Ga0207668_10010526 | Ga0207668_100105262 | 170 |
| 642 | 3300025972 | Ga0207668_10037590 | Ga0207668_100375902 | 170 |
| 643 | 3300025972 | Ga0207668_10047779 | Ga0207668_100477793 | 170 |
| 644 | 3300025972 | Ga0207668_11274381 | Ga0207668_112743811 | 170 |
| 645 | 3300025981 | Ga0207640_10365564 | Ga0207640_103655642 | 170 |
| 646 | 3300025986 | Ga0207658_10665146 | Ga0207658_106651462 | 170 |
| 647 | 3300026023 | Ga0207677_10712367 | Ga0207677_107123671 | 170 |
| 648 | 3300026035 | Ga0207703_10097641 | Ga0207703_100976412 | 170 |
| 649 | 3300026041 | Ga0207639_10091196 | Ga0207639_100911962 | 170 |
| 650 | 3300026041 | Ga0207639_10121012 | Ga0207639_101210122 | 170 |
| 651 | 3300026067 | Ga0207678_10113826 | Ga0207678_101138262 | 170 |
| 652 | 3300026067 | Ga0207678_10223993 | Ga0207678_102239933 | 170 |
| 653 | 3300026067 | Ga0207678_10268474 | Ga0207678_102684743 | 170 |
| 654 | 3300026067 | Ga0207678_10312257 | Ga0207678_103122573 | 170 |
| 655 | 3300026067 | Ga0207678_10612757 | Ga0207678_106127572 | 170 |
| 656 | 3300026075 | Ga0207708_10008525 | Ga0207708_100085256 | 170 |
| 657 | 3300026075 | Ga0207708_11148620 | Ga0207708_111486202 | 170 |
| 658 | 3300026078 | Ga0207702_10001047 | Ga0207702_100010478 | 170 |
| 659 | 3300026078 | Ga0207702_10228565 | Ga0207702_102285653 | 170 |
| 660 | 3300026088 | Ga0207641_10400936 | Ga0207641_104009362 | 170 |
| 661 | 3300026089 | Ga0207648_10089994 | Ga0207648_100899942 | 170 |
| 662 | 3300026089 | Ga0207648_10416531 | Ga0207648_104165313 | 170 |
| 663 | 3300026095 | Ga0207676_10243216 | Ga0207676_102432163 | 170 |
| 664 | 3300026095 | Ga0207676_11133763 | Ga0207676_111337632 | 170 |
| 665 | 3300026116 | Ga0207674_10012072 | Ga0207674_100120727 | 170 |
| 666 | 3300026116 | Ga0207674_10348965 | Ga0207674_103489652 | 170 |
| 667 | 3300026116 | Ga0207674_10419768 | Ga0207674_104197682 | 170 |
| 668 | 3300026118 | Ga0207675_100028411 | Ga0207675_1000284115 | 170 |
| 669 | 3300026118 | Ga0207675_100188181 | Ga0207675_1001881813 | 170 |
| 670 | 3300026118 | Ga0207675_101432763 | Ga0207675_1014327631 | 170 |
| 671 | 3300026121 | Ga0207683_10073609 | Ga0207683_100736093 | 170 |
| 672 | 3300026121 | Ga0207683_10098824 | Ga0207683_100988242 | 170 |
| 673 | 3300026121 | Ga0207683_10257155 | Ga0207683_102571552 | 170 |
| 674 | 3300026121 | Ga0207683_10863138 | Ga0207683_108631383 | 170 |
| 675 | 3300027671 | Ga0209588_1026891 | Ga0209588_10268912 | 170 |
| 676 | 3300027671 | Ga0209588_1067060 | Ga0209588_10670603 | 170 |
| 677 | 3300027866 | Ga0209813_10048772 | Ga0209813_100487722 | 170 |
| 678 | 3300027866 | Ga0209813_10189949 | Ga0209813_101899492 | 170 |
| 679 | 3300027907 | Ga0207428_10197381 | Ga0207428_101973812 | 170 |
| 680 | 3300027907 | Ga0207428_10483372 | Ga0207428_104833722 | 170 |
| 681 | 3300028379 | Ga0268266_10002184 | Ga0268266_1000218413 | 170 |
| 682 | 3300028379 | Ga0268266_10060151 | Ga0268266_100601514 | 170 |
| 683 | 3300028379 | Ga0268266_10153118 | Ga0268266_101531182 | 170 |
| 684 | 3300028379 | Ga0268266_10249767 | Ga0268266_102497672 | 170 |
| 685 | 3300028379 | Ga0268266_10958335 | Ga0268266_109583353 | 170 |
| 686 | 3300028380 | Ga0268265_10072126 | Ga0268265_100721262 | 170 |
| 687 | 3300028380 | Ga0268265_10213468 | Ga0268265_102134683 | 170 |
| 688 | 3300028380 | Ga0268265_11175410 | Ga0268265_111754103 | 170 |
| 689 | 3300028381 | Ga0268264_10193987 | Ga0268264_101939872 | 170 |
| 690 | 3300028786 | Ga0307517_10078607 | Ga0307517_100786073 | 170 |
| 691 | 3300031235 | Ga0265330_10058161 | Ga0265330_100581613 | 170 |
| 692 | 3300031235 | Ga0265330_10252262 | Ga0265330_102522622 | 170 |
| 693 | 3300031238 | Ga0265332_10065690 | Ga0265332_100656903 | 170 |
| 694 | 3300031241 | Ga0265325_10020366 | Ga0265325_100203662 | 170 |
| 695 | 3300031247 | Ga0265340_10007905 | Ga0265340_100079055 | 170 |
| 696 | 3300031249 | Ga0265339_10021548 | Ga0265339_100215483 | 170 |
| 697 | 3300031249 | Ga0265339_10100600 | Ga0265339_101006001 | 170 |
| 698 | 3300031249 | Ga0265339_10241996 | Ga0265339_102419961 | 170 |
| 699 | 3300031250 | Ga0265331_10032416 | Ga0265331_100324162 | 170 |
| 700 | 3300031344 | Ga0265316_10193425 | Ga0265316_101934253 | 170 |
| 701 | 3300031344 | Ga0265316_10869292 | Ga0265316_108692922 | 170 |
| 702 | 3300031456 | Ga0307513_10792852 | Ga0307513_107928522 | 170 |
| 703 | 3300031616 | Ga0307508_10154913 | Ga0307508_101549133 | 170 |
| 704 | 3300031616 | Ga0307508_10199081 | Ga0307508_101990813 | 170 |
| 705 | 3300031711 | Ga0265314_10001300 | Ga0265314_1000130010 | 170 |
| 706 | 3300031711 | Ga0265314_10081181 | Ga0265314_100811813 | 170 |
| 707 | 3300031712 | Ga0265342_10032530 | Ga0265342_100325302 | 170 |
| 708 | 3300031712 | Ga0265342_10266819 | Ga0265342_102668192 | 170 |
| 709 | 3300031731 | Ga0307405_10070040 | Ga0307405_100700402 | 170 |
| 710 | 3300031731 | Ga0307405_10775690 | Ga0307405_107756901 | 170 |
| 711 | 3300031901 | Ga0307406_10080793 | Ga0307406_100807933 | 170 |
| 712 | 3300032005 | Ga0307411_10190555 | Ga0307411_101905552 | 170 |
| 713 | 3300033180 | Ga0307510_10021118 | Ga0307510_100211187 | 170 |
| 714 | 3300035086 | Ga0373934_0044142 | Ga0373934_0044142_720_1232 | 170 |
| 715 | 3300035086 | Ga0373934_0116328 | Ga0373934_0116328_37_549 | 170 |
| 716 | 3300035111 | Ga0373923_0018239 | Ga0373923_0018239_1934_2446 | 170 |
| 717 | 3300035111 | Ga0373923_0089817 | Ga0373923_0089817_693_1205 | 170 |
| 718 | 3300035113 | Ga0373936_0042259 | Ga0373936_0042259_586_1098 | 170 |
| 719 | 3300035116 | Ga0373945_0014945 | Ga0373945_0014945_530_1042 | 170 |
| 720 | 3300035116 | Ga0373945_0178031 | Ga0373945_0178031_61_573 | 170 |
| 721 | 3300035117 | Ga0373953_0001115 | Ga0373953_0001115_4511_5023 | 170 |
| 722 | 3300035118 | Ga0373954_0005560 | Ga0373954_0005560_2636_3148 | 170 |
| 723 | 3300035118 | Ga0373954_0027484 | Ga0373954_0027484_309_821 | 170 |
| 724 | 3300035118 | Ga0373954_0065815 | Ga0373954_0065815_245_757 | 170 |
| 725 | 3300035119 | Ga0373956_0000298 | Ga0373956_0000298_10349_10861 | 170 |
| 726 | 3300035119 | Ga0373956_0033906 | Ga0373956_0033906_1025_1537 | 170 |
| 727 | 3300035120 | Ga0373957_0001343 | Ga0373957_0001343_135_647 | 170 |
| 728 | 3300035120 | Ga0373957_0023830 | Ga0373957_0023830_422_934 | 170 |
| 729 | 3300035170 | Ga0373943_0008246 | Ga0373943_0008246_1127_1639 | 170 |
| 730 | 3300035172 | Ga0373955_0004260 | Ga0373955_0004260_5685_6197 | 170 |
| 731 | 3300035207 | Ga0373942_0068932 | Ga0373942_0068932_45_560 | 170 |
| 732 | 3300035410 | Ga0373924_0004379 | Ga0373924_0004379_3596_4108 | 170 |
| 733 | 3300035410 | Ga0373924_0096122 | Ga0373924_0096122_268_780 | 170 |
| 734 | 3300035691 | Ga0373931_0132728 | Ga0373931_0132728_826_1338 | 170 |
| 735 | 3300035692 | Ga0373935_0000186 | Ga0373935_0000186_11386_11898 | 170 |
| 736 | 3300035692 | Ga0373935_0090898 | Ga0373935_0090898_1398_1910 | 170 |
| 737 | 3300035692 | Ga0373935_0212816 | Ga0373935_0212816_586_1098 | 170 |
| 738 | 3300035695 | Ga0373927_0001401 | Ga0373927_0001401_9953_10465 | 170 |
| 739 | 3300035695 | Ga0373927_0004095 | Ga0373927_0004095_9444_9956 | 170 |
| 740 | 3300035695 | Ga0373927_0023017 | Ga0373927_0023017_1537_2049 | 170 |
| 741 | 3300035695 | Ga0373927_0163659 | Ga0373927_0163659_235_747 | 170 |
| 742 | 3300035724 | Ga0373933_0000368 | Ga0373933_0000368_6413_6925 | 170 |
| 743 | 3300035725 | Ga0373947_0001325 | Ga0373947_0001325_9828_10340 | 170 |
| 744 | 3300035725 | Ga0373947_0089206 | Ga0373947_0089206_138_650 | 170 |
| 745 | 3300035725 | Ga0373947_0457516 | Ga0373947_0457516_50_562 | 170 |
| 746 | 3300036401 | Ga0373937_0009543 | Ga0373937_0009543_3925_4437 | 170 |
| 747 | 3300036401 | Ga0373937_0115123 | Ga0373937_0115123_712_1224 | 170 |
| 748 | 3300037068 | Ga0373925_0002553 | Ga0373925_0002553_293_805 | 170 |
| 749 | 3300037068 | Ga0373925_0037874 | Ga0373925_0037874_1224_1736 | 170 |
| 750 | 3300037068 | Ga0373925_0253610 | Ga0373925_0253610_190_702 | 170 |
| 751 | 3300037068 | Ga0373925_0260018 | Ga0373925_0260018_233_745 | 170 |
| 752 | 3300037418 | Ga0395900_0908025 | Ga0395900_0908025_75_587 | 170 |
| 753 | 3300037471 | Ga0395905_0100918 | Ga0395905_0100918_1217_1729 | 170 |
| 754 | 3300037853 | Ga0436364_0385142 | Ga0436364_0385142_82_594 | 170 |
| 755 | 3300037853 | Ga0436364_1460540 | Ga0436364_1460540_2438_2950 | 170 |
| 756 | 3300038443 | Ga0395901_0158993 | Ga0395901_0158993_17_529 | 170 |
| 757 | 3300039437 | Ga0436365_0735123 | Ga0436365_0735123_440_952 | 170 |
| 758 | 3300039437 | Ga0436365_0990941 | Ga0436365_0990941_4860_5372 | 170 |
| 759 | 3300039438 | Ga0436360_1376600 | Ga0436360_1376600_1296_1808 | 170 |
| 760 | 3300039450 | Ga0436363_0951156 | Ga0436363_0951156_264_776 | 170 |
| 761 | 3300039453 | Ga0436362_1182516 | Ga0436362_1182516_103_615 | 170 |
| 762 | 3300041413 | Ga0439465_0027021 | Ga0439465_0027021_977_1489 | 170 |
| 763 | 3300041451 | Ga0451791_0227239 | Ga0451791_0227239_25_537 | 170 |
| 764 | 3300041451 | Ga0451791_1046831 | Ga0451791_1046831_205_717 | 170 |
| 765 | 3300041452 | Ga0451793_0175087 | Ga0451793_0175087_10_522 | 170 |
| 766 | 3300041453 | Ga0451797_1036343 | Ga0451797_1036343_335_847 | 170 |
| 767 | 3300041460 | Ga0451802_0491935 | Ga0451802_0491935_18_530 | 170 |
| 768 | 3300041460 | Ga0451802_1397736 | Ga0451802_1397736_43_555 | 170 |
| 769 | 3300041494 | Ga0451837_1228415 | Ga0451837_1228415_68_580 | 170 |
| 770 | 3300041512 | Ga0451853_2172712 | Ga0451853_2172712_89_601 | 170 |
| 771 | 3300042157 | Ga0439458_0056731 | Ga0439458_0056731_23_535 | 170 |
| 772 | 3300042438 | Ga0439459_0004861 | Ga0439459_0004861_234_746 | 170 |
| 773 | 3300046452 | Ga0495617_017617 | Ga0495617_017617_1022_1534 | 170 |
| 774 | 3300046454 | Ga0495592_0001299 | Ga0495592_0001299_2530_3042 | 170 |
| 775 | 3300046454 | Ga0495592_0098492 | Ga0495592_0098492_1436_1948 | 170 |
| 776 | 3300046455 | Ga0495603_0001707 | Ga0495603_0001707_7278_7790 | 170 |
| 777 | 3300046455 | Ga0495603_0002520 | Ga0495603_0002520_2893_3405 | 170 |
| 778 | 3300046455 | Ga0495603_0025039 | Ga0495603_0025039_1886_2398 | 170 |
| 779 | 3300046455 | Ga0495603_0108439 | Ga0495603_0108439_387_899 | 170 |
| 780 | 3300046459 | Ga0495629_0000606 | Ga0495629_0000606_19938_20450 | 170 |
| 781 | 3300046459 | Ga0495629_0012153 | Ga0495629_0012153_559_1071 | 170 |
| 782 | 3300046459 | Ga0495629_0188199 | Ga0495629_0188199_672_1184 | 170 |
| 783 | 3300046460 | Ga0495638_0046286 | Ga0495638_0046286_1290_1802 | 170 |
| 784 | 3300046460 | Ga0495638_0492508 | Ga0495638_0492508_92_604 | 170 |
| 785 | 3300046462 | Ga0495651_0031188 | Ga0495651_0031188_188_700 | 170 |
| 786 | 3300046462 | Ga0495651_0034272 | Ga0495651_0034272_2087_2599 | 170 |
| 787 | 3300046463 | Ga0495653_0053884 | Ga0495653_0053884_139_651 | 170 |
| 788 | 3300046471 | Ga0495650_0108601 | Ga0495650_0108601_59_571 | 170 |
| 789 | 3300046472 | Ga0495580_0001307 | Ga0495580_0001307_13187_13699 | 170 |
| 790 | 3300046472 | Ga0495580_0235487 | Ga0495580_0235487_88_600 | 170 |
| 791 | 3300046475 | Ga0495639_0000136 | Ga0495639_0000136_8783_9295 | 170 |
| 792 | 3300046476 | Ga0495662_0000392 | Ga0495662_0000392_8355_8867 | 170 |
| 793 | 3300046477 | Ga0495664_0009869 | Ga0495664_0009869_2468_2980 | 170 |
| 794 | 3300046477 | Ga0495664_0010089 | Ga0495664_0010089_678_1190 | 170 |
| 795 | 3300046477 | Ga0495664_0061267 | Ga0495664_0061267_427_939 | 170 |
| 796 | 3300046477 | Ga0495664_0136765 | Ga0495664_0136765_758_1270 | 170 |
| 797 | 3300046491 | Ga0495584_0061716 | Ga0495584_0061716_141_653 | 170 |
| 798 | 3300046492 | Ga0495585_0087422 | Ga0495585_0087422_911_1423 | 170 |
| 799 | 3300046499 | Ga0495594_0000843 | Ga0495594_0000843_6667_7179 | 170 |
| 800 | 3300046499 | Ga0495594_0059578 | Ga0495594_0059578_193_705 | 170 |
| 801 | 3300046500 | Ga0495596_0149365 | Ga0495596_0149365_382_894 | 170 |
| 802 | 3300046501 | Ga0495607_0356540 | Ga0495607_0356540_23_535 | 170 |
| 803 | 3300046506 | Ga0495583_0191397 | Ga0495583_0191397_227_739 | 170 |
| 804 | 3300046506 | Ga0495583_0265526 | Ga0495583_0265526_75_587 | 170 |
| 805 | 3300046507 | Ga0495606_0003785 | Ga0495606_0003785_6050_6562 | 170 |
| 806 | 3300046511 | Ga0495608_0008627 | Ga0495608_0008627_5887_6399 | 170 |
| 807 | 3300046512 | Ga0495610_0102076 | Ga0495610_0102076_103_615 | 170 |
| 808 | 3300046512 | Ga0495610_0191172 | Ga0495610_0191172_100_612 | 170 |
| 809 | 3300046513 | Ga0495616_0077966 | Ga0495616_0077966_166_678 | 170 |
| 810 | 3300046514 | Ga0495618_0214507 | Ga0495618_0214507_420_932 | 170 |
| 811 | 3300046515 | Ga0495620_0058290 | Ga0495620_0058290_336_848 | 170 |
| 812 | 3300046516 | Ga0495628_0053564 | Ga0495628_0053564_574_1086 | 170 |
| 813 | 3300046516 | Ga0495628_0085243 | Ga0495628_0085243_485_997 | 170 |
| 814 | 3300046517 | Ga0495630_0285172 | Ga0495630_0285172_509_1021 | 170 |
| 815 | 3300046519 | Ga0495632_0124882 | Ga0495632_0124882_240_752 | 170 |
| 816 | 3300046523 | Ga0495644_0112986 | Ga0495644_0112986_161_673 | 170 |
| 817 | 3300046523 | Ga0495644_0196056 | Ga0495644_0196056_86_598 | 170 |
| 818 | 3300046524 | Ga0495648_0005884 | Ga0495648_0005884_4466_4978 | 170 |
| 819 | 3300046526 | Ga0495666_0162264 | Ga0495666_0162264_63_575 | 170 |
| 820 | 3300046529 | Ga0495652_0082944 | Ga0495652_0082944_1587_2099 | 170 |
| 821 | 3300046529 | Ga0495652_0101851 | Ga0495652_0101851_738_1250 | 170 |
| 822 | 3300046529 | Ga0495652_0194649 | Ga0495652_0194649_375_887 | 170 |
| 823 | 3300046529 | Ga0495652_0268062 | Ga0495652_0268062_297_809 | 170 |
| 824 | 3300046529 | Ga0495652_0620996 | Ga0495652_0620996_161_673 | 170 |
| 825 | 3300046531 | Ga0495665_0000026 | Ga0495665_0000026_31593_32105 | 170 |
| 826 | 3300046533 | Ga0495640_0019925 | Ga0495640_0019925_2903_3415 | 170 |
| 827 | 3300046533 | Ga0495640_0032516 | Ga0495640_0032516_625_1137 | 170 |
| 828 | 3300046533 | Ga0495640_0089605 | Ga0495640_0089605_172_684 | 170 |
| 829 | 3300046533 | Ga0495640_0312686 | Ga0495640_0312686_433_945 | 170 |
| 830 | 3300046536 | Ga0495587_0019713 | Ga0495587_0019713_3207_3719 | 170 |
| 831 | 3300046536 | Ga0495587_0081199 | Ga0495587_0081199_1356_1868 | 170 |
| 832 | 3300046537 | Ga0495598_0005787 | Ga0495598_0005787_2204_2716 | 170 |
| 833 | 3300046537 | Ga0495598_0094724 | Ga0495598_0094724_289_801 | 170 |
| 834 | 3300046539 | Ga0495621_0014542 | Ga0495621_0014542_1699_2211 | 170 |
| 835 | 3300046539 | Ga0495621_0095710 | Ga0495621_0095710_547_1059 | 170 |
| 836 | 3300046542 | Ga0495597_0230225 | Ga0495597_0230225_22_534 | 170 |
| 837 | 3300046543 | Ga0495645_0013176 | Ga0495645_0013176_2407_2919 | 170 |
| 838 | 3300046543 | Ga0495645_0035707 | Ga0495645_0035707_1227_1739 | 170 |
| 839 | 3300046543 | Ga0495645_0150289 | Ga0495645_0150289_468_980 | 170 |
| 840 | 3300046557 | Ga0495622_0002841 | Ga0495622_0002841_4486_4998 | 170 |
| 841 | 3300046558 | Ga0495633_0096722 | Ga0495633_0096722_303_815 | 170 |
| 842 | 3300046558 | Ga0495633_0115874 | Ga0495633_0115874_541_1053 | 170 |
| 843 | 3300046559 | Ga0495667_0028023 | Ga0495667_0028023_1308_1820 | 170 |
| 844 | 3300046559 | Ga0495667_0047064 | Ga0495667_0047064_1290_1802 | 170 |
| 845 | 3300046559 | Ga0495667_0048749 | Ga0495667_0048749_38_550 | 170 |
| 846 | 3300046559 | Ga0495667_0128776 | Ga0495667_0128776_80_592 | 170 |
| 847 | 3300046615 | Ga0495656_0057916 | Ga0495656_0057916_862_1374 | 170 |
| 848 | 3300046615 | Ga0495656_0334263 | Ga0495656_0334263_46_558 | 170 |
| 849 | 3300046616 | Ga0495668_0341131 | Ga0495668_0341131_217_729 | 170 |
| 850 | 3300046642 | Ga0495634_0000634 | Ga0495634_0000634_24766_25278 | 170 |
| 851 | 3300046642 | Ga0495634_0023387 | Ga0495634_0023387_2166_2678 | 170 |
| 852 | 3300046642 | Ga0495634_0042420 | Ga0495634_0042420_317_829 | 170 |
| 853 | 3300046648 | Ga0495611_0094639 | Ga0495611_0094639_300_812 | 170 |
| 854 | 3300046648 | Ga0495611_0255654 | Ga0495611_0255654_243_755 | 170 |
| 855 | 3300046648 | Ga0495611_0419225 | Ga0495611_0419225_31_543 | 170 |
| 856 | 3300046660 | Ga0495625_0217787 | Ga0495625_0217787_28_540 | 170 |
| 857 | 3300046660 | Ga0495625_0370258 | Ga0495625_0370258_174_686 | 170 |
| 858 | 3300046660 | Ga0495625_0526124 | Ga0495625_0526124_74_586 | 170 |
| 859 | 3300046663 | Ga0495635_0000827 | Ga0495635_0000827_9549_10061 | 170 |
| 860 | 3300046663 | Ga0495635_0002063 | Ga0495635_0002063_5886_6398 | 170 |
| 861 | 3300046663 | Ga0495635_0137115 | Ga0495635_0137115_729_1241 | 170 |
| 862 | 3300046674 | Ga0495588_0050578 | Ga0495588_0050578_680_1192 | 170 |
| 863 | 3300046675 | Ga0495657_0032998 | Ga0495657_0032998_250_762 | 170 |
| 864 | 3300046675 | Ga0495657_0042292 | Ga0495657_0042292_1686_2198 | 170 |
| 865 | 3300046675 | Ga0495657_0150903 | Ga0495657_0150903_526_1038 | 170 |
| 866 | 3300046678 | Ga0495599_0074009 | Ga0495599_0074009_738_1250 | 170 |
| 867 | 3300046678 | Ga0495599_0167839 | Ga0495599_0167839_284_796 | 170 |
| 868 | 3300046678 | Ga0495599_0311306 | Ga0495599_0311306_258_770 | 170 |
| 869 | 3300046679 | Ga0495623_0004722 | Ga0495623_0004722_2553_3065 | 170 |
| 870 | 3300046679 | Ga0495623_0039351 | Ga0495623_0039351_1428_1940 | 170 |
| 871 | 3300046680 | Ga0495646_0054824 | Ga0495646_0054824_362_874 | 170 |
| 872 | 3300046680 | Ga0495646_0209439 | Ga0495646_0209439_481_993 | 170 |
| 873 | 3300046683 | Ga0495658_0002383 | Ga0495658_0002383_5695_6207 | 170 |
| 874 | 3300046684 | Ga0495669_0032965 | Ga0495669_0032965_1552_2064 | 170 |
| 875 | 3300046684 | Ga0495669_0182944 | Ga0495669_0182944_424_936 | 170 |
| 876 | 3300046689 | Ga0495613_0025652 | Ga0495613_0025652_2572_3084 | 170 |
| 877 | 3300046689 | Ga0495613_0072434 | Ga0495613_0072434_694_1206 | 170 |
| 878 | 3300046689 | Ga0495613_0082704 | Ga0495613_0082704_27_539 | 170 |
| 879 | 3300046690 | Ga0495624_0000201 | Ga0495624_0000201_9631_10143 | 170 |
| 880 | 3300046691 | Ga0495670_0242639 | Ga0495670_0242639_301_813 | 170 |
| 881 | 3300046692 | Ga0495671_0374117 | Ga0495671_0374117_55_567 | 170 |
| 882 | 3300046694 | Ga0495649_0229220 | Ga0495649_0229220_214_726 | 170 |
| 883 | 3300046794 | Ga0495589_0431725 | Ga0495589_0431725_20_532 | 170 |
| 884 | 3300046809 | Ga0495600_0024231 | Ga0495600_0024231_1522_2034 | 170 |
| 885 | 3300046809 | Ga0495600_0025302 | Ga0495600_0025302_122_634 | 170 |
| 886 | 3300046809 | Ga0495600_0075575 | Ga0495600_0075575_1472_1984 | 170 |
| 887 | 3300046809 | Ga0495600_0379276 | Ga0495600_0379276_331_843 | 170 |
| 888 | 3300047315 | Ga0495581_0000828 | Ga0495581_0000828_9993_10505 | 170 |
| 889 | 3300047317 | Ga0495604_0052770 | Ga0495604_0052770_956_1468 | 170 |
| 890 | 3300047317 | Ga0495604_0879966 | Ga0495604_0879966_38_550 | 170 |
| 891 | 3300047319 | Ga0495674_0070830 | Ga0495674_0070830_2464_2976 | 170 |
| 892 | 3300047319 | Ga0495674_0076190 | Ga0495674_0076190_1702_2214 | 170 |
| 893 | 3300047319 | Ga0495674_0455893 | Ga0495674_0455893_366_878 | 170 |
| 894 | 3300047320 | Ga0495672_0016840 | Ga0495672_0016840_3024_3536 | 170 |
| 895 | 3300047321 | Ga0495676_0018819 | Ga0495676_0018819_529_1041 | 170 |
| 896 | 3300047321 | Ga0495676_0218246 | Ga0495676_0218246_317_829 | 170 |
| 897 | 3300047322 | Ga0495680_0068454 | Ga0495680_0068454_554_1066 | 170 |
| 898 | 3300047322 | Ga0495680_0434811 | Ga0495680_0434811_139_651 | 170 |
| 899 | 3300047322 | Ga0495680_0497209 | Ga0495680_0497209_285_797 | 170 |
| 900 | 3300047444 | Ga0495675_0130176 | Ga0495675_0130176_712_1224 | 170 |
| 901 | 3300047444 | Ga0495675_0713985 | Ga0495675_0713985_38_550 | 170 |
| 902 | 3300047445 | Ga0495677_0025572 | Ga0495677_0025572_264_776 | 170 |
| 903 | 3300047445 | Ga0495677_0069072 | Ga0495677_0069072_441_953 | 170 |
| 904 | 3300047469 | Ga0495673_0026878 | Ga0495673_0026878_1643_2155 | 170 |
| 905 | 3300047469 | Ga0495673_0105254 | Ga0495673_0105254_222_734 | 170 |
| 906 | 3300047470 | Ga0495681_0157067 | Ga0495681_0157067_168_680 | 170 |
| 907 | 3300047471 | Ga0495684_0034305 | Ga0495684_0034305_1280_1792 | 170 |
| 908 | 3300047471 | Ga0495684_0051065 | Ga0495684_0051065_2249_2761 | 170 |
| 909 | 3300047472 | Ga0495686_0076032 | Ga0495686_0076032_1099_1611 | 170 |
| 910 | 3300047472 | Ga0495686_0334789 | Ga0495686_0334789_146_658 | 170 |
| 911 | 3300047673 | Ga0495593_0000282 | Ga0495593_0000282_20495_21007 | 170 |
| 912 | 3300047673 | Ga0495593_0001509 | Ga0495593_0001509_416_928 | 170 |
| 913 | 3300048088 | Ga0495602_0089153 | Ga0495602_0089153_312_824 | 170 |
| 914 | 3300048088 | Ga0495602_0221809 | Ga0495602_0221809_38_550 | 170 |
| 915 | 3300048088 | Ga0495602_0744782 | Ga0495602_0744782_23_535 | 170 |
| 916 | 3300048089 | Ga0495614_0016341 | Ga0495614_0016341_1678_2190 | 170 |
| 917 | 3300048903 | Ga0496100_0189176 | Ga0496100_0189176_674_1186 | 170 |
| 918 | 3300048903 | Ga0496100_0342336 | Ga0496100_0342336_53_565 | 170 |
| 919 | 3300048903 | Ga0496100_0963612 | Ga0496100_0963612_79_591 | 170 |
| 920 | 3300048904 | Ga0496101_0296917 | Ga0496101_0296917_703_1215 | 170 |
| 921 | 3300048905 | Ga0496102_0008807 | Ga0496102_0008807_5108_5620 | 170 |
| 922 | 3300048905 | Ga0496102_0099366 | Ga0496102_0099366_825_1337 | 170 |
| 923 | 3300048905 | Ga0496102_0344613 | Ga0496102_0344613_222_734 | 170 |
| 924 | 3300048905 | Ga0496102_0663711 | Ga0496102_0663711_309_821 | 170 |
| 925 | 3300048906 | Ga0496103_0044481 | Ga0496103_0044481_1261_1773 | 170 |
| 926 | 3300048906 | Ga0496103_0105501 | Ga0496103_0105501_716_1228 | 170 |
| 927 | 3300048907 | Ga0496104_0257040 | Ga0496104_0257040_1132_1644 | 170 |
| 928 | 3300048907 | Ga0496104_0450104 | Ga0496104_0450104_18_530 | 170 |
| 929 | 3300048909 | Ga0496106_0323858 | Ga0496106_0323858_357_869 | 170 |
| 930 | 3300048909 | Ga0496106_0518655 | Ga0496106_0518655_246_758 | 170 |
| 931 | 3300048910 | Ga0496107_0151120 | Ga0496107_0151120_1141_1653 | 170 |
| 932 | 3300048910 | Ga0496107_0254912 | Ga0496107_0254912_562_1074 | 170 |
| 933 | 3300048910 | Ga0496107_0377745 | Ga0496107_0377745_441_953 | 170 |
| 934 | 3300048911 | Ga0496108_1063475 | Ga0496108_1063475_156_668 | 170 |
| 935 | 3300048912 | Ga0496109_0151869 | Ga0496109_0151869_258_770 | 170 |
| 936 | 3300048912 | Ga0496109_0521919 | Ga0496109_0521919_133_645 | 170 |
| 937 | 3300048912 | Ga0496109_0758475 | Ga0496109_0758475_28_540 | 170 |
| 938 | 3300048912 | Ga0496109_1003953 | Ga0496109_1003953_164_676 | 170 |
| 939 | 3300048912 | Ga0496109_1015126 | Ga0496109_1015126_103_615 | 170 |
| 940 | 3300048913 | Ga0496110_0535726 | Ga0496110_0535726_282_794 | 170 |
| 941 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_394385_394897 | 170 |
| 942 | 3300048915 | Ga0496112_0191499 | Ga0496112_0191499_1400_1912 | 170 |
| 943 | 3300048915 | Ga0496112_0273967 | Ga0496112_0273967_1033_1545 | 170 |
| 944 | 3300048915 | Ga0496112_0313284 | Ga0496112_0313284_820_1332 | 170 |
| 945 | 3300048916 | Ga0496113_0144862 | Ga0496113_0144862_66_578 | 170 |
| 946 | 3300048916 | Ga0496113_0318662 | Ga0496113_0318662_159_671 | 170 |
| 947 | 3300048916 | Ga0496113_0831487 | Ga0496113_0831487_16_528 | 170 |
| 948 | 3300048917 | Ga0496114_0625973 | Ga0496114_0625973_219_731 | 170 |
| 949 | 3300048917 | Ga0496114_1091143 | Ga0496114_1091143_15_527 | 170 |
| 950 | 3300048918 | Ga0496115_0000864 | Ga0496115_0000864_1707_2219 | 170 |
| 951 | 3300048920 | Ga0496117_0285350 | Ga0496117_0285350_96_608 | 170 |
| 952 | 3300048924 | Ga0496121_0000657 | Ga0496121_0000657_59142_59654 | 170 |
| 953 | 3300048924 | Ga0496121_0358223 | Ga0496121_0358223_355_867 | 170 |
| 954 | 3300048927 | Ga0496124_0454716 | Ga0496124_0454716_83_595 | 170 |
| 955 | 3300048928 | Ga0496125_0173128 | Ga0496125_0173128_605_1117 | 170 |
| 956 | 3300048928 | Ga0496125_0407700 | Ga0496125_0407700_171_683 | 170 |
| 957 | 3300048929 | Ga0496126_0009539 | Ga0496126_0009539_2135_2647 | 170 |
| 958 | 3300048929 | Ga0496126_0071312 | Ga0496126_0071312_844_1356 | 170 |
| 959 | 3300048929 | Ga0496126_0118516 | Ga0496126_0118516_713_1225 | 170 |
| 960 | 3300048929 | Ga0496126_0121857 | Ga0496126_0121857_202_714 | 170 |
| 961 | 3300048929 | Ga0496126_0253973 | Ga0496126_0253973_128_640 | 170 |
| 962 | 3300048929 | Ga0496126_0544304 | Ga0496126_0544304_62_574 | 170 |
| 963 | 3300048929 | Ga0496126_0736047 | Ga0496126_0736047_103_615 | 170 |
| 964 | 3300049459 | Ga0495678_048806 | Ga0495678_048806_323_835 | 170 |
| 965 | 3300050489 | nmdc:mga03683_231732_c1 | nmdc:mga03683_231732_c1_136_648 | 170 |
| 966 | 3300050490 | nmdc:mga03n38_438369_c1 | nmdc:mga03n38_438369_c1_36_548 | 170 |
| 967 | 3300050490 | nmdc:mga03n38_879_c1 | nmdc:mga03n38_879_c1_5188_5700 | 170 |
| 968 | 3300050491 | nmdc:mga00v17_212530_c1 | nmdc:mga00v17_212530_c1_488_1000 | 170 |
| 969 | 3300050491 | nmdc:mga00v17_296458_c1 | nmdc:mga00v17_296458_c1_220_732 | 170 |
| 970 | 3300050491 | nmdc:mga00v17_79840_c1 | nmdc:mga00v17_79840_c1_562_1074 | 170 |
| 971 | 3300050492 | nmdc:mga0yw44_141738_c1 | nmdc:mga0yw44_141738_c1_483_995 | 170 |
| 972 | 3300050492 | nmdc:mga0yw44_206608_c1 | nmdc:mga0yw44_206608_c1_710_1222 | 170 |
| 973 | 3300050492 | nmdc:mga0yw44_41086_c1 | nmdc:mga0yw44_41086_c1_562_1074 | 170 |
| 974 | 3300050493 | nmdc:mga0k408_504339_c1 | nmdc:mga0k408_504339_c1_130_642 | 170 |
| 975 | 3300050494 | nmdc:mga06z11_387043_c1 | nmdc:mga06z11_387043_c1_59_571 | 170 |
| 976 | 3300050494 | nmdc:mga06z11_425970_c1 | nmdc:mga06z11_425970_c1_192_704 | 170 |
| 977 | 3300050495 | nmdc:mga04h51_113182_c1 | nmdc:mga04h51_113182_c1_107_619 | 170 |
| 978 | 3300050495 | nmdc:mga04h51_51228_c1 | nmdc:mga04h51_51228_c1_108_620 | 170 |
| 979 | 3300050496 | nmdc:mga07m45_14924_c3 | nmdc:mga07m45_14924_c3_55_567 | 170 |
| 980 | 3300050496 | nmdc:mga07m45_15435_c1 | nmdc:mga07m45_15435_c1_2414_2926 | 170 |
| 981 | 3300050496 | nmdc:mga07m45_27449_c2 | nmdc:mga07m45_27449_c2_263_775 | 170 |
| 982 | 3300050496 | nmdc:mga07m45_470175_c1 | nmdc:mga07m45_470175_c1_184_696 | 170 |
| 983 | 3300050507 | nmdc:mga05p37_204769_c1 | nmdc:mga05p37_204769_c1_1782_2300 | 170 |
| 984 | 3300050509 | nmdc:mga0qj67_788636_c1 | nmdc:mga0qj67_788636_c1_124_636 | 170 |
| 985 | 3300050511 | nmdc:mga08y16_172584_c1 | nmdc:mga08y16_172584_c1_1693_2205 | 170 |
| 986 | 3300050511 | nmdc:mga08y16_563261_c1 | nmdc:mga08y16_563261_c1_148_660 | 170 |
| 987 | 3300050512 | nmdc:mga0n895_318403_c1 | nmdc:mga0n895_318403_c1_462_974 | 170 |
| 988 | 3300050515 | nmdc:mga0a205_586453_c1 | nmdc:mga0a205_586453_c1_165_677 | 170 |
| 989 | 3300050516 | nmdc:mga0sz30_54510_c1 | nmdc:mga0sz30_54510_c1_200_712 | 170 |
| 990 | 3300053077 | Ga0495601_0038409 | Ga0495601_0038409_224_736 | 170 |
| 991 | 3300053078 | Ga0495612_0009691 | Ga0495612_0009691_940_1452 | 170 |
| 992 | 3300053078 | Ga0495612_0046962 | Ga0495612_0046962_252_764 | 170 |
| 993 | 3300053078 | Ga0495612_0193636 | Ga0495612_0193636_86_598 | 170 |
| 994 | 3300053080 | Ga0500635_0116069 | Ga0500635_0116069_152_664 | 170 |
| 995 | 3300053084 | Ga0495595_0002356 | Ga0495595_0002356_6839_7351 | 170 |
| 996 | 3300053084 | Ga0495595_0003182 | Ga0495595_0003182_4112_4624 | 170 |
| 997 | 3300053084 | Ga0495595_0063936 | Ga0495595_0063936_213_725 | 170 |
| 998 | 3300053085 | Ga0495619_0001272 | Ga0495619_0001272_13674_14186 | 170 |
| 999 | 3300053085 | Ga0495619_0003981 | Ga0495619_0003981_5230_5742 | 170 |
| 1000 | 3300053085 | Ga0495619_0082024 | Ga0495619_0082024_940_1452 | 170 |
| 1001 | 3300053086 | Ga0500578_0277836 | Ga0500578_0277836_285_797 | 170 |
| 1002 | 3300053087 | Ga0500643_071899 | Ga0500643_071899_329_841 | 170 |
| 1003 | 3300053090 | Ga0500646_0114676 | Ga0500646_0114676_119_631 | 170 |
| 1004 | 3300053092 | Ga0500583_0046518 | Ga0500583_0046518_955_1467 | 170 |
| 1005 | 3300053094 | Ga0500566_0023277 | Ga0500566_0023277_3108_3620 | 170 |
| 1006 | 3300053102 | Ga0500554_003144 | Ga0500554_003144_1420_1932 | 170 |
| 1007 | 3300053102 | Ga0500554_025708 | Ga0500554_025708_293_805 | 170 |
| 1008 | 3300053109 | Ga0500569_100380 | Ga0500569_100380_240_752 | 170 |
| 1009 | 3300053119 | Ga0500595_001946 | Ga0500595_001946_5959_6471 | 170 |
| 1010 | 3300053119 | Ga0500595_003152 | Ga0500595_003152_1382_1894 | 170 |
| 1011 | 3300053126 | Ga0500621_105201 | Ga0500621_105201_428_940 | 170 |
| 1012 | 3300053130 | Ga0500642_0147886 | Ga0500642_0147886_164_676 | 170 |
| 1013 | 3300053133 | Ga0500655_023115 | Ga0500655_023115_98_610 | 170 |
| 1014 | 3300053134 | Ga0500658_0429950 | Ga0500658_0429950_76_588 | 170 |
| 1015 | 3300053137 | Ga0500561_0181401 | Ga0500561_0181401_93_605 | 170 |
| 1016 | 3300053146 | Ga0500588_0082423 | Ga0500588_0082423_381_893 | 170 |
| 1017 | 3300053147 | Ga0500589_027705 | Ga0500589_027705_1403_1915 | 170 |
| 1018 | 3300053147 | Ga0500589_297538 | Ga0500589_297538_12_524 | 170 |
| 1019 | 3300053150 | Ga0500603_021048 | Ga0500603_021048_708_1220 | 170 |
| 1020 | 3300053161 | Ga0500634_0080241 | Ga0500634_0080241_322_834 | 170 |
| 1021 | 3300053162 | Ga0500638_002898 | Ga0500638_002898_4811_5323 | 170 |
| 1022 | 3300053177 | Ga0500636_0041125 | Ga0500636_0041125_1551_2063 | 170 |
| 1023 | 3300053178 | Ga0500637_0000291 | Ga0500637_0000291_14645_15157 | 170 |
| 1024 | 3300053178 | Ga0500637_0011540 | Ga0500637_0011540_3981_4493 | 170 |
| 1025 | 3300053727 | Ga0500611_074263 | Ga0500611_074263_33_545 | 170 |
| 1026 | 3300055283 | Ga0500661_004256 | Ga0500661_004256_809_1321 | 170 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fiw-assembly1.cif.gz_A | crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris | 0.9601 | 1 | 160 |
| 2fiw-assembly1.cif.gz_A | crystal structure of the gcn5-related n-acetyltransferase: aminotransferase, class-ii from rhodopseudomonas palustris | 0.9542 | 1 | 160 |
| 8osp-assembly2.cif.gz_C | gcn5-related n-acetyltransferase from lactobacillus curiae | 0.8906 | 7 | 160 |
| 3pp9-assembly2.cif.gz_C | 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a | 0.8534 | 61 | 159 |
| 7ypu-assembly4.cif.gz_G | orfe-coa-glycylthricin complex | 0.8469 | 62 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fiwA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9922 | 7 | 160 | 3.40.630.30 |
| af_Q47158_1_148_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9646 | 6 | 159 | 3.40.630.30 |
| 2fiwA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9607 | 7 | 160 | 3.40.630.30 |
| af_Q47158_1_148_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9457 | 6 | 159 | 3.40.630.30 |
| af_I1MSW7_129_252_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9343 | 84 | 142 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0B4XLZ9-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.983 | 7 | 162 |
GO:0016747
|
| AF-A0A7V2H0L0-F1-model_v4 | GNAT family N-acetyltransferase | 0.9802 | 9 | 161 |
GO:0016747
|
| AF-A0A2A4ZWG1-F1-model_v4 | GNAT family N-acetyltransferase | 0.9775 | 9 | 160 |
GO:0016747
|
| AF-A0A2E7TP31-F1-model_v4 | GNAT family N-acetyltransferase | 0.9771 | 6 | 161 |
GO:0016747
|
| AF-A0A846DGZ9-F1-model_v4 | GNAT family N-acetyltransferase | 0.977 | 9 | 161 |
GO:0016747
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar