F488533
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1027 | 493 | 2054 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300007788|Ga0099795_10067720|Ga0099795_100677202 |
| Length | 228 |
| Sequence | VFFPLPANTRERGKTMPEISSLMRRAVAAALTLSVLASSVLASVGWAQQPPPVRIRGTIESVDGAMLMIKSREGTDMKVRVTDNVAVFGVAKTEMSEIKPGSYIGVSAMPEPDGTQKALAVHIFPETQRGAAEGFRPWDLRPNSTMTNATVAETVKGTDGQNILVKYKDGEKKVVVPPDTPIVTFVAGDKSELKPGAKIIIFGAVKKDDGTLEANRVNVGRDGITPPM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 2 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 13 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 214 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 215 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 225 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 226 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 228 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 232 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 233 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 234 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 235 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 236 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 237 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 238 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 239 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 241 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 242 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 248 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 250 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 253 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 255 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 256 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 260 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 262 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 263 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 264 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 265 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 269 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 273 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 274 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 278 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 279 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 280 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 356 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 357 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 358 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 359 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 360 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 361 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 363 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 364 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 365 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 366 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 367 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 368 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 369 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 370 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 371 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 372 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 384 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 385 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 386 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 396 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 399 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 400 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 401 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 402 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 403 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 404 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 407 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 408 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 409 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 410 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 411 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 412 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 413 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 414 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 415 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 417 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 419 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 420 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 421 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 422 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 423 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 424 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 425 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 426 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 427 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 428 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 429 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 430 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 431 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 432 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 433 | 2791355199 | |||
| 434 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 435 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 436 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 437 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 438 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 439 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 440 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 441 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 442 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 443 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 444 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 445 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 446 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 447 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 448 | 2904699407 | |||
| 449 | 2906610324 | |||
| 450 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 451 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 452 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 453 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 454 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 455 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 456 | 2922425934 | |||
| 457 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 458 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 459 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 460 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 461 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 462 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 463 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 464 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 465 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 466 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 467 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 468 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 469 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 470 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 471 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 472 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 473 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 474 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 475 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 476 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 477 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 478 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 479 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 480 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 481 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 482 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 483 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 484 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 485 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 486 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 487 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 488 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 489 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 490 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 491 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 492 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 493 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.86 |
| Metatranscriptomes | 0.2 |
| Isolates | 6.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.52 |
| Nodule | 6.23 |
| Rhizoplane | 8.47 |
| Rhizosphere | 74.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0099795_10067720 | 3300007788 | Bacteria | 1340 |
| 2 | JGI24032J14994_100531 | 3300001430 | Bacteria | 2004 |
| 3 | JGI24739J22299_10000871 | 3300001989 | Bacteria | 11154 |
| 4 | JGI24737J22298_10010529 | 3300001990 | Bacteria | 3050 |
| 5 | JGI24750J21931_1009691 | 3300002070 | Bacteria | 1244 |
| 6 | JGI24748J21848_1006767 | 3300002074 | Bacteria | 1338 |
| 7 | JGI24738J21930_10002474 | 3300002075 | Bacteria | 4827 |
| 8 | JGI24744J21845_10007283 | 3300002077 | Bacteria | 2286 |
| 9 | JGI24744J21845_10007868 | 3300002077 | Bacteria | 2201 |
| 10 | JGI24034J26672_10006652 | 3300002239 | Bacteria | 1669 |
| 11 | JGI24742J22300_10003578 | 3300002244 | Bacteria | 2525 |
| 12 | JGI25406J46586_10000064 | 3300003203 | Bacteria | 49110 |
| 13 | JGI25404J52841_10033318 | 3300003659 | Bacteria | 1098 |
| 14 | JGI25404J52841_10078960 | 3300003659 | Bacteria | 687 |
| 15 | Ga0058859_11740492 | 3300004798 | Bacteria | 739 |
| 16 | Ga0065715_10174306 | 3300005293 | Bacteria | 1523 |
| 17 | Ga0065715_10565648 | 3300005293 | Bacteria | 730 |
| 18 | Ga0070658_10710365 | 3300005327 | Bacteria | 873 |
| 19 | Ga0070676_10020837 | 3300005328 | Bacteria | 3665 |
| 20 | Ga0070683_100041896 | 3300005329 | Bacteria | 4215 |
| 21 | Ga0070690_100226054 | 3300005330 | Bacteria | 1313 |
| 22 | Ga0070690_100230852 | 3300005330 | Bacteria | 1301 |
| 23 | Ga0070670_100077132 | 3300005331 | Bacteria | 2863 |
| 24 | Ga0070670_100183096 | 3300005331 | Bacteria | 1819 |
| 25 | Ga0068869_100021302 | 3300005334 | Bacteria | 4458 |
| 26 | Ga0068869_100082663 | 3300005334 | Bacteria | 2400 |
| 27 | Ga0070680_100003647 | 3300005336 | Bacteria | 11501 |
| 28 | Ga0070680_100029856 | 3300005336 | Bacteria | 4377 |
| 29 | Ga0070680_100121614 | 3300005336 | Bacteria | 2180 |
| 30 | Ga0070680_100205891 | 3300005336 | Bacteria | 1659 |
| 31 | Ga0070680_100226621 | 3300005336 | Bacteria | 1578 |
| 32 | Ga0070682_100007969 | 3300005337 | Bacteria | 5962 |
| 33 | Ga0068868_100138279 | 3300005338 | Bacteria | 1998 |
| 34 | Ga0068868_100408198 | 3300005338 | Bacteria | 1173 |
| 35 | Ga0070660_100034303 | 3300005339 | Bacteria | 3833 |
| 36 | Ga0070660_100375198 | 3300005339 | Bacteria | 1174 |
| 37 | Ga0070689_100031062 | 3300005340 | Bacteria | 4058 |
| 38 | Ga0070689_100121015 | 3300005340 | Bacteria | 2091 |
| 39 | Ga0070689_100208226 | 3300005340 | Unclassified | 1600 |
| 40 | Ga0070689_100327516 | 3300005340 | Bacteria | 1281 |
| 41 | Ga0070691_10004859 | 3300005341 | Bacteria | 6121 |
| 42 | Ga0070687_100049605 | 3300005343 | Bacteria | 2164 |
| 43 | Ga0070687_100052564 | 3300005343 | Bacteria | 2115 |
| 44 | Ga0070661_100009866 | 3300005344 | Bacteria | 6624 |
| 45 | Ga0070692_10045412 | 3300005345 | Bacteria | 2266 |
| 46 | Ga0070692_10260157 | 3300005345 | Bacteria | 1043 |
| 47 | Ga0070668_100013726 | 3300005347 | Bacteria | 6051 |
| 48 | Ga0070668_100036445 | 3300005347 | Bacteria | 3754 |
| 49 | Ga0070668_100067131 | 3300005347 | Bacteria | 2785 |
| 50 | Ga0070668_100672016 | 3300005347 | Bacteria | 911 |
| 51 | Ga0070669_100014406 | 3300005353 | Bacteria | 5628 |
| 52 | Ga0070669_100035084 | 3300005353 | Bacteria | 3633 |
| 53 | Ga0070669_100093037 | 3300005353 | Bacteria | 2264 |
| 54 | Ga0070669_100434671 | 3300005353 | Bacteria | 1079 |
| 55 | Ga0070675_100018170 | 3300005354 | Bacteria | 5596 |
| 56 | Ga0070675_100732289 | 3300005354 | Bacteria | 902 |
| 57 | Ga0070671_100034258 | 3300005355 | Bacteria | 4203 |
| 58 | Ga0070671_100296361 | 3300005355 | Bacteria | 1377 |
| 59 | Ga0070671_100441341 | 3300005355 | Bacteria | 1116 |
| 60 | Ga0070674_100005693 | 3300005356 | Bacteria | 7227 |
| 61 | Ga0070674_100047397 | 3300005356 | Bacteria | 2944 |
| 62 | Ga0070673_100015849 | 3300005364 | Bacteria | 5308 |
| 63 | Ga0070688_100037805 | 3300005365 | Bacteria | 2943 |
| 64 | Ga0070688_100348498 | 3300005365 | Bacteria | 1084 |
| 65 | Ga0070688_100381848 | 3300005365 | Bacteria | 1039 |
| 66 | Ga0070659_100076576 | 3300005366 | Bacteria | 2667 |
| 67 | Ga0070659_100079331 | 3300005366 | Bacteria | 2620 |
| 68 | Ga0070659_100161364 | 3300005366 | Bacteria | 1833 |
| 69 | Ga0070659_100374802 | 3300005366 | Bacteria | 1198 |
| 70 | Ga0070659_100445386 | 3300005366 | Bacteria | 1098 |
| 71 | Ga0070667_100024258 | 3300005367 | Bacteria | 5037 |
| 72 | Ga0070667_100032997 | 3300005367 | Bacteria | 4322 |
| 73 | Ga0070667_100731541 | 3300005367 | Bacteria | 916 |
| 74 | Ga0070703_10003201 | 3300005406 | Bacteria | 4676 |
| 75 | Ga0070713_100003057 | 3300005436 | Bacteria | 10992 |
| 76 | Ga0070713_100347891 | 3300005436 | Unclassified | 1375 |
| 77 | Ga0070710_10106609 | 3300005437 | Bacteria | 1677 |
| 78 | Ga0070701_10004348 | 3300005438 | Bacteria | 5724 |
| 79 | Ga0070711_100077792 | 3300005439 | Bacteria | 2355 |
| 80 | Ga0070711_100591894 | 3300005439 | Bacteria | 924 |
| 81 | Ga0070705_100023373 | 3300005440 | Bacteria | 3318 |
| 82 | Ga0070705_100126002 | 3300005440 | Bacteria | 1662 |
| 83 | Ga0070705_100215842 | 3300005440 | Unclassified | 1325 |
| 84 | Ga0070700_100039431 | 3300005441 | Bacteria | 2885 |
| 85 | Ga0070694_100019693 | 3300005444 | Bacteria | 4294 |
| 86 | Ga0070694_100109804 | 3300005444 | Bacteria | 1963 |
| 87 | Ga0070708_100209630 | 3300005445 | Bacteria | 1826 |
| 88 | Ga0070708_100521341 | 3300005445 | Bacteria | 1121 |
| 89 | Ga0070708_100767105 | 3300005445 | Bacteria | 907 |
| 90 | Ga0070663_100027341 | 3300005455 | Bacteria | 3873 |
| 91 | Ga0070663_100059872 | 3300005455 | Bacteria | 2737 |
| 92 | Ga0070663_100082344 | 3300005455 | Bacteria | 2367 |
| 93 | Ga0070663_100679161 | 3300005455 | Bacteria | 873 |
| 94 | Ga0070678_100052290 | 3300005456 | Bacteria | 2965 |
| 95 | Ga0070678_100086184 | 3300005456 | Bacteria | 2395 |
| 96 | Ga0070662_100033312 | 3300005457 | Bacteria | 3626 |
| 97 | Ga0070662_100071711 | 3300005457 | Bacteria | 2555 |
| 98 | Ga0070662_100120688 | 3300005457 | Bacteria | 2009 |
| 99 | Ga0070681_10032947 | 3300005458 | Bacteria | 5201 |
| 100 | Ga0070681_10475268 | 3300005458 | Bacteria | 1162 |
| 101 | Ga0068867_100021271 | 3300005459 | Bacteria | 4629 |
| 102 | Ga0068867_100128077 | 3300005459 | Bacteria | 1969 |
| 103 | Ga0070685_10048441 | 3300005466 | Bacteria | 2447 |
| 104 | Ga0070706_100624318 | 3300005467 | Bacteria | 1001 |
| 105 | Ga0070684_100022473 | 3300005535 | Bacteria | 5261 |
| 106 | Ga0070684_100254112 | 3300005535 | Bacteria | 1606 |
| 107 | Ga0070697_100173177 | 3300005536 | Bacteria | 1827 |
| 108 | Ga0068853_100002207 | 3300005539 | Bacteria | 14542 |
| 109 | Ga0068853_100003634 | 3300005539 | Bacteria | 11828 |
| 110 | Ga0068853_100060238 | 3300005539 | Bacteria | 3279 |
| 111 | Ga0068853_100061086 | 3300005539 | Bacteria | 3259 |
| 112 | Ga0068853_100426138 | 3300005539 | Bacteria | 1245 |
| 113 | Ga0070672_100006742 | 3300005543 | Bacteria | 7744 |
| 114 | Ga0070686_100035110 | 3300005544 | Bacteria | 3094 |
| 115 | Ga0070695_100027274 | 3300005545 | Bacteria | 3537 |
| 116 | Ga0070696_100027513 | 3300005546 | Bacteria | 3875 |
| 117 | Ga0070693_100024374 | 3300005547 | Bacteria | 3244 |
| 118 | Ga0070665_100009777 | 3300005548 | Bacteria | 9699 |
| 119 | Ga0070665_100063185 | 3300005548 | Bacteria | 3712 |
| 120 | Ga0070665_100237840 | 3300005548 | Bacteria | 1822 |
| 121 | Ga0070665_100360172 | 3300005548 | Bacteria | 1460 |
| 122 | Ga0070665_100579006 | 3300005548 | Bacteria | 1135 |
| 123 | Ga0070665_101072015 | 3300005548 | Bacteria | 817 |
| 124 | Ga0070704_100025802 | 3300005549 | Bacteria | 3873 |
| 125 | Ga0070704_100208955 | 3300005549 | Bacteria | 1580 |
| 126 | Ga0068855_100018412 | 3300005563 | Bacteria | 8391 |
| 127 | Ga0068855_100099837 | 3300005563 | Bacteria | 3343 |
| 128 | Ga0068855_100121549 | 3300005563 | Bacteria | 2988 |
| 129 | Ga0070664_100069419 | 3300005564 | Bacteria | 3015 |
| 130 | Ga0070664_100118200 | 3300005564 | Bacteria | 2319 |
| 131 | Ga0068857_100038621 | 3300005577 | Bacteria | 4228 |
| 132 | Ga0068857_100124799 | 3300005577 | Bacteria | 2319 |
| 133 | Ga0068854_100016856 | 3300005578 | Bacteria | 4878 |
| 134 | Ga0068854_100246521 | 3300005578 | Bacteria | 1425 |
| 135 | Ga0068856_100074006 | 3300005614 | Bacteria | 3372 |
| 136 | Ga0070702_100058574 | 3300005615 | Bacteria | 2232 |
| 137 | Ga0070702_100091658 | 3300005615 | Unclassified | 1844 |
| 138 | Ga0070702_100108151 | 3300005615 | Bacteria | 1718 |
| 139 | Ga0068852_100024735 | 3300005616 | Bacteria | 4858 |
| 140 | Ga0068852_100028928 | 3300005616 | Bacteria | 4543 |
| 141 | Ga0068852_100135745 | 3300005616 | Bacteria | 2271 |
| 142 | Ga0068852_100321492 | 3300005616 | Bacteria | 1503 |
| 143 | Ga0068852_100597485 | 3300005616 | Bacteria | 1107 |
| 144 | Ga0068859_100035913 | 3300005617 | Bacteria | 4973 |
| 145 | Ga0068859_100096333 | 3300005617 | Bacteria | 3012 |
| 146 | Ga0068859_100279653 | 3300005617 | Bacteria | 1761 |
| 147 | Ga0068864_100026533 | 3300005618 | Bacteria | 4885 |
| 148 | Ga0068864_100459111 | 3300005618 | Bacteria | 1219 |
| 149 | Ga0068866_10100091 | 3300005718 | Bacteria | 1597 |
| 150 | Ga0068866_10195582 | 3300005718 | Unclassified | 1204 |
| 151 | Ga0068861_100019676 | 3300005719 | Bacteria | 4823 |
| 152 | Ga0068861_100042474 | 3300005719 | Bacteria | 3407 |
| 153 | Ga0068861_100048184 | 3300005719 | Bacteria | 3220 |
| 154 | Ga0068861_100111473 | 3300005719 | Bacteria | 2192 |
| 155 | Ga0068861_100214160 | 3300005719 | Bacteria | 1624 |
| 156 | Ga0068851_10206447 | 3300005834 | Bacteria | 1099 |
| 157 | Ga0068870_10026852 | 3300005840 | Bacteria | 2874 |
| 158 | Ga0068863_100006825 | 3300005841 | Bacteria | 11196 |
| 159 | Ga0068863_100142125 | 3300005841 | Bacteria | 2294 |
| 160 | Ga0068858_100057433 | 3300005842 | Bacteria | 3597 |
| 161 | Ga0068858_100079901 | 3300005842 | Bacteria | 3038 |
| 162 | Ga0068858_100484718 | 3300005842 | Bacteria | 1194 |
| 163 | Ga0068858_100806662 | 3300005842 | Unclassified | 916 |
| 164 | Ga0068860_100002033 | 3300005843 | Bacteria | 21319 |
| 165 | Ga0068860_100018432 | 3300005843 | Bacteria | 6790 |
| 166 | Ga0068860_100040901 | 3300005843 | Bacteria | 4429 |
| 167 | Ga0068860_100158101 | 3300005843 | Bacteria | 2184 |
| 168 | Ga0068860_100192601 | 3300005843 | Bacteria | 1973 |
| 169 | Ga0068860_101373457 | 3300005843 | Bacteria | 728 |
| 170 | Ga0068862_100010222 | 3300005844 | Bacteria | 7743 |
| 171 | Ga0068862_100028055 | 3300005844 | Bacteria | 4741 |
| 172 | Ga0068862_100083389 | 3300005844 | Bacteria | 2775 |
| 173 | Ga0068862_100342269 | 3300005844 | Bacteria | 1385 |
| 174 | Ga0081455_10000200 | 3300005937 | Bacteria | 76013 |
| 175 | Ga0081455_10033922 | 3300005937 | Bacteria | 4579 |
| 176 | Ga0081455_10051904 | 3300005937 | Bacteria | 3515 |
| 177 | Ga0081455_10091058 | 3300005937 | Bacteria | 2471 |
| 178 | Ga0081455_10114395 | 3300005937 | Bacteria | 2138 |
| 179 | Ga0081538_10011493 | 3300005981 | Bacteria | 7167 |
| 180 | Ga0081540_1002062 | 3300005983 | Bacteria | 16766 |
| 181 | Ga0081540_1004242 | 3300005983 | Bacteria | 11009 |
| 182 | Ga0081540_1012946 | 3300005983 | Bacteria | 5450 |
| 183 | Ga0081540_1021026 | 3300005983 | Bacteria | 3904 |
| 184 | Ga0081540_1070985 | 3300005983 | Bacteria | 1611 |
| 185 | Ga0081539_10000099 | 3300005985 | Bacteria | 201018 |
| 186 | Ga0070717_10003779 | 3300006028 | Bacteria | 10878 |
| 187 | Ga0070717_10004793 | 3300006028 | Bacteria | 9837 |
| 188 | Ga0070717_10082660 | 3300006028 | Bacteria | 2699 |
| 189 | Ga0075365_10012654 | 3300006038 | Bacteria | 5020 |
| 190 | Ga0075368_10010256 | 3300006042 | Bacteria | 3384 |
| 191 | Ga0075368_10197072 | 3300006042 | Bacteria | 852 |
| 192 | Ga0075363_100005067 | 3300006048 | Bacteria | 5827 |
| 193 | Ga0075363_100011785 | 3300006048 | Bacteria | 4195 |
| 194 | Ga0075363_100223399 | 3300006048 | Bacteria | 1080 |
| 195 | Ga0075363_100476049 | 3300006048 | Bacteria | 740 |
| 196 | Ga0075364_10115711 | 3300006051 | Bacteria | 1792 |
| 197 | Ga0075364_10263586 | 3300006051 | Bacteria | 1171 |
| 198 | Ga0070716_100235027 | 3300006173 | Bacteria | 1240 |
| 199 | Ga0070712_100062605 | 3300006175 | Bacteria | 2631 |
| 200 | Ga0070712_100233934 | 3300006175 | Bacteria | 1461 |
| 201 | Ga0075367_10013887 | 3300006178 | Bacteria | 4344 |
| 202 | Ga0075367_10021083 | 3300006178 | Bacteria | 3638 |
| 203 | Ga0075366_10027167 | 3300006195 | Bacteria | 3357 |
| 204 | Ga0075366_10225549 | 3300006195 | Bacteria | 1141 |
| 205 | Ga0075366_10284461 | 3300006195 | Bacteria | 1011 |
| 206 | Ga0097621_100007897 | 3300006237 | Bacteria | 7631 |
| 207 | Ga0097621_100053560 | 3300006237 | Bacteria | 3289 |
| 208 | Ga0097621_100302683 | 3300006237 | Bacteria | 1412 |
| 209 | Ga0075370_10003183 | 3300006353 | Bacteria | 7771 |
| 210 | Ga0075370_10104230 | 3300006353 | Bacteria | 1643 |
| 211 | Ga0075370_10401972 | 3300006353 | Bacteria | 822 |
| 212 | Ga0068871_100029425 | 3300006358 | Bacteria | 4314 |
| 213 | Ga0075428_100300564 | 3300006844 | Bacteria | 1725 |
| 214 | Ga0075433_10025119 | 3300006852 | Bacteria | 5036 |
| 215 | Ga0075433_10201324 | 3300006852 | Bacteria | 1770 |
| 216 | Ga0075434_100008091 | 3300006871 | Bacteria | 9750 |
| 217 | Ga0075434_100021009 | 3300006871 | Bacteria | 6341 |
| 218 | Ga0068865_100001544 | 3300006881 | Bacteria | 13429 |
| 219 | Ga0068865_100216332 | 3300006881 | Bacteria | 1496 |
| 220 | Ga0097620_100035916 | 3300006931 | Bacteria | 4973 |
| 221 | Ga0097620_100096333 | 3300006931 | Bacteria | 3012 |
| 222 | Ga0097620_100279657 | 3300006931 | Bacteria | 1761 |
| 223 | Ga0075435_100603384 | 3300007076 | Unclassified | 952 |
| 224 | Ga0099795_10033214 | 3300007788 | Bacteria | 1790 |
| 225 | Ga0099795_10235779 | 3300007788 | Bacteria | 784 |
| 226 | Ga0105244_10185079 | 3300009036 | Bacteria | 987 |
| 227 | Ga0105250_10043606 | 3300009092 | Bacteria | 1798 |
| 228 | Ga0105250_10122793 | 3300009092 | Bacteria | 1069 |
| 229 | Ga0105240_10012128 | 3300009093 | Bacteria | 11932 |
| 230 | Ga0105240_10140846 | 3300009093 | Bacteria | 2884 |
| 231 | Ga0111539_10001808 | 3300009094 | Bacteria | 28479 |
| 232 | Ga0111539_10057213 | 3300009094 | Bacteria | 4631 |
| 233 | Ga0111539_10739166 | 3300009094 | Bacteria | 1145 |
| 234 | Ga0105245_10014034 | 3300009098 | Bacteria | 6976 |
| 235 | Ga0105245_10060262 | 3300009098 | Bacteria | 3418 |
| 236 | Ga0105245_10514256 | 3300009098 | Bacteria | 1215 |
| 237 | Ga0105247_10087187 | 3300009101 | Bacteria | 1976 |
| 238 | Ga0105247_10143497 | 3300009101 | Bacteria | 1567 |
| 239 | Ga0105247_10167620 | 3300009101 | Bacteria | 1458 |
| 240 | Ga0105243_10139000 | 3300009148 | Bacteria | 2070 |
| 241 | Ga0105243_10162608 | 3300009148 | Bacteria | 1926 |
| 242 | Ga0105243_10241861 | 3300009148 | Bacteria | 1607 |
| 243 | Ga0105241_10031108 | 3300009174 | Bacteria | 3994 |
| 244 | Ga0105241_10272783 | 3300009174 | Bacteria | 1442 |
| 245 | Ga0105241_10649305 | 3300009174 | Bacteria | 958 |
| 246 | Ga0105242_10153900 | 3300009176 | Unclassified | 2007 |
| 247 | Ga0105242_10204421 | 3300009176 | Bacteria | 1756 |
| 248 | Ga0105248_10005933 | 3300009177 | Bacteria | 13426 |
| 249 | Ga0105248_10011779 | 3300009177 | Bacteria | 9647 |
| 250 | Ga0105248_10029891 | 3300009177 | Bacteria | 6080 |
| 251 | Ga0105248_10034176 | 3300009177 | Bacteria | 5684 |
| 252 | Ga0105237_10004719 | 3300009545 | Bacteria | 15684 |
| 253 | Ga0105237_10007432 | 3300009545 | Bacteria | 11993 |
| 254 | Ga0105237_10070348 | 3300009545 | Bacteria | 3495 |
| 255 | Ga0105237_10599999 | 3300009545 | Bacteria | 1108 |
| 256 | Ga0105238_10003421 | 3300009551 | Bacteria | 15825 |
| 257 | Ga0105238_10436192 | 3300009551 | Bacteria | 1306 |
| 258 | Ga0105238_10935501 | 3300009551 | Bacteria | 886 |
| 259 | Ga0105249_10014723 | 3300009553 | Bacteria | 6914 |
| 260 | Ga0105249_10019871 | 3300009553 | Bacteria | 5999 |
| 261 | Ga0105249_10528641 | 3300009553 | Bacteria | 1228 |
| 262 | Ga0099796_10022143 | 3300010159 | Bacteria | 1968 |
| 263 | Ga0099796_10055610 | 3300010159 | Bacteria | 1387 |
| 264 | Ga0099796_10130836 | 3300010159 | Bacteria | 973 |
| 265 | Ga0105239_10023212 | 3300010375 | Bacteria | 6836 |
| 266 | Ga0105239_10053470 | 3300010375 | Bacteria | 4430 |
| 267 | Ga0105239_10102667 | 3300010375 | Bacteria | 3164 |
| 268 | Ga0105239_10783691 | 3300010375 | Bacteria | 1092 |
| 269 | Ga0105239_10797822 | 3300010375 | Bacteria | 1082 |
| 270 | Ga0105239_11371603 | 3300010375 | Bacteria | 816 |
| 271 | Ga0105246_10032205 | 3300011119 | Bacteria | 3475 |
| 272 | Ga0105246_10079330 | 3300011119 | Bacteria | 2334 |
| 273 | Ga0105246_10597510 | 3300011119 | Bacteria | 953 |
| 274 | Ga0157373_10024897 | 3300013100 | Bacteria | 4334 |
| 275 | Ga0157373_10298226 | 3300013100 | Unclassified | 1144 |
| 276 | Ga0157370_10101962 | 3300013104 | Bacteria | 2688 |
| 277 | Ga0157369_10065365 | 3300013105 | Bacteria | 3914 |
| 278 | Ga0157369_10315863 | 3300013105 | Bacteria | 1624 |
| 279 | Ga0157374_10411201 | 3300013296 | Bacteria | 1351 |
| 280 | Ga0157378_10031566 | 3300013297 | Bacteria | 4679 |
| 281 | Ga0157378_10086387 | 3300013297 | Bacteria | 2844 |
| 282 | Ga0157378_10104776 | 3300013297 | Bacteria | 2586 |
| 283 | Ga0157378_10258421 | 3300013297 | Unclassified | 1670 |
| 284 | Ga0163162_10022234 | 3300013306 | Bacteria | 6250 |
| 285 | Ga0163162_10053512 | 3300013306 | Bacteria | 4057 |
| 286 | Ga0163162_10602920 | 3300013306 | Bacteria | 1224 |
| 287 | Ga0157372_10016582 | 3300013307 | Bacteria | 7904 |
| 288 | Ga0157372_10186079 | 3300013307 | Bacteria | 2405 |
| 289 | Ga0157375_10084799 | 3300013308 | Bacteria | 3217 |
| 290 | Ga0157375_10261478 | 3300013308 | Bacteria | 1892 |
| 291 | Ga0157375_10298866 | 3300013308 | Bacteria | 1773 |
| 292 | Ga0163163_10016805 | 3300014325 | Bacteria | 6811 |
| 293 | Ga0163163_10226212 | 3300014325 | Unclassified | 1920 |
| 294 | Ga0157380_10100984 | 3300014326 | Bacteria | 2403 |
| 295 | Ga0157377_10013798 | 3300014745 | Bacteria | 4096 |
| 296 | Ga0157379_10089794 | 3300014968 | Bacteria | 2756 |
| 297 | Ga0157379_10153801 | 3300014968 | Bacteria | 2075 |
| 298 | Ga0157379_10848577 | 3300014968 | Bacteria | 864 |
| 299 | Ga0157376_10006128 | 3300014969 | Bacteria | 8466 |
| 300 | Ga0157376_10135746 | 3300014969 | Bacteria | 2201 |
| 301 | Ga0157376_10217613 | 3300014969 | Unclassified | 1767 |
| 302 | Ga0163161_10006229 | 3300017792 | Bacteria | 8265 |
| 303 | Ga0163161_10675526 | 3300017792 | Bacteria | 858 |
| 304 | Ga0213876_10340105 | 3300021384 | Bacteria | 798 |
| 305 | Ga0213875_10034248 | 3300021388 | Bacteria | 2398 |
| 306 | Ga0209233_1005084 | 3300025261 | Bacteria | 4400 |
| 307 | Ga0207666_1000311 | 3300025271 | Bacteria | 6768 |
| 308 | Ga0207673_1003304 | 3300025290 | Bacteria | 1880 |
| 309 | Ga0209758_1001737 | 3300025297 | Bacteria | 24275 |
| 310 | Ga0209758_1003580 | 3300025297 | Bacteria | 13909 |
| 311 | Ga0207697_10006626 | 3300025315 | Bacteria | 5222 |
| 312 | Ga0207653_10002805 | 3300025885 | Bacteria | 5539 |
| 313 | Ga0207682_10000009 | 3300025893 | Bacteria | 86366 |
| 314 | Ga0207682_10014469 | 3300025893 | Bacteria | 3074 |
| 315 | Ga0207692_10092310 | 3300025898 | Bacteria | 1645 |
| 316 | Ga0207642_10044313 | 3300025899 | Bacteria | 1968 |
| 317 | Ga0207710_10002730 | 3300025900 | Bacteria | 8088 |
| 318 | Ga0207688_10000892 | 3300025901 | Bacteria | 15087 |
| 319 | Ga0207688_10094545 | 3300025901 | Bacteria | 1719 |
| 320 | Ga0207647_10002160 | 3300025904 | Bacteria | 15015 |
| 321 | Ga0207685_10406230 | 3300025905 | Bacteria | 699 |
| 322 | Ga0207645_10000999 | 3300025907 | Bacteria | 23365 |
| 323 | Ga0207645_10194083 | 3300025907 | Bacteria | 1335 |
| 324 | Ga0207643_10006739 | 3300025908 | Bacteria | 6161 |
| 325 | Ga0207705_10522401 | 3300025909 | Bacteria | 922 |
| 326 | Ga0207705_10596831 | 3300025909 | Bacteria | 859 |
| 327 | Ga0207654_10236456 | 3300025911 | Bacteria | 1219 |
| 328 | Ga0207654_10401528 | 3300025911 | Bacteria | 953 |
| 329 | Ga0207707_10002224 | 3300025912 | Bacteria | 17529 |
| 330 | Ga0207707_10020542 | 3300025912 | Bacteria | 5767 |
| 331 | Ga0207695_10046019 | 3300025913 | Bacteria | 4626 |
| 332 | Ga0207671_10035416 | 3300025914 | Bacteria | 3705 |
| 333 | Ga0207671_10064994 | 3300025914 | Bacteria | 2713 |
| 334 | Ga0207671_10077969 | 3300025914 | Bacteria | 2481 |
| 335 | Ga0207671_10180264 | 3300025914 | Bacteria | 1644 |
| 336 | Ga0207693_10018708 | 3300025915 | Bacteria | 5514 |
| 337 | Ga0207693_10205162 | 3300025915 | Bacteria | 1550 |
| 338 | Ga0207693_10227981 | 3300025915 | Bacteria | 1463 |
| 339 | Ga0207663_10132464 | 3300025916 | Bacteria | 1724 |
| 340 | Ga0207663_10599911 | 3300025916 | Bacteria | 865 |
| 341 | Ga0207660_10001283 | 3300025917 | Bacteria | 16867 |
| 342 | Ga0207660_10010206 | 3300025917 | Bacteria | 6087 |
| 343 | Ga0207660_10294273 | 3300025917 | Bacteria | 1291 |
| 344 | Ga0207662_10000025 | 3300025918 | Bacteria | 70078 |
| 345 | Ga0207662_10037874 | 3300025918 | Bacteria | 2825 |
| 346 | Ga0207657_10005246 | 3300025919 | Bacteria | 13576 |
| 347 | Ga0207657_10018108 | 3300025919 | Bacteria | 6739 |
| 348 | Ga0207657_10044766 | 3300025919 | Bacteria | 3889 |
| 349 | Ga0207657_10546461 | 3300025919 | Bacteria | 906 |
| 350 | Ga0207649_10002186 | 3300025920 | Bacteria | 11047 |
| 351 | Ga0207652_10004348 | 3300025921 | Bacteria | 11546 |
| 352 | Ga0207652_10035191 | 3300025921 | Bacteria | 4225 |
| 353 | Ga0207681_10007074 | 3300025923 | Bacteria | 6881 |
| 354 | Ga0207681_10068564 | 3300025923 | Bacteria | 2464 |
| 355 | Ga0207681_10248997 | 3300025923 | Bacteria | 1386 |
| 356 | Ga0207694_10075578 | 3300025924 | Bacteria | 2637 |
| 357 | Ga0207694_10082962 | 3300025924 | Bacteria | 2520 |
| 358 | Ga0207694_10318994 | 3300025924 | Bacteria | 1282 |
| 359 | Ga0207650_10190498 | 3300025925 | Bacteria | 1638 |
| 360 | Ga0207650_10388174 | 3300025925 | Bacteria | 1154 |
| 361 | Ga0207650_10669745 | 3300025925 | Bacteria | 875 |
| 362 | Ga0207659_10030381 | 3300025926 | Bacteria | 3691 |
| 363 | Ga0207659_10262721 | 3300025926 | Bacteria | 1405 |
| 364 | Ga0207687_10001197 | 3300025927 | Bacteria | 17741 |
| 365 | Ga0207687_10002549 | 3300025927 | Bacteria | 12372 |
| 366 | Ga0207700_10055969 | 3300025928 | Bacteria | 2967 |
| 367 | Ga0207700_10092879 | 3300025928 | Bacteria | 2387 |
| 368 | Ga0207700_10144687 | 3300025928 | Bacteria | 1958 |
| 369 | Ga0207700_10469555 | 3300025928 | Bacteria | 1111 |
| 370 | Ga0207664_10152833 | 3300025929 | Bacteria | 1962 |
| 371 | Ga0207664_10375743 | 3300025929 | Bacteria | 1261 |
| 372 | Ga0207664_10828401 | 3300025929 | Bacteria | 832 |
| 373 | Ga0207644_10036076 | 3300025931 | Bacteria | 3469 |
| 374 | Ga0207644_10066815 | 3300025931 | Bacteria | 2619 |
| 375 | Ga0207644_10365892 | 3300025931 | Bacteria | 1174 |
| 376 | Ga0207690_10011755 | 3300025932 | Bacteria | 5236 |
| 377 | Ga0207690_10310657 | 3300025932 | Bacteria | 1236 |
| 378 | Ga0207706_10005363 | 3300025933 | Bacteria | 11952 |
| 379 | Ga0207706_10040844 | 3300025933 | Bacteria | 4112 |
| 380 | Ga0207706_10103304 | 3300025933 | Bacteria | 2507 |
| 381 | Ga0207686_10001310 | 3300025934 | Bacteria | 14258 |
| 382 | Ga0207686_10274618 | 3300025934 | Bacteria | 1241 |
| 383 | Ga0207709_10006190 | 3300025935 | Bacteria | 6736 |
| 384 | Ga0207709_10012682 | 3300025935 | Bacteria | 4646 |
| 385 | Ga0207709_10688635 | 3300025935 | Bacteria | 817 |
| 386 | Ga0207670_10013997 | 3300025936 | Bacteria | 4749 |
| 387 | Ga0207670_10118723 | 3300025936 | Bacteria | 1919 |
| 388 | Ga0207670_10194202 | 3300025936 | Unclassified | 1538 |
| 389 | Ga0207670_10406048 | 3300025936 | Bacteria | 1090 |
| 390 | Ga0207669_10001324 | 3300025937 | Bacteria | 10540 |
| 391 | Ga0207669_10157264 | 3300025937 | Bacteria | 1600 |
| 392 | Ga0207669_10659658 | 3300025937 | Bacteria | 856 |
| 393 | Ga0207704_10003457 | 3300025938 | Bacteria | 7181 |
| 394 | Ga0207665_10198325 | 3300025939 | Bacteria | 1461 |
| 395 | Ga0207691_10002604 | 3300025940 | Bacteria | 17616 |
| 396 | Ga0207691_10159553 | 3300025940 | Bacteria | 1979 |
| 397 | Ga0207711_10031474 | 3300025941 | Bacteria | 4479 |
| 398 | Ga0207711_10073623 | 3300025941 | Bacteria | 2969 |
| 399 | Ga0207711_10101876 | 3300025941 | Bacteria | 2541 |
| 400 | Ga0207711_10218792 | 3300025941 | Bacteria | 1741 |
| 401 | Ga0207689_10001156 | 3300025942 | Bacteria | 25400 |
| 402 | Ga0207689_10038650 | 3300025942 | Bacteria | 3952 |
| 403 | Ga0207689_10049010 | 3300025942 | Bacteria | 3485 |
| 404 | Ga0207689_10087744 | 3300025942 | Bacteria | 2555 |
| 405 | Ga0207661_10007789 | 3300025944 | Bacteria | 7627 |
| 406 | Ga0207679_10004160 | 3300025945 | Bacteria | 8991 |
| 407 | Ga0207667_10012980 | 3300025949 | Bacteria | 9561 |
| 408 | Ga0207667_10077987 | 3300025949 | Bacteria | 3434 |
| 409 | Ga0207667_10095327 | 3300025949 | Bacteria | 3072 |
| 410 | Ga0207667_10310444 | 3300025949 | Bacteria | 1611 |
| 411 | Ga0207667_10507823 | 3300025949 | Bacteria | 1222 |
| 412 | Ga0207667_10961565 | 3300025949 | Bacteria | 843 |
| 413 | Ga0207651_10087185 | 3300025960 | Bacteria | 2271 |
| 414 | Ga0207651_10328099 | 3300025960 | Bacteria | 1281 |
| 415 | Ga0207712_10000579 | 3300025961 | Bacteria | 29666 |
| 416 | Ga0207712_10252552 | 3300025961 | Bacteria | 1426 |
| 417 | Ga0207668_10001403 | 3300025972 | Bacteria | 14194 |
| 418 | Ga0207668_10005581 | 3300025972 | Bacteria | 7417 |
| 419 | Ga0207668_10032114 | 3300025972 | Bacteria | 3465 |
| 420 | Ga0207668_10033457 | 3300025972 | Bacteria | 3405 |
| 421 | Ga0207668_10079730 | 3300025972 | Bacteria | 2369 |
| 422 | Ga0207668_10481642 | 3300025972 | Bacteria | 1064 |
| 423 | Ga0207640_10003644 | 3300025981 | Bacteria | 8306 |
| 424 | Ga0207658_10113485 | 3300025986 | Bacteria | 2147 |
| 425 | Ga0207658_10359771 | 3300025986 | Bacteria | 1269 |
| 426 | Ga0207658_10372366 | 3300025986 | Bacteria | 1249 |
| 427 | Ga0207658_10608626 | 3300025986 | Unclassified | 982 |
| 428 | Ga0207658_10639432 | 3300025986 | Bacteria | 958 |
| 429 | Ga0207703_10014416 | 3300026035 | Bacteria | 6164 |
| 430 | Ga0207703_10032293 | 3300026035 | Bacteria | 4143 |
| 431 | Ga0207639_10001866 | 3300026041 | Bacteria | 14170 |
| 432 | Ga0207639_10117459 | 3300026041 | Bacteria | 2180 |
| 433 | Ga0207639_10128563 | 3300026041 | Bacteria | 2094 |
| 434 | Ga0207639_10547058 | 3300026041 | Bacteria | 1062 |
| 435 | Ga0207678_10027315 | 3300026067 | Bacteria | 4977 |
| 436 | Ga0207678_10033660 | 3300026067 | Bacteria | 4464 |
| 437 | Ga0207678_10042596 | 3300026067 | Bacteria | 3932 |
| 438 | Ga0207678_10048901 | 3300026067 | Bacteria | 3654 |
| 439 | Ga0207678_10062786 | 3300026067 | Bacteria | 3193 |
| 440 | Ga0207678_10080462 | 3300026067 | Bacteria | 2789 |
| 441 | Ga0207678_10080882 | 3300026067 | Bacteria | 2781 |
| 442 | Ga0207678_10222167 | 3300026067 | Bacteria | 1617 |
| 443 | Ga0207708_10020931 | 3300026075 | Bacteria | 4935 |
| 444 | Ga0207708_10023687 | 3300026075 | Bacteria | 4641 |
| 445 | Ga0207708_10050635 | 3300026075 | Bacteria | 3162 |
| 446 | Ga0207708_10480363 | 3300026075 | Bacteria | 1039 |
| 447 | Ga0207702_10010946 | 3300026078 | Bacteria | 7566 |
| 448 | Ga0207702_10257067 | 3300026078 | Bacteria | 1643 |
| 449 | Ga0207702_10359494 | 3300026078 | Bacteria | 1395 |
| 450 | Ga0207641_10006404 | 3300026088 | Bacteria | 9923 |
| 451 | Ga0207641_10171571 | 3300026088 | Bacteria | 1980 |
| 452 | Ga0207641_10315377 | 3300026088 | Unclassified | 1481 |
| 453 | Ga0207648_10004627 | 3300026089 | Bacteria | 14090 |
| 454 | Ga0207648_10046915 | 3300026089 | Bacteria | 3787 |
| 455 | Ga0207648_10807228 | 3300026089 | Bacteria | 874 |
| 456 | Ga0207676_10030863 | 3300026095 | Bacteria | 4026 |
| 457 | Ga0207676_10282270 | 3300026095 | Bacteria | 1508 |
| 458 | Ga0207674_10094104 | 3300026116 | Bacteria | 2983 |
| 459 | Ga0207674_10112597 | 3300026116 | Bacteria | 2695 |
| 460 | Ga0207674_10530319 | 3300026116 | Bacteria | 1137 |
| 461 | Ga0207675_100003859 | 3300026118 | Bacteria | 14570 |
| 462 | Ga0207683_10000850 | 3300026121 | Bacteria | 28050 |
| 463 | Ga0207683_10051919 | 3300026121 | Bacteria | 3592 |
| 464 | Ga0207683_10075790 | 3300026121 | Bacteria | 2978 |
| 465 | Ga0207683_10176198 | 3300026121 | Bacteria | 1938 |
| 466 | Ga0207698_10087412 | 3300026142 | Bacteria | 2539 |
| 467 | Ga0207698_10089661 | 3300026142 | Bacteria | 2512 |
| 468 | Ga0207698_10636350 | 3300026142 | Bacteria | 1055 |
| 469 | Ga0209984_1018261 | 3300027424 | Bacteria | 947 |
| 470 | Ga0210002_1003557 | 3300027617 | Bacteria | 2298 |
| 471 | Ga0209998_10002588 | 3300027717 | Bacteria | 4111 |
| 472 | Ga0209813_10105597 | 3300027866 | Bacteria | 964 |
| 473 | Ga0209974_10003747 | 3300027876 | Bacteria | 5444 |
| 474 | Ga0207428_10000164 | 3300027907 | Bacteria | 91968 |
| 475 | Ga0207428_10459443 | 3300027907 | Bacteria | 928 |
| 476 | Ga0268266_10012217 | 3300028379 | Bacteria | 7429 |
| 477 | Ga0268266_10013853 | 3300028379 | Bacteria | 6942 |
| 478 | Ga0268266_10164400 | 3300028379 | Bacteria | 2009 |
| 479 | Ga0268266_10227310 | 3300028379 | Bacteria | 1717 |
| 480 | Ga0268266_10363782 | 3300028379 | Bacteria | 1361 |
| 481 | Ga0268266_10559329 | 3300028379 | Bacteria | 1096 |
| 482 | Ga0268265_10004025 | 3300028380 | Bacteria | 10352 |
| 483 | Ga0268265_10022554 | 3300028380 | Bacteria | 4425 |
| 484 | Ga0268265_10079812 | 3300028380 | Bacteria | 2578 |
| 485 | Ga0268264_10000174 | 3300028381 | Bacteria | 137254 |
| 486 | Ga0268264_10049152 | 3300028381 | Bacteria | 3508 |
| 487 | Ga0268264_10102694 | 3300028381 | Bacteria | 2488 |
| 488 | Ga0268264_10158236 | 3300028381 | Bacteria | 2038 |
| 489 | Ga0268264_10756675 | 3300028381 | Bacteria | 968 |
| 490 | Ga0265334_10031226 | 3300028573 | Bacteria | 2130 |
| 491 | Ga0307517_10000859 | 3300028786 | Bacteria | 51881 |
| 492 | Ga0307511_10032093 | 3300030521 | Bacteria | 4676 |
| 493 | Ga0307512_10244813 | 3300030522 | Bacteria | 902 |
| 494 | Ga0265330_10052577 | 3300031235 | Bacteria | 1784 |
| 495 | Ga0265332_10029296 | 3300031238 | Bacteria | 2407 |
| 496 | Ga0265325_10000019 | 3300031241 | Bacteria | 125265 |
| 497 | Ga0265339_10303624 | 3300031249 | Bacteria | 760 |
| 498 | Ga0265331_10110613 | 3300031250 | Bacteria | 1260 |
| 499 | Ga0307513_10377142 | 3300031456 | Bacteria | 1159 |
| 500 | Ga0307509_10006398 | 3300031507 | Bacteria | 15864 |
| 501 | Ga0307509_10082116 | 3300031507 | Bacteria | 3325 |
| 502 | Ga0307408_100180430 | 3300031548 | Bacteria | 1693 |
| 503 | Ga0307408_100715716 | 3300031548 | Bacteria | 901 |
| 504 | Ga0265313_10067069 | 3300031595 | Bacteria | 1661 |
| 505 | Ga0265313_10117892 | 3300031595 | Bacteria | 1161 |
| 506 | Ga0307508_10494422 | 3300031616 | Bacteria | 817 |
| 507 | Ga0307516_10059646 | 3300031730 | Bacteria | 3710 |
| 508 | Ga0307516_10060402 | 3300031730 | Bacteria | 3683 |
| 509 | Ga0307405_10595972 | 3300031731 | Bacteria | 901 |
| 510 | Ga0307405_11002876 | 3300031731 | Bacteria | 712 |
| 511 | Ga0307413_10038231 | 3300031824 | Bacteria | 2780 |
| 512 | Ga0307413_10491927 | 3300031824 | Bacteria | 983 |
| 513 | Ga0307407_10258970 | 3300031903 | Bacteria | 1196 |
| 514 | Ga0307409_100021933 | 3300031995 | Bacteria | 4391 |
| 515 | Ga0307416_100558321 | 3300032002 | Bacteria | 1219 |
| 516 | Ga0307415_100004684 | 3300032126 | Bacteria | 7153 |
| 517 | Ga0307507_10028588 | 3300033179 | Bacteria | 5937 |
| 518 | Ga0307510_10019115 | 3300033180 | Bacteria | 8037 |
| 519 | Ga0307510_10201911 | 3300033180 | Bacteria | 1522 |
| 520 | Ga0315911_1000040 | 3300033442 | Bacteria | 50766 |
| 521 | Ga0316215_1000931 | 3300033544 | Bacteria | 2860 |
| 522 | Ga0373930_0002256 | 3300034816 | Bacteria | 2972 |
| 523 | Ga0373948_0001906 | 3300034817 | Bacteria | 2989 |
| 524 | Ga0373950_0013019 | 3300034818 | Bacteria | 1382 |
| 525 | Ga0373959_0008747 | 3300034820 | Bacteria | 1731 |
| 526 | Ga0373926_0054548 | 3300035083 | Bacteria | 1448 |
| 527 | Ga0373926_0083666 | 3300035083 | Bacteria | 1182 |
| 528 | Ga0373929_0006845 | 3300035085 | Bacteria | 2070 |
| 529 | Ga0373929_0007992 | 3300035085 | Bacteria | 1945 |
| 530 | Ga0373951_0029322 | 3300035091 | Bacteria | 1292 |
| 531 | Ga0373952_0000933 | 3300035092 | Bacteria | 5313 |
| 532 | Ga0373923_0003867 | 3300035111 | Bacteria | 4879 |
| 533 | Ga0373923_0021124 | 3300035111 | Bacteria | 2538 |
| 534 | Ga0373923_0027670 | 3300035111 | Bacteria | 2263 |
| 535 | Ga0373932_0003751 | 3300035112 | Bacteria | 3626 |
| 536 | Ga0373936_0006062 | 3300035113 | Bacteria | 4555 |
| 537 | Ga0373936_0179144 | 3300035113 | Bacteria | 929 |
| 538 | Ga0373939_0003090 | 3300035114 | Bacteria | 3908 |
| 539 | Ga0373941_0013201 | 3300035115 | Bacteria | 2178 |
| 540 | Ga0373953_0012482 | 3300035117 | Bacteria | 3010 |
| 541 | Ga0373953_0018244 | 3300035117 | Plasmid | 2594 |
| 542 | Ga0373953_0066408 | 3300035117 | Bacteria | 1482 |
| 543 | Ga0373954_0000213 | 3300035118 | Bacteria | 21171 |
| 544 | Ga0373954_0001219 | 3300035118 | Bacteria | 10343 |
| 545 | Ga0373954_0008152 | 3300035118 | Bacteria | 4590 |
| 546 | Ga0373954_0015754 | 3300035118 | Bacteria | 3381 |
| 547 | Ga0373954_0349097 | 3300035118 | Bacteria | 731 |
| 548 | Ga0373956_0004720 | 3300035119 | Bacteria | 5448 |
| 549 | Ga0373956_0112176 | 3300035119 | Bacteria | 1270 |
| 550 | Ga0373957_0003464 | 3300035120 | Bacteria | 4665 |
| 551 | Ga0373957_0182082 | 3300035120 | Bacteria | 871 |
| 552 | Ga0373960_0006476 | 3300035121 | Bacteria | 2749 |
| 553 | Ga0373943_0005037 | 3300035170 | Bacteria | 5958 |
| 554 | Ga0373943_0066209 | 3300035170 | Bacteria | 1819 |
| 555 | Ga0373943_0255544 | 3300035170 | Bacteria | 985 |
| 556 | Ga0373955_0002049 | 3300035172 | Bacteria | 8671 |
| 557 | Ga0373955_0012895 | 3300035172 | Plasmid | 4029 |
| 558 | Ga0373955_0241240 | 3300035172 | Bacteria | 1082 |
| 559 | Ga0373955_0503749 | 3300035172 | Bacteria | 739 |
| 560 | Ga0373942_0027318 | 3300035207 | Bacteria | 1484 |
| 561 | Ga0373961_0036817 | 3300035241 | Bacteria | 1395 |
| 562 | Ga0373962_0009071 | 3300035242 | Bacteria | 2457 |
| 563 | Ga0373924_0007721 | 3300035410 | Bacteria | 3888 |
| 564 | Ga0373924_0014698 | 3300035410 | Bacteria | 2961 |
| 565 | Ga0373931_0002611 | 3300035691 | Bacteria | 8014 |
| 566 | Ga0373931_0004766 | 3300035691 | Bacteria | 6220 |
| 567 | Ga0373935_0000942 | 3300035692 | Bacteria | 15748 |
| 568 | Ga0373935_0057406 | 3300035692 | Unclassified | 2483 |
| 569 | Ga0373927_0000528 | 3300035695 | Bacteria | 29016 |
| 570 | Ga0373927_0007183 | 3300035695 | Bacteria | 7558 |
| 571 | Ga0373927_0064676 | 3300035695 | Bacteria | 2366 |
| 572 | Ga0373927_0089359 | 3300035695 | Bacteria | 2000 |
| 573 | Ga0373927_0202177 | 3300035695 | Bacteria | 1304 |
| 574 | Ga0373927_0327937 | 3300035695 | Bacteria | 1008 |
| 575 | Ga0373933_0010853 | 3300035724 | Bacteria | 4999 |
| 576 | Ga0373933_0034817 | 3300035724 | Plasmid | 2937 |
| 577 | Ga0373933_0112377 | 3300035724 | Bacteria | 1700 |
| 578 | Ga0373933_0340671 | 3300035724 | Bacteria | 973 |
| 579 | Ga0373947_0000455 | 3300035725 | Bacteria | 23308 |
| 580 | Ga0373947_0035994 | 3300035725 | Bacteria | 2933 |
| 581 | Ga0373947_0039442 | 3300035725 | Bacteria | 2810 |
| 582 | Ga0373947_0091001 | 3300035725 | Bacteria | 1903 |
| 583 | Ga0373947_0183995 | 3300035725 | Bacteria | 1361 |
| 584 | Ga0373947_0376258 | 3300035725 | Bacteria | 955 |
| 585 | Ga0373937_0004613 | 3300036401 | Bacteria | 11701 |
| 586 | Ga0373937_0008188 | 3300036401 | Bacteria | 9080 |
| 587 | Ga0373937_0015336 | 3300036401 | Bacteria | 6776 |
| 588 | Ga0373937_0185926 | 3300036401 | Bacteria | 1951 |
| 589 | Ga0373937_0485225 | 3300036401 | Bacteria | 1174 |
| 590 | Ga0372808_023218 | 3300036459 | Bacteria | 891 |
| 591 | Ga0373925_0003563 | 3300037068 | Bacteria | 12000 |
| 592 | Ga0373925_0023694 | 3300037068 | Bacteria | 4479 |
| 593 | Ga0373925_0034269 | 3300037068 | Bacteria | 3741 |
| 594 | Ga0373925_0081325 | 3300037068 | Bacteria | 2463 |
| 595 | Ga0373925_0085487 | 3300037068 | Unclassified | 2405 |
| 596 | Ga0373925_0154434 | 3300037068 | Bacteria | 1804 |
| 597 | Ga0373925_0301832 | 3300037068 | Bacteria | 1293 |
| 598 | Ga0373925_0466402 | 3300037068 | Bacteria | 1035 |
| 599 | Ga0395905_0077529 | 3300037471 | Bacteria | 3114 |
| 600 | Ga0436364_0157539 | 3300037853 | Bacteria | 2550 |
| 601 | Ga0436364_0476354 | 3300037853 | Bacteria | 863 |
| 602 | Ga0436364_1289063 | 3300037853 | Bacteria | 1174 |
| 603 | Ga0395901_0067053 | 3300038443 | Bacteria | 3738 |
| 604 | Ga0436365_1698837 | 3300039437 | Bacteria | 869 |
| 605 | Ga0436363_1437817 | 3300039450 | Bacteria | 1546 |
| 606 | Ga0439465_0132882 | 3300041413 | Bacteria | 879 |
| 607 | Ga0451791_0240992 | 3300041451 | Bacteria | 1064 |
| 608 | Ga0451791_0284711 | 3300041451 | Bacteria | 886 |
| 609 | Ga0451791_0441720 | 3300041451 | Bacteria | 774 |
| 610 | Ga0451793_1400233 | 3300041452 | Bacteria | 729 |
| 611 | Ga0451807_0428279 | 3300041486 | Bacteria | 994 |
| 612 | Ga0451837_1412964 | 3300041494 | Bacteria | 1276 |
| 613 | Ga0451853_0921849 | 3300041512 | Bacteria | 811 |
| 614 | Ga0451853_4011993 | 3300041512 | Bacteria | 1075 |
| 615 | Ga0466968_0247024 | 3300044735 | Bacteria | 847 |
| 616 | Ga0495617_085353 | 3300046452 | Bacteria | 1033 |
| 617 | Ga0495617_165209 | 3300046452 | Bacteria | 700 |
| 618 | Ga0495592_0005277 | 3300046454 | Bacteria | 9521 |
| 619 | Ga0495592_0021465 | 3300046454 | Bacteria | 4910 |
| 620 | Ga0495592_0032569 | 3300046454 | Bacteria | 3932 |
| 621 | Ga0495592_0218026 | 3300046454 | Bacteria | 1277 |
| 622 | Ga0495592_0341783 | 3300046454 | Bacteria | 962 |
| 623 | Ga0495603_0000239 | 3300046455 | Bacteria | 28578 |
| 624 | Ga0495603_0009322 | 3300046455 | Bacteria | 5935 |
| 625 | Ga0495603_0058945 | 3300046455 | Bacteria | 2269 |
| 626 | Ga0495590_0068691 | 3300046457 | Bacteria | 1242 |
| 627 | Ga0495629_0000457 | 3300046459 | Bacteria | 34088 |
| 628 | Ga0495629_0007972 | 3300046459 | Bacteria | 7791 |
| 629 | Ga0495629_0225537 | 3300046459 | Bacteria | 1292 |
| 630 | Ga0495638_0021622 | 3300046460 | Bacteria | 4236 |
| 631 | Ga0495638_0076101 | 3300046460 | Bacteria | 2045 |
| 632 | Ga0495641_0002157 | 3300046461 | Bacteria | 15774 |
| 633 | Ga0495641_0094341 | 3300046461 | Bacteria | 1337 |
| 634 | Ga0495641_0209869 | 3300046461 | Bacteria | 873 |
| 635 | Ga0495651_0014000 | 3300046462 | Bacteria | 6203 |
| 636 | Ga0495651_0037984 | 3300046462 | Bacteria | 3749 |
| 637 | Ga0495651_0054995 | 3300046462 | Bacteria | 3058 |
| 638 | Ga0495651_0363524 | 3300046462 | Bacteria | 953 |
| 639 | Ga0495653_0004257 | 3300046463 | Bacteria | 11596 |
| 640 | Ga0495653_0009797 | 3300046463 | Bacteria | 7835 |
| 641 | Ga0495653_0021824 | 3300046463 | Bacteria | 5182 |
| 642 | Ga0495653_0155003 | 3300046463 | Bacteria | 1596 |
| 643 | Ga0495650_0051594 | 3300046471 | Bacteria | 1694 |
| 644 | Ga0495580_0002960 | 3300046472 | Bacteria | 14585 |
| 645 | Ga0495580_0198659 | 3300046472 | Bacteria | 1382 |
| 646 | Ga0495582_0000077 | 3300046473 | Bacteria | 49112 |
| 647 | Ga0495639_0000101 | 3300046475 | Bacteria | 42348 |
| 648 | Ga0495639_0095966 | 3300046475 | Bacteria | 1396 |
| 649 | Ga0495639_0179661 | 3300046475 | Unclassified | 1030 |
| 650 | Ga0495662_0012510 | 3300046476 | Bacteria | 4140 |
| 651 | Ga0495662_0033507 | 3300046476 | Bacteria | 2481 |
| 652 | Ga0495664_0005157 | 3300046477 | Bacteria | 7169 |
| 653 | Ga0495664_0038052 | 3300046477 | Plasmid | 2839 |
| 654 | Ga0495664_0041464 | 3300046477 | Bacteria | 2724 |
| 655 | Ga0495664_0432353 | 3300046477 | Bacteria | 789 |
| 656 | Ga0495664_0530360 | 3300046477 | Bacteria | 702 |
| 657 | Ga0495584_0046170 | 3300046491 | Bacteria | 2197 |
| 658 | Ga0495584_0108892 | 3300046491 | Bacteria | 1401 |
| 659 | Ga0495585_0031320 | 3300046492 | Bacteria | 3019 |
| 660 | Ga0495594_0000083 | 3300046499 | Bacteria | 42703 |
| 661 | Ga0495594_0186100 | 3300046499 | Bacteria | 1182 |
| 662 | Ga0495606_0000357 | 3300046507 | Bacteria | 78015 |
| 663 | Ga0495606_0313024 | 3300046507 | Bacteria | 846 |
| 664 | Ga0495608_0000911 | 3300046511 | Bacteria | 20725 |
| 665 | Ga0495608_0004649 | 3300046511 | Bacteria | 9811 |
| 666 | Ga0495616_0335648 | 3300046513 | Bacteria | 632 |
| 667 | Ga0495618_0003586 | 3300046514 | Bacteria | 9613 |
| 668 | Ga0495618_0014258 | 3300046514 | Bacteria | 4840 |
| 669 | Ga0495628_0023578 | 3300046516 | Bacteria | 5049 |
| 670 | Ga0495628_0046394 | 3300046516 | Bacteria | 3451 |
| 671 | Ga0495628_0055320 | 3300046516 | Plasmid | 3125 |
| 672 | Ga0495628_0062832 | 3300046516 | Bacteria | 2910 |
| 673 | Ga0495630_0074877 | 3300046517 | Bacteria | 2551 |
| 674 | Ga0495630_0079394 | 3300046517 | Unclassified | 2475 |
| 675 | Ga0495630_0167276 | 3300046517 | Bacteria | 1674 |
| 676 | Ga0495630_0268244 | 3300046517 | Bacteria | 1304 |
| 677 | Ga0495632_0015464 | 3300046519 | Bacteria | 4277 |
| 678 | Ga0495644_0046783 | 3300046523 | Bacteria | 1626 |
| 679 | Ga0495666_0037457 | 3300046526 | Bacteria | 2359 |
| 680 | Ga0495652_0021917 | 3300046529 | Bacteria | 5680 |
| 681 | Ga0495652_0046433 | 3300046529 | Bacteria | 3729 |
| 682 | Ga0495652_0046645 | 3300046529 | Bacteria | 3719 |
| 683 | Ga0495652_0145338 | 3300046529 | Unclassified | 1859 |
| 684 | Ga0495665_0000055 | 3300046531 | Bacteria | 45208 |
| 685 | Ga0495640_0011661 | 3300046533 | Bacteria | 6748 |
| 686 | Ga0495640_0051741 | 3300046533 | Bacteria | 2822 |
| 687 | Ga0495640_0053786 | 3300046533 | Plasmid | 2759 |
| 688 | Ga0495640_0169903 | 3300046533 | Bacteria | 1393 |
| 689 | Ga0495640_0486452 | 3300046533 | Bacteria | 752 |
| 690 | Ga0495586_0026013 | 3300046535 | Bacteria | 3131 |
| 691 | Ga0495586_0590969 | 3300046535 | Bacteria | 641 |
| 692 | Ga0495587_0005897 | 3300046536 | Bacteria | 7984 |
| 693 | Ga0495587_0011562 | 3300046536 | Bacteria | 5588 |
| 694 | Ga0495587_0015897 | 3300046536 | Bacteria | 4687 |
| 695 | Ga0495587_0165550 | 3300046536 | Bacteria | 1257 |
| 696 | Ga0495598_0005561 | 3300046537 | Bacteria | 2802 |
| 697 | Ga0495597_0148045 | 3300046542 | Bacteria | 965 |
| 698 | Ga0495645_0031846 | 3300046543 | Bacteria | 3844 |
| 699 | Ga0495645_0042847 | 3300046543 | Bacteria | 3300 |
| 700 | Ga0495645_0061920 | 3300046543 | Bacteria | 2711 |
| 701 | Ga0495645_0331495 | 3300046543 | Bacteria | 985 |
| 702 | Ga0495622_0002233 | 3300046557 | Bacteria | 9422 |
| 703 | Ga0495622_0128327 | 3300046557 | Bacteria | 1155 |
| 704 | Ga0495622_0162331 | 3300046557 | Bacteria | 1007 |
| 705 | Ga0495633_0094045 | 3300046558 | Bacteria | 1393 |
| 706 | Ga0495667_0013782 | 3300046559 | Bacteria | 5460 |
| 707 | Ga0495667_0021423 | 3300046559 | Bacteria | 4361 |
| 708 | Ga0495667_0023279 | 3300046559 | Bacteria | 4173 |
| 709 | Ga0495667_0048600 | 3300046559 | Bacteria | 2801 |
| 710 | Ga0495667_0093406 | 3300046559 | Bacteria | 1948 |
| 711 | Ga0495656_0008262 | 3300046615 | Bacteria | 3711 |
| 712 | Ga0495656_0308414 | 3300046615 | Bacteria | 813 |
| 713 | Ga0495668_0114332 | 3300046616 | Bacteria | 1476 |
| 714 | Ga0495634_0001036 | 3300046642 | Bacteria | 26033 |
| 715 | Ga0495611_0063779 | 3300046648 | Bacteria | 1677 |
| 716 | Ga0495625_0592842 | 3300046660 | Bacteria | 666 |
| 717 | Ga0495635_0000815 | 3300046663 | Bacteria | 20434 |
| 718 | Ga0495635_0004810 | 3300046663 | Bacteria | 9387 |
| 719 | Ga0495635_0011194 | 3300046663 | Bacteria | 6289 |
| 720 | Ga0495635_0029736 | 3300046663 | Bacteria | 3799 |
| 721 | Ga0495635_0053819 | 3300046663 | Bacteria | 2772 |
| 722 | Ga0495659_0004501 | 3300046664 | Bacteria | 4388 |
| 723 | Ga0495588_0005058 | 3300046674 | Bacteria | 5855 |
| 724 | Ga0495588_0005077 | 3300046674 | Bacteria | 5848 |
| 725 | Ga0495657_0003079 | 3300046675 | Bacteria | 13781 |
| 726 | Ga0495657_0034720 | 3300046675 | Bacteria | 3500 |
| 727 | Ga0495657_0068646 | 3300046675 | Bacteria | 2322 |
| 728 | Ga0495599_0001945 | 3300046678 | Bacteria | 11972 |
| 729 | Ga0495599_0097068 | 3300046678 | Bacteria | 1837 |
| 730 | Ga0495599_0156310 | 3300046678 | Bacteria | 1411 |
| 731 | Ga0495623_0001015 | 3300046679 | Bacteria | 18970 |
| 732 | Ga0495623_0020870 | 3300046679 | Bacteria | 4233 |
| 733 | Ga0495623_0077150 | 3300046679 | Bacteria | 2066 |
| 734 | Ga0495646_0001642 | 3300046680 | Bacteria | 13342 |
| 735 | Ga0495646_0014188 | 3300046680 | Bacteria | 5065 |
| 736 | Ga0495646_0113094 | 3300046680 | Bacteria | 1544 |
| 737 | Ga0495646_0189630 | 3300046680 | Bacteria | 1124 |
| 738 | Ga0495647_0067226 | 3300046681 | Bacteria | 1427 |
| 739 | Ga0495658_0001572 | 3300046683 | Bacteria | 11910 |
| 740 | Ga0495669_0002048 | 3300046684 | Bacteria | 8266 |
| 741 | Ga0495613_0003480 | 3300046689 | Bacteria | 11777 |
| 742 | Ga0495613_0078788 | 3300046689 | Unclassified | 2396 |
| 743 | Ga0495613_0092005 | 3300046689 | Bacteria | 2196 |
| 744 | Ga0495613_0168523 | 3300046689 | Bacteria | 1555 |
| 745 | Ga0495613_0660189 | 3300046689 | Bacteria | 691 |
| 746 | Ga0495624_0000235 | 3300046690 | Bacteria | 43165 |
| 747 | Ga0495624_0050807 | 3300046690 | Plasmid | 2625 |
| 748 | Ga0495624_0179546 | 3300046690 | Bacteria | 1290 |
| 749 | Ga0495670_0192981 | 3300046691 | Bacteria | 1077 |
| 750 | Ga0495671_0061334 | 3300046692 | Bacteria | 1855 |
| 751 | Ga0495589_0184650 | 3300046794 | Bacteria | 988 |
| 752 | Ga0495600_0012719 | 3300046809 | Bacteria | 5268 |
| 753 | Ga0495600_0015287 | 3300046809 | Bacteria | 4851 |
| 754 | Ga0495600_0245824 | 3300046809 | Bacteria | 1139 |
| 755 | Ga0495600_0339237 | 3300046809 | Bacteria | 942 |
| 756 | Ga0495600_0344774 | 3300046809 | Bacteria | 934 |
| 757 | Ga0495600_0574508 | 3300046809 | Bacteria | 687 |
| 758 | Ga0495581_0000041 | 3300047315 | Bacteria | 46518 |
| 759 | Ga0495581_0196067 | 3300047315 | Bacteria | 1181 |
| 760 | Ga0495604_0007221 | 3300047317 | Bacteria | 8800 |
| 761 | Ga0495604_0272830 | 3300047317 | Bacteria | 1145 |
| 762 | Ga0495674_0028002 | 3300047319 | Bacteria | 5145 |
| 763 | Ga0495674_0036100 | 3300047319 | Bacteria | 4451 |
| 764 | Ga0495674_0602898 | 3300047319 | Bacteria | 870 |
| 765 | Ga0495676_0018550 | 3300047321 | Bacteria | 6135 |
| 766 | Ga0495680_0017765 | 3300047322 | Bacteria | 6056 |
| 767 | Ga0495680_0028245 | 3300047322 | Bacteria | 4600 |
| 768 | Ga0495680_0154374 | 3300047322 | Bacteria | 1671 |
| 769 | Ga0495680_0414882 | 3300047322 | Bacteria | 927 |
| 770 | Ga0495675_0025398 | 3300047444 | Bacteria | 3777 |
| 771 | Ga0495675_0048080 | 3300047444 | Bacteria | 2713 |
| 772 | Ga0495677_0151369 | 3300047445 | Bacteria | 893 |
| 773 | Ga0495679_093047 | 3300047446 | Bacteria | 844 |
| 774 | Ga0495673_0025589 | 3300047469 | Bacteria | 2830 |
| 775 | Ga0495684_0001399 | 3300047471 | Bacteria | 19329 |
| 776 | Ga0495684_0028335 | 3300047471 | Bacteria | 4301 |
| 777 | Ga0495684_0405869 | 3300047471 | Bacteria | 955 |
| 778 | Ga0495686_0224071 | 3300047472 | Bacteria | 1068 |
| 779 | Ga0495593_0000024 | 3300047673 | Bacteria | 65718 |
| 780 | Ga0495593_0004938 | 3300047673 | Bacteria | 7905 |
| 781 | Ga0495593_0019588 | 3300047673 | Bacteria | 3793 |
| 782 | Ga0495602_0019419 | 3300048088 | Bacteria | 6748 |
| 783 | Ga0495602_0035012 | 3300048088 | Bacteria | 4687 |
| 784 | Ga0495602_0067291 | 3300048088 | Bacteria | 3082 |
| 785 | Ga0495626_0219016 | 3300048091 | Bacteria | 774 |
| 786 | Ga0496100_0032123 | 3300048903 | Bacteria | 3270 |
| 787 | Ga0496100_0084124 | 3300048903 | Bacteria | 2156 |
| 788 | Ga0496100_0301201 | 3300048903 | Bacteria | 1200 |
| 789 | Ga0496100_0552808 | 3300048903 | Bacteria | 891 |
| 790 | Ga0496101_0002275 | 3300048904 | Bacteria | 11728 |
| 791 | Ga0496101_0017665 | 3300048904 | Bacteria | 4839 |
| 792 | Ga0496101_0257139 | 3300048904 | Unclassified | 1361 |
| 793 | Ga0496101_0290603 | 3300048904 | Bacteria | 1279 |
| 794 | Ga0496101_0475822 | 3300048904 | Unclassified | 986 |
| 795 | Ga0496102_0015668 | 3300048905 | Bacteria | 6604 |
| 796 | Ga0496102_0022366 | 3300048905 | Bacteria | 5601 |
| 797 | Ga0496102_0076164 | 3300048905 | Bacteria | 3085 |
| 798 | Ga0496102_0286670 | 3300048905 | Bacteria | 1552 |
| 799 | Ga0496102_0414593 | 3300048905 | Bacteria | 1265 |
| 800 | Ga0496103_0019772 | 3300048906 | Bacteria | 4042 |
| 801 | Ga0496103_0026671 | 3300048906 | Bacteria | 3498 |
| 802 | Ga0496103_0413174 | 3300048906 | Bacteria | 866 |
| 803 | Ga0496104_0047895 | 3300048907 | Bacteria | 4029 |
| 804 | Ga0496104_0088890 | 3300048907 | Bacteria | 2951 |
| 805 | Ga0496104_0121736 | 3300048907 | Bacteria | 2505 |
| 806 | Ga0496104_0135420 | 3300048907 | Bacteria | 2366 |
| 807 | Ga0496104_0249235 | 3300048907 | Unclassified | 1689 |
| 808 | Ga0496104_0353360 | 3300048907 | Bacteria | 1382 |
| 809 | Ga0496105_0012396 | 3300048908 | Bacteria | 6749 |
| 810 | Ga0496105_0292958 | 3300048908 | Unclassified | 1310 |
| 811 | Ga0496105_0827525 | 3300048908 | Bacteria | 702 |
| 812 | Ga0496106_0003446 | 3300048909 | Bacteria | 11782 |
| 813 | Ga0496106_0039727 | 3300048909 | Bacteria | 3524 |
| 814 | Ga0496106_0058706 | 3300048909 | Bacteria | 2913 |
| 815 | Ga0496106_0103687 | 3300048909 | Unclassified | 2208 |
| 816 | Ga0496106_0147996 | 3300048909 | Bacteria | 1851 |
| 817 | Ga0496106_0149447 | 3300048909 | Bacteria | 1842 |
| 818 | Ga0496106_0267929 | 3300048909 | Bacteria | 1367 |
| 819 | Ga0496106_0299272 | 3300048909 | Bacteria | 1290 |
| 820 | Ga0496107_0000509 | 3300048910 | Bacteria | 21565 |
| 821 | Ga0496107_0021914 | 3300048910 | Bacteria | 4514 |
| 822 | Ga0496107_0055248 | 3300048910 | Bacteria | 2868 |
| 823 | Ga0496107_0159541 | 3300048910 | Bacteria | 1671 |
| 824 | Ga0496107_0184967 | 3300048910 | Unclassified | 1547 |
| 825 | Ga0496107_0210648 | 3300048910 | Bacteria | 1445 |
| 826 | Ga0496107_0397163 | 3300048910 | Unclassified | 1025 |
| 827 | Ga0496108_0031275 | 3300048911 | Bacteria | 4415 |
| 828 | Ga0496108_0043219 | 3300048911 | Bacteria | 3764 |
| 829 | Ga0496108_0150590 | 3300048911 | Bacteria | 2007 |
| 830 | Ga0496109_0026994 | 3300048912 | Bacteria | 5122 |
| 831 | Ga0496109_0063752 | 3300048912 | Bacteria | 3371 |
| 832 | Ga0496109_0170543 | 3300048912 | Bacteria | 2041 |
| 833 | Ga0496109_0207049 | 3300048912 | Bacteria | 1844 |
| 834 | Ga0496109_0241523 | 3300048912 | Bacteria | 1700 |
| 835 | Ga0496109_0273602 | 3300048912 | Bacteria | 1591 |
| 836 | Ga0496109_0995085 | 3300048912 | Bacteria | 776 |
| 837 | Ga0496110_0033752 | 3300048913 | Bacteria | 4429 |
| 838 | Ga0496110_0130718 | 3300048913 | Bacteria | 2267 |
| 839 | Ga0496110_0313674 | 3300048913 | Bacteria | 1428 |
| 840 | Ga0496110_0703311 | 3300048913 | Bacteria | 912 |
| 841 | Ga0496110_0799685 | 3300048913 | Bacteria | 847 |
| 842 | Ga0496110_0920507 | 3300048913 | Bacteria | 781 |
| 843 | Ga0496111_0024753 | 3300048914 | Bacteria | 4233 |
| 844 | Ga0496111_0039292 | 3300048914 | Bacteria | 3392 |
| 845 | Ga0496111_0233770 | 3300048914 | Bacteria | 1365 |
| 846 | Ga0496111_0348952 | 3300048914 | Bacteria | 1095 |
| 847 | Ga0496111_0510088 | 3300048914 | Bacteria | 885 |
| 848 | Ga0496112_0012715 | 3300048915 | Bacteria | 7740 |
| 849 | Ga0496112_0048594 | 3300048915 | Bacteria | 4159 |
| 850 | Ga0496112_0086667 | 3300048915 | Bacteria | 3098 |
| 851 | Ga0496112_0252685 | 3300048915 | Unclassified | 1714 |
| 852 | Ga0496112_0284141 | 3300048915 | Bacteria | 1601 |
| 853 | Ga0496113_0002503 | 3300048916 | Bacteria | 10701 |
| 854 | Ga0496113_0008294 | 3300048916 | Bacteria | 6760 |
| 855 | Ga0496113_0056499 | 3300048916 | Bacteria | 2947 |
| 856 | Ga0496113_0057698 | 3300048916 | Bacteria | 2919 |
| 857 | Ga0496113_0533929 | 3300048916 | Bacteria | 941 |
| 858 | Ga0496114_0009294 | 3300048917 | Bacteria | 7801 |
| 859 | Ga0496114_0048418 | 3300048917 | Bacteria | 3536 |
| 860 | Ga0496114_0079135 | 3300048917 | Bacteria | 2774 |
| 861 | Ga0496114_0401699 | 3300048917 | Bacteria | 1213 |
| 862 | Ga0496115_0045511 | 3300048918 | Bacteria | 3504 |
| 863 | Ga0496115_0059345 | 3300048918 | Bacteria | 3081 |
| 864 | Ga0496115_0106674 | 3300048918 | Unclassified | 2300 |
| 865 | Ga0496115_0133773 | 3300048918 | Bacteria | 2044 |
| 866 | Ga0496115_0266420 | 3300048918 | Bacteria | 1408 |
| 867 | Ga0496117_0238499 | 3300048920 | Bacteria | 1000 |
| 868 | Ga0496119_0047619 | 3300048922 | Bacteria | 2666 |
| 869 | Ga0496121_0000927 | 3300048924 | Bacteria | 53016 |
| 870 | Ga0496121_0095423 | 3300048924 | Bacteria | 2311 |
| 871 | Ga0496121_0151137 | 3300048924 | Bacteria | 1708 |
| 872 | Ga0496121_0203641 | 3300048924 | Bacteria | 1408 |
| 873 | Ga0496124_0233805 | 3300048927 | Bacteria | 1372 |
| 874 | Ga0496126_0060792 | 3300048929 | Bacteria | 3396 |
| 875 | Ga0496126_0082014 | 3300048929 | Bacteria | 2850 |
| 876 | Ga0496126_0378771 | 3300048929 | Bacteria | 1152 |
| 877 | Ga0496126_0570173 | 3300048929 | Bacteria | 896 |
| 878 | Ga0496126_0726628 | 3300048929 | Bacteria | 769 |
| 879 | Ga0501032_0139342 | 3300049569 | Bacteria | 1598 |
| 880 | Ga0501043_0280819 | 3300049579 | Bacteria | 1276 |
| 881 | Ga0501046_0060334 | 3300049580 | Bacteria | 2968 |
| 882 | Ga0501047_0014411 | 3300049581 | Bacteria | 7517 |
| 883 | Ga0501067_0039577 | 3300049583 | Bacteria | 2618 |
| 884 | Ga0501070_0006598 | 3300049586 | Bacteria | 9876 |
| 885 | Ga0501044_0005514 | 3300049823 | Bacteria | 14047 |
| 886 | Ga0501044_0209640 | 3300049823 | Unclassified | 1903 |
| 887 | nmdc:mga00v17_297583_c1 | 3300050491 | Bacteria | 1048 |
| 888 | nmdc:mga0yw44_13282_c1 | 3300050492 | Bacteria | 4330 |
| 889 | nmdc:mga0yw44_168291_c1 | 3300050492 | Bacteria | 1438 |
| 890 | nmdc:mga0yw44_211928_c1 | 3300050492 | Bacteria | 1282 |
| 891 | nmdc:mga0yw44_285890_c1 | 3300050492 | Bacteria | 1103 |
| 892 | nmdc:mga0k408_292622_c1 | 3300050493 | Bacteria | 972 |
| 893 | nmdc:mga06z11_151224_c1 | 3300050494 | Bacteria | 1320 |
| 894 | nmdc:mga06z11_45147_c1 | 3300050494 | Bacteria | 1399 |
| 895 | nmdc:mga06z11_84370_c1 | 3300050494 | Bacteria | 1712 |
| 896 | nmdc:mga04h51_9301_c1 | 3300050495 | Bacteria | 2658 |
| 897 | nmdc:mga07m45_8848_c1 | 3300050496 | Bacteria | 5195 |
| 898 | nmdc:mga07m45_94518_c1 | 3300050496 | Bacteria | 1714 |
| 899 | nmdc:mga08y16_108_c1 | 3300050511 | Bacteria | 69804 |
| 900 | nmdc:mga08y16_191984_c1 | 3300050511 | Bacteria | 2118 |
| 901 | nmdc:mga08y16_366135_c1 | 3300050511 | Bacteria | 1479 |
| 902 | nmdc:mga0n895_121255_c1 | 3300050512 | Bacteria | 2636 |
| 903 | nmdc:mga0n895_216385_c1 | 3300050512 | Unclassified | 1945 |
| 904 | nmdc:mga0n895_37633_c1 | 3300050512 | Bacteria | 4682 |
| 905 | nmdc:mga0rr50_537400_c1 | 3300050513 | Bacteria | 995 |
| 906 | nmdc:mga08x19_396636_c1 | 3300050514 | Bacteria | 967 |
| 907 | nmdc:mga0a205_1049_c1 | 3300050515 | Bacteria | 23004 |
| 908 | nmdc:mga0a205_206208_c1 | 3300050515 | Bacteria | 1855 |
| 909 | nmdc:mga0sz30_114689_c1 | 3300050516 | Bacteria | 1182 |
| 910 | Ga0495601_0009169 | 3300053077 | Bacteria | 5846 |
| 911 | Ga0495601_0141831 | 3300053077 | Unclassified | 1567 |
| 912 | Ga0495601_0173060 | 3300053077 | Bacteria | 1411 |
| 913 | Ga0495601_0249003 | 3300053077 | Bacteria | 1160 |
| 914 | Ga0495601_0250303 | 3300053077 | Bacteria | 1157 |
| 915 | Ga0495612_0193999 | 3300053078 | Bacteria | 894 |
| 916 | Ga0500635_0001974 | 3300053080 | Bacteria | 5009 |
| 917 | Ga0500635_0031249 | 3300053080 | Bacteria | 1722 |
| 918 | Ga0495595_0000554 | 3300053084 | Bacteria | 14279 |
| 919 | Ga0495595_0000637 | 3300053084 | Bacteria | 13319 |
| 920 | Ga0495619_0001080 | 3300053085 | Bacteria | 17897 |
| 921 | Ga0495619_0425381 | 3300053085 | Bacteria | 916 |
| 922 | Ga0500578_0445488 | 3300053086 | Bacteria | 738 |
| 923 | Ga0500647_0195221 | 3300053091 | Bacteria | 921 |
| 924 | Ga0500583_0009184 | 3300053092 | Bacteria | 3598 |
| 925 | Ga0500583_0051691 | 3300053092 | Bacteria | 1910 |
| 926 | Ga0500641_0005024 | 3300053096 | Bacteria | 4691 |
| 927 | Ga0500641_0024967 | 3300053096 | Bacteria | 2309 |
| 928 | Ga0500641_0133006 | 3300053096 | Bacteria | 1073 |
| 929 | Ga0500648_100720 | 3300053097 | Bacteria | 1607 |
| 930 | Ga0500595_001951 | 3300053119 | Bacteria | 10615 |
| 931 | Ga0500595_026055 | 3300053119 | Bacteria | 2020 |
| 932 | Ga0500658_0145563 | 3300053134 | Bacteria | 1065 |
| 933 | Ga0500658_0147074 | 3300053134 | Bacteria | 1060 |
| 934 | Ga0500559_0015190 | 3300053136 | Bacteria | 3253 |
| 935 | Ga0500568_0006709 | 3300053139 | Bacteria | 5754 |
| 936 | Ga0500568_0096636 | 3300053139 | Bacteria | 1111 |
| 937 | Ga0500573_0008543 | 3300053140 | Bacteria | 5644 |
| 938 | Ga0500588_0013956 | 3300053146 | Bacteria | 2025 |
| 939 | Ga0500588_0129991 | 3300053146 | Bacteria | 896 |
| 940 | Ga0500589_021876 | 3300053147 | Bacteria | 2937 |
| 941 | Ga0500589_042286 | 3300053147 | Bacteria | 2125 |
| 942 | Ga0500590_093943 | 3300053148 | Bacteria | 1452 |
| 943 | Ga0500603_000226 | 3300053150 | Bacteria | 14827 |
| 944 | Ga0500622_0248361 | 3300053156 | Bacteria | 782 |
| 945 | Ga0500634_0075126 | 3300053161 | Bacteria | 1758 |
| 946 | Ga0500634_0091011 | 3300053161 | Bacteria | 1548 |
| 947 | Ga0500639_048715 | 3300053163 | Bacteria | 2212 |
| 948 | Ga0500636_0013138 | 3300053177 | Bacteria | 4858 |
| 949 | Ga0500637_0003349 | 3300053178 | Bacteria | 7387 |
| 950 | Ga0500637_0165132 | 3300053178 | Bacteria | 1274 |
| 951 | Ga0500645_012764 | 3300053730 | Bacteria | 2712 |
| 952 | Ga0500596_003281 | 3300053735 | Bacteria | 3099 |
| 953 | 2507511875 | 2507262055 | Bacteria | 8048963 |
| 954 | 2508545539 | 2508501009 | Bacteria | 7784016 |
| 955 | 2508694357 | 2508501042 | Bacteria | 8719808 |
| 956 | 2513659240 | 2513237096 | Bacteria | 8722461 |
| 957 | 2513696314 | 2513237101 | Bacteria | 7952346 |
| 958 | 2513859039 | 2513237137 | Bacteria | 9558895 |
| 959 | 2513887727 | 2513237141 | Bacteria | 8496279 |
| 960 | 2513921880 | 2513237145 | Bacteria | 8979722 |
| 961 | 2515624712 | 2515154112 | Bacteria | 8294334 |
| 962 | 2517895961 | 2517572143 | Bacteria | 9484767 |
| 963 | 2671122755 | 2667528175 | Bacteria | 7532676 |
| 964 | 2723842810 | 2721755755 | Bacteria | 8322773 |
| 965 | 2728752344 | 2728368998 | Bacteria | 8720350 |
| 966 | 2793069609 | 2791355197 | Bacteria | 8420563 |
| 967 | 2793080288 | |||
| 968 | 2874592255 | 2874590934 | Bacteria | 8299676 |
| 969 | 2874606516 | 2874604998 | Bacteria | 7834745 |
| 970 | 2874647371 | 2874645413 | Bacteria | 8214782 |
| 971 | 2876774782 | 2876771140 | Bacteria | 8287509 |
| 972 | 2876809827 | 2876808645 | Bacteria | 8824342 |
| 973 | 2876819735 | 2876818435 | Bacteria | 8274608 |
| 974 | 2879079350 | 2879074833 | Bacteria | 8279565 |
| 975 | 2879113774 | 2879110137 | Bacteria | 8907982 |
| 976 | 2879129084 | 2879127579 | Bacteria | 8294491 |
| 977 | 2879144761 | 2879142872 | Bacteria | 8267021 |
| 978 | 2885382988 | 2885374607 | Bacteria | 8927485 |
| 979 | 2889033863 | 2889033259 | Bacteria | 9099371 |
| 980 | 2903756065 | 2903748898 | Bacteria | 9972761 |
| 981 | 2904699113 | 2904690495 | Bacteria | 9412302 |
| 982 | 2904707116 | |||
| 983 | 2906615569 | |||
| 984 | 2906642017 | 2906635258 | Bacteria | 8601019 |
| 985 | 2906665003 | 2906660503 | Bacteria | 8595048 |
| 986 | 2908745610 | 2908739725 | Bacteria | 8628932 |
| 987 | 2908763682 | 2908756301 | Bacteria | 8864324 |
| 988 | 2922367285 | 2922361189 | Bacteria | 7436256 |
| 989 | 2922390011 | 2922386360 | Bacteria | 7017218 |
| 990 | 2922432436 | |||
| 991 | 2935630750 | 2935630451 | Bacteria | 8169952 |
| 992 | 2935650478 | 2935648319 | Bacteria | 8801166 |
| 993 | 2935662920 | 2935656913 | Bacteria | 8965014 |
| 994 | 2935911235 | 2935908558 | Bacteria | 8568796 |
| 995 | 2935920767 | 2935916978 | Bacteria | 9113783 |
| 996 | 2935928264 | 2935926038 | Bacteria | 8601059 |
| 997 | 2935937909 | 2935934488 | Bacteria | 8602579 |
| 998 | 2935945191 | 2935942939 | Bacteria | 8599779 |
| 999 | 2935954303 | 2935951376 | Bacteria | 8602333 |
| 1000 | 2935971429 | 2935967501 | Bacteria | 8603075 |
| 1001 | 2935982049 | 2935975950 | Bacteria | 8347125 |
| 1002 | 2935990612 | 2935984226 | Bacteria | 8302647 |
| 1003 | 2936017166 | 2936011229 | Bacteria | 8801034 |
| 1004 | 2936026699 | 2936019824 | Bacteria | 8804134 |
| 1005 | 2936035442 | 2936028420 | Bacteria | 8965941 |
| 1006 | 2936053591 | 2936046547 | Bacteria | 8903709 |
| 1007 | 2936062669 | 2936055302 | Bacteria | 8785755 |
| 1008 | 2941507402 | 2941507105 | Bacteria | 8166816 |
| 1009 | 2941515829 | 2941515067 | Bacteria | 8166720 |
| 1010 | 2941523463 | 2941523033 | Bacteria | 8169134 |
| 1011 | 3005476602 | 3005474847 | Bacteria | 9259049 |
| 1012 | 8006934884 | 8006933436 | Bacteria | 10410654 |
| 1013 | 8006966127 | 8006964411 | Bacteria | 8966052 |
| 1014 | 8006974852 | 8006973647 | Bacteria | 10679141 |
| 1015 | 8006989710 | 8006984368 | Bacteria | 9651211 |
| 1016 | 8006998097 | 8006994254 | Bacteria | 8309700 |
| 1017 | 8019563775 | 8019555841 | Bacteria | 9642137 |
| 1018 | 8019573840 | 8019565922 | Bacteria | 9639779 |
| 1019 | 8019624152 | 8019619141 | Bacteria | 9218857 |
| 1020 | 8019637875 | 8019629233 | Bacteria | 8687553 |
| 1021 | 8019641749 | 8019638758 | Bacteria | 9062356 |
| 1022 | 8019665804 | 8019659431 | Bacteria | 8577854 |
| 1023 | 8019675330 | 8019668869 | Bacteria | 8791617 |
| 1024 | 8019680775 | 8019678201 | Bacteria | 8863603 |
| 1025 | 8019694993 | 8019687851 | Bacteria | 8712826 |
| 1026 | 8056675121 | 8056673599 | Bacteria | 7871253 |
| 1027 | 8056696202 | 8056689827 | Bacteria | 6712655 |
| 1028 | Ga0099795_10067720 | |||
| 1029 | JGI24032J14994_100531 | |||
| 1030 | JGI24739J22299_10000871 | |||
| 1031 | JGI24737J22298_10010529 | |||
| 1032 | JGI24750J21931_1009691 | |||
| 1033 | JGI24748J21848_1006767 | |||
| 1034 | JGI24738J21930_10002474 | |||
| 1035 | JGI24744J21845_10007283 | |||
| 1036 | JGI24744J21845_10007868 | |||
| 1037 | JGI24034J26672_10006652 | |||
| 1038 | JGI24742J22300_10003578 | |||
| 1039 | JGI25406J46586_10000064 | |||
| 1040 | JGI25404J52841_10033318 | |||
| 1041 | JGI25404J52841_10078960 | |||
| 1042 | Ga0058859_11740492 | |||
| 1043 | Ga0065715_10174306 | |||
| 1044 | Ga0065715_10565648 | |||
| 1045 | Ga0070658_10710365 | |||
| 1046 | Ga0070676_10020837 | |||
| 1047 | Ga0070683_100041896 | |||
| 1048 | Ga0070690_100226054 | |||
| 1049 | Ga0070690_100230852 | |||
| 1050 | Ga0070670_100077132 | |||
| 1051 | Ga0070670_100183096 | |||
| 1052 | Ga0068869_100021302 | |||
| 1053 | Ga0068869_100082663 | |||
| 1054 | Ga0070680_100003647 | |||
| 1055 | Ga0070680_100029856 | |||
| 1056 | Ga0070680_100121614 | |||
| 1057 | Ga0070680_100205891 | |||
| 1058 | Ga0070680_100226621 | |||
| 1059 | Ga0070682_100007969 | |||
| 1060 | Ga0068868_100138279 | |||
| 1061 | Ga0068868_100408198 | |||
| 1062 | Ga0070660_100034303 | |||
| 1063 | Ga0070660_100375198 | |||
| 1064 | Ga0070689_100031062 | |||
| 1065 | Ga0070689_100121015 | |||
| 1066 | Ga0070689_100208226 | |||
| 1067 | Ga0070689_100327516 | |||
| 1068 | Ga0070691_10004859 | |||
| 1069 | Ga0070687_100049605 | |||
| 1070 | Ga0070687_100052564 | |||
| 1071 | Ga0070661_100009866 | |||
| 1072 | Ga0070692_10045412 | |||
| 1073 | Ga0070692_10260157 | |||
| 1074 | Ga0070668_100013726 | |||
| 1075 | Ga0070668_100036445 | |||
| 1076 | Ga0070668_100067131 | |||
| 1077 | Ga0070668_100672016 | |||
| 1078 | Ga0070669_100014406 | |||
| 1079 | Ga0070669_100035084 | |||
| 1080 | Ga0070669_100093037 | |||
| 1081 | Ga0070669_100434671 | |||
| 1082 | Ga0070675_100018170 | |||
| 1083 | Ga0070675_100732289 | |||
| 1084 | Ga0070671_100034258 | |||
| 1085 | Ga0070671_100296361 | |||
| 1086 | Ga0070671_100441341 | |||
| 1087 | Ga0070674_100005693 | |||
| 1088 | Ga0070674_100047397 | |||
| 1089 | Ga0070673_100015849 | |||
| 1090 | Ga0070688_100037805 | |||
| 1091 | Ga0070688_100348498 | |||
| 1092 | Ga0070688_100381848 | |||
| 1093 | Ga0070659_100076576 | |||
| 1094 | Ga0070659_100079331 | |||
| 1095 | Ga0070659_100161364 | |||
| 1096 | Ga0070659_100374802 | |||
| 1097 | Ga0070659_100445386 | |||
| 1098 | Ga0070667_100024258 | |||
| 1099 | Ga0070667_100032997 | |||
| 1100 | Ga0070667_100731541 | |||
| 1101 | Ga0070703_10003201 | |||
| 1102 | Ga0070713_100003057 | |||
| 1103 | Ga0070713_100347891 | |||
| 1104 | Ga0070710_10106609 | |||
| 1105 | Ga0070701_10004348 | |||
| 1106 | Ga0070711_100077792 | |||
| 1107 | Ga0070711_100591894 | |||
| 1108 | Ga0070705_100023373 | |||
| 1109 | Ga0070705_100126002 | |||
| 1110 | Ga0070705_100215842 | |||
| 1111 | Ga0070700_100039431 | |||
| 1112 | Ga0070694_100019693 | |||
| 1113 | Ga0070694_100109804 | |||
| 1114 | Ga0070708_100209630 | |||
| 1115 | Ga0070708_100521341 | |||
| 1116 | Ga0070708_100767105 | |||
| 1117 | Ga0070663_100027341 | |||
| 1118 | Ga0070663_100059872 | |||
| 1119 | Ga0070663_100082344 | |||
| 1120 | Ga0070663_100679161 | |||
| 1121 | Ga0070678_100052290 | |||
| 1122 | Ga0070678_100086184 | |||
| 1123 | Ga0070662_100033312 | |||
| 1124 | Ga0070662_100071711 | |||
| 1125 | Ga0070662_100120688 | |||
| 1126 | Ga0070681_10032947 | |||
| 1127 | Ga0070681_10475268 | |||
| 1128 | Ga0068867_100021271 | |||
| 1129 | Ga0068867_100128077 | |||
| 1130 | Ga0070685_10048441 | |||
| 1131 | Ga0070706_100624318 | |||
| 1132 | Ga0070684_100022473 | |||
| 1133 | Ga0070684_100254112 | |||
| 1134 | Ga0070697_100173177 | |||
| 1135 | Ga0068853_100002207 | |||
| 1136 | Ga0068853_100003634 | |||
| 1137 | Ga0068853_100060238 | |||
| 1138 | Ga0068853_100061086 | |||
| 1139 | Ga0068853_100426138 | |||
| 1140 | Ga0070672_100006742 | |||
| 1141 | Ga0070686_100035110 | |||
| 1142 | Ga0070695_100027274 | |||
| 1143 | Ga0070696_100027513 | |||
| 1144 | Ga0070693_100024374 | |||
| 1145 | Ga0070665_100009777 | |||
| 1146 | Ga0070665_100063185 | |||
| 1147 | Ga0070665_100237840 | |||
| 1148 | Ga0070665_100360172 | |||
| 1149 | Ga0070665_100579006 | |||
| 1150 | Ga0070665_101072015 | |||
| 1151 | Ga0070704_100025802 | |||
| 1152 | Ga0070704_100208955 | |||
| 1153 | Ga0068855_100018412 | |||
| 1154 | Ga0068855_100099837 | |||
| 1155 | Ga0068855_100121549 | |||
| 1156 | Ga0070664_100069419 | |||
| 1157 | Ga0070664_100118200 | |||
| 1158 | Ga0068857_100038621 | |||
| 1159 | Ga0068857_100124799 | |||
| 1160 | Ga0068854_100016856 | |||
| 1161 | Ga0068854_100246521 | |||
| 1162 | Ga0068856_100074006 | |||
| 1163 | Ga0070702_100058574 | |||
| 1164 | Ga0070702_100091658 | |||
| 1165 | Ga0070702_100108151 | |||
| 1166 | Ga0068852_100024735 | |||
| 1167 | Ga0068852_100028928 | |||
| 1168 | Ga0068852_100135745 | |||
| 1169 | Ga0068852_100321492 | |||
| 1170 | Ga0068852_100597485 | |||
| 1171 | Ga0068859_100035913 | |||
| 1172 | Ga0068859_100096333 | |||
| 1173 | Ga0068859_100279653 | |||
| 1174 | Ga0068864_100026533 | |||
| 1175 | Ga0068864_100459111 | |||
| 1176 | Ga0068866_10100091 | |||
| 1177 | Ga0068866_10195582 | |||
| 1178 | Ga0068861_100019676 | |||
| 1179 | Ga0068861_100042474 | |||
| 1180 | Ga0068861_100048184 | |||
| 1181 | Ga0068861_100111473 | |||
| 1182 | Ga0068861_100214160 | |||
| 1183 | Ga0068851_10206447 | |||
| 1184 | Ga0068870_10026852 | |||
| 1185 | Ga0068863_100006825 | |||
| 1186 | Ga0068863_100142125 | |||
| 1187 | Ga0068858_100057433 | |||
| 1188 | Ga0068858_100079901 | |||
| 1189 | Ga0068858_100484718 | |||
| 1190 | Ga0068858_100806662 | |||
| 1191 | Ga0068860_100002033 | |||
| 1192 | Ga0068860_100018432 | |||
| 1193 | Ga0068860_100040901 | |||
| 1194 | Ga0068860_100158101 | |||
| 1195 | Ga0068860_100192601 | |||
| 1196 | Ga0068860_101373457 | |||
| 1197 | Ga0068862_100010222 | |||
| 1198 | Ga0068862_100028055 | |||
| 1199 | Ga0068862_100083389 | |||
| 1200 | Ga0068862_100342269 | |||
| 1201 | Ga0081455_10000200 | |||
| 1202 | Ga0081455_10033922 | |||
| 1203 | Ga0081455_10051904 | |||
| 1204 | Ga0081455_10091058 | |||
| 1205 | Ga0081455_10114395 | |||
| 1206 | Ga0081538_10011493 | |||
| 1207 | Ga0081540_1002062 | |||
| 1208 | Ga0081540_1004242 | |||
| 1209 | Ga0081540_1012946 | |||
| 1210 | Ga0081540_1021026 | |||
| 1211 | Ga0081540_1070985 | |||
| 1212 | Ga0081539_10000099 | |||
| 1213 | Ga0070717_10003779 | |||
| 1214 | Ga0070717_10004793 | |||
| 1215 | Ga0070717_10082660 | |||
| 1216 | Ga0075365_10012654 | |||
| 1217 | Ga0075368_10010256 | |||
| 1218 | Ga0075368_10197072 | |||
| 1219 | Ga0075363_100005067 | |||
| 1220 | Ga0075363_100011785 | |||
| 1221 | Ga0075363_100223399 | |||
| 1222 | Ga0075363_100476049 | |||
| 1223 | Ga0075364_10115711 | |||
| 1224 | Ga0075364_10263586 | |||
| 1225 | Ga0070716_100235027 | |||
| 1226 | Ga0070712_100062605 | |||
| 1227 | Ga0070712_100233934 | |||
| 1228 | Ga0075367_10013887 | |||
| 1229 | Ga0075367_10021083 | |||
| 1230 | Ga0075366_10027167 | |||
| 1231 | Ga0075366_10225549 | |||
| 1232 | Ga0075366_10284461 | |||
| 1233 | Ga0097621_100007897 | |||
| 1234 | Ga0097621_100053560 | |||
| 1235 | Ga0097621_100302683 | |||
| 1236 | Ga0075370_10003183 | |||
| 1237 | Ga0075370_10104230 | |||
| 1238 | Ga0075370_10401972 | |||
| 1239 | Ga0068871_100029425 | |||
| 1240 | Ga0075428_100300564 | |||
| 1241 | Ga0075433_10025119 | |||
| 1242 | Ga0075433_10201324 | |||
| 1243 | Ga0075434_100008091 | |||
| 1244 | Ga0075434_100021009 | |||
| 1245 | Ga0068865_100001544 | |||
| 1246 | Ga0068865_100216332 | |||
| 1247 | Ga0097620_100035916 | |||
| 1248 | Ga0097620_100096333 | |||
| 1249 | Ga0097620_100279657 | |||
| 1250 | Ga0075435_100603384 | |||
| 1251 | Ga0099795_10033214 | |||
| 1252 | Ga0099795_10235779 | |||
| 1253 | Ga0105244_10185079 | |||
| 1254 | Ga0105250_10043606 | |||
| 1255 | Ga0105250_10122793 | |||
| 1256 | Ga0105240_10012128 | |||
| 1257 | Ga0105240_10140846 | |||
| 1258 | Ga0111539_10001808 | |||
| 1259 | Ga0111539_10057213 | |||
| 1260 | Ga0111539_10739166 | |||
| 1261 | Ga0105245_10014034 | |||
| 1262 | Ga0105245_10060262 | |||
| 1263 | Ga0105245_10514256 | |||
| 1264 | Ga0105247_10087187 | |||
| 1265 | Ga0105247_10143497 | |||
| 1266 | Ga0105247_10167620 | |||
| 1267 | Ga0105243_10139000 | |||
| 1268 | Ga0105243_10162608 | |||
| 1269 | Ga0105243_10241861 | |||
| 1270 | Ga0105241_10031108 | |||
| 1271 | Ga0105241_10272783 | |||
| 1272 | Ga0105241_10649305 | |||
| 1273 | Ga0105242_10153900 | |||
| 1274 | Ga0105242_10204421 | |||
| 1275 | Ga0105248_10005933 | |||
| 1276 | Ga0105248_10011779 | |||
| 1277 | Ga0105248_10029891 | |||
| 1278 | Ga0105248_10034176 | |||
| 1279 | Ga0105237_10004719 | |||
| 1280 | Ga0105237_10007432 | |||
| 1281 | Ga0105237_10070348 | |||
| 1282 | Ga0105237_10599999 | |||
| 1283 | Ga0105238_10003421 | |||
| 1284 | Ga0105238_10436192 | |||
| 1285 | Ga0105238_10935501 | |||
| 1286 | Ga0105249_10014723 | |||
| 1287 | Ga0105249_10019871 | |||
| 1288 | Ga0105249_10528641 | |||
| 1289 | Ga0099796_10022143 | |||
| 1290 | Ga0099796_10055610 | |||
| 1291 | Ga0099796_10130836 | |||
| 1292 | Ga0105239_10023212 | |||
| 1293 | Ga0105239_10053470 | |||
| 1294 | Ga0105239_10102667 | |||
| 1295 | Ga0105239_10783691 | |||
| 1296 | Ga0105239_10797822 | |||
| 1297 | Ga0105239_11371603 | |||
| 1298 | Ga0105246_10032205 | |||
| 1299 | Ga0105246_10079330 | |||
| 1300 | Ga0105246_10597510 | |||
| 1301 | Ga0157373_10024897 | |||
| 1302 | Ga0157373_10298226 | |||
| 1303 | Ga0157370_10101962 | |||
| 1304 | Ga0157369_10065365 | |||
| 1305 | Ga0157369_10315863 | |||
| 1306 | Ga0157374_10411201 | |||
| 1307 | Ga0157378_10031566 | |||
| 1308 | Ga0157378_10086387 | |||
| 1309 | Ga0157378_10104776 | |||
| 1310 | Ga0157378_10258421 | |||
| 1311 | Ga0163162_10022234 | |||
| 1312 | Ga0163162_10053512 | |||
| 1313 | Ga0163162_10602920 | |||
| 1314 | Ga0157372_10016582 | |||
| 1315 | Ga0157372_10186079 | |||
| 1316 | Ga0157375_10084799 | |||
| 1317 | Ga0157375_10261478 | |||
| 1318 | Ga0157375_10298866 | |||
| 1319 | Ga0163163_10016805 | |||
| 1320 | Ga0163163_10226212 | |||
| 1321 | Ga0157380_10100984 | |||
| 1322 | Ga0157377_10013798 | |||
| 1323 | Ga0157379_10089794 | |||
| 1324 | Ga0157379_10153801 | |||
| 1325 | Ga0157379_10848577 | |||
| 1326 | Ga0157376_10006128 | |||
| 1327 | Ga0157376_10135746 | |||
| 1328 | Ga0157376_10217613 | |||
| 1329 | Ga0163161_10006229 | |||
| 1330 | Ga0163161_10675526 | |||
| 1331 | Ga0213876_10340105 | |||
| 1332 | Ga0213875_10034248 | |||
| 1333 | Ga0209233_1005084 | |||
| 1334 | Ga0207666_1000311 | |||
| 1335 | Ga0207673_1003304 | |||
| 1336 | Ga0209758_1001737 | |||
| 1337 | Ga0209758_1003580 | |||
| 1338 | Ga0207697_10006626 | |||
| 1339 | Ga0207653_10002805 | |||
| 1340 | Ga0207682_10000009 | |||
| 1341 | Ga0207682_10014469 | |||
| 1342 | Ga0207692_10092310 | |||
| 1343 | Ga0207642_10044313 | |||
| 1344 | Ga0207710_10002730 | |||
| 1345 | Ga0207688_10000892 | |||
| 1346 | Ga0207688_10094545 | |||
| 1347 | Ga0207647_10002160 | |||
| 1348 | Ga0207685_10406230 | |||
| 1349 | Ga0207645_10000999 | |||
| 1350 | Ga0207645_10194083 | |||
| 1351 | Ga0207643_10006739 | |||
| 1352 | Ga0207705_10522401 | |||
| 1353 | Ga0207705_10596831 | |||
| 1354 | Ga0207654_10236456 | |||
| 1355 | Ga0207654_10401528 | |||
| 1356 | Ga0207707_10002224 | |||
| 1357 | Ga0207707_10020542 | |||
| 1358 | Ga0207695_10046019 | |||
| 1359 | Ga0207671_10035416 | |||
| 1360 | Ga0207671_10064994 | |||
| 1361 | Ga0207671_10077969 | |||
| 1362 | Ga0207671_10180264 | |||
| 1363 | Ga0207693_10018708 | |||
| 1364 | Ga0207693_10205162 | |||
| 1365 | Ga0207693_10227981 | |||
| 1366 | Ga0207663_10132464 | |||
| 1367 | Ga0207663_10599911 | |||
| 1368 | Ga0207660_10001283 | |||
| 1369 | Ga0207660_10010206 | |||
| 1370 | Ga0207660_10294273 | |||
| 1371 | Ga0207662_10000025 | |||
| 1372 | Ga0207662_10037874 | |||
| 1373 | Ga0207657_10005246 | |||
| 1374 | Ga0207657_10018108 | |||
| 1375 | Ga0207657_10044766 | |||
| 1376 | Ga0207657_10546461 | |||
| 1377 | Ga0207649_10002186 | |||
| 1378 | Ga0207652_10004348 | |||
| 1379 | Ga0207652_10035191 | |||
| 1380 | Ga0207681_10007074 | |||
| 1381 | Ga0207681_10068564 | |||
| 1382 | Ga0207681_10248997 | |||
| 1383 | Ga0207694_10075578 | |||
| 1384 | Ga0207694_10082962 | |||
| 1385 | Ga0207694_10318994 | |||
| 1386 | Ga0207650_10190498 | |||
| 1387 | Ga0207650_10388174 | |||
| 1388 | Ga0207650_10669745 | |||
| 1389 | Ga0207659_10030381 | |||
| 1390 | Ga0207659_10262721 | |||
| 1391 | Ga0207687_10001197 | |||
| 1392 | Ga0207687_10002549 | |||
| 1393 | Ga0207700_10055969 | |||
| 1394 | Ga0207700_10092879 | |||
| 1395 | Ga0207700_10144687 | |||
| 1396 | Ga0207700_10469555 | |||
| 1397 | Ga0207664_10152833 | |||
| 1398 | Ga0207664_10375743 | |||
| 1399 | Ga0207664_10828401 | |||
| 1400 | Ga0207644_10036076 | |||
| 1401 | Ga0207644_10066815 | |||
| 1402 | Ga0207644_10365892 | |||
| 1403 | Ga0207690_10011755 | |||
| 1404 | Ga0207690_10310657 | |||
| 1405 | Ga0207706_10005363 | |||
| 1406 | Ga0207706_10040844 | |||
| 1407 | Ga0207706_10103304 | |||
| 1408 | Ga0207686_10001310 | |||
| 1409 | Ga0207686_10274618 | |||
| 1410 | Ga0207709_10006190 | |||
| 1411 | Ga0207709_10012682 | |||
| 1412 | Ga0207709_10688635 | |||
| 1413 | Ga0207670_10013997 | |||
| 1414 | Ga0207670_10118723 | |||
| 1415 | Ga0207670_10194202 | |||
| 1416 | Ga0207670_10406048 | |||
| 1417 | Ga0207669_10001324 | |||
| 1418 | Ga0207669_10157264 | |||
| 1419 | Ga0207669_10659658 | |||
| 1420 | Ga0207704_10003457 | |||
| 1421 | Ga0207665_10198325 | |||
| 1422 | Ga0207691_10002604 | |||
| 1423 | Ga0207691_10159553 | |||
| 1424 | Ga0207711_10031474 | |||
| 1425 | Ga0207711_10073623 | |||
| 1426 | Ga0207711_10101876 | |||
| 1427 | Ga0207711_10218792 | |||
| 1428 | Ga0207689_10001156 | |||
| 1429 | Ga0207689_10038650 | |||
| 1430 | Ga0207689_10049010 | |||
| 1431 | Ga0207689_10087744 | |||
| 1432 | Ga0207661_10007789 | |||
| 1433 | Ga0207679_10004160 | |||
| 1434 | Ga0207667_10012980 | |||
| 1435 | Ga0207667_10077987 | |||
| 1436 | Ga0207667_10095327 | |||
| 1437 | Ga0207667_10310444 | |||
| 1438 | Ga0207667_10507823 | |||
| 1439 | Ga0207667_10961565 | |||
| 1440 | Ga0207651_10087185 | |||
| 1441 | Ga0207651_10328099 | |||
| 1442 | Ga0207712_10000579 | |||
| 1443 | Ga0207712_10252552 | |||
| 1444 | Ga0207668_10001403 | |||
| 1445 | Ga0207668_10005581 | |||
| 1446 | Ga0207668_10032114 | |||
| 1447 | Ga0207668_10033457 | |||
| 1448 | Ga0207668_10079730 | |||
| 1449 | Ga0207668_10481642 | |||
| 1450 | Ga0207640_10003644 | |||
| 1451 | Ga0207658_10113485 | |||
| 1452 | Ga0207658_10359771 | |||
| 1453 | Ga0207658_10372366 | |||
| 1454 | Ga0207658_10608626 | |||
| 1455 | Ga0207658_10639432 | |||
| 1456 | Ga0207703_10014416 | |||
| 1457 | Ga0207703_10032293 | |||
| 1458 | Ga0207639_10001866 | |||
| 1459 | Ga0207639_10117459 | |||
| 1460 | Ga0207639_10128563 | |||
| 1461 | Ga0207639_10547058 | |||
| 1462 | Ga0207678_10027315 | |||
| 1463 | Ga0207678_10033660 | |||
| 1464 | Ga0207678_10042596 | |||
| 1465 | Ga0207678_10048901 | |||
| 1466 | Ga0207678_10062786 | |||
| 1467 | Ga0207678_10080462 | |||
| 1468 | Ga0207678_10080882 | |||
| 1469 | Ga0207678_10222167 | |||
| 1470 | Ga0207708_10020931 | |||
| 1471 | Ga0207708_10023687 | |||
| 1472 | Ga0207708_10050635 | |||
| 1473 | Ga0207708_10480363 | |||
| 1474 | Ga0207702_10010946 | |||
| 1475 | Ga0207702_10257067 | |||
| 1476 | Ga0207702_10359494 | |||
| 1477 | Ga0207641_10006404 | |||
| 1478 | Ga0207641_10171571 | |||
| 1479 | Ga0207641_10315377 | |||
| 1480 | Ga0207648_10004627 | |||
| 1481 | Ga0207648_10046915 | |||
| 1482 | Ga0207648_10807228 | |||
| 1483 | Ga0207676_10030863 | |||
| 1484 | Ga0207676_10282270 | |||
| 1485 | Ga0207674_10094104 | |||
| 1486 | Ga0207674_10112597 | |||
| 1487 | Ga0207674_10530319 | |||
| 1488 | Ga0207675_100003859 | |||
| 1489 | Ga0207683_10000850 | |||
| 1490 | Ga0207683_10051919 | |||
| 1491 | Ga0207683_10075790 | |||
| 1492 | Ga0207683_10176198 | |||
| 1493 | Ga0207698_10087412 | |||
| 1494 | Ga0207698_10089661 | |||
| 1495 | Ga0207698_10636350 | |||
| 1496 | Ga0209984_1018261 | |||
| 1497 | Ga0210002_1003557 | |||
| 1498 | Ga0209998_10002588 | |||
| 1499 | Ga0209813_10105597 | |||
| 1500 | Ga0209974_10003747 | |||
| 1501 | Ga0207428_10000164 | |||
| 1502 | Ga0207428_10459443 | |||
| 1503 | Ga0268266_10012217 | |||
| 1504 | Ga0268266_10013853 | |||
| 1505 | Ga0268266_10164400 | |||
| 1506 | Ga0268266_10227310 | |||
| 1507 | Ga0268266_10363782 | |||
| 1508 | Ga0268266_10559329 | |||
| 1509 | Ga0268265_10004025 | |||
| 1510 | Ga0268265_10022554 | |||
| 1511 | Ga0268265_10079812 | |||
| 1512 | Ga0268264_10000174 | |||
| 1513 | Ga0268264_10049152 | |||
| 1514 | Ga0268264_10102694 | |||
| 1515 | Ga0268264_10158236 | |||
| 1516 | Ga0268264_10756675 | |||
| 1517 | Ga0265334_10031226 | |||
| 1518 | Ga0307517_10000859 | |||
| 1519 | Ga0307511_10032093 | |||
| 1520 | Ga0307512_10244813 | |||
| 1521 | Ga0265330_10052577 | |||
| 1522 | Ga0265332_10029296 | |||
| 1523 | Ga0265325_10000019 | |||
| 1524 | Ga0265339_10303624 | |||
| 1525 | Ga0265331_10110613 | |||
| 1526 | Ga0307513_10377142 | |||
| 1527 | Ga0307509_10006398 | |||
| 1528 | Ga0307509_10082116 | |||
| 1529 | Ga0307408_100180430 | |||
| 1530 | Ga0307408_100715716 | |||
| 1531 | Ga0265313_10067069 | |||
| 1532 | Ga0265313_10117892 | |||
| 1533 | Ga0307508_10494422 | |||
| 1534 | Ga0307516_10059646 | |||
| 1535 | Ga0307516_10060402 | |||
| 1536 | Ga0307405_10595972 | |||
| 1537 | Ga0307405_11002876 | |||
| 1538 | Ga0307413_10038231 | |||
| 1539 | Ga0307413_10491927 | |||
| 1540 | Ga0307407_10258970 | |||
| 1541 | Ga0307409_100021933 | |||
| 1542 | Ga0307416_100558321 | |||
| 1543 | Ga0307415_100004684 | |||
| 1544 | Ga0307507_10028588 | |||
| 1545 | Ga0307510_10019115 | |||
| 1546 | Ga0307510_10201911 | |||
| 1547 | Ga0315911_1000040 | |||
| 1548 | Ga0316215_1000931 | |||
| 1549 | Ga0373930_0002256 | |||
| 1550 | Ga0373948_0001906 | |||
| 1551 | Ga0373950_0013019 | |||
| 1552 | Ga0373959_0008747 | |||
| 1553 | Ga0373926_0054548 | |||
| 1554 | Ga0373926_0083666 | |||
| 1555 | Ga0373929_0006845 | |||
| 1556 | Ga0373929_0007992 | |||
| 1557 | Ga0373951_0029322 | |||
| 1558 | Ga0373952_0000933 | |||
| 1559 | Ga0373923_0003867 | |||
| 1560 | Ga0373923_0021124 | |||
| 1561 | Ga0373923_0027670 | |||
| 1562 | Ga0373932_0003751 | |||
| 1563 | Ga0373936_0006062 | |||
| 1564 | Ga0373936_0179144 | |||
| 1565 | Ga0373939_0003090 | |||
| 1566 | Ga0373941_0013201 | |||
| 1567 | Ga0373953_0012482 | |||
| 1568 | Ga0373953_0018244 | |||
| 1569 | Ga0373953_0066408 | |||
| 1570 | Ga0373954_0000213 | |||
| 1571 | Ga0373954_0001219 | |||
| 1572 | Ga0373954_0008152 | |||
| 1573 | Ga0373954_0015754 | |||
| 1574 | Ga0373954_0349097 | |||
| 1575 | Ga0373956_0004720 | |||
| 1576 | Ga0373956_0112176 | |||
| 1577 | Ga0373957_0003464 | |||
| 1578 | Ga0373957_0182082 | |||
| 1579 | Ga0373960_0006476 | |||
| 1580 | Ga0373943_0005037 | |||
| 1581 | Ga0373943_0066209 | |||
| 1582 | Ga0373943_0255544 | |||
| 1583 | Ga0373955_0002049 | |||
| 1584 | Ga0373955_0012895 | |||
| 1585 | Ga0373955_0241240 | |||
| 1586 | Ga0373955_0503749 | |||
| 1587 | Ga0373942_0027318 | |||
| 1588 | Ga0373961_0036817 | |||
| 1589 | Ga0373962_0009071 | |||
| 1590 | Ga0373924_0007721 | |||
| 1591 | Ga0373924_0014698 | |||
| 1592 | Ga0373931_0002611 | |||
| 1593 | Ga0373931_0004766 | |||
| 1594 | Ga0373935_0000942 | |||
| 1595 | Ga0373935_0057406 | |||
| 1596 | Ga0373927_0000528 | |||
| 1597 | Ga0373927_0007183 | |||
| 1598 | Ga0373927_0064676 | |||
| 1599 | Ga0373927_0089359 | |||
| 1600 | Ga0373927_0202177 | |||
| 1601 | Ga0373927_0327937 | |||
| 1602 | Ga0373933_0010853 | |||
| 1603 | Ga0373933_0034817 | |||
| 1604 | Ga0373933_0112377 | |||
| 1605 | Ga0373933_0340671 | |||
| 1606 | Ga0373947_0000455 | |||
| 1607 | Ga0373947_0035994 | |||
| 1608 | Ga0373947_0039442 | |||
| 1609 | Ga0373947_0091001 | |||
| 1610 | Ga0373947_0183995 | |||
| 1611 | Ga0373947_0376258 | |||
| 1612 | Ga0373937_0004613 | |||
| 1613 | Ga0373937_0008188 | |||
| 1614 | Ga0373937_0015336 | |||
| 1615 | Ga0373937_0185926 | |||
| 1616 | Ga0373937_0485225 | |||
| 1617 | Ga0372808_023218 | |||
| 1618 | Ga0373925_0003563 | |||
| 1619 | Ga0373925_0023694 | |||
| 1620 | Ga0373925_0034269 | |||
| 1621 | Ga0373925_0081325 | |||
| 1622 | Ga0373925_0085487 | |||
| 1623 | Ga0373925_0154434 | |||
| 1624 | Ga0373925_0301832 | |||
| 1625 | Ga0373925_0466402 | |||
| 1626 | Ga0395905_0077529 | |||
| 1627 | Ga0436364_0157539 | |||
| 1628 | Ga0436364_0476354 | |||
| 1629 | Ga0436364_1289063 | |||
| 1630 | Ga0395901_0067053 | |||
| 1631 | Ga0436365_1698837 | |||
| 1632 | Ga0436363_1437817 | |||
| 1633 | Ga0439465_0132882 | |||
| 1634 | Ga0451791_0240992 | |||
| 1635 | Ga0451791_0284711 | |||
| 1636 | Ga0451791_0441720 | |||
| 1637 | Ga0451793_1400233 | |||
| 1638 | Ga0451807_0428279 | |||
| 1639 | Ga0451837_1412964 | |||
| 1640 | Ga0451853_0921849 | |||
| 1641 | Ga0451853_4011993 | |||
| 1642 | Ga0466968_0247024 | |||
| 1643 | Ga0495617_085353 | |||
| 1644 | Ga0495617_165209 | |||
| 1645 | Ga0495592_0005277 | |||
| 1646 | Ga0495592_0021465 | |||
| 1647 | Ga0495592_0032569 | |||
| 1648 | Ga0495592_0218026 | |||
| 1649 | Ga0495592_0341783 | |||
| 1650 | Ga0495603_0000239 | |||
| 1651 | Ga0495603_0009322 | |||
| 1652 | Ga0495603_0058945 | |||
| 1653 | Ga0495590_0068691 | |||
| 1654 | Ga0495629_0000457 | |||
| 1655 | Ga0495629_0007972 | |||
| 1656 | Ga0495629_0225537 | |||
| 1657 | Ga0495638_0021622 | |||
| 1658 | Ga0495638_0076101 | |||
| 1659 | Ga0495641_0002157 | |||
| 1660 | Ga0495641_0094341 | |||
| 1661 | Ga0495641_0209869 | |||
| 1662 | Ga0495651_0014000 | |||
| 1663 | Ga0495651_0037984 | |||
| 1664 | Ga0495651_0054995 | |||
| 1665 | Ga0495651_0363524 | |||
| 1666 | Ga0495653_0004257 | |||
| 1667 | Ga0495653_0009797 | |||
| 1668 | Ga0495653_0021824 | |||
| 1669 | Ga0495653_0155003 | |||
| 1670 | Ga0495650_0051594 | |||
| 1671 | Ga0495580_0002960 | |||
| 1672 | Ga0495580_0198659 | |||
| 1673 | Ga0495582_0000077 | |||
| 1674 | Ga0495639_0000101 | |||
| 1675 | Ga0495639_0095966 | |||
| 1676 | Ga0495639_0179661 | |||
| 1677 | Ga0495662_0012510 | |||
| 1678 | Ga0495662_0033507 | |||
| 1679 | Ga0495664_0005157 | |||
| 1680 | Ga0495664_0038052 | |||
| 1681 | Ga0495664_0041464 | |||
| 1682 | Ga0495664_0432353 | |||
| 1683 | Ga0495664_0530360 | |||
| 1684 | Ga0495584_0046170 | |||
| 1685 | Ga0495584_0108892 | |||
| 1686 | Ga0495585_0031320 | |||
| 1687 | Ga0495594_0000083 | |||
| 1688 | Ga0495594_0186100 | |||
| 1689 | Ga0495606_0000357 | |||
| 1690 | Ga0495606_0313024 | |||
| 1691 | Ga0495608_0000911 | |||
| 1692 | Ga0495608_0004649 | |||
| 1693 | Ga0495616_0335648 | |||
| 1694 | Ga0495618_0003586 | |||
| 1695 | Ga0495618_0014258 | |||
| 1696 | Ga0495628_0023578 | |||
| 1697 | Ga0495628_0046394 | |||
| 1698 | Ga0495628_0055320 | |||
| 1699 | Ga0495628_0062832 | |||
| 1700 | Ga0495630_0074877 | |||
| 1701 | Ga0495630_0079394 | |||
| 1702 | Ga0495630_0167276 | |||
| 1703 | Ga0495630_0268244 | |||
| 1704 | Ga0495632_0015464 | |||
| 1705 | Ga0495644_0046783 | |||
| 1706 | Ga0495666_0037457 | |||
| 1707 | Ga0495652_0021917 | |||
| 1708 | Ga0495652_0046433 | |||
| 1709 | Ga0495652_0046645 | |||
| 1710 | Ga0495652_0145338 | |||
| 1711 | Ga0495665_0000055 | |||
| 1712 | Ga0495640_0011661 | |||
| 1713 | Ga0495640_0051741 | |||
| 1714 | Ga0495640_0053786 | |||
| 1715 | Ga0495640_0169903 | |||
| 1716 | Ga0495640_0486452 | |||
| 1717 | Ga0495586_0026013 | |||
| 1718 | Ga0495586_0590969 | |||
| 1719 | Ga0495587_0005897 | |||
| 1720 | Ga0495587_0011562 | |||
| 1721 | Ga0495587_0015897 | |||
| 1722 | Ga0495587_0165550 | |||
| 1723 | Ga0495598_0005561 | |||
| 1724 | Ga0495597_0148045 | |||
| 1725 | Ga0495645_0031846 | |||
| 1726 | Ga0495645_0042847 | |||
| 1727 | Ga0495645_0061920 | |||
| 1728 | Ga0495645_0331495 | |||
| 1729 | Ga0495622_0002233 | |||
| 1730 | Ga0495622_0128327 | |||
| 1731 | Ga0495622_0162331 | |||
| 1732 | Ga0495633_0094045 | |||
| 1733 | Ga0495667_0013782 | |||
| 1734 | Ga0495667_0021423 | |||
| 1735 | Ga0495667_0023279 | |||
| 1736 | Ga0495667_0048600 | |||
| 1737 | Ga0495667_0093406 | |||
| 1738 | Ga0495656_0008262 | |||
| 1739 | Ga0495656_0308414 | |||
| 1740 | Ga0495668_0114332 | |||
| 1741 | Ga0495634_0001036 | |||
| 1742 | Ga0495611_0063779 | |||
| 1743 | Ga0495625_0592842 | |||
| 1744 | Ga0495635_0000815 | |||
| 1745 | Ga0495635_0004810 | |||
| 1746 | Ga0495635_0011194 | |||
| 1747 | Ga0495635_0029736 | |||
| 1748 | Ga0495635_0053819 | |||
| 1749 | Ga0495659_0004501 | |||
| 1750 | Ga0495588_0005058 | |||
| 1751 | Ga0495588_0005077 | |||
| 1752 | Ga0495657_0003079 | |||
| 1753 | Ga0495657_0034720 | |||
| 1754 | Ga0495657_0068646 | |||
| 1755 | Ga0495599_0001945 | |||
| 1756 | Ga0495599_0097068 | |||
| 1757 | Ga0495599_0156310 | |||
| 1758 | Ga0495623_0001015 | |||
| 1759 | Ga0495623_0020870 | |||
| 1760 | Ga0495623_0077150 | |||
| 1761 | Ga0495646_0001642 | |||
| 1762 | Ga0495646_0014188 | |||
| 1763 | Ga0495646_0113094 | |||
| 1764 | Ga0495646_0189630 | |||
| 1765 | Ga0495647_0067226 | |||
| 1766 | Ga0495658_0001572 | |||
| 1767 | Ga0495669_0002048 | |||
| 1768 | Ga0495613_0003480 | |||
| 1769 | Ga0495613_0078788 | |||
| 1770 | Ga0495613_0092005 | |||
| 1771 | Ga0495613_0168523 | |||
| 1772 | Ga0495613_0660189 | |||
| 1773 | Ga0495624_0000235 | |||
| 1774 | Ga0495624_0050807 | |||
| 1775 | Ga0495624_0179546 | |||
| 1776 | Ga0495670_0192981 | |||
| 1777 | Ga0495671_0061334 | |||
| 1778 | Ga0495589_0184650 | |||
| 1779 | Ga0495600_0012719 | |||
| 1780 | Ga0495600_0015287 | |||
| 1781 | Ga0495600_0245824 | |||
| 1782 | Ga0495600_0339237 | |||
| 1783 | Ga0495600_0344774 | |||
| 1784 | Ga0495600_0574508 | |||
| 1785 | Ga0495581_0000041 | |||
| 1786 | Ga0495581_0196067 | |||
| 1787 | Ga0495604_0007221 | |||
| 1788 | Ga0495604_0272830 | |||
| 1789 | Ga0495674_0028002 | |||
| 1790 | Ga0495674_0036100 | |||
| 1791 | Ga0495674_0602898 | |||
| 1792 | Ga0495676_0018550 | |||
| 1793 | Ga0495680_0017765 | |||
| 1794 | Ga0495680_0028245 | |||
| 1795 | Ga0495680_0154374 | |||
| 1796 | Ga0495680_0414882 | |||
| 1797 | Ga0495675_0025398 | |||
| 1798 | Ga0495675_0048080 | |||
| 1799 | Ga0495677_0151369 | |||
| 1800 | Ga0495679_093047 | |||
| 1801 | Ga0495673_0025589 | |||
| 1802 | Ga0495684_0001399 | |||
| 1803 | Ga0495684_0028335 | |||
| 1804 | Ga0495684_0405869 | |||
| 1805 | Ga0495686_0224071 | |||
| 1806 | Ga0495593_0000024 | |||
| 1807 | Ga0495593_0004938 | |||
| 1808 | Ga0495593_0019588 | |||
| 1809 | Ga0495602_0019419 | |||
| 1810 | Ga0495602_0035012 | |||
| 1811 | Ga0495602_0067291 | |||
| 1812 | Ga0495626_0219016 | |||
| 1813 | Ga0496100_0032123 | |||
| 1814 | Ga0496100_0084124 | |||
| 1815 | Ga0496100_0301201 | |||
| 1816 | Ga0496100_0552808 | |||
| 1817 | Ga0496101_0002275 | |||
| 1818 | Ga0496101_0017665 | |||
| 1819 | Ga0496101_0257139 | |||
| 1820 | Ga0496101_0290603 | |||
| 1821 | Ga0496101_0475822 | |||
| 1822 | Ga0496102_0015668 | |||
| 1823 | Ga0496102_0022366 | |||
| 1824 | Ga0496102_0076164 | |||
| 1825 | Ga0496102_0286670 | |||
| 1826 | Ga0496102_0414593 | |||
| 1827 | Ga0496103_0019772 | |||
| 1828 | Ga0496103_0026671 | |||
| 1829 | Ga0496103_0413174 | |||
| 1830 | Ga0496104_0047895 | |||
| 1831 | Ga0496104_0088890 | |||
| 1832 | Ga0496104_0121736 | |||
| 1833 | Ga0496104_0135420 | |||
| 1834 | Ga0496104_0249235 | |||
| 1835 | Ga0496104_0353360 | |||
| 1836 | Ga0496105_0012396 | |||
| 1837 | Ga0496105_0292958 | |||
| 1838 | Ga0496105_0827525 | |||
| 1839 | Ga0496106_0003446 | |||
| 1840 | Ga0496106_0039727 | |||
| 1841 | Ga0496106_0058706 | |||
| 1842 | Ga0496106_0103687 | |||
| 1843 | Ga0496106_0147996 | |||
| 1844 | Ga0496106_0149447 | |||
| 1845 | Ga0496106_0267929 | |||
| 1846 | Ga0496106_0299272 | |||
| 1847 | Ga0496107_0000509 | |||
| 1848 | Ga0496107_0021914 | |||
| 1849 | Ga0496107_0055248 | |||
| 1850 | Ga0496107_0159541 | |||
| 1851 | Ga0496107_0184967 | |||
| 1852 | Ga0496107_0210648 | |||
| 1853 | Ga0496107_0397163 | |||
| 1854 | Ga0496108_0031275 | |||
| 1855 | Ga0496108_0043219 | |||
| 1856 | Ga0496108_0150590 | |||
| 1857 | Ga0496109_0026994 | |||
| 1858 | Ga0496109_0063752 | |||
| 1859 | Ga0496109_0170543 | |||
| 1860 | Ga0496109_0207049 | |||
| 1861 | Ga0496109_0241523 | |||
| 1862 | Ga0496109_0273602 | |||
| 1863 | Ga0496109_0995085 | |||
| 1864 | Ga0496110_0033752 | |||
| 1865 | Ga0496110_0130718 | |||
| 1866 | Ga0496110_0313674 | |||
| 1867 | Ga0496110_0703311 | |||
| 1868 | Ga0496110_0799685 | |||
| 1869 | Ga0496110_0920507 | |||
| 1870 | Ga0496111_0024753 | |||
| 1871 | Ga0496111_0039292 | |||
| 1872 | Ga0496111_0233770 | |||
| 1873 | Ga0496111_0348952 | |||
| 1874 | Ga0496111_0510088 | |||
| 1875 | Ga0496112_0012715 | |||
| 1876 | Ga0496112_0048594 | |||
| 1877 | Ga0496112_0086667 | |||
| 1878 | Ga0496112_0252685 | |||
| 1879 | Ga0496112_0284141 | |||
| 1880 | Ga0496113_0002503 | |||
| 1881 | Ga0496113_0008294 | |||
| 1882 | Ga0496113_0056499 | |||
| 1883 | Ga0496113_0057698 | |||
| 1884 | Ga0496113_0533929 | |||
| 1885 | Ga0496114_0009294 | |||
| 1886 | Ga0496114_0048418 | |||
| 1887 | Ga0496114_0079135 | |||
| 1888 | Ga0496114_0401699 | |||
| 1889 | Ga0496115_0045511 | |||
| 1890 | Ga0496115_0059345 | |||
| 1891 | Ga0496115_0106674 | |||
| 1892 | Ga0496115_0133773 | |||
| 1893 | Ga0496115_0266420 | |||
| 1894 | Ga0496117_0238499 | |||
| 1895 | Ga0496119_0047619 | |||
| 1896 | Ga0496121_0000927 | |||
| 1897 | Ga0496121_0095423 | |||
| 1898 | Ga0496121_0151137 | |||
| 1899 | Ga0496121_0203641 | |||
| 1900 | Ga0496124_0233805 | |||
| 1901 | Ga0496126_0060792 | |||
| 1902 | Ga0496126_0082014 | |||
| 1903 | Ga0496126_0378771 | |||
| 1904 | Ga0496126_0570173 | |||
| 1905 | Ga0496126_0726628 | |||
| 1906 | Ga0501032_0139342 | |||
| 1907 | Ga0501043_0280819 | |||
| 1908 | Ga0501046_0060334 | |||
| 1909 | Ga0501047_0014411 | |||
| 1910 | Ga0501067_0039577 | |||
| 1911 | Ga0501070_0006598 | |||
| 1912 | Ga0501044_0005514 | |||
| 1913 | Ga0501044_0209640 | |||
| 1914 | nmdc:mga00v17_297583_c1 | |||
| 1915 | nmdc:mga0yw44_13282_c1 | |||
| 1916 | nmdc:mga0yw44_168291_c1 | |||
| 1917 | nmdc:mga0yw44_211928_c1 | |||
| 1918 | nmdc:mga0yw44_285890_c1 | |||
| 1919 | nmdc:mga0k408_292622_c1 | |||
| 1920 | nmdc:mga06z11_151224_c1 | |||
| 1921 | nmdc:mga06z11_45147_c1 | |||
| 1922 | nmdc:mga06z11_84370_c1 | |||
| 1923 | nmdc:mga04h51_9301_c1 | |||
| 1924 | nmdc:mga07m45_8848_c1 | |||
| 1925 | nmdc:mga07m45_94518_c1 | |||
| 1926 | nmdc:mga08y16_108_c1 | |||
| 1927 | nmdc:mga08y16_191984_c1 | |||
| 1928 | nmdc:mga08y16_366135_c1 | |||
| 1929 | nmdc:mga0n895_121255_c1 | |||
| 1930 | nmdc:mga0n895_216385_c1 | |||
| 1931 | nmdc:mga0n895_37633_c1 | |||
| 1932 | nmdc:mga0rr50_537400_c1 | |||
| 1933 | nmdc:mga08x19_396636_c1 | |||
| 1934 | nmdc:mga0a205_1049_c1 | |||
| 1935 | nmdc:mga0a205_206208_c1 | |||
| 1936 | nmdc:mga0sz30_114689_c1 | |||
| 1937 | Ga0495601_0009169 | |||
| 1938 | Ga0495601_0141831 | |||
| 1939 | Ga0495601_0173060 | |||
| 1940 | Ga0495601_0249003 | |||
| 1941 | Ga0495601_0250303 | |||
| 1942 | Ga0495612_0193999 | |||
| 1943 | Ga0500635_0001974 | |||
| 1944 | Ga0500635_0031249 | |||
| 1945 | Ga0495595_0000554 | |||
| 1946 | Ga0495595_0000637 | |||
| 1947 | Ga0495619_0001080 | |||
| 1948 | Ga0495619_0425381 | |||
| 1949 | Ga0500578_0445488 | |||
| 1950 | Ga0500647_0195221 | |||
| 1951 | Ga0500583_0009184 | |||
| 1952 | Ga0500583_0051691 | |||
| 1953 | Ga0500641_0005024 | |||
| 1954 | Ga0500641_0024967 | |||
| 1955 | Ga0500641_0133006 | |||
| 1956 | Ga0500648_100720 | |||
| 1957 | Ga0500595_001951 | |||
| 1958 | Ga0500595_026055 | |||
| 1959 | Ga0500658_0145563 | |||
| 1960 | Ga0500658_0147074 | |||
| 1961 | Ga0500559_0015190 | |||
| 1962 | Ga0500568_0006709 | |||
| 1963 | Ga0500568_0096636 | |||
| 1964 | Ga0500573_0008543 | |||
| 1965 | Ga0500588_0013956 | |||
| 1966 | Ga0500588_0129991 | |||
| 1967 | Ga0500589_021876 | |||
| 1968 | Ga0500589_042286 | |||
| 1969 | Ga0500590_093943 | |||
| 1970 | Ga0500603_000226 | |||
| 1971 | Ga0500622_0248361 | |||
| 1972 | Ga0500634_0075126 | |||
| 1973 | Ga0500634_0091011 | |||
| 1974 | Ga0500639_048715 | |||
| 1975 | Ga0500636_0013138 | |||
| 1976 | Ga0500637_0003349 | |||
| 1977 | Ga0500637_0165132 | |||
| 1978 | Ga0500645_012764 | |||
| 1979 | Ga0500596_003281 | |||
| 1980 | 2507511875 | |||
| 1981 | 2508545539 | |||
| 1982 | 2508694357 | |||
| 1983 | 2513659240 | |||
| 1984 | 2513696314 | |||
| 1985 | 2513859039 | |||
| 1986 | 2513887727 | |||
| 1987 | 2513921880 | |||
| 1988 | 2515624712 | |||
| 1989 | 2517895961 | |||
| 1990 | 2671122755 | |||
| 1991 | 2723842810 | |||
| 1992 | 2728752344 | |||
| 1993 | 2793069609 | |||
| 1994 | 2793080288 | |||
| 1995 | 2874592255 | |||
| 1996 | 2874606516 | |||
| 1997 | 2874647371 | |||
| 1998 | 2876774782 | |||
| 1999 | 2876809827 | |||
| 2000 | 2876819735 | |||
| 2001 | 2879079350 | |||
| 2002 | 2879113774 | |||
| 2003 | 2879129084 | |||
| 2004 | 2879144761 | |||
| 2005 | 2885382988 | |||
| 2006 | 2889033863 | |||
| 2007 | 2903756065 | |||
| 2008 | 2904699113 | |||
| 2009 | 2904707116 | |||
| 2010 | 2906615569 | |||
| 2011 | 2906642017 | |||
| 2012 | 2906665003 | |||
| 2013 | 2908745610 | |||
| 2014 | 2908763682 | |||
| 2015 | 2922367285 | |||
| 2016 | 2922390011 | |||
| 2017 | 2922432436 | |||
| 2018 | 2935630750 | |||
| 2019 | 2935650478 | |||
| 2020 | 2935662920 | |||
| 2021 | 2935911235 | |||
| 2022 | 2935920767 | |||
| 2023 | 2935928264 | |||
| 2024 | 2935937909 | |||
| 2025 | 2935945191 | |||
| 2026 | 2935954303 | |||
| 2027 | 2935971429 | |||
| 2028 | 2935982049 | |||
| 2029 | 2935990612 | |||
| 2030 | 2936017166 | |||
| 2031 | 2936026699 | |||
| 2032 | 2936035442 | |||
| 2033 | 2936053591 | |||
| 2034 | 2936062669 | |||
| 2035 | 2941507402 | |||
| 2036 | 2941515829 | |||
| 2037 | 2941523463 | |||
| 2038 | 3005476602 | |||
| 2039 | 8006934884 | |||
| 2040 | 8006966127 | |||
| 2041 | 8006974852 | |||
| 2042 | 8006989710 | |||
| 2043 | 8006998097 | |||
| 2044 | 8019563775 | |||
| 2045 | 8019573840 | |||
| 2046 | 8019624152 | |||
| 2047 | 8019637875 | |||
| 2048 | 8019641749 | |||
| 2049 | 8019665804 | |||
| 2050 | 8019675330 | |||
| 2051 | 8019680775 | |||
| 2052 | 8019694993 | |||
| 2053 | 8056675121 | |||
| 2054 | 8056696202 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8eug-assembly1.cif.gz_n | ytm1 associated nascent 60s ribosome state 3 | 0.8696 | 113 | 139 |
| 8eui-assembly1.cif.gz_n | ytm1 associated nascent 60s ribosome (-fkbp39) state 3 | 0.8689 | 113 | 139 |
| 8ev3-assembly1.cif.gz_n | ytm1 associated 60s nascent ribosome (-fkbp39) state 1b | 0.862 | 113 | 141 |
| 8etg-assembly1.cif.gz_n | fkbp39 associated 60s nascent ribosome state 3 | 0.8451 | 113 | 141 |
| 8fku-assembly1.cif.gz_SM | human nucleolar pre-60s ribosomal subunit (state c2) | 0.8448 | 113 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IBZ4_29_132_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8355 | 12 | 44 | 2.40.50.140 |
| af_A0A1D6MPP2_1_86_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8338 | 12 | 42 | 2.40.50.140 |
| af_M9PDL2_134_240_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7685 | 12 | 48 | 2.40.50.140 |
| 5xyiE03 | Mainly Beta;Roll;SH3 type barrels.; | 0.7563 | 110 | 137 | 2.30.30.30 |
| af_Q8I262_123_205_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.7468 | 14 | 42 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P9H572-F1-model_v4 | DUF5666 domain-containing protein | 0.9584 | 15 | 188 |
|
| AF-A0A2S5TVB9-F1-model_v4 | deleted | 0.947 | 16 | 189 |
|
| AF-A0A2P9H572-F1-model_v4 | DUF5666 domain-containing protein | 0.9426 | 15 | 188 |
|
| AF-L2EHC2-F1-model_v4 | deleted | 0.9382 | 6 | 188 |
|
| AF-A0A537QAT7-F1-model_v4 | DUF5666 domain-containing protein | 0.937 | 12 | 188 |
|