F488533

General Info

Members Datasets Scaffolds Average Seq Length
1027 493 2054 201

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10067720|Ga0099795_100677202
Length 228
Sequence VFFPLPANTRERGKTMPEISSLMRRAVAAALTLSVLASSVLASVGWAQQPPPVRIRGTIESVDGAMLMIKSREGTDMKVRVTDNVAVFGVAKTEMSEIKPGSYIGVSAMPEPDGTQKALAVHIFPETQRGAAEGFRPWDLRPNSTMTNATVAETVKGTDGQNILVKYKDGEKKVVVPPDTPIVTFVAGDKSELKPGAKIIIFGAVKKDDGTLEANRVNVGRDGITPPM

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
206 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
214 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
215 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
224 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
235 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
236 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
237 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
238 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
239 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
240 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
241 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
242 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
243 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
246 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
248 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
249 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
250 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
251 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
252 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
253 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
254 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
255 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
256 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
257 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
258 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
259 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
260 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
261 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
263 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
266 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
269 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
273 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
274 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
275 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
276 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
277 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
278 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
279 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
280 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
300 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
306 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
317 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
318 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
319 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
320 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
321 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
322 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
323 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
324 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
325 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
326 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
327 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
328 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
329 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
330 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
335 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
336 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
337 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
342 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
345 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
346 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
347 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
350 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
351 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
352 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
359 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
360 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
361 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
362 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
363 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
364 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
365 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
366 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
367 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
368 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
371 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
372 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
379 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
382 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
383 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
384 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
385 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
386 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
387 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
388 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
389 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
399 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
400 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
401 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
402 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
403 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
404 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
405 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
406 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
407 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
408 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
409 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
410 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
411 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
412 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
413 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
414 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
415 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
416 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
417 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
418 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
419 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
420 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
421 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
422 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
423 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
424 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
425 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
426 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
427 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
428 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
429 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
430 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
431 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
432 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
433 2791355199
434 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
435 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
436 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
437 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
438 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
439 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
440 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
441 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
442 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
443 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
444 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
445 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
446 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
447 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
448 2904699407
449 2906610324
450 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
451 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
452 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
453 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
454 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
455 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
456 2922425934
457 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
458 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
459 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
460 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
461 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
462 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
463 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
464 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
465 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
466 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
467 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
468 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
469 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
470 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
471 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
472 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
473 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
474 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
475 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
476 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
477 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
478 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
479 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
480 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
481 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
482 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
483 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
484 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
485 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
486 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
487 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
488 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
489 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
490 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
491 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
492 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
493 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0.2
Isolates 6.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.52
Nodule 6.23
Rhizoplane 8.47
Rhizosphere 74.1
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10067720 3300007788 Bacteria 1340
2 JGI24032J14994_100531 3300001430 Bacteria 2004
3 JGI24739J22299_10000871 3300001989 Bacteria 11154
4 JGI24737J22298_10010529 3300001990 Bacteria 3050
5 JGI24750J21931_1009691 3300002070 Bacteria 1244
6 JGI24748J21848_1006767 3300002074 Bacteria 1338
7 JGI24738J21930_10002474 3300002075 Bacteria 4827
8 JGI24744J21845_10007283 3300002077 Bacteria 2286
9 JGI24744J21845_10007868 3300002077 Bacteria 2201
10 JGI24034J26672_10006652 3300002239 Bacteria 1669
11 JGI24742J22300_10003578 3300002244 Bacteria 2525
12 JGI25406J46586_10000064 3300003203 Bacteria 49110
13 JGI25404J52841_10033318 3300003659 Bacteria 1098
14 JGI25404J52841_10078960 3300003659 Bacteria 687
15 Ga0058859_11740492 3300004798 Bacteria 739
16 Ga0065715_10174306 3300005293 Bacteria 1523
17 Ga0065715_10565648 3300005293 Bacteria 730
18 Ga0070658_10710365 3300005327 Bacteria 873
19 Ga0070676_10020837 3300005328 Bacteria 3665
20 Ga0070683_100041896 3300005329 Bacteria 4215
21 Ga0070690_100226054 3300005330 Bacteria 1313
22 Ga0070690_100230852 3300005330 Bacteria 1301
23 Ga0070670_100077132 3300005331 Bacteria 2863
24 Ga0070670_100183096 3300005331 Bacteria 1819
25 Ga0068869_100021302 3300005334 Bacteria 4458
26 Ga0068869_100082663 3300005334 Bacteria 2400
27 Ga0070680_100003647 3300005336 Bacteria 11501
28 Ga0070680_100029856 3300005336 Bacteria 4377
29 Ga0070680_100121614 3300005336 Bacteria 2180
30 Ga0070680_100205891 3300005336 Bacteria 1659
31 Ga0070680_100226621 3300005336 Bacteria 1578
32 Ga0070682_100007969 3300005337 Bacteria 5962
33 Ga0068868_100138279 3300005338 Bacteria 1998
34 Ga0068868_100408198 3300005338 Bacteria 1173
35 Ga0070660_100034303 3300005339 Bacteria 3833
36 Ga0070660_100375198 3300005339 Bacteria 1174
37 Ga0070689_100031062 3300005340 Bacteria 4058
38 Ga0070689_100121015 3300005340 Bacteria 2091
39 Ga0070689_100208226 3300005340 Unclassified 1600
40 Ga0070689_100327516 3300005340 Bacteria 1281
41 Ga0070691_10004859 3300005341 Bacteria 6121
42 Ga0070687_100049605 3300005343 Bacteria 2164
43 Ga0070687_100052564 3300005343 Bacteria 2115
44 Ga0070661_100009866 3300005344 Bacteria 6624
45 Ga0070692_10045412 3300005345 Bacteria 2266
46 Ga0070692_10260157 3300005345 Bacteria 1043
47 Ga0070668_100013726 3300005347 Bacteria 6051
48 Ga0070668_100036445 3300005347 Bacteria 3754
49 Ga0070668_100067131 3300005347 Bacteria 2785
50 Ga0070668_100672016 3300005347 Bacteria 911
51 Ga0070669_100014406 3300005353 Bacteria 5628
52 Ga0070669_100035084 3300005353 Bacteria 3633
53 Ga0070669_100093037 3300005353 Bacteria 2264
54 Ga0070669_100434671 3300005353 Bacteria 1079
55 Ga0070675_100018170 3300005354 Bacteria 5596
56 Ga0070675_100732289 3300005354 Bacteria 902
57 Ga0070671_100034258 3300005355 Bacteria 4203
58 Ga0070671_100296361 3300005355 Bacteria 1377
59 Ga0070671_100441341 3300005355 Bacteria 1116
60 Ga0070674_100005693 3300005356 Bacteria 7227
61 Ga0070674_100047397 3300005356 Bacteria 2944
62 Ga0070673_100015849 3300005364 Bacteria 5308
63 Ga0070688_100037805 3300005365 Bacteria 2943
64 Ga0070688_100348498 3300005365 Bacteria 1084
65 Ga0070688_100381848 3300005365 Bacteria 1039
66 Ga0070659_100076576 3300005366 Bacteria 2667
67 Ga0070659_100079331 3300005366 Bacteria 2620
68 Ga0070659_100161364 3300005366 Bacteria 1833
69 Ga0070659_100374802 3300005366 Bacteria 1198
70 Ga0070659_100445386 3300005366 Bacteria 1098
71 Ga0070667_100024258 3300005367 Bacteria 5037
72 Ga0070667_100032997 3300005367 Bacteria 4322
73 Ga0070667_100731541 3300005367 Bacteria 916
74 Ga0070703_10003201 3300005406 Bacteria 4676
75 Ga0070713_100003057 3300005436 Bacteria 10992
76 Ga0070713_100347891 3300005436 Unclassified 1375
77 Ga0070710_10106609 3300005437 Bacteria 1677
78 Ga0070701_10004348 3300005438 Bacteria 5724
79 Ga0070711_100077792 3300005439 Bacteria 2355
80 Ga0070711_100591894 3300005439 Bacteria 924
81 Ga0070705_100023373 3300005440 Bacteria 3318
82 Ga0070705_100126002 3300005440 Bacteria 1662
83 Ga0070705_100215842 3300005440 Unclassified 1325
84 Ga0070700_100039431 3300005441 Bacteria 2885
85 Ga0070694_100019693 3300005444 Bacteria 4294
86 Ga0070694_100109804 3300005444 Bacteria 1963
87 Ga0070708_100209630 3300005445 Bacteria 1826
88 Ga0070708_100521341 3300005445 Bacteria 1121
89 Ga0070708_100767105 3300005445 Bacteria 907
90 Ga0070663_100027341 3300005455 Bacteria 3873
91 Ga0070663_100059872 3300005455 Bacteria 2737
92 Ga0070663_100082344 3300005455 Bacteria 2367
93 Ga0070663_100679161 3300005455 Bacteria 873
94 Ga0070678_100052290 3300005456 Bacteria 2965
95 Ga0070678_100086184 3300005456 Bacteria 2395
96 Ga0070662_100033312 3300005457 Bacteria 3626
97 Ga0070662_100071711 3300005457 Bacteria 2555
98 Ga0070662_100120688 3300005457 Bacteria 2009
99 Ga0070681_10032947 3300005458 Bacteria 5201
100 Ga0070681_10475268 3300005458 Bacteria 1162
101 Ga0068867_100021271 3300005459 Bacteria 4629
102 Ga0068867_100128077 3300005459 Bacteria 1969
103 Ga0070685_10048441 3300005466 Bacteria 2447
104 Ga0070706_100624318 3300005467 Bacteria 1001
105 Ga0070684_100022473 3300005535 Bacteria 5261
106 Ga0070684_100254112 3300005535 Bacteria 1606
107 Ga0070697_100173177 3300005536 Bacteria 1827
108 Ga0068853_100002207 3300005539 Bacteria 14542
109 Ga0068853_100003634 3300005539 Bacteria 11828
110 Ga0068853_100060238 3300005539 Bacteria 3279
111 Ga0068853_100061086 3300005539 Bacteria 3259
112 Ga0068853_100426138 3300005539 Bacteria 1245
113 Ga0070672_100006742 3300005543 Bacteria 7744
114 Ga0070686_100035110 3300005544 Bacteria 3094
115 Ga0070695_100027274 3300005545 Bacteria 3537
116 Ga0070696_100027513 3300005546 Bacteria 3875
117 Ga0070693_100024374 3300005547 Bacteria 3244
118 Ga0070665_100009777 3300005548 Bacteria 9699
119 Ga0070665_100063185 3300005548 Bacteria 3712
120 Ga0070665_100237840 3300005548 Bacteria 1822
121 Ga0070665_100360172 3300005548 Bacteria 1460
122 Ga0070665_100579006 3300005548 Bacteria 1135
123 Ga0070665_101072015 3300005548 Bacteria 817
124 Ga0070704_100025802 3300005549 Bacteria 3873
125 Ga0070704_100208955 3300005549 Bacteria 1580
126 Ga0068855_100018412 3300005563 Bacteria 8391
127 Ga0068855_100099837 3300005563 Bacteria 3343
128 Ga0068855_100121549 3300005563 Bacteria 2988
129 Ga0070664_100069419 3300005564 Bacteria 3015
130 Ga0070664_100118200 3300005564 Bacteria 2319
131 Ga0068857_100038621 3300005577 Bacteria 4228
132 Ga0068857_100124799 3300005577 Bacteria 2319
133 Ga0068854_100016856 3300005578 Bacteria 4878
134 Ga0068854_100246521 3300005578 Bacteria 1425
135 Ga0068856_100074006 3300005614 Bacteria 3372
136 Ga0070702_100058574 3300005615 Bacteria 2232
137 Ga0070702_100091658 3300005615 Unclassified 1844
138 Ga0070702_100108151 3300005615 Bacteria 1718
139 Ga0068852_100024735 3300005616 Bacteria 4858
140 Ga0068852_100028928 3300005616 Bacteria 4543
141 Ga0068852_100135745 3300005616 Bacteria 2271
142 Ga0068852_100321492 3300005616 Bacteria 1503
143 Ga0068852_100597485 3300005616 Bacteria 1107
144 Ga0068859_100035913 3300005617 Bacteria 4973
145 Ga0068859_100096333 3300005617 Bacteria 3012
146 Ga0068859_100279653 3300005617 Bacteria 1761
147 Ga0068864_100026533 3300005618 Bacteria 4885
148 Ga0068864_100459111 3300005618 Bacteria 1219
149 Ga0068866_10100091 3300005718 Bacteria 1597
150 Ga0068866_10195582 3300005718 Unclassified 1204
151 Ga0068861_100019676 3300005719 Bacteria 4823
152 Ga0068861_100042474 3300005719 Bacteria 3407
153 Ga0068861_100048184 3300005719 Bacteria 3220
154 Ga0068861_100111473 3300005719 Bacteria 2192
155 Ga0068861_100214160 3300005719 Bacteria 1624
156 Ga0068851_10206447 3300005834 Bacteria 1099
157 Ga0068870_10026852 3300005840 Bacteria 2874
158 Ga0068863_100006825 3300005841 Bacteria 11196
159 Ga0068863_100142125 3300005841 Bacteria 2294
160 Ga0068858_100057433 3300005842 Bacteria 3597
161 Ga0068858_100079901 3300005842 Bacteria 3038
162 Ga0068858_100484718 3300005842 Bacteria 1194
163 Ga0068858_100806662 3300005842 Unclassified 916
164 Ga0068860_100002033 3300005843 Bacteria 21319
165 Ga0068860_100018432 3300005843 Bacteria 6790
166 Ga0068860_100040901 3300005843 Bacteria 4429
167 Ga0068860_100158101 3300005843 Bacteria 2184
168 Ga0068860_100192601 3300005843 Bacteria 1973
169 Ga0068860_101373457 3300005843 Bacteria 728
170 Ga0068862_100010222 3300005844 Bacteria 7743
171 Ga0068862_100028055 3300005844 Bacteria 4741
172 Ga0068862_100083389 3300005844 Bacteria 2775
173 Ga0068862_100342269 3300005844 Bacteria 1385
174 Ga0081455_10000200 3300005937 Bacteria 76013
175 Ga0081455_10033922 3300005937 Bacteria 4579
176 Ga0081455_10051904 3300005937 Bacteria 3515
177 Ga0081455_10091058 3300005937 Bacteria 2471
178 Ga0081455_10114395 3300005937 Bacteria 2138
179 Ga0081538_10011493 3300005981 Bacteria 7167
180 Ga0081540_1002062 3300005983 Bacteria 16766
181 Ga0081540_1004242 3300005983 Bacteria 11009
182 Ga0081540_1012946 3300005983 Bacteria 5450
183 Ga0081540_1021026 3300005983 Bacteria 3904
184 Ga0081540_1070985 3300005983 Bacteria 1611
185 Ga0081539_10000099 3300005985 Bacteria 201018
186 Ga0070717_10003779 3300006028 Bacteria 10878
187 Ga0070717_10004793 3300006028 Bacteria 9837
188 Ga0070717_10082660 3300006028 Bacteria 2699
189 Ga0075365_10012654 3300006038 Bacteria 5020
190 Ga0075368_10010256 3300006042 Bacteria 3384
191 Ga0075368_10197072 3300006042 Bacteria 852
192 Ga0075363_100005067 3300006048 Bacteria 5827
193 Ga0075363_100011785 3300006048 Bacteria 4195
194 Ga0075363_100223399 3300006048 Bacteria 1080
195 Ga0075363_100476049 3300006048 Bacteria 740
196 Ga0075364_10115711 3300006051 Bacteria 1792
197 Ga0075364_10263586 3300006051 Bacteria 1171
198 Ga0070716_100235027 3300006173 Bacteria 1240
199 Ga0070712_100062605 3300006175 Bacteria 2631
200 Ga0070712_100233934 3300006175 Bacteria 1461
201 Ga0075367_10013887 3300006178 Bacteria 4344
202 Ga0075367_10021083 3300006178 Bacteria 3638
203 Ga0075366_10027167 3300006195 Bacteria 3357
204 Ga0075366_10225549 3300006195 Bacteria 1141
205 Ga0075366_10284461 3300006195 Bacteria 1011
206 Ga0097621_100007897 3300006237 Bacteria 7631
207 Ga0097621_100053560 3300006237 Bacteria 3289
208 Ga0097621_100302683 3300006237 Bacteria 1412
209 Ga0075370_10003183 3300006353 Bacteria 7771
210 Ga0075370_10104230 3300006353 Bacteria 1643
211 Ga0075370_10401972 3300006353 Bacteria 822
212 Ga0068871_100029425 3300006358 Bacteria 4314
213 Ga0075428_100300564 3300006844 Bacteria 1725
214 Ga0075433_10025119 3300006852 Bacteria 5036
215 Ga0075433_10201324 3300006852 Bacteria 1770
216 Ga0075434_100008091 3300006871 Bacteria 9750
217 Ga0075434_100021009 3300006871 Bacteria 6341
218 Ga0068865_100001544 3300006881 Bacteria 13429
219 Ga0068865_100216332 3300006881 Bacteria 1496
220 Ga0097620_100035916 3300006931 Bacteria 4973
221 Ga0097620_100096333 3300006931 Bacteria 3012
222 Ga0097620_100279657 3300006931 Bacteria 1761
223 Ga0075435_100603384 3300007076 Unclassified 952
224 Ga0099795_10033214 3300007788 Bacteria 1790
225 Ga0099795_10235779 3300007788 Bacteria 784
226 Ga0105244_10185079 3300009036 Bacteria 987
227 Ga0105250_10043606 3300009092 Bacteria 1798
228 Ga0105250_10122793 3300009092 Bacteria 1069
229 Ga0105240_10012128 3300009093 Bacteria 11932
230 Ga0105240_10140846 3300009093 Bacteria 2884
231 Ga0111539_10001808 3300009094 Bacteria 28479
232 Ga0111539_10057213 3300009094 Bacteria 4631
233 Ga0111539_10739166 3300009094 Bacteria 1145
234 Ga0105245_10014034 3300009098 Bacteria 6976
235 Ga0105245_10060262 3300009098 Bacteria 3418
236 Ga0105245_10514256 3300009098 Bacteria 1215
237 Ga0105247_10087187 3300009101 Bacteria 1976
238 Ga0105247_10143497 3300009101 Bacteria 1567
239 Ga0105247_10167620 3300009101 Bacteria 1458
240 Ga0105243_10139000 3300009148 Bacteria 2070
241 Ga0105243_10162608 3300009148 Bacteria 1926
242 Ga0105243_10241861 3300009148 Bacteria 1607
243 Ga0105241_10031108 3300009174 Bacteria 3994
244 Ga0105241_10272783 3300009174 Bacteria 1442
245 Ga0105241_10649305 3300009174 Bacteria 958
246 Ga0105242_10153900 3300009176 Unclassified 2007
247 Ga0105242_10204421 3300009176 Bacteria 1756
248 Ga0105248_10005933 3300009177 Bacteria 13426
249 Ga0105248_10011779 3300009177 Bacteria 9647
250 Ga0105248_10029891 3300009177 Bacteria 6080
251 Ga0105248_10034176 3300009177 Bacteria 5684
252 Ga0105237_10004719 3300009545 Bacteria 15684
253 Ga0105237_10007432 3300009545 Bacteria 11993
254 Ga0105237_10070348 3300009545 Bacteria 3495
255 Ga0105237_10599999 3300009545 Bacteria 1108
256 Ga0105238_10003421 3300009551 Bacteria 15825
257 Ga0105238_10436192 3300009551 Bacteria 1306
258 Ga0105238_10935501 3300009551 Bacteria 886
259 Ga0105249_10014723 3300009553 Bacteria 6914
260 Ga0105249_10019871 3300009553 Bacteria 5999
261 Ga0105249_10528641 3300009553 Bacteria 1228
262 Ga0099796_10022143 3300010159 Bacteria 1968
263 Ga0099796_10055610 3300010159 Bacteria 1387
264 Ga0099796_10130836 3300010159 Bacteria 973
265 Ga0105239_10023212 3300010375 Bacteria 6836
266 Ga0105239_10053470 3300010375 Bacteria 4430
267 Ga0105239_10102667 3300010375 Bacteria 3164
268 Ga0105239_10783691 3300010375 Bacteria 1092
269 Ga0105239_10797822 3300010375 Bacteria 1082
270 Ga0105239_11371603 3300010375 Bacteria 816
271 Ga0105246_10032205 3300011119 Bacteria 3475
272 Ga0105246_10079330 3300011119 Bacteria 2334
273 Ga0105246_10597510 3300011119 Bacteria 953
274 Ga0157373_10024897 3300013100 Bacteria 4334
275 Ga0157373_10298226 3300013100 Unclassified 1144
276 Ga0157370_10101962 3300013104 Bacteria 2688
277 Ga0157369_10065365 3300013105 Bacteria 3914
278 Ga0157369_10315863 3300013105 Bacteria 1624
279 Ga0157374_10411201 3300013296 Bacteria 1351
280 Ga0157378_10031566 3300013297 Bacteria 4679
281 Ga0157378_10086387 3300013297 Bacteria 2844
282 Ga0157378_10104776 3300013297 Bacteria 2586
283 Ga0157378_10258421 3300013297 Unclassified 1670
284 Ga0163162_10022234 3300013306 Bacteria 6250
285 Ga0163162_10053512 3300013306 Bacteria 4057
286 Ga0163162_10602920 3300013306 Bacteria 1224
287 Ga0157372_10016582 3300013307 Bacteria 7904
288 Ga0157372_10186079 3300013307 Bacteria 2405
289 Ga0157375_10084799 3300013308 Bacteria 3217
290 Ga0157375_10261478 3300013308 Bacteria 1892
291 Ga0157375_10298866 3300013308 Bacteria 1773
292 Ga0163163_10016805 3300014325 Bacteria 6811
293 Ga0163163_10226212 3300014325 Unclassified 1920
294 Ga0157380_10100984 3300014326 Bacteria 2403
295 Ga0157377_10013798 3300014745 Bacteria 4096
296 Ga0157379_10089794 3300014968 Bacteria 2756
297 Ga0157379_10153801 3300014968 Bacteria 2075
298 Ga0157379_10848577 3300014968 Bacteria 864
299 Ga0157376_10006128 3300014969 Bacteria 8466
300 Ga0157376_10135746 3300014969 Bacteria 2201
301 Ga0157376_10217613 3300014969 Unclassified 1767
302 Ga0163161_10006229 3300017792 Bacteria 8265
303 Ga0163161_10675526 3300017792 Bacteria 858
304 Ga0213876_10340105 3300021384 Bacteria 798
305 Ga0213875_10034248 3300021388 Bacteria 2398
306 Ga0209233_1005084 3300025261 Bacteria 4400
307 Ga0207666_1000311 3300025271 Bacteria 6768
308 Ga0207673_1003304 3300025290 Bacteria 1880
309 Ga0209758_1001737 3300025297 Bacteria 24275
310 Ga0209758_1003580 3300025297 Bacteria 13909
311 Ga0207697_10006626 3300025315 Bacteria 5222
312 Ga0207653_10002805 3300025885 Bacteria 5539
313 Ga0207682_10000009 3300025893 Bacteria 86366
314 Ga0207682_10014469 3300025893 Bacteria 3074
315 Ga0207692_10092310 3300025898 Bacteria 1645
316 Ga0207642_10044313 3300025899 Bacteria 1968
317 Ga0207710_10002730 3300025900 Bacteria 8088
318 Ga0207688_10000892 3300025901 Bacteria 15087
319 Ga0207688_10094545 3300025901 Bacteria 1719
320 Ga0207647_10002160 3300025904 Bacteria 15015
321 Ga0207685_10406230 3300025905 Bacteria 699
322 Ga0207645_10000999 3300025907 Bacteria 23365
323 Ga0207645_10194083 3300025907 Bacteria 1335
324 Ga0207643_10006739 3300025908 Bacteria 6161
325 Ga0207705_10522401 3300025909 Bacteria 922
326 Ga0207705_10596831 3300025909 Bacteria 859
327 Ga0207654_10236456 3300025911 Bacteria 1219
328 Ga0207654_10401528 3300025911 Bacteria 953
329 Ga0207707_10002224 3300025912 Bacteria 17529
330 Ga0207707_10020542 3300025912 Bacteria 5767
331 Ga0207695_10046019 3300025913 Bacteria 4626
332 Ga0207671_10035416 3300025914 Bacteria 3705
333 Ga0207671_10064994 3300025914 Bacteria 2713
334 Ga0207671_10077969 3300025914 Bacteria 2481
335 Ga0207671_10180264 3300025914 Bacteria 1644
336 Ga0207693_10018708 3300025915 Bacteria 5514
337 Ga0207693_10205162 3300025915 Bacteria 1550
338 Ga0207693_10227981 3300025915 Bacteria 1463
339 Ga0207663_10132464 3300025916 Bacteria 1724
340 Ga0207663_10599911 3300025916 Bacteria 865
341 Ga0207660_10001283 3300025917 Bacteria 16867
342 Ga0207660_10010206 3300025917 Bacteria 6087
343 Ga0207660_10294273 3300025917 Bacteria 1291
344 Ga0207662_10000025 3300025918 Bacteria 70078
345 Ga0207662_10037874 3300025918 Bacteria 2825
346 Ga0207657_10005246 3300025919 Bacteria 13576
347 Ga0207657_10018108 3300025919 Bacteria 6739
348 Ga0207657_10044766 3300025919 Bacteria 3889
349 Ga0207657_10546461 3300025919 Bacteria 906
350 Ga0207649_10002186 3300025920 Bacteria 11047
351 Ga0207652_10004348 3300025921 Bacteria 11546
352 Ga0207652_10035191 3300025921 Bacteria 4225
353 Ga0207681_10007074 3300025923 Bacteria 6881
354 Ga0207681_10068564 3300025923 Bacteria 2464
355 Ga0207681_10248997 3300025923 Bacteria 1386
356 Ga0207694_10075578 3300025924 Bacteria 2637
357 Ga0207694_10082962 3300025924 Bacteria 2520
358 Ga0207694_10318994 3300025924 Bacteria 1282
359 Ga0207650_10190498 3300025925 Bacteria 1638
360 Ga0207650_10388174 3300025925 Bacteria 1154
361 Ga0207650_10669745 3300025925 Bacteria 875
362 Ga0207659_10030381 3300025926 Bacteria 3691
363 Ga0207659_10262721 3300025926 Bacteria 1405
364 Ga0207687_10001197 3300025927 Bacteria 17741
365 Ga0207687_10002549 3300025927 Bacteria 12372
366 Ga0207700_10055969 3300025928 Bacteria 2967
367 Ga0207700_10092879 3300025928 Bacteria 2387
368 Ga0207700_10144687 3300025928 Bacteria 1958
369 Ga0207700_10469555 3300025928 Bacteria 1111
370 Ga0207664_10152833 3300025929 Bacteria 1962
371 Ga0207664_10375743 3300025929 Bacteria 1261
372 Ga0207664_10828401 3300025929 Bacteria 832
373 Ga0207644_10036076 3300025931 Bacteria 3469
374 Ga0207644_10066815 3300025931 Bacteria 2619
375 Ga0207644_10365892 3300025931 Bacteria 1174
376 Ga0207690_10011755 3300025932 Bacteria 5236
377 Ga0207690_10310657 3300025932 Bacteria 1236
378 Ga0207706_10005363 3300025933 Bacteria 11952
379 Ga0207706_10040844 3300025933 Bacteria 4112
380 Ga0207706_10103304 3300025933 Bacteria 2507
381 Ga0207686_10001310 3300025934 Bacteria 14258
382 Ga0207686_10274618 3300025934 Bacteria 1241
383 Ga0207709_10006190 3300025935 Bacteria 6736
384 Ga0207709_10012682 3300025935 Bacteria 4646
385 Ga0207709_10688635 3300025935 Bacteria 817
386 Ga0207670_10013997 3300025936 Bacteria 4749
387 Ga0207670_10118723 3300025936 Bacteria 1919
388 Ga0207670_10194202 3300025936 Unclassified 1538
389 Ga0207670_10406048 3300025936 Bacteria 1090
390 Ga0207669_10001324 3300025937 Bacteria 10540
391 Ga0207669_10157264 3300025937 Bacteria 1600
392 Ga0207669_10659658 3300025937 Bacteria 856
393 Ga0207704_10003457 3300025938 Bacteria 7181
394 Ga0207665_10198325 3300025939 Bacteria 1461
395 Ga0207691_10002604 3300025940 Bacteria 17616
396 Ga0207691_10159553 3300025940 Bacteria 1979
397 Ga0207711_10031474 3300025941 Bacteria 4479
398 Ga0207711_10073623 3300025941 Bacteria 2969
399 Ga0207711_10101876 3300025941 Bacteria 2541
400 Ga0207711_10218792 3300025941 Bacteria 1741
401 Ga0207689_10001156 3300025942 Bacteria 25400
402 Ga0207689_10038650 3300025942 Bacteria 3952
403 Ga0207689_10049010 3300025942 Bacteria 3485
404 Ga0207689_10087744 3300025942 Bacteria 2555
405 Ga0207661_10007789 3300025944 Bacteria 7627
406 Ga0207679_10004160 3300025945 Bacteria 8991
407 Ga0207667_10012980 3300025949 Bacteria 9561
408 Ga0207667_10077987 3300025949 Bacteria 3434
409 Ga0207667_10095327 3300025949 Bacteria 3072
410 Ga0207667_10310444 3300025949 Bacteria 1611
411 Ga0207667_10507823 3300025949 Bacteria 1222
412 Ga0207667_10961565 3300025949 Bacteria 843
413 Ga0207651_10087185 3300025960 Bacteria 2271
414 Ga0207651_10328099 3300025960 Bacteria 1281
415 Ga0207712_10000579 3300025961 Bacteria 29666
416 Ga0207712_10252552 3300025961 Bacteria 1426
417 Ga0207668_10001403 3300025972 Bacteria 14194
418 Ga0207668_10005581 3300025972 Bacteria 7417
419 Ga0207668_10032114 3300025972 Bacteria 3465
420 Ga0207668_10033457 3300025972 Bacteria 3405
421 Ga0207668_10079730 3300025972 Bacteria 2369
422 Ga0207668_10481642 3300025972 Bacteria 1064
423 Ga0207640_10003644 3300025981 Bacteria 8306
424 Ga0207658_10113485 3300025986 Bacteria 2147
425 Ga0207658_10359771 3300025986 Bacteria 1269
426 Ga0207658_10372366 3300025986 Bacteria 1249
427 Ga0207658_10608626 3300025986 Unclassified 982
428 Ga0207658_10639432 3300025986 Bacteria 958
429 Ga0207703_10014416 3300026035 Bacteria 6164
430 Ga0207703_10032293 3300026035 Bacteria 4143
431 Ga0207639_10001866 3300026041 Bacteria 14170
432 Ga0207639_10117459 3300026041 Bacteria 2180
433 Ga0207639_10128563 3300026041 Bacteria 2094
434 Ga0207639_10547058 3300026041 Bacteria 1062
435 Ga0207678_10027315 3300026067 Bacteria 4977
436 Ga0207678_10033660 3300026067 Bacteria 4464
437 Ga0207678_10042596 3300026067 Bacteria 3932
438 Ga0207678_10048901 3300026067 Bacteria 3654
439 Ga0207678_10062786 3300026067 Bacteria 3193
440 Ga0207678_10080462 3300026067 Bacteria 2789
441 Ga0207678_10080882 3300026067 Bacteria 2781
442 Ga0207678_10222167 3300026067 Bacteria 1617
443 Ga0207708_10020931 3300026075 Bacteria 4935
444 Ga0207708_10023687 3300026075 Bacteria 4641
445 Ga0207708_10050635 3300026075 Bacteria 3162
446 Ga0207708_10480363 3300026075 Bacteria 1039
447 Ga0207702_10010946 3300026078 Bacteria 7566
448 Ga0207702_10257067 3300026078 Bacteria 1643
449 Ga0207702_10359494 3300026078 Bacteria 1395
450 Ga0207641_10006404 3300026088 Bacteria 9923
451 Ga0207641_10171571 3300026088 Bacteria 1980
452 Ga0207641_10315377 3300026088 Unclassified 1481
453 Ga0207648_10004627 3300026089 Bacteria 14090
454 Ga0207648_10046915 3300026089 Bacteria 3787
455 Ga0207648_10807228 3300026089 Bacteria 874
456 Ga0207676_10030863 3300026095 Bacteria 4026
457 Ga0207676_10282270 3300026095 Bacteria 1508
458 Ga0207674_10094104 3300026116 Bacteria 2983
459 Ga0207674_10112597 3300026116 Bacteria 2695
460 Ga0207674_10530319 3300026116 Bacteria 1137
461 Ga0207675_100003859 3300026118 Bacteria 14570
462 Ga0207683_10000850 3300026121 Bacteria 28050
463 Ga0207683_10051919 3300026121 Bacteria 3592
464 Ga0207683_10075790 3300026121 Bacteria 2978
465 Ga0207683_10176198 3300026121 Bacteria 1938
466 Ga0207698_10087412 3300026142 Bacteria 2539
467 Ga0207698_10089661 3300026142 Bacteria 2512
468 Ga0207698_10636350 3300026142 Bacteria 1055
469 Ga0209984_1018261 3300027424 Bacteria 947
470 Ga0210002_1003557 3300027617 Bacteria 2298
471 Ga0209998_10002588 3300027717 Bacteria 4111
472 Ga0209813_10105597 3300027866 Bacteria 964
473 Ga0209974_10003747 3300027876 Bacteria 5444
474 Ga0207428_10000164 3300027907 Bacteria 91968
475 Ga0207428_10459443 3300027907 Bacteria 928
476 Ga0268266_10012217 3300028379 Bacteria 7429
477 Ga0268266_10013853 3300028379 Bacteria 6942
478 Ga0268266_10164400 3300028379 Bacteria 2009
479 Ga0268266_10227310 3300028379 Bacteria 1717
480 Ga0268266_10363782 3300028379 Bacteria 1361
481 Ga0268266_10559329 3300028379 Bacteria 1096
482 Ga0268265_10004025 3300028380 Bacteria 10352
483 Ga0268265_10022554 3300028380 Bacteria 4425
484 Ga0268265_10079812 3300028380 Bacteria 2578
485 Ga0268264_10000174 3300028381 Bacteria 137254
486 Ga0268264_10049152 3300028381 Bacteria 3508
487 Ga0268264_10102694 3300028381 Bacteria 2488
488 Ga0268264_10158236 3300028381 Bacteria 2038
489 Ga0268264_10756675 3300028381 Bacteria 968
490 Ga0265334_10031226 3300028573 Bacteria 2130
491 Ga0307517_10000859 3300028786 Bacteria 51881
492 Ga0307511_10032093 3300030521 Bacteria 4676
493 Ga0307512_10244813 3300030522 Bacteria 902
494 Ga0265330_10052577 3300031235 Bacteria 1784
495 Ga0265332_10029296 3300031238 Bacteria 2407
496 Ga0265325_10000019 3300031241 Bacteria 125265
497 Ga0265339_10303624 3300031249 Bacteria 760
498 Ga0265331_10110613 3300031250 Bacteria 1260
499 Ga0307513_10377142 3300031456 Bacteria 1159
500 Ga0307509_10006398 3300031507 Bacteria 15864
501 Ga0307509_10082116 3300031507 Bacteria 3325
502 Ga0307408_100180430 3300031548 Bacteria 1693
503 Ga0307408_100715716 3300031548 Bacteria 901
504 Ga0265313_10067069 3300031595 Bacteria 1661
505 Ga0265313_10117892 3300031595 Bacteria 1161
506 Ga0307508_10494422 3300031616 Bacteria 817
507 Ga0307516_10059646 3300031730 Bacteria 3710
508 Ga0307516_10060402 3300031730 Bacteria 3683
509 Ga0307405_10595972 3300031731 Bacteria 901
510 Ga0307405_11002876 3300031731 Bacteria 712
511 Ga0307413_10038231 3300031824 Bacteria 2780
512 Ga0307413_10491927 3300031824 Bacteria 983
513 Ga0307407_10258970 3300031903 Bacteria 1196
514 Ga0307409_100021933 3300031995 Bacteria 4391
515 Ga0307416_100558321 3300032002 Bacteria 1219
516 Ga0307415_100004684 3300032126 Bacteria 7153
517 Ga0307507_10028588 3300033179 Bacteria 5937
518 Ga0307510_10019115 3300033180 Bacteria 8037
519 Ga0307510_10201911 3300033180 Bacteria 1522
520 Ga0315911_1000040 3300033442 Bacteria 50766
521 Ga0316215_1000931 3300033544 Bacteria 2860
522 Ga0373930_0002256 3300034816 Bacteria 2972
523 Ga0373948_0001906 3300034817 Bacteria 2989
524 Ga0373950_0013019 3300034818 Bacteria 1382
525 Ga0373959_0008747 3300034820 Bacteria 1731
526 Ga0373926_0054548 3300035083 Bacteria 1448
527 Ga0373926_0083666 3300035083 Bacteria 1182
528 Ga0373929_0006845 3300035085 Bacteria 2070
529 Ga0373929_0007992 3300035085 Bacteria 1945
530 Ga0373951_0029322 3300035091 Bacteria 1292
531 Ga0373952_0000933 3300035092 Bacteria 5313
532 Ga0373923_0003867 3300035111 Bacteria 4879
533 Ga0373923_0021124 3300035111 Bacteria 2538
534 Ga0373923_0027670 3300035111 Bacteria 2263
535 Ga0373932_0003751 3300035112 Bacteria 3626
536 Ga0373936_0006062 3300035113 Bacteria 4555
537 Ga0373936_0179144 3300035113 Bacteria 929
538 Ga0373939_0003090 3300035114 Bacteria 3908
539 Ga0373941_0013201 3300035115 Bacteria 2178
540 Ga0373953_0012482 3300035117 Bacteria 3010
541 Ga0373953_0018244 3300035117 Plasmid 2594
542 Ga0373953_0066408 3300035117 Bacteria 1482
543 Ga0373954_0000213 3300035118 Bacteria 21171
544 Ga0373954_0001219 3300035118 Bacteria 10343
545 Ga0373954_0008152 3300035118 Bacteria 4590
546 Ga0373954_0015754 3300035118 Bacteria 3381
547 Ga0373954_0349097 3300035118 Bacteria 731
548 Ga0373956_0004720 3300035119 Bacteria 5448
549 Ga0373956_0112176 3300035119 Bacteria 1270
550 Ga0373957_0003464 3300035120 Bacteria 4665
551 Ga0373957_0182082 3300035120 Bacteria 871
552 Ga0373960_0006476 3300035121 Bacteria 2749
553 Ga0373943_0005037 3300035170 Bacteria 5958
554 Ga0373943_0066209 3300035170 Bacteria 1819
555 Ga0373943_0255544 3300035170 Bacteria 985
556 Ga0373955_0002049 3300035172 Bacteria 8671
557 Ga0373955_0012895 3300035172 Plasmid 4029
558 Ga0373955_0241240 3300035172 Bacteria 1082
559 Ga0373955_0503749 3300035172 Bacteria 739
560 Ga0373942_0027318 3300035207 Bacteria 1484
561 Ga0373961_0036817 3300035241 Bacteria 1395
562 Ga0373962_0009071 3300035242 Bacteria 2457
563 Ga0373924_0007721 3300035410 Bacteria 3888
564 Ga0373924_0014698 3300035410 Bacteria 2961
565 Ga0373931_0002611 3300035691 Bacteria 8014
566 Ga0373931_0004766 3300035691 Bacteria 6220
567 Ga0373935_0000942 3300035692 Bacteria 15748
568 Ga0373935_0057406 3300035692 Unclassified 2483
569 Ga0373927_0000528 3300035695 Bacteria 29016
570 Ga0373927_0007183 3300035695 Bacteria 7558
571 Ga0373927_0064676 3300035695 Bacteria 2366
572 Ga0373927_0089359 3300035695 Bacteria 2000
573 Ga0373927_0202177 3300035695 Bacteria 1304
574 Ga0373927_0327937 3300035695 Bacteria 1008
575 Ga0373933_0010853 3300035724 Bacteria 4999
576 Ga0373933_0034817 3300035724 Plasmid 2937
577 Ga0373933_0112377 3300035724 Bacteria 1700
578 Ga0373933_0340671 3300035724 Bacteria 973
579 Ga0373947_0000455 3300035725 Bacteria 23308
580 Ga0373947_0035994 3300035725 Bacteria 2933
581 Ga0373947_0039442 3300035725 Bacteria 2810
582 Ga0373947_0091001 3300035725 Bacteria 1903
583 Ga0373947_0183995 3300035725 Bacteria 1361
584 Ga0373947_0376258 3300035725 Bacteria 955
585 Ga0373937_0004613 3300036401 Bacteria 11701
586 Ga0373937_0008188 3300036401 Bacteria 9080
587 Ga0373937_0015336 3300036401 Bacteria 6776
588 Ga0373937_0185926 3300036401 Bacteria 1951
589 Ga0373937_0485225 3300036401 Bacteria 1174
590 Ga0372808_023218 3300036459 Bacteria 891
591 Ga0373925_0003563 3300037068 Bacteria 12000
592 Ga0373925_0023694 3300037068 Bacteria 4479
593 Ga0373925_0034269 3300037068 Bacteria 3741
594 Ga0373925_0081325 3300037068 Bacteria 2463
595 Ga0373925_0085487 3300037068 Unclassified 2405
596 Ga0373925_0154434 3300037068 Bacteria 1804
597 Ga0373925_0301832 3300037068 Bacteria 1293
598 Ga0373925_0466402 3300037068 Bacteria 1035
599 Ga0395905_0077529 3300037471 Bacteria 3114
600 Ga0436364_0157539 3300037853 Bacteria 2550
601 Ga0436364_0476354 3300037853 Bacteria 863
602 Ga0436364_1289063 3300037853 Bacteria 1174
603 Ga0395901_0067053 3300038443 Bacteria 3738
604 Ga0436365_1698837 3300039437 Bacteria 869
605 Ga0436363_1437817 3300039450 Bacteria 1546
606 Ga0439465_0132882 3300041413 Bacteria 879
607 Ga0451791_0240992 3300041451 Bacteria 1064
608 Ga0451791_0284711 3300041451 Bacteria 886
609 Ga0451791_0441720 3300041451 Bacteria 774
610 Ga0451793_1400233 3300041452 Bacteria 729
611 Ga0451807_0428279 3300041486 Bacteria 994
612 Ga0451837_1412964 3300041494 Bacteria 1276
613 Ga0451853_0921849 3300041512 Bacteria 811
614 Ga0451853_4011993 3300041512 Bacteria 1075
615 Ga0466968_0247024 3300044735 Bacteria 847
616 Ga0495617_085353 3300046452 Bacteria 1033
617 Ga0495617_165209 3300046452 Bacteria 700
618 Ga0495592_0005277 3300046454 Bacteria 9521
619 Ga0495592_0021465 3300046454 Bacteria 4910
620 Ga0495592_0032569 3300046454 Bacteria 3932
621 Ga0495592_0218026 3300046454 Bacteria 1277
622 Ga0495592_0341783 3300046454 Bacteria 962
623 Ga0495603_0000239 3300046455 Bacteria 28578
624 Ga0495603_0009322 3300046455 Bacteria 5935
625 Ga0495603_0058945 3300046455 Bacteria 2269
626 Ga0495590_0068691 3300046457 Bacteria 1242
627 Ga0495629_0000457 3300046459 Bacteria 34088
628 Ga0495629_0007972 3300046459 Bacteria 7791
629 Ga0495629_0225537 3300046459 Bacteria 1292
630 Ga0495638_0021622 3300046460 Bacteria 4236
631 Ga0495638_0076101 3300046460 Bacteria 2045
632 Ga0495641_0002157 3300046461 Bacteria 15774
633 Ga0495641_0094341 3300046461 Bacteria 1337
634 Ga0495641_0209869 3300046461 Bacteria 873
635 Ga0495651_0014000 3300046462 Bacteria 6203
636 Ga0495651_0037984 3300046462 Bacteria 3749
637 Ga0495651_0054995 3300046462 Bacteria 3058
638 Ga0495651_0363524 3300046462 Bacteria 953
639 Ga0495653_0004257 3300046463 Bacteria 11596
640 Ga0495653_0009797 3300046463 Bacteria 7835
641 Ga0495653_0021824 3300046463 Bacteria 5182
642 Ga0495653_0155003 3300046463 Bacteria 1596
643 Ga0495650_0051594 3300046471 Bacteria 1694
644 Ga0495580_0002960 3300046472 Bacteria 14585
645 Ga0495580_0198659 3300046472 Bacteria 1382
646 Ga0495582_0000077 3300046473 Bacteria 49112
647 Ga0495639_0000101 3300046475 Bacteria 42348
648 Ga0495639_0095966 3300046475 Bacteria 1396
649 Ga0495639_0179661 3300046475 Unclassified 1030
650 Ga0495662_0012510 3300046476 Bacteria 4140
651 Ga0495662_0033507 3300046476 Bacteria 2481
652 Ga0495664_0005157 3300046477 Bacteria 7169
653 Ga0495664_0038052 3300046477 Plasmid 2839
654 Ga0495664_0041464 3300046477 Bacteria 2724
655 Ga0495664_0432353 3300046477 Bacteria 789
656 Ga0495664_0530360 3300046477 Bacteria 702
657 Ga0495584_0046170 3300046491 Bacteria 2197
658 Ga0495584_0108892 3300046491 Bacteria 1401
659 Ga0495585_0031320 3300046492 Bacteria 3019
660 Ga0495594_0000083 3300046499 Bacteria 42703
661 Ga0495594_0186100 3300046499 Bacteria 1182
662 Ga0495606_0000357 3300046507 Bacteria 78015
663 Ga0495606_0313024 3300046507 Bacteria 846
664 Ga0495608_0000911 3300046511 Bacteria 20725
665 Ga0495608_0004649 3300046511 Bacteria 9811
666 Ga0495616_0335648 3300046513 Bacteria 632
667 Ga0495618_0003586 3300046514 Bacteria 9613
668 Ga0495618_0014258 3300046514 Bacteria 4840
669 Ga0495628_0023578 3300046516 Bacteria 5049
670 Ga0495628_0046394 3300046516 Bacteria 3451
671 Ga0495628_0055320 3300046516 Plasmid 3125
672 Ga0495628_0062832 3300046516 Bacteria 2910
673 Ga0495630_0074877 3300046517 Bacteria 2551
674 Ga0495630_0079394 3300046517 Unclassified 2475
675 Ga0495630_0167276 3300046517 Bacteria 1674
676 Ga0495630_0268244 3300046517 Bacteria 1304
677 Ga0495632_0015464 3300046519 Bacteria 4277
678 Ga0495644_0046783 3300046523 Bacteria 1626
679 Ga0495666_0037457 3300046526 Bacteria 2359
680 Ga0495652_0021917 3300046529 Bacteria 5680
681 Ga0495652_0046433 3300046529 Bacteria 3729
682 Ga0495652_0046645 3300046529 Bacteria 3719
683 Ga0495652_0145338 3300046529 Unclassified 1859
684 Ga0495665_0000055 3300046531 Bacteria 45208
685 Ga0495640_0011661 3300046533 Bacteria 6748
686 Ga0495640_0051741 3300046533 Bacteria 2822
687 Ga0495640_0053786 3300046533 Plasmid 2759
688 Ga0495640_0169903 3300046533 Bacteria 1393
689 Ga0495640_0486452 3300046533 Bacteria 752
690 Ga0495586_0026013 3300046535 Bacteria 3131
691 Ga0495586_0590969 3300046535 Bacteria 641
692 Ga0495587_0005897 3300046536 Bacteria 7984
693 Ga0495587_0011562 3300046536 Bacteria 5588
694 Ga0495587_0015897 3300046536 Bacteria 4687
695 Ga0495587_0165550 3300046536 Bacteria 1257
696 Ga0495598_0005561 3300046537 Bacteria 2802
697 Ga0495597_0148045 3300046542 Bacteria 965
698 Ga0495645_0031846 3300046543 Bacteria 3844
699 Ga0495645_0042847 3300046543 Bacteria 3300
700 Ga0495645_0061920 3300046543 Bacteria 2711
701 Ga0495645_0331495 3300046543 Bacteria 985
702 Ga0495622_0002233 3300046557 Bacteria 9422
703 Ga0495622_0128327 3300046557 Bacteria 1155
704 Ga0495622_0162331 3300046557 Bacteria 1007
705 Ga0495633_0094045 3300046558 Bacteria 1393
706 Ga0495667_0013782 3300046559 Bacteria 5460
707 Ga0495667_0021423 3300046559 Bacteria 4361
708 Ga0495667_0023279 3300046559 Bacteria 4173
709 Ga0495667_0048600 3300046559 Bacteria 2801
710 Ga0495667_0093406 3300046559 Bacteria 1948
711 Ga0495656_0008262 3300046615 Bacteria 3711
712 Ga0495656_0308414 3300046615 Bacteria 813
713 Ga0495668_0114332 3300046616 Bacteria 1476
714 Ga0495634_0001036 3300046642 Bacteria 26033
715 Ga0495611_0063779 3300046648 Bacteria 1677
716 Ga0495625_0592842 3300046660 Bacteria 666
717 Ga0495635_0000815 3300046663 Bacteria 20434
718 Ga0495635_0004810 3300046663 Bacteria 9387
719 Ga0495635_0011194 3300046663 Bacteria 6289
720 Ga0495635_0029736 3300046663 Bacteria 3799
721 Ga0495635_0053819 3300046663 Bacteria 2772
722 Ga0495659_0004501 3300046664 Bacteria 4388
723 Ga0495588_0005058 3300046674 Bacteria 5855
724 Ga0495588_0005077 3300046674 Bacteria 5848
725 Ga0495657_0003079 3300046675 Bacteria 13781
726 Ga0495657_0034720 3300046675 Bacteria 3500
727 Ga0495657_0068646 3300046675 Bacteria 2322
728 Ga0495599_0001945 3300046678 Bacteria 11972
729 Ga0495599_0097068 3300046678 Bacteria 1837
730 Ga0495599_0156310 3300046678 Bacteria 1411
731 Ga0495623_0001015 3300046679 Bacteria 18970
732 Ga0495623_0020870 3300046679 Bacteria 4233
733 Ga0495623_0077150 3300046679 Bacteria 2066
734 Ga0495646_0001642 3300046680 Bacteria 13342
735 Ga0495646_0014188 3300046680 Bacteria 5065
736 Ga0495646_0113094 3300046680 Bacteria 1544
737 Ga0495646_0189630 3300046680 Bacteria 1124
738 Ga0495647_0067226 3300046681 Bacteria 1427
739 Ga0495658_0001572 3300046683 Bacteria 11910
740 Ga0495669_0002048 3300046684 Bacteria 8266
741 Ga0495613_0003480 3300046689 Bacteria 11777
742 Ga0495613_0078788 3300046689 Unclassified 2396
743 Ga0495613_0092005 3300046689 Bacteria 2196
744 Ga0495613_0168523 3300046689 Bacteria 1555
745 Ga0495613_0660189 3300046689 Bacteria 691
746 Ga0495624_0000235 3300046690 Bacteria 43165
747 Ga0495624_0050807 3300046690 Plasmid 2625
748 Ga0495624_0179546 3300046690 Bacteria 1290
749 Ga0495670_0192981 3300046691 Bacteria 1077
750 Ga0495671_0061334 3300046692 Bacteria 1855
751 Ga0495589_0184650 3300046794 Bacteria 988
752 Ga0495600_0012719 3300046809 Bacteria 5268
753 Ga0495600_0015287 3300046809 Bacteria 4851
754 Ga0495600_0245824 3300046809 Bacteria 1139
755 Ga0495600_0339237 3300046809 Bacteria 942
756 Ga0495600_0344774 3300046809 Bacteria 934
757 Ga0495600_0574508 3300046809 Bacteria 687
758 Ga0495581_0000041 3300047315 Bacteria 46518
759 Ga0495581_0196067 3300047315 Bacteria 1181
760 Ga0495604_0007221 3300047317 Bacteria 8800
761 Ga0495604_0272830 3300047317 Bacteria 1145
762 Ga0495674_0028002 3300047319 Bacteria 5145
763 Ga0495674_0036100 3300047319 Bacteria 4451
764 Ga0495674_0602898 3300047319 Bacteria 870
765 Ga0495676_0018550 3300047321 Bacteria 6135
766 Ga0495680_0017765 3300047322 Bacteria 6056
767 Ga0495680_0028245 3300047322 Bacteria 4600
768 Ga0495680_0154374 3300047322 Bacteria 1671
769 Ga0495680_0414882 3300047322 Bacteria 927
770 Ga0495675_0025398 3300047444 Bacteria 3777
771 Ga0495675_0048080 3300047444 Bacteria 2713
772 Ga0495677_0151369 3300047445 Bacteria 893
773 Ga0495679_093047 3300047446 Bacteria 844
774 Ga0495673_0025589 3300047469 Bacteria 2830
775 Ga0495684_0001399 3300047471 Bacteria 19329
776 Ga0495684_0028335 3300047471 Bacteria 4301
777 Ga0495684_0405869 3300047471 Bacteria 955
778 Ga0495686_0224071 3300047472 Bacteria 1068
779 Ga0495593_0000024 3300047673 Bacteria 65718
780 Ga0495593_0004938 3300047673 Bacteria 7905
781 Ga0495593_0019588 3300047673 Bacteria 3793
782 Ga0495602_0019419 3300048088 Bacteria 6748
783 Ga0495602_0035012 3300048088 Bacteria 4687
784 Ga0495602_0067291 3300048088 Bacteria 3082
785 Ga0495626_0219016 3300048091 Bacteria 774
786 Ga0496100_0032123 3300048903 Bacteria 3270
787 Ga0496100_0084124 3300048903 Bacteria 2156
788 Ga0496100_0301201 3300048903 Bacteria 1200
789 Ga0496100_0552808 3300048903 Bacteria 891
790 Ga0496101_0002275 3300048904 Bacteria 11728
791 Ga0496101_0017665 3300048904 Bacteria 4839
792 Ga0496101_0257139 3300048904 Unclassified 1361
793 Ga0496101_0290603 3300048904 Bacteria 1279
794 Ga0496101_0475822 3300048904 Unclassified 986
795 Ga0496102_0015668 3300048905 Bacteria 6604
796 Ga0496102_0022366 3300048905 Bacteria 5601
797 Ga0496102_0076164 3300048905 Bacteria 3085
798 Ga0496102_0286670 3300048905 Bacteria 1552
799 Ga0496102_0414593 3300048905 Bacteria 1265
800 Ga0496103_0019772 3300048906 Bacteria 4042
801 Ga0496103_0026671 3300048906 Bacteria 3498
802 Ga0496103_0413174 3300048906 Bacteria 866
803 Ga0496104_0047895 3300048907 Bacteria 4029
804 Ga0496104_0088890 3300048907 Bacteria 2951
805 Ga0496104_0121736 3300048907 Bacteria 2505
806 Ga0496104_0135420 3300048907 Bacteria 2366
807 Ga0496104_0249235 3300048907 Unclassified 1689
808 Ga0496104_0353360 3300048907 Bacteria 1382
809 Ga0496105_0012396 3300048908 Bacteria 6749
810 Ga0496105_0292958 3300048908 Unclassified 1310
811 Ga0496105_0827525 3300048908 Bacteria 702
812 Ga0496106_0003446 3300048909 Bacteria 11782
813 Ga0496106_0039727 3300048909 Bacteria 3524
814 Ga0496106_0058706 3300048909 Bacteria 2913
815 Ga0496106_0103687 3300048909 Unclassified 2208
816 Ga0496106_0147996 3300048909 Bacteria 1851
817 Ga0496106_0149447 3300048909 Bacteria 1842
818 Ga0496106_0267929 3300048909 Bacteria 1367
819 Ga0496106_0299272 3300048909 Bacteria 1290
820 Ga0496107_0000509 3300048910 Bacteria 21565
821 Ga0496107_0021914 3300048910 Bacteria 4514
822 Ga0496107_0055248 3300048910 Bacteria 2868
823 Ga0496107_0159541 3300048910 Bacteria 1671
824 Ga0496107_0184967 3300048910 Unclassified 1547
825 Ga0496107_0210648 3300048910 Bacteria 1445
826 Ga0496107_0397163 3300048910 Unclassified 1025
827 Ga0496108_0031275 3300048911 Bacteria 4415
828 Ga0496108_0043219 3300048911 Bacteria 3764
829 Ga0496108_0150590 3300048911 Bacteria 2007
830 Ga0496109_0026994 3300048912 Bacteria 5122
831 Ga0496109_0063752 3300048912 Bacteria 3371
832 Ga0496109_0170543 3300048912 Bacteria 2041
833 Ga0496109_0207049 3300048912 Bacteria 1844
834 Ga0496109_0241523 3300048912 Bacteria 1700
835 Ga0496109_0273602 3300048912 Bacteria 1591
836 Ga0496109_0995085 3300048912 Bacteria 776
837 Ga0496110_0033752 3300048913 Bacteria 4429
838 Ga0496110_0130718 3300048913 Bacteria 2267
839 Ga0496110_0313674 3300048913 Bacteria 1428
840 Ga0496110_0703311 3300048913 Bacteria 912
841 Ga0496110_0799685 3300048913 Bacteria 847
842 Ga0496110_0920507 3300048913 Bacteria 781
843 Ga0496111_0024753 3300048914 Bacteria 4233
844 Ga0496111_0039292 3300048914 Bacteria 3392
845 Ga0496111_0233770 3300048914 Bacteria 1365
846 Ga0496111_0348952 3300048914 Bacteria 1095
847 Ga0496111_0510088 3300048914 Bacteria 885
848 Ga0496112_0012715 3300048915 Bacteria 7740
849 Ga0496112_0048594 3300048915 Bacteria 4159
850 Ga0496112_0086667 3300048915 Bacteria 3098
851 Ga0496112_0252685 3300048915 Unclassified 1714
852 Ga0496112_0284141 3300048915 Bacteria 1601
853 Ga0496113_0002503 3300048916 Bacteria 10701
854 Ga0496113_0008294 3300048916 Bacteria 6760
855 Ga0496113_0056499 3300048916 Bacteria 2947
856 Ga0496113_0057698 3300048916 Bacteria 2919
857 Ga0496113_0533929 3300048916 Bacteria 941
858 Ga0496114_0009294 3300048917 Bacteria 7801
859 Ga0496114_0048418 3300048917 Bacteria 3536
860 Ga0496114_0079135 3300048917 Bacteria 2774
861 Ga0496114_0401699 3300048917 Bacteria 1213
862 Ga0496115_0045511 3300048918 Bacteria 3504
863 Ga0496115_0059345 3300048918 Bacteria 3081
864 Ga0496115_0106674 3300048918 Unclassified 2300
865 Ga0496115_0133773 3300048918 Bacteria 2044
866 Ga0496115_0266420 3300048918 Bacteria 1408
867 Ga0496117_0238499 3300048920 Bacteria 1000
868 Ga0496119_0047619 3300048922 Bacteria 2666
869 Ga0496121_0000927 3300048924 Bacteria 53016
870 Ga0496121_0095423 3300048924 Bacteria 2311
871 Ga0496121_0151137 3300048924 Bacteria 1708
872 Ga0496121_0203641 3300048924 Bacteria 1408
873 Ga0496124_0233805 3300048927 Bacteria 1372
874 Ga0496126_0060792 3300048929 Bacteria 3396
875 Ga0496126_0082014 3300048929 Bacteria 2850
876 Ga0496126_0378771 3300048929 Bacteria 1152
877 Ga0496126_0570173 3300048929 Bacteria 896
878 Ga0496126_0726628 3300048929 Bacteria 769
879 Ga0501032_0139342 3300049569 Bacteria 1598
880 Ga0501043_0280819 3300049579 Bacteria 1276
881 Ga0501046_0060334 3300049580 Bacteria 2968
882 Ga0501047_0014411 3300049581 Bacteria 7517
883 Ga0501067_0039577 3300049583 Bacteria 2618
884 Ga0501070_0006598 3300049586 Bacteria 9876
885 Ga0501044_0005514 3300049823 Bacteria 14047
886 Ga0501044_0209640 3300049823 Unclassified 1903
887 nmdc:mga00v17_297583_c1 3300050491 Bacteria 1048
888 nmdc:mga0yw44_13282_c1 3300050492 Bacteria 4330
889 nmdc:mga0yw44_168291_c1 3300050492 Bacteria 1438
890 nmdc:mga0yw44_211928_c1 3300050492 Bacteria 1282
891 nmdc:mga0yw44_285890_c1 3300050492 Bacteria 1103
892 nmdc:mga0k408_292622_c1 3300050493 Bacteria 972
893 nmdc:mga06z11_151224_c1 3300050494 Bacteria 1320
894 nmdc:mga06z11_45147_c1 3300050494 Bacteria 1399
895 nmdc:mga06z11_84370_c1 3300050494 Bacteria 1712
896 nmdc:mga04h51_9301_c1 3300050495 Bacteria 2658
897 nmdc:mga07m45_8848_c1 3300050496 Bacteria 5195
898 nmdc:mga07m45_94518_c1 3300050496 Bacteria 1714
899 nmdc:mga08y16_108_c1 3300050511 Bacteria 69804
900 nmdc:mga08y16_191984_c1 3300050511 Bacteria 2118
901 nmdc:mga08y16_366135_c1 3300050511 Bacteria 1479
902 nmdc:mga0n895_121255_c1 3300050512 Bacteria 2636
903 nmdc:mga0n895_216385_c1 3300050512 Unclassified 1945
904 nmdc:mga0n895_37633_c1 3300050512 Bacteria 4682
905 nmdc:mga0rr50_537400_c1 3300050513 Bacteria 995
906 nmdc:mga08x19_396636_c1 3300050514 Bacteria 967
907 nmdc:mga0a205_1049_c1 3300050515 Bacteria 23004
908 nmdc:mga0a205_206208_c1 3300050515 Bacteria 1855
909 nmdc:mga0sz30_114689_c1 3300050516 Bacteria 1182
910 Ga0495601_0009169 3300053077 Bacteria 5846
911 Ga0495601_0141831 3300053077 Unclassified 1567
912 Ga0495601_0173060 3300053077 Bacteria 1411
913 Ga0495601_0249003 3300053077 Bacteria 1160
914 Ga0495601_0250303 3300053077 Bacteria 1157
915 Ga0495612_0193999 3300053078 Bacteria 894
916 Ga0500635_0001974 3300053080 Bacteria 5009
917 Ga0500635_0031249 3300053080 Bacteria 1722
918 Ga0495595_0000554 3300053084 Bacteria 14279
919 Ga0495595_0000637 3300053084 Bacteria 13319
920 Ga0495619_0001080 3300053085 Bacteria 17897
921 Ga0495619_0425381 3300053085 Bacteria 916
922 Ga0500578_0445488 3300053086 Bacteria 738
923 Ga0500647_0195221 3300053091 Bacteria 921
924 Ga0500583_0009184 3300053092 Bacteria 3598
925 Ga0500583_0051691 3300053092 Bacteria 1910
926 Ga0500641_0005024 3300053096 Bacteria 4691
927 Ga0500641_0024967 3300053096 Bacteria 2309
928 Ga0500641_0133006 3300053096 Bacteria 1073
929 Ga0500648_100720 3300053097 Bacteria 1607
930 Ga0500595_001951 3300053119 Bacteria 10615
931 Ga0500595_026055 3300053119 Bacteria 2020
932 Ga0500658_0145563 3300053134 Bacteria 1065
933 Ga0500658_0147074 3300053134 Bacteria 1060
934 Ga0500559_0015190 3300053136 Bacteria 3253
935 Ga0500568_0006709 3300053139 Bacteria 5754
936 Ga0500568_0096636 3300053139 Bacteria 1111
937 Ga0500573_0008543 3300053140 Bacteria 5644
938 Ga0500588_0013956 3300053146 Bacteria 2025
939 Ga0500588_0129991 3300053146 Bacteria 896
940 Ga0500589_021876 3300053147 Bacteria 2937
941 Ga0500589_042286 3300053147 Bacteria 2125
942 Ga0500590_093943 3300053148 Bacteria 1452
943 Ga0500603_000226 3300053150 Bacteria 14827
944 Ga0500622_0248361 3300053156 Bacteria 782
945 Ga0500634_0075126 3300053161 Bacteria 1758
946 Ga0500634_0091011 3300053161 Bacteria 1548
947 Ga0500639_048715 3300053163 Bacteria 2212
948 Ga0500636_0013138 3300053177 Bacteria 4858
949 Ga0500637_0003349 3300053178 Bacteria 7387
950 Ga0500637_0165132 3300053178 Bacteria 1274
951 Ga0500645_012764 3300053730 Bacteria 2712
952 Ga0500596_003281 3300053735 Bacteria 3099
953 2507511875 2507262055 Bacteria 8048963
954 2508545539 2508501009 Bacteria 7784016
955 2508694357 2508501042 Bacteria 8719808
956 2513659240 2513237096 Bacteria 8722461
957 2513696314 2513237101 Bacteria 7952346
958 2513859039 2513237137 Bacteria 9558895
959 2513887727 2513237141 Bacteria 8496279
960 2513921880 2513237145 Bacteria 8979722
961 2515624712 2515154112 Bacteria 8294334
962 2517895961 2517572143 Bacteria 9484767
963 2671122755 2667528175 Bacteria 7532676
964 2723842810 2721755755 Bacteria 8322773
965 2728752344 2728368998 Bacteria 8720350
966 2793069609 2791355197 Bacteria 8420563
967 2793080288
968 2874592255 2874590934 Bacteria 8299676
969 2874606516 2874604998 Bacteria 7834745
970 2874647371 2874645413 Bacteria 8214782
971 2876774782 2876771140 Bacteria 8287509
972 2876809827 2876808645 Bacteria 8824342
973 2876819735 2876818435 Bacteria 8274608
974 2879079350 2879074833 Bacteria 8279565
975 2879113774 2879110137 Bacteria 8907982
976 2879129084 2879127579 Bacteria 8294491
977 2879144761 2879142872 Bacteria 8267021
978 2885382988 2885374607 Bacteria 8927485
979 2889033863 2889033259 Bacteria 9099371
980 2903756065 2903748898 Bacteria 9972761
981 2904699113 2904690495 Bacteria 9412302
982 2904707116
983 2906615569
984 2906642017 2906635258 Bacteria 8601019
985 2906665003 2906660503 Bacteria 8595048
986 2908745610 2908739725 Bacteria 8628932
987 2908763682 2908756301 Bacteria 8864324
988 2922367285 2922361189 Bacteria 7436256
989 2922390011 2922386360 Bacteria 7017218
990 2922432436
991 2935630750 2935630451 Bacteria 8169952
992 2935650478 2935648319 Bacteria 8801166
993 2935662920 2935656913 Bacteria 8965014
994 2935911235 2935908558 Bacteria 8568796
995 2935920767 2935916978 Bacteria 9113783
996 2935928264 2935926038 Bacteria 8601059
997 2935937909 2935934488 Bacteria 8602579
998 2935945191 2935942939 Bacteria 8599779
999 2935954303 2935951376 Bacteria 8602333
1000 2935971429 2935967501 Bacteria 8603075
1001 2935982049 2935975950 Bacteria 8347125
1002 2935990612 2935984226 Bacteria 8302647
1003 2936017166 2936011229 Bacteria 8801034
1004 2936026699 2936019824 Bacteria 8804134
1005 2936035442 2936028420 Bacteria 8965941
1006 2936053591 2936046547 Bacteria 8903709
1007 2936062669 2936055302 Bacteria 8785755
1008 2941507402 2941507105 Bacteria 8166816
1009 2941515829 2941515067 Bacteria 8166720
1010 2941523463 2941523033 Bacteria 8169134
1011 3005476602 3005474847 Bacteria 9259049
1012 8006934884 8006933436 Bacteria 10410654
1013 8006966127 8006964411 Bacteria 8966052
1014 8006974852 8006973647 Bacteria 10679141
1015 8006989710 8006984368 Bacteria 9651211
1016 8006998097 8006994254 Bacteria 8309700
1017 8019563775 8019555841 Bacteria 9642137
1018 8019573840 8019565922 Bacteria 9639779
1019 8019624152 8019619141 Bacteria 9218857
1020 8019637875 8019629233 Bacteria 8687553
1021 8019641749 8019638758 Bacteria 9062356
1022 8019665804 8019659431 Bacteria 8577854
1023 8019675330 8019668869 Bacteria 8791617
1024 8019680775 8019678201 Bacteria 8863603
1025 8019694993 8019687851 Bacteria 8712826
1026 8056675121 8056673599 Bacteria 7871253
1027 8056696202 8056689827 Bacteria 6712655
1028 Ga0099795_10067720
1029 JGI24032J14994_100531
1030 JGI24739J22299_10000871
1031 JGI24737J22298_10010529
1032 JGI24750J21931_1009691
1033 JGI24748J21848_1006767
1034 JGI24738J21930_10002474
1035 JGI24744J21845_10007283
1036 JGI24744J21845_10007868
1037 JGI24034J26672_10006652
1038 JGI24742J22300_10003578
1039 JGI25406J46586_10000064
1040 JGI25404J52841_10033318
1041 JGI25404J52841_10078960
1042 Ga0058859_11740492
1043 Ga0065715_10174306
1044 Ga0065715_10565648
1045 Ga0070658_10710365
1046 Ga0070676_10020837
1047 Ga0070683_100041896
1048 Ga0070690_100226054
1049 Ga0070690_100230852
1050 Ga0070670_100077132
1051 Ga0070670_100183096
1052 Ga0068869_100021302
1053 Ga0068869_100082663
1054 Ga0070680_100003647
1055 Ga0070680_100029856
1056 Ga0070680_100121614
1057 Ga0070680_100205891
1058 Ga0070680_100226621
1059 Ga0070682_100007969
1060 Ga0068868_100138279
1061 Ga0068868_100408198
1062 Ga0070660_100034303
1063 Ga0070660_100375198
1064 Ga0070689_100031062
1065 Ga0070689_100121015
1066 Ga0070689_100208226
1067 Ga0070689_100327516
1068 Ga0070691_10004859
1069 Ga0070687_100049605
1070 Ga0070687_100052564
1071 Ga0070661_100009866
1072 Ga0070692_10045412
1073 Ga0070692_10260157
1074 Ga0070668_100013726
1075 Ga0070668_100036445
1076 Ga0070668_100067131
1077 Ga0070668_100672016
1078 Ga0070669_100014406
1079 Ga0070669_100035084
1080 Ga0070669_100093037
1081 Ga0070669_100434671
1082 Ga0070675_100018170
1083 Ga0070675_100732289
1084 Ga0070671_100034258
1085 Ga0070671_100296361
1086 Ga0070671_100441341
1087 Ga0070674_100005693
1088 Ga0070674_100047397
1089 Ga0070673_100015849
1090 Ga0070688_100037805
1091 Ga0070688_100348498
1092 Ga0070688_100381848
1093 Ga0070659_100076576
1094 Ga0070659_100079331
1095 Ga0070659_100161364
1096 Ga0070659_100374802
1097 Ga0070659_100445386
1098 Ga0070667_100024258
1099 Ga0070667_100032997
1100 Ga0070667_100731541
1101 Ga0070703_10003201
1102 Ga0070713_100003057
1103 Ga0070713_100347891
1104 Ga0070710_10106609
1105 Ga0070701_10004348
1106 Ga0070711_100077792
1107 Ga0070711_100591894
1108 Ga0070705_100023373
1109 Ga0070705_100126002
1110 Ga0070705_100215842
1111 Ga0070700_100039431
1112 Ga0070694_100019693
1113 Ga0070694_100109804
1114 Ga0070708_100209630
1115 Ga0070708_100521341
1116 Ga0070708_100767105
1117 Ga0070663_100027341
1118 Ga0070663_100059872
1119 Ga0070663_100082344
1120 Ga0070663_100679161
1121 Ga0070678_100052290
1122 Ga0070678_100086184
1123 Ga0070662_100033312
1124 Ga0070662_100071711
1125 Ga0070662_100120688
1126 Ga0070681_10032947
1127 Ga0070681_10475268
1128 Ga0068867_100021271
1129 Ga0068867_100128077
1130 Ga0070685_10048441
1131 Ga0070706_100624318
1132 Ga0070684_100022473
1133 Ga0070684_100254112
1134 Ga0070697_100173177
1135 Ga0068853_100002207
1136 Ga0068853_100003634
1137 Ga0068853_100060238
1138 Ga0068853_100061086
1139 Ga0068853_100426138
1140 Ga0070672_100006742
1141 Ga0070686_100035110
1142 Ga0070695_100027274
1143 Ga0070696_100027513
1144 Ga0070693_100024374
1145 Ga0070665_100009777
1146 Ga0070665_100063185
1147 Ga0070665_100237840
1148 Ga0070665_100360172
1149 Ga0070665_100579006
1150 Ga0070665_101072015
1151 Ga0070704_100025802
1152 Ga0070704_100208955
1153 Ga0068855_100018412
1154 Ga0068855_100099837
1155 Ga0068855_100121549
1156 Ga0070664_100069419
1157 Ga0070664_100118200
1158 Ga0068857_100038621
1159 Ga0068857_100124799
1160 Ga0068854_100016856
1161 Ga0068854_100246521
1162 Ga0068856_100074006
1163 Ga0070702_100058574
1164 Ga0070702_100091658
1165 Ga0070702_100108151
1166 Ga0068852_100024735
1167 Ga0068852_100028928
1168 Ga0068852_100135745
1169 Ga0068852_100321492
1170 Ga0068852_100597485
1171 Ga0068859_100035913
1172 Ga0068859_100096333
1173 Ga0068859_100279653
1174 Ga0068864_100026533
1175 Ga0068864_100459111
1176 Ga0068866_10100091
1177 Ga0068866_10195582
1178 Ga0068861_100019676
1179 Ga0068861_100042474
1180 Ga0068861_100048184
1181 Ga0068861_100111473
1182 Ga0068861_100214160
1183 Ga0068851_10206447
1184 Ga0068870_10026852
1185 Ga0068863_100006825
1186 Ga0068863_100142125
1187 Ga0068858_100057433
1188 Ga0068858_100079901
1189 Ga0068858_100484718
1190 Ga0068858_100806662
1191 Ga0068860_100002033
1192 Ga0068860_100018432
1193 Ga0068860_100040901
1194 Ga0068860_100158101
1195 Ga0068860_100192601
1196 Ga0068860_101373457
1197 Ga0068862_100010222
1198 Ga0068862_100028055
1199 Ga0068862_100083389
1200 Ga0068862_100342269
1201 Ga0081455_10000200
1202 Ga0081455_10033922
1203 Ga0081455_10051904
1204 Ga0081455_10091058
1205 Ga0081455_10114395
1206 Ga0081538_10011493
1207 Ga0081540_1002062
1208 Ga0081540_1004242
1209 Ga0081540_1012946
1210 Ga0081540_1021026
1211 Ga0081540_1070985
1212 Ga0081539_10000099
1213 Ga0070717_10003779
1214 Ga0070717_10004793
1215 Ga0070717_10082660
1216 Ga0075365_10012654
1217 Ga0075368_10010256
1218 Ga0075368_10197072
1219 Ga0075363_100005067
1220 Ga0075363_100011785
1221 Ga0075363_100223399
1222 Ga0075363_100476049
1223 Ga0075364_10115711
1224 Ga0075364_10263586
1225 Ga0070716_100235027
1226 Ga0070712_100062605
1227 Ga0070712_100233934
1228 Ga0075367_10013887
1229 Ga0075367_10021083
1230 Ga0075366_10027167
1231 Ga0075366_10225549
1232 Ga0075366_10284461
1233 Ga0097621_100007897
1234 Ga0097621_100053560
1235 Ga0097621_100302683
1236 Ga0075370_10003183
1237 Ga0075370_10104230
1238 Ga0075370_10401972
1239 Ga0068871_100029425
1240 Ga0075428_100300564
1241 Ga0075433_10025119
1242 Ga0075433_10201324
1243 Ga0075434_100008091
1244 Ga0075434_100021009
1245 Ga0068865_100001544
1246 Ga0068865_100216332
1247 Ga0097620_100035916
1248 Ga0097620_100096333
1249 Ga0097620_100279657
1250 Ga0075435_100603384
1251 Ga0099795_10033214
1252 Ga0099795_10235779
1253 Ga0105244_10185079
1254 Ga0105250_10043606
1255 Ga0105250_10122793
1256 Ga0105240_10012128
1257 Ga0105240_10140846
1258 Ga0111539_10001808
1259 Ga0111539_10057213
1260 Ga0111539_10739166
1261 Ga0105245_10014034
1262 Ga0105245_10060262
1263 Ga0105245_10514256
1264 Ga0105247_10087187
1265 Ga0105247_10143497
1266 Ga0105247_10167620
1267 Ga0105243_10139000
1268 Ga0105243_10162608
1269 Ga0105243_10241861
1270 Ga0105241_10031108
1271 Ga0105241_10272783
1272 Ga0105241_10649305
1273 Ga0105242_10153900
1274 Ga0105242_10204421
1275 Ga0105248_10005933
1276 Ga0105248_10011779
1277 Ga0105248_10029891
1278 Ga0105248_10034176
1279 Ga0105237_10004719
1280 Ga0105237_10007432
1281 Ga0105237_10070348
1282 Ga0105237_10599999
1283 Ga0105238_10003421
1284 Ga0105238_10436192
1285 Ga0105238_10935501
1286 Ga0105249_10014723
1287 Ga0105249_10019871
1288 Ga0105249_10528641
1289 Ga0099796_10022143
1290 Ga0099796_10055610
1291 Ga0099796_10130836
1292 Ga0105239_10023212
1293 Ga0105239_10053470
1294 Ga0105239_10102667
1295 Ga0105239_10783691
1296 Ga0105239_10797822
1297 Ga0105239_11371603
1298 Ga0105246_10032205
1299 Ga0105246_10079330
1300 Ga0105246_10597510
1301 Ga0157373_10024897
1302 Ga0157373_10298226
1303 Ga0157370_10101962
1304 Ga0157369_10065365
1305 Ga0157369_10315863
1306 Ga0157374_10411201
1307 Ga0157378_10031566
1308 Ga0157378_10086387
1309 Ga0157378_10104776
1310 Ga0157378_10258421
1311 Ga0163162_10022234
1312 Ga0163162_10053512
1313 Ga0163162_10602920
1314 Ga0157372_10016582
1315 Ga0157372_10186079
1316 Ga0157375_10084799
1317 Ga0157375_10261478
1318 Ga0157375_10298866
1319 Ga0163163_10016805
1320 Ga0163163_10226212
1321 Ga0157380_10100984
1322 Ga0157377_10013798
1323 Ga0157379_10089794
1324 Ga0157379_10153801
1325 Ga0157379_10848577
1326 Ga0157376_10006128
1327 Ga0157376_10135746
1328 Ga0157376_10217613
1329 Ga0163161_10006229
1330 Ga0163161_10675526
1331 Ga0213876_10340105
1332 Ga0213875_10034248
1333 Ga0209233_1005084
1334 Ga0207666_1000311
1335 Ga0207673_1003304
1336 Ga0209758_1001737
1337 Ga0209758_1003580
1338 Ga0207697_10006626
1339 Ga0207653_10002805
1340 Ga0207682_10000009
1341 Ga0207682_10014469
1342 Ga0207692_10092310
1343 Ga0207642_10044313
1344 Ga0207710_10002730
1345 Ga0207688_10000892
1346 Ga0207688_10094545
1347 Ga0207647_10002160
1348 Ga0207685_10406230
1349 Ga0207645_10000999
1350 Ga0207645_10194083
1351 Ga0207643_10006739
1352 Ga0207705_10522401
1353 Ga0207705_10596831
1354 Ga0207654_10236456
1355 Ga0207654_10401528
1356 Ga0207707_10002224
1357 Ga0207707_10020542
1358 Ga0207695_10046019
1359 Ga0207671_10035416
1360 Ga0207671_10064994
1361 Ga0207671_10077969
1362 Ga0207671_10180264
1363 Ga0207693_10018708
1364 Ga0207693_10205162
1365 Ga0207693_10227981
1366 Ga0207663_10132464
1367 Ga0207663_10599911
1368 Ga0207660_10001283
1369 Ga0207660_10010206
1370 Ga0207660_10294273
1371 Ga0207662_10000025
1372 Ga0207662_10037874
1373 Ga0207657_10005246
1374 Ga0207657_10018108
1375 Ga0207657_10044766
1376 Ga0207657_10546461
1377 Ga0207649_10002186
1378 Ga0207652_10004348
1379 Ga0207652_10035191
1380 Ga0207681_10007074
1381 Ga0207681_10068564
1382 Ga0207681_10248997
1383 Ga0207694_10075578
1384 Ga0207694_10082962
1385 Ga0207694_10318994
1386 Ga0207650_10190498
1387 Ga0207650_10388174
1388 Ga0207650_10669745
1389 Ga0207659_10030381
1390 Ga0207659_10262721
1391 Ga0207687_10001197
1392 Ga0207687_10002549
1393 Ga0207700_10055969
1394 Ga0207700_10092879
1395 Ga0207700_10144687
1396 Ga0207700_10469555
1397 Ga0207664_10152833
1398 Ga0207664_10375743
1399 Ga0207664_10828401
1400 Ga0207644_10036076
1401 Ga0207644_10066815
1402 Ga0207644_10365892
1403 Ga0207690_10011755
1404 Ga0207690_10310657
1405 Ga0207706_10005363
1406 Ga0207706_10040844
1407 Ga0207706_10103304
1408 Ga0207686_10001310
1409 Ga0207686_10274618
1410 Ga0207709_10006190
1411 Ga0207709_10012682
1412 Ga0207709_10688635
1413 Ga0207670_10013997
1414 Ga0207670_10118723
1415 Ga0207670_10194202
1416 Ga0207670_10406048
1417 Ga0207669_10001324
1418 Ga0207669_10157264
1419 Ga0207669_10659658
1420 Ga0207704_10003457
1421 Ga0207665_10198325
1422 Ga0207691_10002604
1423 Ga0207691_10159553
1424 Ga0207711_10031474
1425 Ga0207711_10073623
1426 Ga0207711_10101876
1427 Ga0207711_10218792
1428 Ga0207689_10001156
1429 Ga0207689_10038650
1430 Ga0207689_10049010
1431 Ga0207689_10087744
1432 Ga0207661_10007789
1433 Ga0207679_10004160
1434 Ga0207667_10012980
1435 Ga0207667_10077987
1436 Ga0207667_10095327
1437 Ga0207667_10310444
1438 Ga0207667_10507823
1439 Ga0207667_10961565
1440 Ga0207651_10087185
1441 Ga0207651_10328099
1442 Ga0207712_10000579
1443 Ga0207712_10252552
1444 Ga0207668_10001403
1445 Ga0207668_10005581
1446 Ga0207668_10032114
1447 Ga0207668_10033457
1448 Ga0207668_10079730
1449 Ga0207668_10481642
1450 Ga0207640_10003644
1451 Ga0207658_10113485
1452 Ga0207658_10359771
1453 Ga0207658_10372366
1454 Ga0207658_10608626
1455 Ga0207658_10639432
1456 Ga0207703_10014416
1457 Ga0207703_10032293
1458 Ga0207639_10001866
1459 Ga0207639_10117459
1460 Ga0207639_10128563
1461 Ga0207639_10547058
1462 Ga0207678_10027315
1463 Ga0207678_10033660
1464 Ga0207678_10042596
1465 Ga0207678_10048901
1466 Ga0207678_10062786
1467 Ga0207678_10080462
1468 Ga0207678_10080882
1469 Ga0207678_10222167
1470 Ga0207708_10020931
1471 Ga0207708_10023687
1472 Ga0207708_10050635
1473 Ga0207708_10480363
1474 Ga0207702_10010946
1475 Ga0207702_10257067
1476 Ga0207702_10359494
1477 Ga0207641_10006404
1478 Ga0207641_10171571
1479 Ga0207641_10315377
1480 Ga0207648_10004627
1481 Ga0207648_10046915
1482 Ga0207648_10807228
1483 Ga0207676_10030863
1484 Ga0207676_10282270
1485 Ga0207674_10094104
1486 Ga0207674_10112597
1487 Ga0207674_10530319
1488 Ga0207675_100003859
1489 Ga0207683_10000850
1490 Ga0207683_10051919
1491 Ga0207683_10075790
1492 Ga0207683_10176198
1493 Ga0207698_10087412
1494 Ga0207698_10089661
1495 Ga0207698_10636350
1496 Ga0209984_1018261
1497 Ga0210002_1003557
1498 Ga0209998_10002588
1499 Ga0209813_10105597
1500 Ga0209974_10003747
1501 Ga0207428_10000164
1502 Ga0207428_10459443
1503 Ga0268266_10012217
1504 Ga0268266_10013853
1505 Ga0268266_10164400
1506 Ga0268266_10227310
1507 Ga0268266_10363782
1508 Ga0268266_10559329
1509 Ga0268265_10004025
1510 Ga0268265_10022554
1511 Ga0268265_10079812
1512 Ga0268264_10000174
1513 Ga0268264_10049152
1514 Ga0268264_10102694
1515 Ga0268264_10158236
1516 Ga0268264_10756675
1517 Ga0265334_10031226
1518 Ga0307517_10000859
1519 Ga0307511_10032093
1520 Ga0307512_10244813
1521 Ga0265330_10052577
1522 Ga0265332_10029296
1523 Ga0265325_10000019
1524 Ga0265339_10303624
1525 Ga0265331_10110613
1526 Ga0307513_10377142
1527 Ga0307509_10006398
1528 Ga0307509_10082116
1529 Ga0307408_100180430
1530 Ga0307408_100715716
1531 Ga0265313_10067069
1532 Ga0265313_10117892
1533 Ga0307508_10494422
1534 Ga0307516_10059646
1535 Ga0307516_10060402
1536 Ga0307405_10595972
1537 Ga0307405_11002876
1538 Ga0307413_10038231
1539 Ga0307413_10491927
1540 Ga0307407_10258970
1541 Ga0307409_100021933
1542 Ga0307416_100558321
1543 Ga0307415_100004684
1544 Ga0307507_10028588
1545 Ga0307510_10019115
1546 Ga0307510_10201911
1547 Ga0315911_1000040
1548 Ga0316215_1000931
1549 Ga0373930_0002256
1550 Ga0373948_0001906
1551 Ga0373950_0013019
1552 Ga0373959_0008747
1553 Ga0373926_0054548
1554 Ga0373926_0083666
1555 Ga0373929_0006845
1556 Ga0373929_0007992
1557 Ga0373951_0029322
1558 Ga0373952_0000933
1559 Ga0373923_0003867
1560 Ga0373923_0021124
1561 Ga0373923_0027670
1562 Ga0373932_0003751
1563 Ga0373936_0006062
1564 Ga0373936_0179144
1565 Ga0373939_0003090
1566 Ga0373941_0013201
1567 Ga0373953_0012482
1568 Ga0373953_0018244
1569 Ga0373953_0066408
1570 Ga0373954_0000213
1571 Ga0373954_0001219
1572 Ga0373954_0008152
1573 Ga0373954_0015754
1574 Ga0373954_0349097
1575 Ga0373956_0004720
1576 Ga0373956_0112176
1577 Ga0373957_0003464
1578 Ga0373957_0182082
1579 Ga0373960_0006476
1580 Ga0373943_0005037
1581 Ga0373943_0066209
1582 Ga0373943_0255544
1583 Ga0373955_0002049
1584 Ga0373955_0012895
1585 Ga0373955_0241240
1586 Ga0373955_0503749
1587 Ga0373942_0027318
1588 Ga0373961_0036817
1589 Ga0373962_0009071
1590 Ga0373924_0007721
1591 Ga0373924_0014698
1592 Ga0373931_0002611
1593 Ga0373931_0004766
1594 Ga0373935_0000942
1595 Ga0373935_0057406
1596 Ga0373927_0000528
1597 Ga0373927_0007183
1598 Ga0373927_0064676
1599 Ga0373927_0089359
1600 Ga0373927_0202177
1601 Ga0373927_0327937
1602 Ga0373933_0010853
1603 Ga0373933_0034817
1604 Ga0373933_0112377
1605 Ga0373933_0340671
1606 Ga0373947_0000455
1607 Ga0373947_0035994
1608 Ga0373947_0039442
1609 Ga0373947_0091001
1610 Ga0373947_0183995
1611 Ga0373947_0376258
1612 Ga0373937_0004613
1613 Ga0373937_0008188
1614 Ga0373937_0015336
1615 Ga0373937_0185926
1616 Ga0373937_0485225
1617 Ga0372808_023218
1618 Ga0373925_0003563
1619 Ga0373925_0023694
1620 Ga0373925_0034269
1621 Ga0373925_0081325
1622 Ga0373925_0085487
1623 Ga0373925_0154434
1624 Ga0373925_0301832
1625 Ga0373925_0466402
1626 Ga0395905_0077529
1627 Ga0436364_0157539
1628 Ga0436364_0476354
1629 Ga0436364_1289063
1630 Ga0395901_0067053
1631 Ga0436365_1698837
1632 Ga0436363_1437817
1633 Ga0439465_0132882
1634 Ga0451791_0240992
1635 Ga0451791_0284711
1636 Ga0451791_0441720
1637 Ga0451793_1400233
1638 Ga0451807_0428279
1639 Ga0451837_1412964
1640 Ga0451853_0921849
1641 Ga0451853_4011993
1642 Ga0466968_0247024
1643 Ga0495617_085353
1644 Ga0495617_165209
1645 Ga0495592_0005277
1646 Ga0495592_0021465
1647 Ga0495592_0032569
1648 Ga0495592_0218026
1649 Ga0495592_0341783
1650 Ga0495603_0000239
1651 Ga0495603_0009322
1652 Ga0495603_0058945
1653 Ga0495590_0068691
1654 Ga0495629_0000457
1655 Ga0495629_0007972
1656 Ga0495629_0225537
1657 Ga0495638_0021622
1658 Ga0495638_0076101
1659 Ga0495641_0002157
1660 Ga0495641_0094341
1661 Ga0495641_0209869
1662 Ga0495651_0014000
1663 Ga0495651_0037984
1664 Ga0495651_0054995
1665 Ga0495651_0363524
1666 Ga0495653_0004257
1667 Ga0495653_0009797
1668 Ga0495653_0021824
1669 Ga0495653_0155003
1670 Ga0495650_0051594
1671 Ga0495580_0002960
1672 Ga0495580_0198659
1673 Ga0495582_0000077
1674 Ga0495639_0000101
1675 Ga0495639_0095966
1676 Ga0495639_0179661
1677 Ga0495662_0012510
1678 Ga0495662_0033507
1679 Ga0495664_0005157
1680 Ga0495664_0038052
1681 Ga0495664_0041464
1682 Ga0495664_0432353
1683 Ga0495664_0530360
1684 Ga0495584_0046170
1685 Ga0495584_0108892
1686 Ga0495585_0031320
1687 Ga0495594_0000083
1688 Ga0495594_0186100
1689 Ga0495606_0000357
1690 Ga0495606_0313024
1691 Ga0495608_0000911
1692 Ga0495608_0004649
1693 Ga0495616_0335648
1694 Ga0495618_0003586
1695 Ga0495618_0014258
1696 Ga0495628_0023578
1697 Ga0495628_0046394
1698 Ga0495628_0055320
1699 Ga0495628_0062832
1700 Ga0495630_0074877
1701 Ga0495630_0079394
1702 Ga0495630_0167276
1703 Ga0495630_0268244
1704 Ga0495632_0015464
1705 Ga0495644_0046783
1706 Ga0495666_0037457
1707 Ga0495652_0021917
1708 Ga0495652_0046433
1709 Ga0495652_0046645
1710 Ga0495652_0145338
1711 Ga0495665_0000055
1712 Ga0495640_0011661
1713 Ga0495640_0051741
1714 Ga0495640_0053786
1715 Ga0495640_0169903
1716 Ga0495640_0486452
1717 Ga0495586_0026013
1718 Ga0495586_0590969
1719 Ga0495587_0005897
1720 Ga0495587_0011562
1721 Ga0495587_0015897
1722 Ga0495587_0165550
1723 Ga0495598_0005561
1724 Ga0495597_0148045
1725 Ga0495645_0031846
1726 Ga0495645_0042847
1727 Ga0495645_0061920
1728 Ga0495645_0331495
1729 Ga0495622_0002233
1730 Ga0495622_0128327
1731 Ga0495622_0162331
1732 Ga0495633_0094045
1733 Ga0495667_0013782
1734 Ga0495667_0021423
1735 Ga0495667_0023279
1736 Ga0495667_0048600
1737 Ga0495667_0093406
1738 Ga0495656_0008262
1739 Ga0495656_0308414
1740 Ga0495668_0114332
1741 Ga0495634_0001036
1742 Ga0495611_0063779
1743 Ga0495625_0592842
1744 Ga0495635_0000815
1745 Ga0495635_0004810
1746 Ga0495635_0011194
1747 Ga0495635_0029736
1748 Ga0495635_0053819
1749 Ga0495659_0004501
1750 Ga0495588_0005058
1751 Ga0495588_0005077
1752 Ga0495657_0003079
1753 Ga0495657_0034720
1754 Ga0495657_0068646
1755 Ga0495599_0001945
1756 Ga0495599_0097068
1757 Ga0495599_0156310
1758 Ga0495623_0001015
1759 Ga0495623_0020870
1760 Ga0495623_0077150
1761 Ga0495646_0001642
1762 Ga0495646_0014188
1763 Ga0495646_0113094
1764 Ga0495646_0189630
1765 Ga0495647_0067226
1766 Ga0495658_0001572
1767 Ga0495669_0002048
1768 Ga0495613_0003480
1769 Ga0495613_0078788
1770 Ga0495613_0092005
1771 Ga0495613_0168523
1772 Ga0495613_0660189
1773 Ga0495624_0000235
1774 Ga0495624_0050807
1775 Ga0495624_0179546
1776 Ga0495670_0192981
1777 Ga0495671_0061334
1778 Ga0495589_0184650
1779 Ga0495600_0012719
1780 Ga0495600_0015287
1781 Ga0495600_0245824
1782 Ga0495600_0339237
1783 Ga0495600_0344774
1784 Ga0495600_0574508
1785 Ga0495581_0000041
1786 Ga0495581_0196067
1787 Ga0495604_0007221
1788 Ga0495604_0272830
1789 Ga0495674_0028002
1790 Ga0495674_0036100
1791 Ga0495674_0602898
1792 Ga0495676_0018550
1793 Ga0495680_0017765
1794 Ga0495680_0028245
1795 Ga0495680_0154374
1796 Ga0495680_0414882
1797 Ga0495675_0025398
1798 Ga0495675_0048080
1799 Ga0495677_0151369
1800 Ga0495679_093047
1801 Ga0495673_0025589
1802 Ga0495684_0001399
1803 Ga0495684_0028335
1804 Ga0495684_0405869
1805 Ga0495686_0224071
1806 Ga0495593_0000024
1807 Ga0495593_0004938
1808 Ga0495593_0019588
1809 Ga0495602_0019419
1810 Ga0495602_0035012
1811 Ga0495602_0067291
1812 Ga0495626_0219016
1813 Ga0496100_0032123
1814 Ga0496100_0084124
1815 Ga0496100_0301201
1816 Ga0496100_0552808
1817 Ga0496101_0002275
1818 Ga0496101_0017665
1819 Ga0496101_0257139
1820 Ga0496101_0290603
1821 Ga0496101_0475822
1822 Ga0496102_0015668
1823 Ga0496102_0022366
1824 Ga0496102_0076164
1825 Ga0496102_0286670
1826 Ga0496102_0414593
1827 Ga0496103_0019772
1828 Ga0496103_0026671
1829 Ga0496103_0413174
1830 Ga0496104_0047895
1831 Ga0496104_0088890
1832 Ga0496104_0121736
1833 Ga0496104_0135420
1834 Ga0496104_0249235
1835 Ga0496104_0353360
1836 Ga0496105_0012396
1837 Ga0496105_0292958
1838 Ga0496105_0827525
1839 Ga0496106_0003446
1840 Ga0496106_0039727
1841 Ga0496106_0058706
1842 Ga0496106_0103687
1843 Ga0496106_0147996
1844 Ga0496106_0149447
1845 Ga0496106_0267929
1846 Ga0496106_0299272
1847 Ga0496107_0000509
1848 Ga0496107_0021914
1849 Ga0496107_0055248
1850 Ga0496107_0159541
1851 Ga0496107_0184967
1852 Ga0496107_0210648
1853 Ga0496107_0397163
1854 Ga0496108_0031275
1855 Ga0496108_0043219
1856 Ga0496108_0150590
1857 Ga0496109_0026994
1858 Ga0496109_0063752
1859 Ga0496109_0170543
1860 Ga0496109_0207049
1861 Ga0496109_0241523
1862 Ga0496109_0273602
1863 Ga0496109_0995085
1864 Ga0496110_0033752
1865 Ga0496110_0130718
1866 Ga0496110_0313674
1867 Ga0496110_0703311
1868 Ga0496110_0799685
1869 Ga0496110_0920507
1870 Ga0496111_0024753
1871 Ga0496111_0039292
1872 Ga0496111_0233770
1873 Ga0496111_0348952
1874 Ga0496111_0510088
1875 Ga0496112_0012715
1876 Ga0496112_0048594
1877 Ga0496112_0086667
1878 Ga0496112_0252685
1879 Ga0496112_0284141
1880 Ga0496113_0002503
1881 Ga0496113_0008294
1882 Ga0496113_0056499
1883 Ga0496113_0057698
1884 Ga0496113_0533929
1885 Ga0496114_0009294
1886 Ga0496114_0048418
1887 Ga0496114_0079135
1888 Ga0496114_0401699
1889 Ga0496115_0045511
1890 Ga0496115_0059345
1891 Ga0496115_0106674
1892 Ga0496115_0133773
1893 Ga0496115_0266420
1894 Ga0496117_0238499
1895 Ga0496119_0047619
1896 Ga0496121_0000927
1897 Ga0496121_0095423
1898 Ga0496121_0151137
1899 Ga0496121_0203641
1900 Ga0496124_0233805
1901 Ga0496126_0060792
1902 Ga0496126_0082014
1903 Ga0496126_0378771
1904 Ga0496126_0570173
1905 Ga0496126_0726628
1906 Ga0501032_0139342
1907 Ga0501043_0280819
1908 Ga0501046_0060334
1909 Ga0501047_0014411
1910 Ga0501067_0039577
1911 Ga0501070_0006598
1912 Ga0501044_0005514
1913 Ga0501044_0209640
1914 nmdc:mga00v17_297583_c1
1915 nmdc:mga0yw44_13282_c1
1916 nmdc:mga0yw44_168291_c1
1917 nmdc:mga0yw44_211928_c1
1918 nmdc:mga0yw44_285890_c1
1919 nmdc:mga0k408_292622_c1
1920 nmdc:mga06z11_151224_c1
1921 nmdc:mga06z11_45147_c1
1922 nmdc:mga06z11_84370_c1
1923 nmdc:mga04h51_9301_c1
1924 nmdc:mga07m45_8848_c1
1925 nmdc:mga07m45_94518_c1
1926 nmdc:mga08y16_108_c1
1927 nmdc:mga08y16_191984_c1
1928 nmdc:mga08y16_366135_c1
1929 nmdc:mga0n895_121255_c1
1930 nmdc:mga0n895_216385_c1
1931 nmdc:mga0n895_37633_c1
1932 nmdc:mga0rr50_537400_c1
1933 nmdc:mga08x19_396636_c1
1934 nmdc:mga0a205_1049_c1
1935 nmdc:mga0a205_206208_c1
1936 nmdc:mga0sz30_114689_c1
1937 Ga0495601_0009169
1938 Ga0495601_0141831
1939 Ga0495601_0173060
1940 Ga0495601_0249003
1941 Ga0495601_0250303
1942 Ga0495612_0193999
1943 Ga0500635_0001974
1944 Ga0500635_0031249
1945 Ga0495595_0000554
1946 Ga0495595_0000637
1947 Ga0495619_0001080
1948 Ga0495619_0425381
1949 Ga0500578_0445488
1950 Ga0500647_0195221
1951 Ga0500583_0009184
1952 Ga0500583_0051691
1953 Ga0500641_0005024
1954 Ga0500641_0024967
1955 Ga0500641_0133006
1956 Ga0500648_100720
1957 Ga0500595_001951
1958 Ga0500595_026055
1959 Ga0500658_0145563
1960 Ga0500658_0147074
1961 Ga0500559_0015190
1962 Ga0500568_0006709
1963 Ga0500568_0096636
1964 Ga0500573_0008543
1965 Ga0500588_0013956
1966 Ga0500588_0129991
1967 Ga0500589_021876
1968 Ga0500589_042286
1969 Ga0500590_093943
1970 Ga0500603_000226
1971 Ga0500622_0248361
1972 Ga0500634_0075126
1973 Ga0500634_0091011
1974 Ga0500639_048715
1975 Ga0500636_0013138
1976 Ga0500637_0003349
1977 Ga0500637_0165132
1978 Ga0500645_012764
1979 Ga0500596_003281
1980 2507511875
1981 2508545539
1982 2508694357
1983 2513659240
1984 2513696314
1985 2513859039
1986 2513887727
1987 2513921880
1988 2515624712
1989 2517895961
1990 2671122755
1991 2723842810
1992 2728752344
1993 2793069609
1994 2793080288
1995 2874592255
1996 2874606516
1997 2874647371
1998 2876774782
1999 2876809827
2000 2876819735
2001 2879079350
2002 2879113774
2003 2879129084
2004 2879144761
2005 2885382988
2006 2889033863
2007 2903756065
2008 2904699113
2009 2904707116
2010 2906615569
2011 2906642017
2012 2906665003
2013 2908745610
2014 2908763682
2015 2922367285
2016 2922390011
2017 2922432436
2018 2935630750
2019 2935650478
2020 2935662920
2021 2935911235
2022 2935920767
2023 2935928264
2024 2935937909
2025 2935945191
2026 2935954303
2027 2935971429
2028 2935982049
2029 2935990612
2030 2936017166
2031 2936026699
2032 2936035442
2033 2936053591
2034 2936062669
2035 2941507402
2036 2941515829
2037 2941523463
2038 3005476602
2039 8006934884
2040 8006966127
2041 8006974852
2042 8006989710
2043 8006998097
2044 8019563775
2045 8019573840
2046 8019624152
2047 8019637875
2048 8019641749
2049 8019665804
2050 8019675330
2051 8019680775
2052 8019694993
2053 8056675121
2054 8056696202

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eug-assembly1.cif.gz_n ytm1 associated nascent 60s ribosome state 3 0.8696 113 139
8eui-assembly1.cif.gz_n ytm1 associated nascent 60s ribosome (-fkbp39) state 3 0.8689 113 139
8ev3-assembly1.cif.gz_n ytm1 associated 60s nascent ribosome (-fkbp39) state 1b 0.862 113 141
8etg-assembly1.cif.gz_n fkbp39 associated 60s nascent ribosome state 3 0.8451 113 141
8fku-assembly1.cif.gz_SM human nucleolar pre-60s ribosomal subunit (state c2) 0.8448 113 139
ID Description Score Start End Superfamily
af_Q8IBZ4_29_132_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8355 12 44 2.40.50.140
af_A0A1D6MPP2_1_86_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8338 12 42 2.40.50.140
af_M9PDL2_134_240_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7685 12 48 2.40.50.140
5xyiE03 Mainly Beta;Roll;SH3 type barrels.; 0.7563 110 137 2.30.30.30
af_Q8I262_123_205_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7468 14 42 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2P9H572-F1-model_v4 DUF5666 domain-containing protein 0.9584 15 188
AF-A0A2S5TVB9-F1-model_v4 deleted 0.947 16 189
AF-A0A2P9H572-F1-model_v4 DUF5666 domain-containing protein 0.9426 15 188
AF-L2EHC2-F1-model_v4 deleted 0.9382 6 188
AF-A0A537QAT7-F1-model_v4 DUF5666 domain-containing protein 0.937 12 188

Map