F488540

General Info

Members Datasets Scaffolds Average Seq Length
1027 445 2054 364

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10248924|Ga0207674_102489242
Length 411
Sequence MSASNLPDSALLRGLTQRRLGRRDALRISGLSALGAALAACGVQGKATPGANLSAAPDVVSKFWTGKAKVGHVDFASWPLYMDPKHPQLKQFTKETGIKVNYDVFDSNEVLQTKLLAGNTGYDVVVPSASFLETQIKAGVFQKLDRSKLPNWKNLDPEILRRLALHDPGNEYAVNHMWGTTSLGYNVKKIKAIDPNAPVDSWNMIFDPKEISKFKSCGVSVLDAPDEVIGIALAYLGRDPNSEKDDDLKAAEDLLMKIRPSIRMIHSSQYIDSLANGDICLSLGWSGDVLQAKSRAEEAKQGVDIALSVPKEGTIIWFDMYAIPADAPHPDNAHAFINYMMRPDVAAANSDFVHYANGNAASLQLIDPAVRNDPGVYPPKETMDKLFPNLAHSPEYTRKMNRVWTRFTTGK

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
173 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
187 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
188 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
189 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
198 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
206 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
209 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
216 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
217 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
229 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
230 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
231 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
232 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
233 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
234 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
235 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
236 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
237 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
238 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
239 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
240 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
241 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
242 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
243 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
244 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
252 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
257 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
261 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
272 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
273 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
274 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
275 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
285 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
286 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
289 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
290 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
294 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
295 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
303 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
306 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
309 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
310 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
313 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
316 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
317 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
318 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
328 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
329 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
330 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
331 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
356 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
359 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
360 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
361 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
373 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
384 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
388 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
391 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
392 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
399 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
400 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
401 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
402 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
403 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
404 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
407 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
408 2511231004 Pseudomonas sp. GM102 Isolate Nodule
409 2511231008 Pseudomonas sp. GM21 Isolate Nodule
410 2511231010 Pseudomonas sp. GM25 Isolate Nodule
411 2511231011 Pseudomonas sp. GM30 Isolate Nodule
412 2511231012 Pseudomonas sp. GM33 Isolate Nodule
413 2511231014 Pseudomonas sp. GM48 Isolate Nodule
414 2511231015 Pseudomonas sp. GM49 Isolate Nodule
415 2511231017 Pseudomonas sp. GM55 Isolate Nodule
416 2511231018 Pseudomonas sp. GM60 Isolate Nodule
417 2511231019 Pseudomonas sp. GM67 Isolate Nodule
418 2511231020 Pseudomonas sp. GM74 Isolate Nodule
419 2511231021 Pseudomonas sp. GM78 Isolate Nodule
420 2511231023 Pseudomonas sp. GM80 Isolate Nodule
421 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
422 2534681786 Brucella suis 92/29 Isolate Unclassified
423 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
424 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
425 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
426 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
427 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
428 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
429 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
430 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
431 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
432 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
433 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
434 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
435 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
436 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
437 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
438 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
439 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
440 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
441 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
442 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
443 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
444 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
445 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.01
Metatranscriptomes 0.29
Isolates 3.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 1.56
Rhizoplane 4.38
Rhizosphere 89.58
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10248924 3300026116 Bacteria 1724
2 MRS2a_Contig_16 2124908027 Bacteria 42770
3 SwRhRL2b_contig_953756 2162886007 Bacteria 6740
4 LJNas_1001711 3300000546 Bacteria 2966
5 Ga0055530_10012102 3300003791 Bacteria 3036
6 Ga0065714_10000072 3300005288 Bacteria 12678
7 Ga0065714_10005237 3300005288 Bacteria 5203
8 Ga0065714_10066226 3300005288 Bacteria 7325
9 Ga0065714_10067131 3300005288 Bacteria 5852
10 Ga0065714_10075957 3300005288 Bacteria 2844
11 Ga0065704_10000383 3300005289 Bacteria 25333
12 Ga0065712_10008655 3300005290 Bacteria 3770
13 Ga0065712_10070719 3300005290 Bacteria 5763
14 Ga0065712_10097359 3300005290 Bacteria 2153
15 Ga0065715_10005206 3300005293 Bacteria 4027
16 Ga0065715_10179943 3300005293 Bacteria 1484
17 Ga0065707_10086325 3300005295 Bacteria 5532
18 Ga0065707_10171212 3300005295 Unclassified 1467
19 Ga0070676_10016552 3300005328 Bacteria 4078
20 Ga0070676_10026332 3300005328 Bacteria 3292
21 Ga0070676_10080007 3300005328 Bacteria 1980
22 Ga0070683_100058980 3300005329 Bacteria 3566
23 Ga0070690_100003222 3300005330 Bacteria 8903
24 Ga0070690_100004347 3300005330 Bacteria 7857
25 Ga0070690_100057243 3300005330 Bacteria 2501
26 Ga0070670_100156086 3300005331 Bacteria 1976
27 Ga0068869_100012109 3300005334 Bacteria 5686
28 Ga0070666_10000962 3300005335 Bacteria 17567
29 Ga0070666_10011348 3300005335 Bacteria 5590
30 Ga0070666_10121936 3300005335 Bacteria 1808
31 Ga0070680_100013082 3300005336 Bacteria 6459
32 Ga0070680_100035452 3300005336 Bacteria 4028
33 Ga0070680_100083582 3300005336 Bacteria 2636
34 Ga0068868_100004028 3300005338 Bacteria 10248
35 Ga0068868_100049291 3300005338 Bacteria 3305
36 Ga0070689_100003911 3300005340 Bacteria 9982
37 Ga0070687_100009013 3300005343 Bacteria 4255
38 Ga0070687_100049552 3300005343 Bacteria 2165
39 Ga0070661_100006248 3300005344 Bacteria 8219
40 Ga0070668_100278649 3300005347 Bacteria 1396
41 Ga0070669_100005076 3300005353 Bacteria 9515
42 Ga0070669_100013419 3300005353 Bacteria 5826
43 Ga0070669_100056750 3300005353 Bacteria 2871
44 Ga0070669_100076753 3300005353 Bacteria 2481
45 Ga0070675_100001269 3300005354 Bacteria 18440
46 Ga0070675_100182374 3300005354 Bacteria 1815
47 Ga0070671_100001534 3300005355 Bacteria 17343
48 Ga0070674_100009909 3300005356 Bacteria 5735
49 Ga0070673_100082082 3300005364 Bacteria 2616
50 Ga0070673_100170866 3300005364 Bacteria 1855
51 Ga0070688_100032026 3300005365 Bacteria 3167
52 Ga0070659_100158956 3300005366 Bacteria 1847
53 Ga0070667_100003021 3300005367 Bacteria 14456
54 Ga0070667_100114387 3300005367 Bacteria 2343
55 Ga0070709_10007519 3300005434 Bacteria 5977
56 Ga0070709_10035426 3300005434 Bacteria 3033
57 Ga0070714_100006553 3300005435 Bacteria 9004
58 Ga0070714_100098538 3300005435 Bacteria 2572
59 Ga0070713_100012067 3300005436 Bacteria 6326
60 Ga0070713_100056713 3300005436 Bacteria 3258
61 Ga0070713_100136448 3300005436 Bacteria 2168
62 Ga0070713_100194413 3300005436 Bacteria 1829
63 Ga0070711_100002860 3300005439 Bacteria 9931
64 Ga0070711_100079964 3300005439 Bacteria 2326
65 Ga0070711_100182802 3300005439 Bacteria 1606
66 Ga0070694_100226894 3300005444 Bacteria 1404
67 Ga0070678_100001008 3300005456 Bacteria 14634
68 Ga0070662_100003902 3300005457 Bacteria 9349
69 Ga0070662_100014075 3300005457 Bacteria 5335
70 Ga0070662_100017390 3300005457 Bacteria 4848
71 Ga0070662_100028108 3300005457 Bacteria 3911
72 Ga0070681_10001577 3300005458 Bacteria 20233
73 Ga0070681_10001582 3300005458 Bacteria 20207
74 Ga0070681_10022982 3300005458 Bacteria 6267
75 Ga0070681_10024376 3300005458 Bacteria 6090
76 Ga0070681_10104148 3300005458 Bacteria 2780
77 Ga0068867_100022954 3300005459 Bacteria 4464
78 Ga0068867_100027329 3300005459 Bacteria 4099
79 Ga0070698_100092786 3300005471 Bacteria 3000
80 Ga0070699_100023197 3300005518 Bacteria 5347
81 Ga0070699_100245641 3300005518 Bacteria 1599
82 Ga0070679_100000469 3300005530 Bacteria 34407
83 Ga0070679_100025516 3300005530 Bacteria 5801
84 Ga0070679_100034185 3300005530 Bacteria 5037
85 Ga0070679_100133096 3300005530 Bacteria 2467
86 Ga0070684_100000389 3300005535 Bacteria 30433
87 Ga0068853_100235807 3300005539 Bacteria 1675
88 Ga0070672_100004629 3300005543 Bacteria 9012
89 Ga0070672_100011940 3300005543 Bacteria 6072
90 Ga0070672_100047307 3300005543 Bacteria 3337
91 Ga0070672_100291995 3300005543 Bacteria 1380
92 Ga0070695_100001122 3300005545 Bacteria 14667
93 Ga0070696_100000233 3300005546 Bacteria 33711
94 Ga0070696_100059238 3300005546 Bacteria 2676
95 Ga0070696_100069992 3300005546 Bacteria 2467
96 Ga0070693_100066758 3300005547 Bacteria 2106
97 Ga0070665_100002122 3300005548 Bacteria 22146
98 Ga0070665_100006304 3300005548 Bacteria 12110
99 Ga0070665_100027331 3300005548 Bacteria 5747
100 Ga0070665_100077491 3300005548 Bacteria 3331
101 Ga0070704_100007227 3300005549 Bacteria 6604
102 Ga0068855_100001482 3300005563 Bacteria 29366
103 Ga0068855_100001944 3300005563 Bacteria 25660
104 Ga0068855_100020801 3300005563 Bacteria 7868
105 Ga0068855_100032489 3300005563 Bacteria 6231
106 Ga0070664_100002633 3300005564 Bacteria 14471
107 Ga0068857_100013260 3300005577 Bacteria 7179
108 Ga0068857_100091965 3300005577 Bacteria 2716
109 Ga0068854_100276653 3300005578 Bacteria 1350
110 Ga0068856_100008652 3300005614 Bacteria 9902
111 Ga0070702_100034486 3300005615 Bacteria 2790
112 Ga0068859_100008619 3300005617 Bacteria 10304
113 Ga0068859_100043274 3300005617 Bacteria 4526
114 Ga0068859_100109922 3300005617 Bacteria 2818
115 Ga0068864_100004892 3300005618 Bacteria 10973
116 Ga0068866_10008386 3300005718 Bacteria 4354
117 Ga0068861_100014206 3300005719 Bacteria 5586
118 Ga0068861_100023752 3300005719 Bacteria 4426
119 Ga0068861_100084466 3300005719 Bacteria 2492
120 Ga0068861_100111892 3300005719 Bacteria 2189
121 Ga0068861_100318503 3300005719 Bacteria 1354
122 Ga0068870_10088817 3300005840 Bacteria 1724
123 Ga0068863_100005440 3300005841 Bacteria 12546
124 Ga0068863_100011401 3300005841 Bacteria 8601
125 Ga0068858_100012168 3300005842 Bacteria 8112
126 Ga0068858_100019147 3300005842 Bacteria 6404
127 Ga0068858_100326704 3300005842 Bacteria 1467
128 Ga0068858_100391105 3300005842 Bacteria 1335
129 Ga0068860_100004196 3300005843 Bacteria 14770
130 Ga0068860_100007155 3300005843 Bacteria 11163
131 Ga0068860_100021474 3300005843 Bacteria 6251
132 Ga0068862_100004849 3300005844 Bacteria 11328
133 Ga0068862_100042263 3300005844 Bacteria 3882
134 Ga0070717_10296058 3300006028 Bacteria 1438
135 Ga0075364_10000792 3300006051 Bacteria 16666
136 Ga0075432_10002709 3300006058 Bacteria 5924
137 Ga0075432_10004298 3300006058 Bacteria 4850
138 Ga0070715_10003057 3300006163 Bacteria 5248
139 Ga0070716_100000449 3300006173 Bacteria 17023
140 Ga0070716_100042537 3300006173 Bacteria 2536
141 Ga0070712_100007685 3300006175 Bacteria 6742
142 Ga0070712_100159298 3300006175 Bacteria 1741
143 Ga0070712_100216295 3300006175 Bacteria 1514
144 Ga0075362_10007547 3300006177 Bacteria 4125
145 Ga0097621_100031096 3300006237 Bacteria 4233
146 Ga0097621_100091567 3300006237 Bacteria 2545
147 Ga0068871_100058698 3300006358 Bacteria 3133
148 Ga0068871_100186058 3300006358 Bacteria 1787
149 Ga0068871_100203953 3300006358 Bacteria 1708
150 Ga0068871_100321155 3300006358 Bacteria 1363
151 Ga0075428_100010582 3300006844 Bacteria 10252
152 Ga0075428_100068346 3300006844 Bacteria 3886
153 Ga0075428_100116803 3300006844 Bacteria 2906
154 Ga0075428_100151919 3300006844 Bacteria 2515
155 Ga0075430_100007468 3300006846 Bacteria 9227
156 Ga0075430_100031773 3300006846 Bacteria 4481
157 Ga0075430_100053905 3300006846 Bacteria 3385
158 Ga0075431_100007866 3300006847 Bacteria 10627
159 Ga0075431_100009924 3300006847 Bacteria 9565
160 Ga0075431_100081783 3300006847 Bacteria 3335
161 Ga0075431_100335748 3300006847 Bacteria 1521
162 Ga0075429_100034978 3300006880 Bacteria 4366
163 Ga0075429_100044334 3300006880 Bacteria 3870
164 Ga0068865_100000735 3300006881 Bacteria 18419
165 Ga0097620_100008619 3300006931 Bacteria 10304
166 Ga0097620_100043275 3300006931 Bacteria 4526
167 Ga0097620_100109919 3300006931 Bacteria 2818
168 Ga0079104_1000068 3300006946 Bacteria 154984
169 Ga0099826_10083695 3300006948 Bacteria 1977
170 Ga0075435_100010333 3300007076 Bacteria 6823
171 Ga0099794_10059459 3300007265 Bacteria 1854
172 Ga0099795_10000022 3300007788 Bacteria 52585
173 Ga0105251_10009643 3300009011 Bacteria 5682
174 Ga0105244_10006047 3300009036 Bacteria 7930
175 Ga0105244_10030412 3300009036 Bacteria 2874
176 Ga0105250_10006223 3300009092 Bacteria 5239
177 Ga0105250_10061266 3300009092 Bacteria 1513
178 Ga0105250_10061724 3300009092 Bacteria 1507
179 Ga0105240_10002127 3300009093 Bacteria 32338
180 Ga0105240_10002705 3300009093 Bacteria 28172
181 Ga0105240_10003826 3300009093 Bacteria 23268
182 Ga0105240_10024889 3300009093 Bacteria 7880
183 Ga0105240_10032775 3300009093 Bacteria 6721
184 Ga0105240_10130983 3300009093 Bacteria 3008
185 Ga0105240_10328419 3300009093 Bacteria 1741
186 Ga0111539_10033108 3300009094 Bacteria 6275
187 Ga0111539_10076554 3300009094 Bacteria 3939
188 Ga0111539_10077583 3300009094 Bacteria 3910
189 Ga0111539_10201499 3300009094 Bacteria 2321
190 Ga0111539_10267558 3300009094 Bacteria 1990
191 Ga0111539_10564067 3300009094 Bacteria 1326
192 Ga0105245_10007920 3300009098 Bacteria 9291
193 Ga0105245_10023209 3300009098 Bacteria 5445
194 Ga0105247_10012409 3300009101 Bacteria 5117
195 Ga0105247_10111901 3300009101 Bacteria 1758
196 Ga0105247_10121127 3300009101 Bacteria 1695
197 Ga0114129_10000367 3300009147 Bacteria 52338
198 Ga0114129_10087255 3300009147 Bacteria 4327
199 Ga0114129_10447332 3300009147 Bacteria 1695
200 Ga0105243_10027562 3300009148 Bacteria 4353
201 Ga0105243_10041735 3300009148 Bacteria 3588
202 Ga0105241_10007997 3300009174 Bacteria 7778
203 Ga0105242_10005298 3300009176 Bacteria 9957
204 Ga0105242_10082584 3300009176 Bacteria 2689
205 Ga0105242_10321662 3300009176 Bacteria 1419
206 Ga0105248_10001404 3300009177 Bacteria 26898
207 Ga0105248_10005489 3300009177 Bacteria 13923
208 Ga0105237_10008371 3300009545 Bacteria 11215
209 Ga0105237_10127911 3300009545 Bacteria 2534
210 Ga0105238_10005376 3300009551 Bacteria 12659
211 Ga0105238_10006381 3300009551 Bacteria 11732
212 Ga0105238_10161450 3300009551 Bacteria 2216
213 Ga0105249_10184405 3300009553 Bacteria 2033
214 Ga0099796_10000025 3300010159 Bacteria 37858
215 Ga0105239_10005723 3300010375 Bacteria 14518
216 Ga0105239_10052494 3300010375 Bacteria 4471
217 Ga0105239_10216510 3300010375 Bacteria 2147
218 Ga0105246_10006341 3300011119 Bacteria 7222
219 Ga0157370_10001472 3300013104 Bacteria 29117
220 Ga0157369_10065057 3300013105 Bacteria 3926
221 Ga0157369_10297375 3300013105 Bacteria 1680
222 Ga0157374_10007656 3300013296 Bacteria 9220
223 Ga0157374_10014556 3300013296 Bacteria 6885
224 Ga0157374_10156555 3300013296 Bacteria 2218
225 Ga0157374_10308818 3300013296 Bacteria 1565
226 Ga0157374_10376833 3300013296 Bacteria 1413
227 Ga0157378_10004873 3300013297 Bacteria 11772
228 Ga0157378_10122887 3300013297 Bacteria 2395
229 Ga0157378_10152685 3300013297 Bacteria 2153
230 Ga0163162_10020035 3300013306 Bacteria 6569
231 Ga0163162_10067923 3300013306 Bacteria 3616
232 Ga0163162_10111624 3300013306 Bacteria 2832
233 Ga0163162_10126118 3300013306 Bacteria 2666
234 Ga0157375_10010708 3300013308 Bacteria 8080
235 Ga0157375_10018198 3300013308 Bacteria 6367
236 Ga0157375_10039263 3300013308 Bacteria 4555
237 Ga0157375_10087488 3300013308 Bacteria 3168
238 Ga0163163_10000485 3300014325 Bacteria 35984
239 Ga0163163_10025005 3300014325 Bacteria 5688
240 Ga0163163_10101260 3300014325 Bacteria 2903
241 Ga0163163_10109176 3300014325 Bacteria 2794
242 Ga0163163_10259556 3300014325 Bacteria 1788
243 Ga0157380_10025900 3300014326 Bacteria 4450
244 Ga0157380_10031338 3300014326 Bacteria 4081
245 Ga0157380_10137624 3300014326 Unclassified 2093
246 Ga0182008_10000655 3300014497 Bacteria 25237
247 Ga0157377_10040514 3300014745 Bacteria 2580
248 Ga0157377_10106531 3300014745 Bacteria 1679
249 Ga0157379_10006630 3300014968 Bacteria 9989
250 Ga0157379_10009851 3300014968 Bacteria 8327
251 Ga0157379_10060155 3300014968 Bacteria 3396
252 Ga0157379_10160111 3300014968 Bacteria 2032
253 Ga0157376_10014926 3300014969 Bacteria 5852
254 Ga0157376_10129844 3300014969 Bacteria 2247
255 Ga0157376_10296935 3300014969 Bacteria 1528
256 Ga0182005_1001019 3300015265 Bacteria 11956
257 Ga0182005_1001549 3300015265 Bacteria 9106
258 Ga0182005_1005470 3300015265 Bacteria 3964
259 Ga0182005_1006564 3300015265 Bacteria 3540
260 Ga0163161_10000986 3300017792 Bacteria 21775
261 Ga0163161_10012623 3300017792 Bacteria 5869
262 Ga0163161_10036963 3300017792 Bacteria 3499
263 Ga0163161_10072485 3300017792 Bacteria 2522
264 Ga0163161_10081043 3300017792 Bacteria 2389
265 Ga0213874_10025026 3300021377 Bacteria 1680
266 Ga0213871_10024524 3300021441 Bacteria 1528
267 Ga0209676_1003062 3300025292 Bacteria 10785
268 Ga0209050_1000229 3300025298 Bacteria 123110
269 Ga0207696_1001869 3300025711 Bacteria 10797
270 Ga0207696_1005521 3300025711 Bacteria 5233
271 Ga0207655_1002567 3300025728 Bacteria 14523
272 Ga0207655_1035489 3300025728 Bacteria 2225
273 Ga0207713_1007553 3300025735 Bacteria 6388
274 Ga0207713_1007696 3300025735 Bacteria 6300
275 Ga0207713_1007941 3300025735 Bacteria 6182
276 Ga0207692_10069265 3300025898 Bacteria 1853
277 Ga0207642_10012317 3300025899 Bacteria 3084
278 Ga0207688_10003915 3300025901 Bacteria 8118
279 Ga0207680_10020513 3300025903 Bacteria 3559
280 Ga0207699_10009239 3300025906 Bacteria 4899
281 Ga0207699_10019729 3300025906 Bacteria 3601
282 Ga0207699_10047568 3300025906 Bacteria 2516
283 Ga0207645_10001223 3300025907 Bacteria 21174
284 Ga0207645_10008199 3300025907 Bacteria 7310
285 Ga0207645_10020611 3300025907 Bacteria 4312
286 Ga0207645_10031001 3300025907 Bacteria 3444
287 Ga0207643_10015755 3300025908 Bacteria 4117
288 Ga0207643_10054417 3300025908 Bacteria 2275
289 Ga0207654_10059460 3300025911 Bacteria 2229
290 Ga0207707_10000122 3300025912 Bacteria 80159
291 Ga0207707_10010048 3300025912 Bacteria 8208
292 Ga0207707_10026203 3300025912 Bacteria 5096
293 Ga0207707_10036563 3300025912 Bacteria 4292
294 Ga0207707_10051542 3300025912 Bacteria 3584
295 Ga0207695_10003540 3300025913 Bacteria 21874
296 Ga0207695_10009529 3300025913 Bacteria 12008
297 Ga0207695_10024867 3300025913 Bacteria 6721
298 Ga0207695_10076336 3300025913 Bacteria 3406
299 Ga0207695_10224006 3300025913 Bacteria 1787
300 Ga0207695_10282383 3300025913 Bacteria 1554
301 Ga0207671_10023246 3300025914 Bacteria 4676
302 Ga0207671_10150432 3300025914 Bacteria 1798
303 Ga0207693_10000083 3300025915 Bacteria 84611
304 Ga0207693_10018817 3300025915 Bacteria 5496
305 Ga0207693_10067420 3300025915 Bacteria 2802
306 Ga0207663_10014494 3300025916 Bacteria 4317
307 Ga0207663_10068245 3300025916 Bacteria 2283
308 Ga0207663_10103380 3300025916 Bacteria 1918
309 Ga0207660_10004896 3300025917 Bacteria 8723
310 Ga0207660_10125130 3300025917 Bacteria 1951
311 Ga0207662_10017279 3300025918 Bacteria 4079
312 Ga0207662_10049888 3300025918 Bacteria 2484
313 Ga0207649_10015857 3300025920 Bacteria 4237
314 Ga0207652_10000613 3300025921 Bacteria 35518
315 Ga0207652_10054368 3300025921 Bacteria 3442
316 Ga0207681_10023771 3300025923 Bacteria 3924
317 Ga0207681_10035475 3300025923 Bacteria 3286
318 Ga0207681_10115901 3300025923 Bacteria 1956
319 Ga0207694_10003403 3300025924 Bacteria 12669
320 Ga0207650_10151323 3300025925 Bacteria 1831
321 Ga0207700_10019447 3300025928 Bacteria 4588
322 Ga0207664_10002133 3300025929 Bacteria 13018
323 Ga0207664_10092412 3300025929 Bacteria 2483
324 Ga0207644_10054804 3300025931 Bacteria 2872
325 Ga0207706_10004326 3300025933 Bacteria 13333
326 Ga0207706_10011127 3300025933 Bacteria 8199
327 Ga0207706_10022865 3300025933 Bacteria 5610
328 Ga0207706_10049227 3300025933 Bacteria 3725
329 Ga0207706_10123377 3300025933 Bacteria 2279
330 Ga0207686_10012915 3300025934 Bacteria 4606
331 Ga0207709_10100092 3300025935 Bacteria 1914
332 Ga0207670_10018344 3300025936 Bacteria 4252
333 Ga0207704_10004318 3300025938 Bacteria 6496
334 Ga0207704_10026508 3300025938 Bacteria 3181
335 Ga0207665_10000587 3300025939 Bacteria 24539
336 Ga0207691_10001448 3300025940 Bacteria 23639
337 Ga0207691_10003491 3300025940 Bacteria 15299
338 Ga0207691_10025122 3300025940 Bacteria 5596
339 Ga0207691_10063046 3300025940 Bacteria 3362
340 Ga0207691_10089162 3300025940 Bacteria 2766
341 Ga0207711_10010034 3300025941 Bacteria 7872
342 Ga0207711_10069829 3300025941 Bacteria 3046
343 Ga0207689_10002923 3300025942 Bacteria 15774
344 Ga0207689_10119325 3300025942 Bacteria 2170
345 Ga0207679_10004598 3300025945 Bacteria 8586
346 Ga0207667_10000798 3300025949 Bacteria 40876
347 Ga0207667_10004634 3300025949 Bacteria 16866
348 Ga0207667_10010115 3300025949 Bacteria 11052
349 Ga0207667_10045147 3300025949 Bacteria 4668
350 Ga0207651_10065531 3300025960 Bacteria 2548
351 Ga0207712_10135138 3300025961 Bacteria 1885
352 Ga0207668_10018342 3300025972 Bacteria 4401
353 Ga0207658_10015483 3300025986 Bacteria 5231
354 Ga0207658_10033045 3300025986 Bacteria 3687
355 Ga0207658_10102880 3300025986 Bacteria 2241
356 Ga0207677_10011599 3300026023 Bacteria 5032
357 Ga0207703_10013397 3300026035 Bacteria 6391
358 Ga0207703_10020264 3300026035 Bacteria 5200
359 Ga0207703_10034034 3300026035 Bacteria 4041
360 Ga0207639_10187658 3300026041 Bacteria 1764
361 Ga0207702_10014159 3300026078 Bacteria 6624
362 Ga0207702_10050952 3300026078 Bacteria 3497
363 Ga0207641_10010458 3300026088 Bacteria 7625
364 Ga0207641_10013892 3300026088 Bacteria 6604
365 Ga0207641_10107192 3300026088 Bacteria 2471
366 Ga0207648_10003080 3300026089 Bacteria 17612
367 Ga0207648_10017129 3300026089 Bacteria 6604
368 Ga0207648_10031254 3300026089 Bacteria 4707
369 Ga0207676_10000965 3300026095 Bacteria 22224
370 Ga0207676_10162691 3300026095 Bacteria 1935
371 Ga0207674_10019239 3300026116 Bacteria 7402
372 Ga0207674_10038183 3300026116 Bacteria 4989
373 Ga0207674_10106883 3300026116 Bacteria 2775
374 Ga0207674_10123226 3300026116 Bacteria 2558
375 Ga0207675_100011407 3300026118 Bacteria 8317
376 Ga0207675_100021455 3300026118 Bacteria 6016
377 Ga0207675_100021604 3300026118 Bacteria 5994
378 Ga0207675_100025193 3300026118 Bacteria 5536
379 Ga0207675_100044724 3300026118 Bacteria 4138
380 Ga0207675_100120239 3300026118 Bacteria 2485
381 Ga0207683_10004897 3300026121 Bacteria 11526
382 Ga0207683_10015951 3300026121 Bacteria 6394
383 Ga0209281_1000168 3300027111 Bacteria 155116
384 Ga0209179_1000130 3300027512 Bacteria 8124
385 Ga0209968_1002478 3300027526 Bacteria 2791
386 Ga0210002_1000931 3300027617 Bacteria 4034
387 Ga0209983_1003838 3300027665 Bacteria 3184
388 Ga0209971_1001319 3300027682 Bacteria 6164
389 Ga0209966_1008616 3300027695 Bacteria 1813
390 Ga0209998_10003556 3300027717 Bacteria 3396
391 Ga0209974_10000854 3300027876 Bacteria 10513
392 Ga0209974_10000908 3300027876 Bacteria 10305
393 Ga0209974_10015078 3300027876 Bacteria 2566
394 Ga0207428_10007665 3300027907 Bacteria 9826
395 Ga0207428_10031774 3300027907 Bacteria 4350
396 Ga0207428_10037263 3300027907 Bacteria 3958
397 Ga0207428_10054420 3300027907 Bacteria 3188
398 Ga0207428_10175028 3300027907 Bacteria 1624
399 Ga0265356_1002354 3300028017 Bacteria 2543
400 Ga0268266_10001602 3300028379 Bacteria 26388
401 Ga0268266_10078755 3300028379 Bacteria 2868
402 Ga0268265_10004447 3300028380 Bacteria 9730
403 Ga0268265_10010052 3300028380 Bacteria 6389
404 Ga0268265_10027069 3300028380 Bacteria 4087
405 Ga0268265_10081988 3300028380 Bacteria 2549
406 Ga0268264_10008436 3300028381 Bacteria 8568
407 Ga0265326_10003138 3300028558 Bacteria 5468
408 Ga0265319_1034522 3300028563 Bacteria 1739
409 Ga0265334_10010215 3300028573 Bacteria 3960
410 Ga0265318_10001836 3300028577 Bacteria 12018
411 Ga0265338_10027362 3300028800 Bacteria 5722
412 Ga0265770_1000007 3300030878 Bacteria 20558
413 Ga0265771_1000279 3300031010 Bacteria 1680
414 Ga0265330_10004483 3300031235 Bacteria 7083
415 Ga0265332_10003174 3300031238 Bacteria 8001
416 Ga0265328_10001169 3300031239 Bacteria 12122
417 Ga0265328_10001255 3300031239 Bacteria 11736
418 Ga0265325_10014663 3300031241 Bacteria 4422
419 Ga0265329_10002693 3300031242 Bacteria 7987
420 Ga0265340_10031574 3300031247 Bacteria 2648
421 Ga0265316_10087366 3300031344 Bacteria 2382
422 Ga0307513_10300521 3300031456 Bacteria 1372
423 Ga0307509_10002372 3300031507 Bacteria 30641
424 Ga0307408_100167094 3300031548 Bacteria 1753
425 Ga0316579_10006989 3300031691 Bacteria 4637
426 Ga0265314_10005988 3300031711 Bacteria 10844
427 Ga0316576_10016733 3300031727 Bacteria 4964
428 Ga0316578_10032798 3300031728 Bacteria 2970
429 Ga0307516_10003963 3300031730 Bacteria 18595
430 Ga0316577_10012050 3300031733 Bacteria 4700
431 Ga0307406_10054867 3300031901 Bacteria 2545
432 Ga0307407_10026194 3300031903 Bacteria 3085
433 Ga0307412_10083076 3300031911 Bacteria 2219
434 Ga0307409_100002517 3300031995 Bacteria 9603
435 Ga0307416_100022288 3300032002 Bacteria 4569
436 Ga0307416_100373857 3300032002 Bacteria 1452
437 Ga0307415_100040526 3300032126 Bacteria 3086
438 Ga0307415_100125851 3300032126 Bacteria 1931
439 Ga0316583_10043007 3300032133 Bacteria 1596
440 Ga0316585_10009072 3300032137 Bacteria 2894
441 Ga0316585_10026871 3300032137 Bacteria 1793
442 Ga0316588_1029669 3300033528 Bacteria 1280
443 Ga0373934_0021534 3300035086 Bacteria 2483
444 Ga0373946_0018068 3300035171 Bacteria 2703
445 Ga0316574_0015922 3300035398 Bacteria 4370
446 Ga0316574_0082030 3300035398 Bacteria 2048
447 Ga0316574_0148528 3300035398 Bacteria 1511
448 Ga0373927_0006326 3300035695 Bacteria 8071
449 Ga0373927_0009759 3300035695 Bacteria 6436
450 Ga0373947_0088407 3300035725 Bacteria 1928
451 Ga0316582_0053540 3300036647 Bacteria 2567
452 Ga0373925_0005652 3300037068 Bacteria 9305
453 Ga0237819_01035 3300038705 Bacteria 8308
454 Ga0436360_0255389 3300039438 Bacteria 5832
455 Ga0436360_0257108 3300039438 Bacteria 2602
456 Ga0436363_0564042 3300039450 Bacteria 1560
457 Ga0436363_0826655 3300039450 Bacteria 1865
458 Ga0436362_0359256 3300039453 Bacteria 3298
459 Ga0439438_000155 3300041405 Bacteria 31230
460 Ga0439438_006304 3300041405 Bacteria 4211
461 Ga0439447_000840 3300041407 Bacteria 11258
462 Ga0439447_007663 3300041407 Bacteria 3401
463 Ga0439466_0001516 3300041411 Bacteria 9079
464 Ga0439466_0010091 3300041411 Bacteria 3512
465 Ga0439466_0015719 3300041411 Bacteria 2748
466 Ga0439432_014891 3300042006 Bacteria 2629
467 Ga0439451_001251 3300042009 Bacteria 5025
468 Ga0439452_001295 3300042010 Bacteria 10559
469 Ga0439456_000015 3300042013 Bacteria 66691
470 Ga0450920_000277 3300042122 Bacteria 7716
471 Ga0450922_000055 3300042124 Bacteria 10075
472 Ga0450896_005081 3300042133 Bacteria 1792
473 Ga0450902_000197 3300042137 Bacteria 7063
474 Ga0450902_000877 3300042137 Bacteria 3916
475 Ga0450903_001073 3300042138 Bacteria 5210
476 Ga0450904_000756 3300042139 Bacteria 5594
477 Ga0450905_003315 3300042142 Bacteria 2113
478 Ga0450906_011247 3300042145 Bacteria 1677
479 Ga0450907_000997 3300042146 Bacteria 6667
480 Ga0451577_0013334 3300042876 Bacteria 7697
481 Ga0451577_0062323 3300042876 Bacteria 3326
482 Ga0451577_0112387 3300042876 Bacteria 2438
483 Ga0466969_0002997 3300044656 Bacteria 8993
484 Ga0466969_0003345 3300044656 Bacteria 8536
485 Ga0466969_0053179 3300044656 Bacteria 1988
486 Ga0466966_0004455 3300044684 Bacteria 9235
487 Ga0466966_0087835 3300044684 Bacteria 1932
488 Ga0466961_0001050 3300044693 Bacteria 17009
489 Ga0466964_0022702 3300044706 Bacteria 2436
490 Ga0453684_0167831 3300044712 Bacteria 2589
491 Ga0466971_0009912 3300044719 Bacteria 4161
492 Ga0466970_0007100 3300044765 Bacteria 5603
493 Ga0466957_0004657 3300044842 Bacteria 7664
494 Ga0466959_0035356 3300045049 Bacteria 3696
495 Ga0466959_0060878 3300045049 Bacteria 2746
496 Ga0466959_0144119 3300045049 Bacteria 1681
497 Ga0451576_0023197 3300045051 Bacteria 6722
498 Ga0451576_0077150 3300045051 Bacteria 3467
499 Ga0451576_0079861 3300045051 Bacteria 3404
500 Ga0495617_000474 3300046452 Bacteria 21327
501 Ga0495617_003460 3300046452 Bacteria 5939
502 Ga0495617_003692 3300046452 Bacteria 5708
503 Ga0495617_004104 3300046452 Bacteria 5348
504 Ga0495617_006049 3300046452 Bacteria 4262
505 Ga0495617_012387 3300046452 Bacteria 2905
506 Ga0495617_061351 3300046452 Bacteria 1243
507 Ga0495627_000534 3300046453 Bacteria 31440
508 Ga0495627_000640 3300046453 Bacteria 27419
509 Ga0495627_007012 3300046453 Bacteria 4369
510 Ga0495627_012974 3300046453 Bacteria 2941
511 Ga0495627_052243 3300046453 Bacteria 1226
512 Ga0495592_0005399 3300046454 Bacteria 9435
513 Ga0495603_0001283 3300046455 Bacteria 14634
514 Ga0495603_0005913 3300046455 Bacteria 7313
515 Ga0495590_0000130 3300046457 Bacteria 44477
516 Ga0495590_0003711 3300046457 Bacteria 6217
517 Ga0495590_0005128 3300046457 Bacteria 5212
518 Ga0495590_0010681 3300046457 Bacteria 3441
519 Ga0495591_000021 3300046458 Bacteria 203554
520 Ga0495591_000150 3300046458 Bacteria 73568
521 Ga0495591_000273 3300046458 Bacteria 48617
522 Ga0495591_002178 3300046458 Bacteria 11216
523 Ga0495591_002505 3300046458 Bacteria 10150
524 Ga0495591_007189 3300046458 Bacteria 4769
525 Ga0495591_008436 3300046458 Bacteria 4220
526 Ga0495591_009648 3300046458 Bacteria 3815
527 Ga0495629_0000490 3300046459 Bacteria 33122
528 Ga0495629_0013707 3300046459 Bacteria 5850
529 Ga0495629_0111232 3300046459 Bacteria 1910
530 Ga0495638_0000947 3300046460 Bacteria 29436
531 Ga0495638_0001168 3300046460 Bacteria 25231
532 Ga0495638_0001991 3300046460 Bacteria 17423
533 Ga0495638_0002314 3300046460 Bacteria 15692
534 Ga0495638_0003073 3300046460 Bacteria 13255
535 Ga0495638_0005036 3300046460 Bacteria 9915
536 Ga0495638_0007477 3300046460 Bacteria 7829
537 Ga0495638_0008564 3300046460 Bacteria 7239
538 Ga0495638_0009288 3300046460 Bacteria 6911
539 Ga0495638_0009651 3300046460 Bacteria 6751
540 Ga0495638_0018895 3300046460 Bacteria 4568
541 Ga0495638_0020025 3300046460 Bacteria 4422
542 Ga0495638_0028419 3300046460 Bacteria 3612
543 Ga0495638_0115045 3300046460 Bacteria 1594
544 Ga0495641_0012212 3300046461 Bacteria 4821
545 Ga0495653_0070080 3300046463 Bacteria 2624
546 Ga0495650_0003285 3300046471 Bacteria 11957
547 Ga0495650_0004517 3300046471 Bacteria 9500
548 Ga0495650_0005241 3300046471 Bacteria 8506
549 Ga0495650_0009160 3300046471 Bacteria 5669
550 Ga0495650_0022637 3300046471 Bacteria 3010
551 Ga0495580_0002317 3300046472 Bacteria 16600
552 Ga0495580_0097407 3300046472 Bacteria 2046
553 Ga0495580_0131295 3300046472 Bacteria 1737
554 Ga0495582_0003939 3300046473 Bacteria 8341
555 Ga0495582_0010605 3300046473 Bacteria 5069
556 Ga0495605_0000480 3300046474 Bacteria 35032
557 Ga0495605_0002173 3300046474 Bacteria 12250
558 Ga0495605_0002997 3300046474 Bacteria 10199
559 Ga0495605_0006888 3300046474 Bacteria 6491
560 Ga0495639_0004319 3300046475 Bacteria 6095
561 Ga0495639_0005800 3300046475 Bacteria 5314
562 Ga0495639_0022287 3300046475 Bacteria 2778
563 Ga0495584_0000067 3300046491 Bacteria 73689
564 Ga0495584_0000917 3300046491 Bacteria 18791
565 Ga0495584_0001601 3300046491 Bacteria 13348
566 Ga0495584_0020071 3300046491 Bacteria 3394
567 Ga0495584_0083289 3300046491 Bacteria 1610
568 Ga0495585_0000030 3300046492 Bacteria 145184
569 Ga0495585_0000056 3300046492 Bacteria 113739
570 Ga0495585_0000335 3300046492 Bacteria 45891
571 Ga0495585_0000871 3300046492 Bacteria 25767
572 Ga0495585_0003232 3300046492 Bacteria 11116
573 Ga0495585_0003534 3300046492 Bacteria 10511
574 Ga0495585_0005465 3300046492 Bacteria 8005
575 Ga0495585_0006863 3300046492 Bacteria 7022
576 Ga0495585_0062042 3300046492 Bacteria 2053
577 Ga0495594_0001605 3300046499 Bacteria 11772
578 Ga0495594_0002194 3300046499 Bacteria 10147
579 Ga0495596_0000012 3300046500 Bacteria 125996
580 Ga0495596_0006906 3300046500 Bacteria 5172
581 Ga0495607_0001305 3300046501 Bacteria 22209
582 Ga0495607_0006997 3300046501 Bacteria 7853
583 Ga0495607_0012999 3300046501 Bacteria 5473
584 Ga0495607_0014897 3300046501 Bacteria 5053
585 Ga0495607_0020256 3300046501 Bacteria 4209
586 Ga0495583_0000112 3300046506 Bacteria 138078
587 Ga0495583_0003028 3300046506 Bacteria 13394
588 Ga0495583_0004042 3300046506 Bacteria 10794
589 Ga0495606_0002318 3300046507 Bacteria 22431
590 Ga0495606_0004165 3300046507 Bacteria 14658
591 Ga0495606_0007763 3300046507 Bacteria 9494
592 Ga0495606_0009647 3300046507 Bacteria 8131
593 Ga0495606_0083686 3300046507 Bacteria 1977
594 Ga0495610_0003225 3300046512 Bacteria 12903
595 Ga0495610_0003495 3300046512 Bacteria 12221
596 Ga0495610_0004389 3300046512 Bacteria 10438
597 Ga0495610_0004415 3300046512 Bacteria 10403
598 Ga0495610_0010870 3300046512 Bacteria 5619
599 Ga0495610_0014754 3300046512 Bacteria 4574
600 Ga0495610_0017503 3300046512 Bacteria 4083
601 Ga0495610_0030494 3300046512 Bacteria 2825
602 Ga0495616_0000251 3300046513 Bacteria 43349
603 Ga0495616_0001505 3300046513 Bacteria 16092
604 Ga0495616_0003694 3300046513 Bacteria 9775
605 Ga0495616_0006088 3300046513 Bacteria 7354
606 Ga0495616_0011509 3300046513 Bacteria 5063
607 Ga0495616_0020835 3300046513 Bacteria 3561
608 Ga0495616_0048391 3300046513 Bacteria 2137
609 Ga0495620_0000860 3300046515 Bacteria 18785
610 Ga0495620_0003461 3300046515 Bacteria 9033
611 Ga0495620_0004610 3300046515 Bacteria 7747
612 Ga0495620_0009266 3300046515 Bacteria 5242
613 Ga0495630_0003131 3300046517 Bacteria 11476
614 Ga0495630_0022286 3300046517 Bacteria 4679
615 Ga0495631_0000002 3300046518 Bacteria 178694
616 Ga0495631_0005996 3300046518 Bacteria 6321
617 Ga0495631_0008277 3300046518 Bacteria 5243
618 Ga0495632_0002079 3300046519 Bacteria 15668
619 Ga0495632_0003562 3300046519 Bacteria 10990
620 Ga0495632_0004142 3300046519 Bacteria 9959
621 Ga0495632_0004772 3300046519 Bacteria 9129
622 Ga0495632_0005080 3300046519 Bacteria 8801
623 Ga0495632_0006324 3300046519 Bacteria 7641
624 Ga0495632_0007608 3300046519 Bacteria 6776
625 Ga0495632_0008901 3300046519 Bacteria 6099
626 Ga0495632_0009802 3300046519 Bacteria 5736
627 Ga0495632_0014646 3300046519 Bacteria 4428
628 Ga0495632_0077697 3300046519 Bacteria 1587
629 Ga0495632_0096544 3300046519 Bacteria 1396
630 Ga0495637_0000246 3300046520 Bacteria 42500
631 Ga0495637_0001056 3300046520 Bacteria 17210
632 Ga0495637_0002226 3300046520 Bacteria 10798
633 Ga0495637_0003199 3300046520 Bacteria 8740
634 Ga0495637_0003357 3300046520 Bacteria 8514
635 Ga0495637_0004380 3300046520 Bacteria 7321
636 Ga0495637_0013128 3300046520 Bacteria 3939
637 Ga0495643_0004092 3300046522 Bacteria 10388
638 Ga0495643_0010664 3300046522 Bacteria 5646
639 Ga0495644_0000025 3300046523 Bacteria 75756
640 Ga0495644_0000545 3300046523 Bacteria 15914
641 Ga0495648_0000246 3300046524 Bacteria 61159
642 Ga0495648_0000981 3300046524 Bacteria 29447
643 Ga0495648_0001566 3300046524 Bacteria 22326
644 Ga0495648_0002585 3300046524 Bacteria 16582
645 Ga0495648_0007688 3300046524 Bacteria 8592
646 Ga0495648_0015779 3300046524 Bacteria 5464
647 Ga0495648_0026386 3300046524 Bacteria 3912
648 Ga0495648_0034013 3300046524 Bacteria 3323
649 Ga0495666_0002299 3300046526 Bacteria 9524
650 Ga0495666_0006761 3300046526 Bacteria 5765
651 Ga0495666_0035650 3300046526 Bacteria 2424
652 Ga0495642_0000003 3300046528 Bacteria 185425
653 Ga0495642_0000245 3300046528 Bacteria 30611
654 Ga0495654_0000225 3300046530 Bacteria 52679
655 Ga0495654_0003093 3300046530 Bacteria 10351
656 Ga0495654_0003282 3300046530 Bacteria 9979
657 Ga0495654_0004064 3300046530 Bacteria 8786
658 Ga0495654_0007273 3300046530 Bacteria 6202
659 Ga0495654_0011129 3300046530 Bacteria 4884
660 Ga0495654_0017099 3300046530 Bacteria 3818
661 Ga0495654_0033827 3300046530 Bacteria 2584
662 Ga0495654_0042546 3300046530 Bacteria 2254
663 Ga0495654_0043339 3300046530 Bacteria 2230
664 Ga0495586_0026747 3300046535 Bacteria 3087
665 Ga0495586_0033140 3300046535 Bacteria 2772
666 Ga0495587_0000989 3300046536 Bacteria 18668
667 Ga0495587_0005793 3300046536 Bacteria 8045
668 Ga0495609_0004230 3300046538 Bacteria 7930
669 Ga0495609_0006067 3300046538 Bacteria 6222
670 Ga0495609_0008112 3300046538 Bacteria 5170
671 Ga0495621_0001365 3300046539 Bacteria 6314
672 Ga0495597_0001245 3300046542 Bacteria 18852
673 Ga0495597_0001251 3300046542 Bacteria 18767
674 Ga0495597_0005566 3300046542 Bacteria 6649
675 Ga0495597_0008380 3300046542 Bacteria 5182
676 Ga0495597_0015109 3300046542 Bacteria 3660
677 Ga0495597_0015948 3300046542 Bacteria 3552
678 Ga0495597_0021618 3300046542 Bacteria 2989
679 Ga0495645_0018444 3300046543 Bacteria 5011
680 Ga0495645_0133200 3300046543 Bacteria 1740
681 Ga0495622_0004166 3300046557 Bacteria 6746
682 Ga0495622_0005166 3300046557 Bacteria 6051
683 Ga0495622_0007233 3300046557 Bacteria 5153
684 Ga0495622_0008458 3300046557 Bacteria 4764
685 Ga0495633_0000612 3300046558 Bacteria 33866
686 Ga0495633_0005129 3300046558 Bacteria 8125
687 Ga0495656_0004477 3300046615 Bacteria 4790
688 Ga0495656_0014077 3300046615 Bacteria 2991
689 Ga0495668_0000728 3300046616 Bacteria 39499
690 Ga0495668_0001396 3300046616 Bacteria 23512
691 Ga0495668_0011121 3300046616 Bacteria 5407
692 Ga0495634_0000572 3300046642 Bacteria 35710
693 Ga0495634_0006857 3300046642 Bacteria 8617
694 Ga0495634_0011150 3300046642 Bacteria 6555
695 Ga0495611_0002819 3300046648 Bacteria 7775
696 Ga0495625_0000838 3300046660 Bacteria 42224
697 Ga0495625_0001956 3300046660 Bacteria 23279
698 Ga0495625_0012219 3300046660 Bacteria 6964
699 Ga0495625_0018882 3300046660 Bacteria 5368
700 Ga0495625_0034474 3300046660 Bacteria 3736
701 Ga0495625_0053431 3300046660 Bacteria 2889
702 Ga0495625_0081578 3300046660 Bacteria 2251
703 Ga0495625_0097604 3300046660 Bacteria 2022
704 Ga0495635_0000115 3300046663 Bacteria 47781
705 Ga0495635_0000594 3300046663 Bacteria 23281
706 Ga0495635_0060343 3300046663 Bacteria 2607
707 Ga0495635_0196965 3300046663 Bacteria 1367
708 Ga0495659_0000208 3300046664 Bacteria 25391
709 Ga0495659_0035154 3300046664 Bacteria 1765
710 Ga0495661_0000100 3300046665 Bacteria 104957
711 Ga0495661_0004882 3300046665 Bacteria 9600
712 Ga0495661_0030206 3300046665 Bacteria 3453
713 Ga0495661_0034374 3300046665 Bacteria 3190
714 Ga0495661_0071738 3300046665 Bacteria 2022
715 Ga0495661_0076183 3300046665 Bacteria 1947
716 Ga0495661_0148413 3300046665 Bacteria 1268
717 Ga0495588_0005387 3300046674 Bacteria 5689
718 Ga0495588_0006858 3300046674 Bacteria 5159
719 Ga0495588_0024007 3300046674 Bacteria 3025
720 Ga0495588_0089190 3300046674 Bacteria 1614
721 Ga0495623_0004300 3300046679 Bacteria 9372
722 Ga0495646_0003836 3300046680 Bacteria 9393
723 Ga0495646_0007178 3300046680 Bacteria 7075
724 Ga0495647_0006055 3300046681 Bacteria 3986
725 Ga0495658_0012040 3300046683 Bacteria 4369
726 Ga0495658_0012173 3300046683 Bacteria 4347
727 Ga0495658_0022014 3300046683 Bacteria 3367
728 Ga0495613_0001100 3300046689 Bacteria 20643
729 Ga0495613_0007322 3300046689 Bacteria 8217
730 Ga0495613_0008530 3300046689 Bacteria 7605
731 Ga0495613_0011859 3300046689 Bacteria 6476
732 Ga0495613_0014931 3300046689 Bacteria 5763
733 Ga0495624_0000975 3300046690 Bacteria 22598
734 Ga0495670_0000596 3300046691 Bacteria 17241
735 Ga0495670_0010570 3300046691 Bacteria 4536
736 Ga0495671_0000066 3300046692 Bacteria 105167
737 Ga0495671_0000459 3300046692 Bacteria 31939
738 Ga0495671_0000814 3300046692 Bacteria 22295
739 Ga0495671_0001652 3300046692 Bacteria 14603
740 Ga0495671_0004212 3300046692 Bacteria 8659
741 Ga0495671_0004620 3300046692 Bacteria 8178
742 Ga0495671_0010838 3300046692 Bacteria 5039
743 Ga0495671_0013033 3300046692 Bacteria 4521
744 Ga0495671_0014481 3300046692 Bacteria 4243
745 Ga0495671_0100446 3300046692 Bacteria 1414
746 Ga0495649_0000404 3300046694 Bacteria 37432
747 Ga0495649_0003432 3300046694 Bacteria 10695
748 Ga0495649_0004074 3300046694 Bacteria 9614
749 Ga0495649_0005118 3300046694 Bacteria 8414
750 Ga0495649_0010434 3300046694 Bacteria 5477
751 Ga0495649_0010488 3300046694 Bacteria 5464
752 Ga0495649_0010623 3300046694 Bacteria 5424
753 Ga0495649_0012992 3300046694 Bacteria 4820
754 Ga0495589_0002746 3300046794 Bacteria 9739
755 Ga0495589_0002978 3300046794 Bacteria 9333
756 Ga0495589_0003332 3300046794 Bacteria 8718
757 Ga0495589_0004860 3300046794 Bacteria 7129
758 Ga0495589_0010325 3300046794 Bacteria 4849
759 Ga0495589_0011597 3300046794 Bacteria 4575
760 Ga0495660_0003045 3300046810 Bacteria 10458
761 Ga0495660_0005353 3300046810 Bacteria 7684
762 Ga0495660_0006453 3300046810 Bacteria 6937
763 Ga0495660_0014849 3300046810 Bacteria 4503
764 Ga0495660_0015082 3300046810 Bacteria 4468
765 Ga0495660_0018297 3300046810 Bacteria 4027
766 Ga0495660_0018860 3300046810 Bacteria 3961
767 Ga0495660_0038757 3300046810 Bacteria 2648
768 Ga0495660_0046073 3300046810 Bacteria 2392
769 Ga0495581_0000838 3300047315 Bacteria 16367
770 Ga0495604_0001248 3300047317 Bacteria 20850
771 Ga0495604_0021351 3300047317 Bacteria 5168
772 Ga0495674_0005618 3300047319 Bacteria 12021
773 Ga0495672_0000185 3300047320 Bacteria 90160
774 Ga0495672_0000247 3300047320 Bacteria 75920
775 Ga0495672_0002156 3300047320 Bacteria 18395
776 Ga0495672_0002436 3300047320 Bacteria 17130
777 Ga0495672_0003437 3300047320 Bacteria 13558
778 Ga0495672_0006184 3300047320 Bacteria 9337
779 Ga0495672_0006235 3300047320 Bacteria 9300
780 Ga0495672_0008726 3300047320 Bacteria 7433
781 Ga0495672_0014421 3300047320 Bacteria 5412
782 Ga0495672_0059405 3300047320 Bacteria 2212
783 Ga0495672_0069994 3300047320 Bacteria 1989
784 Ga0495676_0007185 3300047321 Bacteria 10215
785 Ga0495676_0177801 3300047321 Bacteria 1493
786 Ga0495680_0000029 3300047322 Bacteria 112033
787 Ga0495680_0019446 3300047322 Bacteria 5732
788 Ga0495680_0019504 3300047322 Bacteria 5720
789 Ga0495680_0115936 3300047322 Bacteria 1981
790 Ga0495683_0000037 3300047323 Bacteria 140632
791 Ga0495683_0000674 3300047323 Bacteria 25217
792 Ga0495683_0006806 3300047323 Bacteria 6212
793 Ga0495683_0009191 3300047323 Bacteria 5267
794 Ga0495683_0014115 3300047323 Bacteria 4162
795 Ga0495683_0100629 3300047323 Bacteria 1390
796 Ga0495683_0118524 3300047323 Bacteria 1258
797 Ga0495675_0004640 3300047444 Bacteria 8349
798 Ga0495677_0001883 3300047445 Bacteria 8384
799 Ga0495679_000336 3300047446 Bacteria 37066
800 Ga0495679_000402 3300047446 Bacteria 32396
801 Ga0495679_001939 3300047446 Bacteria 11047
802 Ga0495679_003604 3300047446 Bacteria 7393
803 Ga0495679_004478 3300047446 Bacteria 6425
804 Ga0495685_044248 3300047447 Bacteria 1518
805 Ga0495673_0000093 3300047469 Bacteria 185841
806 Ga0495673_0000184 3300047469 Bacteria 101002
807 Ga0495673_0000760 3300047469 Bacteria 30610
808 Ga0495673_0003126 3300047469 Bacteria 11084
809 Ga0495673_0008563 3300047469 Bacteria 5734
810 Ga0495673_0014513 3300047469 Bacteria 4093
811 Ga0495673_0023907 3300047469 Bacteria 2962
812 Ga0495681_0000082 3300047470 Bacteria 83609
813 Ga0495681_0000156 3300047470 Bacteria 57235
814 Ga0495681_0001246 3300047470 Bacteria 19318
815 Ga0495681_0004206 3300047470 Bacteria 9870
816 Ga0495681_0006108 3300047470 Bacteria 7958
817 Ga0495681_0007287 3300047470 Bacteria 7097
818 Ga0495681_0010952 3300047470 Bacteria 5445
819 Ga0495681_0014931 3300047470 Bacteria 4425
820 Ga0495684_0005960 3300047471 Bacteria 9468
821 Ga0495686_0000789 3300047472 Bacteria 41293
822 Ga0495686_0009134 3300047472 Bacteria 7181
823 Ga0495686_0045490 3300047472 Bacteria 2777
824 Ga0495686_0181060 3300047472 Bacteria 1221
825 Ga0495593_0008525 3300047673 Bacteria 5959
826 Ga0495593_0086790 3300047673 Bacteria 1613
827 Ga0495602_0001183 3300048088 Bacteria 25616
828 Ga0495602_0048266 3300048088 Bacteria 3828
829 Ga0495626_0000087 3300048091 Bacteria 122878
830 Ga0495626_0000331 3300048091 Bacteria 50083
831 Ga0495626_0000525 3300048091 Bacteria 38289
832 Ga0495626_0003549 3300048091 Bacteria 9956
833 Ga0495626_0004136 3300048091 Bacteria 9007
834 Ga0495626_0006636 3300048091 Bacteria 6560
835 Ga0495626_0010989 3300048091 Bacteria 4804
836 Ga0496100_0003273 3300048903 Bacteria 8417
837 Ga0496101_0014908 3300048904 Bacteria 5230
838 Ga0496102_0000073 3300048905 Bacteria 149887
839 Ga0496102_0006064 3300048905 Bacteria 10305
840 Ga0496102_0172769 3300048905 Bacteria 2034
841 Ga0496102_0188412 3300048905 Bacteria 1944
842 Ga0496102_0293371 3300048905 Bacteria 1533
843 Ga0496103_0000755 3300048906 Bacteria 23849
844 Ga0496103_0039847 3300048906 Bacteria 2887
845 Ga0496103_0085825 3300048906 Bacteria 1984
846 Ga0496104_0007070 3300048907 Bacteria 9899
847 Ga0496104_0032491 3300048907 Bacteria 4857
848 Ga0496104_0045553 3300048907 Bacteria 4126
849 Ga0496104_0250296 3300048907 Bacteria 1684
850 Ga0496105_0001071 3300048908 Bacteria 18940
851 Ga0496105_0010006 3300048908 Bacteria 7441
852 Ga0496105_0094327 3300048908 Bacteria 2471
853 Ga0496105_0137051 3300048908 Bacteria 2016
854 Ga0496105_0254820 3300048908 Bacteria 1421
855 Ga0496106_0013682 3300048909 Bacteria 5992
856 Ga0496106_0016835 3300048909 Bacteria 5409
857 Ga0496107_0001015 3300048910 Bacteria 16758
858 Ga0496108_0033953 3300048911 Bacteria 4237
859 Ga0496109_0006467 3300048912 Bacteria 9867
860 Ga0496109_0011659 3300048912 Bacteria 7559
861 Ga0496109_0011744 3300048912 Bacteria 7536
862 Ga0496110_0000749 3300048913 Bacteria 22420
863 Ga0496110_0016249 3300048913 Bacteria 6210
864 Ga0496110_0039290 3300048913 Bacteria 4120
865 Ga0496110_0233382 3300048913 Bacteria 1673
866 Ga0496111_0005059 3300048914 Bacteria 8392
867 Ga0496111_0030020 3300048914 Bacteria 3864
868 Ga0496112_0011589 3300048915 Bacteria 8060
869 Ga0496112_0011995 3300048915 Bacteria 7946
870 Ga0496112_0068238 3300048915 Bacteria 3511
871 Ga0496113_0016702 3300048916 Bacteria 5075
872 Ga0496113_0043997 3300048916 Bacteria 3306
873 Ga0496113_0291445 3300048916 Bacteria 1306
874 Ga0496114_0004273 3300048917 Bacteria 11058
875 Ga0496114_0004355 3300048917 Bacteria 10956
876 Ga0496115_0013919 3300048918 Bacteria 6087
877 Ga0496115_0016363 3300048918 Bacteria 5646
878 Ga0496115_0038374 3300048918 Bacteria 3801
879 Ga0496117_0015411 3300048920 Bacteria 6519
880 Ga0496118_0003254 3300048921 Bacteria 20709
881 Ga0496118_0026400 3300048921 Bacteria 4950
882 Ga0496118_0041093 3300048921 Bacteria 3666
883 Ga0496118_0072060 3300048921 Bacteria 2484
884 Ga0496119_0002302 3300048922 Bacteria 21116
885 Ga0496120_0002631 3300048923 Bacteria 17782
886 Ga0496121_0043621 3300048924 Bacteria 3880
887 Ga0496121_0052891 3300048924 Bacteria 3406
888 Ga0496124_0024592 3300048927 Bacteria 5471
889 Ga0496124_0081763 3300048927 Bacteria 2653
890 Ga0496125_0035340 3300048928 Bacteria 4386
891 Ga0496125_0061303 3300048928 Bacteria 3017
892 Ga0495678_000542 3300049459 Bacteria 36459
893 Ga0495678_004994 3300049459 Bacteria 7476
894 Ga0495678_011420 3300049459 Bacteria 4255
895 Ga0495678_016219 3300049459 Bacteria 3412
896 Ga0495678_020921 3300049459 Bacteria 2887
897 Ga0495678_061258 3300049459 Bacteria 1412
898 Ga0495682_0000020 3300049460 Bacteria 210849
899 Ga0495682_0000279 3300049460 Bacteria 40020
900 Ga0495682_0011355 3300049460 Bacteria 3429
901 Ga0495682_0042637 3300049460 Bacteria 1663
902 Ga0501034_0078672 3300049571 Bacteria 3301
903 Ga0501034_0114590 3300049571 Bacteria 2684
904 Ga0501034_0124515 3300049571 Bacteria 2563
905 Ga0501034_0143140 3300049571 Bacteria 2370
906 Ga0501036_0016758 3300049572 Bacteria 6121
907 Ga0501038_0003978 3300049574 Bacteria 13728
908 Ga0501039_0007453 3300049575 Bacteria 8349
909 Ga0501039_0028547 3300049575 Bacteria 4295
910 Ga0501039_0130473 3300049575 Bacteria 1972
911 Ga0501040_0002910 3300049576 Bacteria 11068
912 Ga0501040_0027158 3300049576 Bacteria 3852
913 Ga0501041_0020253 3300049577 Bacteria 3975
914 Ga0501042_0004113 3300049578 Bacteria 9244
915 Ga0501042_0024795 3300049578 Bacteria 4209
916 Ga0501042_0230246 3300049578 Bacteria 1337
917 Ga0501043_0113733 3300049579 Bacteria 2125
918 Ga0501046_0006557 3300049580 Bacteria 10291
919 Ga0501048_0000282 3300049582 Bacteria 34461
920 Ga0501048_0001950 3300049582 Bacteria 15676
921 Ga0501068_0001757 3300049584 Bacteria 11522
922 Ga0501068_0021133 3300049584 Bacteria 3799
923 Ga0501068_0026405 3300049584 Bacteria 3421
924 Ga0501069_0165234 3300049585 Bacteria 1275
925 Ga0501070_0085056 3300049586 Bacteria 2618
926 Ga0501071_0099108 3300049587 Bacteria 2147
927 Ga0501072_0001734 3300049588 Bacteria 16263
928 Ga0501073_0008757 3300049589 Bacteria 7490
929 Ga0501073_0070336 3300049589 Bacteria 2438
930 Ga0501074_0004678 3300049590 Bacteria 9797
931 Ga0501074_0005711 3300049590 Bacteria 8970
932 Ga0501074_0047764 3300049590 Bacteria 3093
933 Ga0501074_0086539 3300049590 Bacteria 2245
934 Ga0501076_0000955 3300049592 Bacteria 18891
935 Ga0501238_000771 3300049671 Bacteria 3617
936 Ga0501079_0000142 3300049741 Bacteria 39341
937 Ga0501079_0001187 3300049741 Bacteria 18244
938 Ga0501079_0002370 3300049741 Bacteria 13690
939 Ga0501080_0002846 3300049742 Bacteria 15209
940 Ga0501080_0069979 3300049742 Bacteria 3263
941 Ga0501080_0080217 3300049742 Bacteria 3033
942 Ga0501080_0104938 3300049742 Bacteria 2621
943 Ga0501081_0000147 3300049743 Bacteria 32041
944 Ga0501081_0000552 3300049743 Bacteria 21253
945 Ga0501083_0081976 3300049744 Bacteria 2138
946 Ga0501035_0159671 3300049822 Bacteria 1952
947 Ga0501035_0265255 3300049822 Bacteria 1455
948 Ga0501044_0146499 3300049823 Bacteria 2346
949 Ga0501045_0000401 3300049824 Bacteria 26284
950 Ga0501045_0069893 3300049824 Bacteria 2582
951 nmdc:mga03683_11227_c1 3300050489 Bacteria 3236
952 nmdc:mga00v17_525_c1 3300050491 Bacteria 21487
953 nmdc:mga00v17_84836_c1 3300050491 Bacteria 1983
954 nmdc:mga05p37_234465_c1 3300050507 Bacteria 2210
955 nmdc:mga05p37_277179_c1 3300050507 Bacteria 2001
956 nmdc:mga09592_108376_c1 3300050508 Bacteria 2382
957 nmdc:mga09592_218298_c1 3300050508 Bacteria 1652
958 nmdc:mga09592_28022_c1 3300050508 Bacteria 4677
959 nmdc:mga09592_53045_c1 3300050508 Bacteria 3423
960 nmdc:mga09592_7612_c1 3300050508 Bacteria 8811
961 nmdc:mga0qj67_148576_c1 3300050509 Bacteria 1900
962 nmdc:mga0qj67_195516_c1 3300050509 Bacteria 1643
963 nmdc:mga0qj67_4366_c1 3300050509 Bacteria 10243
964 nmdc:mga0qj67_5391_c1 3300050509 Bacteria 9335
965 nmdc:mga06r32_13988_c1 3300050510 Bacteria 7279
966 nmdc:mga06r32_70979_c1 3300050510 Bacteria 3369
967 nmdc:mga08y16_109806_c1 3300050511 Bacteria 2872
968 nmdc:mga08y16_14457_c1 3300050511 Bacteria 8303
969 nmdc:mga08y16_205111_c1 3300050511 Bacteria 2043
970 nmdc:mga08y16_2161_c1 3300050511 Bacteria 20167
971 nmdc:mga0n895_249507_c1 3300050512 Bacteria 1801
972 nmdc:mga0rr50_36990_c1 3300050513 Bacteria 3520
973 Ga0495619_0011851 3300053085 Bacteria 5491
974 Ga0500586_036145 3300053145 Bacteria 1655
975 Ga0500588_0061140 3300053146 Bacteria 1207
976 Ga0500616_0006666 3300053153 Bacteria 7509
977 Ga0500616_0010386 3300053153 Bacteria 5573
978 Ga0500622_0023584 3300053156 Bacteria 3258
979 Ga0500636_0116461 3300053177 Bacteria 1504
980 Ga0500637_0014962 3300053178 Bacteria 4100
981 Ga0500637_0064324 3300053178 Bacteria 2104
982 Ga0501084_0008950 3300054114 Bacteria 8282
983 Ga0501084_0012410 3300054114 Bacteria 7060
984 Ga0501082_0005214 3300060353 Bacteria 11299
985 Ga0501082_0013531 3300060353 Bacteria 7010
986 Ga0501082_0083364 3300060353 Bacteria 2758
987 Ga0466962_0024978 3300061719 Bacteria 2868
988 Ga0530510_0009039 3300061734 Bacteria 6983
989 Ga0530510_0040239 3300061734 Bacteria 3373
990 2511258189 2511231004 Bacteria 6669789
991 2511277120 2511231008 Bacteria 6624100
992 2511292024 2511231010 Bacteria 6373152
993 2511298825 2511231011 Bacteria 6149768
994 2511301453 2511231012 Bacteria 6738011
995 2511314730 2511231014 Bacteria 6462302
996 2511320526 2511231015 Bacteria 6598026
997 2511333733 2511231017 Bacteria 6503007
998 2511340091 2511231018 Bacteria 6436256
999 2511346834 2511231019 Bacteria 6520662
1000 2511348314 2511231020 Bacteria 6115223
1001 2511357207 2511231021 Bacteria 7302637
1002 2511371719 2511231023 Bacteria 6808468
1003 2511389348 2511231027 Bacteria 5013807
1004 2535485293 2534681786 Bacteria 3308809
1005 2643953427 2643221589 Bacteria 6250934
1006 2644021169 2643221602 Bacteria 6249926
1007 2644188236 2643221633 Bacteria 6733554
1008 2739261859 2738543015 Bacteria 6750701
1009 2765464326 2765235802 Bacteria 5618596
1010 2770194653 2767802442 Bacteria 5747986
1011 2809214402 2808606445 Bacteria 6057339
1012 2819657787 2818991456 Bacteria 6123676
1013 2837651949 2837651117 Bacteria 3772164
1014 2839994241 2839993093 Bacteria 5512535
1015 2842873045 2842871566 Bacteria 4827117
1016 2904551888 2904550169 Bacteria 6221258
1017 2904579085 2904578770 Bacteria 5302906
1018 2919122087 2919119836 Bacteria 5208557
1019 2928521975 2928521798 Bacteria 4960112
1020 2939641542 2939636861 Bacteria 6297853
1021 2939654907 2939651529 Bacteria 5895393
1022 2954014668 2954011201 Bacteria 4762601
1023 3000407783 3000405567 Bacteria 3779330
1024 3007513702 3007511990 Bacteria 6481491
1025 3007625074 3007619802 Bacteria 6411688
1026 8056128234 8056125926 Bacteria 6228218
1027 8056178745 8056177738 Bacteria 6748268
1028 Ga0207674_10248924
1029 MRS2a_Contig_16
1030 SwRhRL2b_contig_953756
1031 LJNas_1001711
1032 Ga0055530_10012102
1033 Ga0065714_10000072
1034 Ga0065714_10005237
1035 Ga0065714_10066226
1036 Ga0065714_10067131
1037 Ga0065714_10075957
1038 Ga0065704_10000383
1039 Ga0065712_10008655
1040 Ga0065712_10070719
1041 Ga0065712_10097359
1042 Ga0065715_10005206
1043 Ga0065715_10179943
1044 Ga0065707_10086325
1045 Ga0065707_10171212
1046 Ga0070676_10016552
1047 Ga0070676_10026332
1048 Ga0070676_10080007
1049 Ga0070683_100058980
1050 Ga0070690_100003222
1051 Ga0070690_100004347
1052 Ga0070690_100057243
1053 Ga0070670_100156086
1054 Ga0068869_100012109
1055 Ga0070666_10000962
1056 Ga0070666_10011348
1057 Ga0070666_10121936
1058 Ga0070680_100013082
1059 Ga0070680_100035452
1060 Ga0070680_100083582
1061 Ga0068868_100004028
1062 Ga0068868_100049291
1063 Ga0070689_100003911
1064 Ga0070687_100009013
1065 Ga0070687_100049552
1066 Ga0070661_100006248
1067 Ga0070668_100278649
1068 Ga0070669_100005076
1069 Ga0070669_100013419
1070 Ga0070669_100056750
1071 Ga0070669_100076753
1072 Ga0070675_100001269
1073 Ga0070675_100182374
1074 Ga0070671_100001534
1075 Ga0070674_100009909
1076 Ga0070673_100082082
1077 Ga0070673_100170866
1078 Ga0070688_100032026
1079 Ga0070659_100158956
1080 Ga0070667_100003021
1081 Ga0070667_100114387
1082 Ga0070709_10007519
1083 Ga0070709_10035426
1084 Ga0070714_100006553
1085 Ga0070714_100098538
1086 Ga0070713_100012067
1087 Ga0070713_100056713
1088 Ga0070713_100136448
1089 Ga0070713_100194413
1090 Ga0070711_100002860
1091 Ga0070711_100079964
1092 Ga0070711_100182802
1093 Ga0070694_100226894
1094 Ga0070678_100001008
1095 Ga0070662_100003902
1096 Ga0070662_100014075
1097 Ga0070662_100017390
1098 Ga0070662_100028108
1099 Ga0070681_10001577
1100 Ga0070681_10001582
1101 Ga0070681_10022982
1102 Ga0070681_10024376
1103 Ga0070681_10104148
1104 Ga0068867_100022954
1105 Ga0068867_100027329
1106 Ga0070698_100092786
1107 Ga0070699_100023197
1108 Ga0070699_100245641
1109 Ga0070679_100000469
1110 Ga0070679_100025516
1111 Ga0070679_100034185
1112 Ga0070679_100133096
1113 Ga0070684_100000389
1114 Ga0068853_100235807
1115 Ga0070672_100004629
1116 Ga0070672_100011940
1117 Ga0070672_100047307
1118 Ga0070672_100291995
1119 Ga0070695_100001122
1120 Ga0070696_100000233
1121 Ga0070696_100059238
1122 Ga0070696_100069992
1123 Ga0070693_100066758
1124 Ga0070665_100002122
1125 Ga0070665_100006304
1126 Ga0070665_100027331
1127 Ga0070665_100077491
1128 Ga0070704_100007227
1129 Ga0068855_100001482
1130 Ga0068855_100001944
1131 Ga0068855_100020801
1132 Ga0068855_100032489
1133 Ga0070664_100002633
1134 Ga0068857_100013260
1135 Ga0068857_100091965
1136 Ga0068854_100276653
1137 Ga0068856_100008652
1138 Ga0070702_100034486
1139 Ga0068859_100008619
1140 Ga0068859_100043274
1141 Ga0068859_100109922
1142 Ga0068864_100004892
1143 Ga0068866_10008386
1144 Ga0068861_100014206
1145 Ga0068861_100023752
1146 Ga0068861_100084466
1147 Ga0068861_100111892
1148 Ga0068861_100318503
1149 Ga0068870_10088817
1150 Ga0068863_100005440
1151 Ga0068863_100011401
1152 Ga0068858_100012168
1153 Ga0068858_100019147
1154 Ga0068858_100326704
1155 Ga0068858_100391105
1156 Ga0068860_100004196
1157 Ga0068860_100007155
1158 Ga0068860_100021474
1159 Ga0068862_100004849
1160 Ga0068862_100042263
1161 Ga0070717_10296058
1162 Ga0075364_10000792
1163 Ga0075432_10002709
1164 Ga0075432_10004298
1165 Ga0070715_10003057
1166 Ga0070716_100000449
1167 Ga0070716_100042537
1168 Ga0070712_100007685
1169 Ga0070712_100159298
1170 Ga0070712_100216295
1171 Ga0075362_10007547
1172 Ga0097621_100031096
1173 Ga0097621_100091567
1174 Ga0068871_100058698
1175 Ga0068871_100186058
1176 Ga0068871_100203953
1177 Ga0068871_100321155
1178 Ga0075428_100010582
1179 Ga0075428_100068346
1180 Ga0075428_100116803
1181 Ga0075428_100151919
1182 Ga0075430_100007468
1183 Ga0075430_100031773
1184 Ga0075430_100053905
1185 Ga0075431_100007866
1186 Ga0075431_100009924
1187 Ga0075431_100081783
1188 Ga0075431_100335748
1189 Ga0075429_100034978
1190 Ga0075429_100044334
1191 Ga0068865_100000735
1192 Ga0097620_100008619
1193 Ga0097620_100043275
1194 Ga0097620_100109919
1195 Ga0079104_1000068
1196 Ga0099826_10083695
1197 Ga0075435_100010333
1198 Ga0099794_10059459
1199 Ga0099795_10000022
1200 Ga0105251_10009643
1201 Ga0105244_10006047
1202 Ga0105244_10030412
1203 Ga0105250_10006223
1204 Ga0105250_10061266
1205 Ga0105250_10061724
1206 Ga0105240_10002127
1207 Ga0105240_10002705
1208 Ga0105240_10003826
1209 Ga0105240_10024889
1210 Ga0105240_10032775
1211 Ga0105240_10130983
1212 Ga0105240_10328419
1213 Ga0111539_10033108
1214 Ga0111539_10076554
1215 Ga0111539_10077583
1216 Ga0111539_10201499
1217 Ga0111539_10267558
1218 Ga0111539_10564067
1219 Ga0105245_10007920
1220 Ga0105245_10023209
1221 Ga0105247_10012409
1222 Ga0105247_10111901
1223 Ga0105247_10121127
1224 Ga0114129_10000367
1225 Ga0114129_10087255
1226 Ga0114129_10447332
1227 Ga0105243_10027562
1228 Ga0105243_10041735
1229 Ga0105241_10007997
1230 Ga0105242_10005298
1231 Ga0105242_10082584
1232 Ga0105242_10321662
1233 Ga0105248_10001404
1234 Ga0105248_10005489
1235 Ga0105237_10008371
1236 Ga0105237_10127911
1237 Ga0105238_10005376
1238 Ga0105238_10006381
1239 Ga0105238_10161450
1240 Ga0105249_10184405
1241 Ga0099796_10000025
1242 Ga0105239_10005723
1243 Ga0105239_10052494
1244 Ga0105239_10216510
1245 Ga0105246_10006341
1246 Ga0157370_10001472
1247 Ga0157369_10065057
1248 Ga0157369_10297375
1249 Ga0157374_10007656
1250 Ga0157374_10014556
1251 Ga0157374_10156555
1252 Ga0157374_10308818
1253 Ga0157374_10376833
1254 Ga0157378_10004873
1255 Ga0157378_10122887
1256 Ga0157378_10152685
1257 Ga0163162_10020035
1258 Ga0163162_10067923
1259 Ga0163162_10111624
1260 Ga0163162_10126118
1261 Ga0157375_10010708
1262 Ga0157375_10018198
1263 Ga0157375_10039263
1264 Ga0157375_10087488
1265 Ga0163163_10000485
1266 Ga0163163_10025005
1267 Ga0163163_10101260
1268 Ga0163163_10109176
1269 Ga0163163_10259556
1270 Ga0157380_10025900
1271 Ga0157380_10031338
1272 Ga0157380_10137624
1273 Ga0182008_10000655
1274 Ga0157377_10040514
1275 Ga0157377_10106531
1276 Ga0157379_10006630
1277 Ga0157379_10009851
1278 Ga0157379_10060155
1279 Ga0157379_10160111
1280 Ga0157376_10014926
1281 Ga0157376_10129844
1282 Ga0157376_10296935
1283 Ga0182005_1001019
1284 Ga0182005_1001549
1285 Ga0182005_1005470
1286 Ga0182005_1006564
1287 Ga0163161_10000986
1288 Ga0163161_10012623
1289 Ga0163161_10036963
1290 Ga0163161_10072485
1291 Ga0163161_10081043
1292 Ga0213874_10025026
1293 Ga0213871_10024524
1294 Ga0209676_1003062
1295 Ga0209050_1000229
1296 Ga0207696_1001869
1297 Ga0207696_1005521
1298 Ga0207655_1002567
1299 Ga0207655_1035489
1300 Ga0207713_1007553
1301 Ga0207713_1007696
1302 Ga0207713_1007941
1303 Ga0207692_10069265
1304 Ga0207642_10012317
1305 Ga0207688_10003915
1306 Ga0207680_10020513
1307 Ga0207699_10009239
1308 Ga0207699_10019729
1309 Ga0207699_10047568
1310 Ga0207645_10001223
1311 Ga0207645_10008199
1312 Ga0207645_10020611
1313 Ga0207645_10031001
1314 Ga0207643_10015755
1315 Ga0207643_10054417
1316 Ga0207654_10059460
1317 Ga0207707_10000122
1318 Ga0207707_10010048
1319 Ga0207707_10026203
1320 Ga0207707_10036563
1321 Ga0207707_10051542
1322 Ga0207695_10003540
1323 Ga0207695_10009529
1324 Ga0207695_10024867
1325 Ga0207695_10076336
1326 Ga0207695_10224006
1327 Ga0207695_10282383
1328 Ga0207671_10023246
1329 Ga0207671_10150432
1330 Ga0207693_10000083
1331 Ga0207693_10018817
1332 Ga0207693_10067420
1333 Ga0207663_10014494
1334 Ga0207663_10068245
1335 Ga0207663_10103380
1336 Ga0207660_10004896
1337 Ga0207660_10125130
1338 Ga0207662_10017279
1339 Ga0207662_10049888
1340 Ga0207649_10015857
1341 Ga0207652_10000613
1342 Ga0207652_10054368
1343 Ga0207681_10023771
1344 Ga0207681_10035475
1345 Ga0207681_10115901
1346 Ga0207694_10003403
1347 Ga0207650_10151323
1348 Ga0207700_10019447
1349 Ga0207664_10002133
1350 Ga0207664_10092412
1351 Ga0207644_10054804
1352 Ga0207706_10004326
1353 Ga0207706_10011127
1354 Ga0207706_10022865
1355 Ga0207706_10049227
1356 Ga0207706_10123377
1357 Ga0207686_10012915
1358 Ga0207709_10100092
1359 Ga0207670_10018344
1360 Ga0207704_10004318
1361 Ga0207704_10026508
1362 Ga0207665_10000587
1363 Ga0207691_10001448
1364 Ga0207691_10003491
1365 Ga0207691_10025122
1366 Ga0207691_10063046
1367 Ga0207691_10089162
1368 Ga0207711_10010034
1369 Ga0207711_10069829
1370 Ga0207689_10002923
1371 Ga0207689_10119325
1372 Ga0207679_10004598
1373 Ga0207667_10000798
1374 Ga0207667_10004634
1375 Ga0207667_10010115
1376 Ga0207667_10045147
1377 Ga0207651_10065531
1378 Ga0207712_10135138
1379 Ga0207668_10018342
1380 Ga0207658_10015483
1381 Ga0207658_10033045
1382 Ga0207658_10102880
1383 Ga0207677_10011599
1384 Ga0207703_10013397
1385 Ga0207703_10020264
1386 Ga0207703_10034034
1387 Ga0207639_10187658
1388 Ga0207702_10014159
1389 Ga0207702_10050952
1390 Ga0207641_10010458
1391 Ga0207641_10013892
1392 Ga0207641_10107192
1393 Ga0207648_10003080
1394 Ga0207648_10017129
1395 Ga0207648_10031254
1396 Ga0207676_10000965
1397 Ga0207676_10162691
1398 Ga0207674_10019239
1399 Ga0207674_10038183
1400 Ga0207674_10106883
1401 Ga0207674_10123226
1402 Ga0207675_100011407
1403 Ga0207675_100021455
1404 Ga0207675_100021604
1405 Ga0207675_100025193
1406 Ga0207675_100044724
1407 Ga0207675_100120239
1408 Ga0207683_10004897
1409 Ga0207683_10015951
1410 Ga0209281_1000168
1411 Ga0209179_1000130
1412 Ga0209968_1002478
1413 Ga0210002_1000931
1414 Ga0209983_1003838
1415 Ga0209971_1001319
1416 Ga0209966_1008616
1417 Ga0209998_10003556
1418 Ga0209974_10000854
1419 Ga0209974_10000908
1420 Ga0209974_10015078
1421 Ga0207428_10007665
1422 Ga0207428_10031774
1423 Ga0207428_10037263
1424 Ga0207428_10054420
1425 Ga0207428_10175028
1426 Ga0265356_1002354
1427 Ga0268266_10001602
1428 Ga0268266_10078755
1429 Ga0268265_10004447
1430 Ga0268265_10010052
1431 Ga0268265_10027069
1432 Ga0268265_10081988
1433 Ga0268264_10008436
1434 Ga0265326_10003138
1435 Ga0265319_1034522
1436 Ga0265334_10010215
1437 Ga0265318_10001836
1438 Ga0265338_10027362
1439 Ga0265770_1000007
1440 Ga0265771_1000279
1441 Ga0265330_10004483
1442 Ga0265332_10003174
1443 Ga0265328_10001169
1444 Ga0265328_10001255
1445 Ga0265325_10014663
1446 Ga0265329_10002693
1447 Ga0265340_10031574
1448 Ga0265316_10087366
1449 Ga0307513_10300521
1450 Ga0307509_10002372
1451 Ga0307408_100167094
1452 Ga0316579_10006989
1453 Ga0265314_10005988
1454 Ga0316576_10016733
1455 Ga0316578_10032798
1456 Ga0307516_10003963
1457 Ga0316577_10012050
1458 Ga0307406_10054867
1459 Ga0307407_10026194
1460 Ga0307412_10083076
1461 Ga0307409_100002517
1462 Ga0307416_100022288
1463 Ga0307416_100373857
1464 Ga0307415_100040526
1465 Ga0307415_100125851
1466 Ga0316583_10043007
1467 Ga0316585_10009072
1468 Ga0316585_10026871
1469 Ga0316588_1029669
1470 Ga0373934_0021534
1471 Ga0373946_0018068
1472 Ga0316574_0015922
1473 Ga0316574_0082030
1474 Ga0316574_0148528
1475 Ga0373927_0006326
1476 Ga0373927_0009759
1477 Ga0373947_0088407
1478 Ga0316582_0053540
1479 Ga0373925_0005652
1480 Ga0237819_01035
1481 Ga0436360_0255389
1482 Ga0436360_0257108
1483 Ga0436363_0564042
1484 Ga0436363_0826655
1485 Ga0436362_0359256
1486 Ga0439438_000155
1487 Ga0439438_006304
1488 Ga0439447_000840
1489 Ga0439447_007663
1490 Ga0439466_0001516
1491 Ga0439466_0010091
1492 Ga0439466_0015719
1493 Ga0439432_014891
1494 Ga0439451_001251
1495 Ga0439452_001295
1496 Ga0439456_000015
1497 Ga0450920_000277
1498 Ga0450922_000055
1499 Ga0450896_005081
1500 Ga0450902_000197
1501 Ga0450902_000877
1502 Ga0450903_001073
1503 Ga0450904_000756
1504 Ga0450905_003315
1505 Ga0450906_011247
1506 Ga0450907_000997
1507 Ga0451577_0013334
1508 Ga0451577_0062323
1509 Ga0451577_0112387
1510 Ga0466969_0002997
1511 Ga0466969_0003345
1512 Ga0466969_0053179
1513 Ga0466966_0004455
1514 Ga0466966_0087835
1515 Ga0466961_0001050
1516 Ga0466964_0022702
1517 Ga0453684_0167831
1518 Ga0466971_0009912
1519 Ga0466970_0007100
1520 Ga0466957_0004657
1521 Ga0466959_0035356
1522 Ga0466959_0060878
1523 Ga0466959_0144119
1524 Ga0451576_0023197
1525 Ga0451576_0077150
1526 Ga0451576_0079861
1527 Ga0495617_000474
1528 Ga0495617_003460
1529 Ga0495617_003692
1530 Ga0495617_004104
1531 Ga0495617_006049
1532 Ga0495617_012387
1533 Ga0495617_061351
1534 Ga0495627_000534
1535 Ga0495627_000640
1536 Ga0495627_007012
1537 Ga0495627_012974
1538 Ga0495627_052243
1539 Ga0495592_0005399
1540 Ga0495603_0001283
1541 Ga0495603_0005913
1542 Ga0495590_0000130
1543 Ga0495590_0003711
1544 Ga0495590_0005128
1545 Ga0495590_0010681
1546 Ga0495591_000021
1547 Ga0495591_000150
1548 Ga0495591_000273
1549 Ga0495591_002178
1550 Ga0495591_002505
1551 Ga0495591_007189
1552 Ga0495591_008436
1553 Ga0495591_009648
1554 Ga0495629_0000490
1555 Ga0495629_0013707
1556 Ga0495629_0111232
1557 Ga0495638_0000947
1558 Ga0495638_0001168
1559 Ga0495638_0001991
1560 Ga0495638_0002314
1561 Ga0495638_0003073
1562 Ga0495638_0005036
1563 Ga0495638_0007477
1564 Ga0495638_0008564
1565 Ga0495638_0009288
1566 Ga0495638_0009651
1567 Ga0495638_0018895
1568 Ga0495638_0020025
1569 Ga0495638_0028419
1570 Ga0495638_0115045
1571 Ga0495641_0012212
1572 Ga0495653_0070080
1573 Ga0495650_0003285
1574 Ga0495650_0004517
1575 Ga0495650_0005241
1576 Ga0495650_0009160
1577 Ga0495650_0022637
1578 Ga0495580_0002317
1579 Ga0495580_0097407
1580 Ga0495580_0131295
1581 Ga0495582_0003939
1582 Ga0495582_0010605
1583 Ga0495605_0000480
1584 Ga0495605_0002173
1585 Ga0495605_0002997
1586 Ga0495605_0006888
1587 Ga0495639_0004319
1588 Ga0495639_0005800
1589 Ga0495639_0022287
1590 Ga0495584_0000067
1591 Ga0495584_0000917
1592 Ga0495584_0001601
1593 Ga0495584_0020071
1594 Ga0495584_0083289
1595 Ga0495585_0000030
1596 Ga0495585_0000056
1597 Ga0495585_0000335
1598 Ga0495585_0000871
1599 Ga0495585_0003232
1600 Ga0495585_0003534
1601 Ga0495585_0005465
1602 Ga0495585_0006863
1603 Ga0495585_0062042
1604 Ga0495594_0001605
1605 Ga0495594_0002194
1606 Ga0495596_0000012
1607 Ga0495596_0006906
1608 Ga0495607_0001305
1609 Ga0495607_0006997
1610 Ga0495607_0012999
1611 Ga0495607_0014897
1612 Ga0495607_0020256
1613 Ga0495583_0000112
1614 Ga0495583_0003028
1615 Ga0495583_0004042
1616 Ga0495606_0002318
1617 Ga0495606_0004165
1618 Ga0495606_0007763
1619 Ga0495606_0009647
1620 Ga0495606_0083686
1621 Ga0495610_0003225
1622 Ga0495610_0003495
1623 Ga0495610_0004389
1624 Ga0495610_0004415
1625 Ga0495610_0010870
1626 Ga0495610_0014754
1627 Ga0495610_0017503
1628 Ga0495610_0030494
1629 Ga0495616_0000251
1630 Ga0495616_0001505
1631 Ga0495616_0003694
1632 Ga0495616_0006088
1633 Ga0495616_0011509
1634 Ga0495616_0020835
1635 Ga0495616_0048391
1636 Ga0495620_0000860
1637 Ga0495620_0003461
1638 Ga0495620_0004610
1639 Ga0495620_0009266
1640 Ga0495630_0003131
1641 Ga0495630_0022286
1642 Ga0495631_0000002
1643 Ga0495631_0005996
1644 Ga0495631_0008277
1645 Ga0495632_0002079
1646 Ga0495632_0003562
1647 Ga0495632_0004142
1648 Ga0495632_0004772
1649 Ga0495632_0005080
1650 Ga0495632_0006324
1651 Ga0495632_0007608
1652 Ga0495632_0008901
1653 Ga0495632_0009802
1654 Ga0495632_0014646
1655 Ga0495632_0077697
1656 Ga0495632_0096544
1657 Ga0495637_0000246
1658 Ga0495637_0001056
1659 Ga0495637_0002226
1660 Ga0495637_0003199
1661 Ga0495637_0003357
1662 Ga0495637_0004380
1663 Ga0495637_0013128
1664 Ga0495643_0004092
1665 Ga0495643_0010664
1666 Ga0495644_0000025
1667 Ga0495644_0000545
1668 Ga0495648_0000246
1669 Ga0495648_0000981
1670 Ga0495648_0001566
1671 Ga0495648_0002585
1672 Ga0495648_0007688
1673 Ga0495648_0015779
1674 Ga0495648_0026386
1675 Ga0495648_0034013
1676 Ga0495666_0002299
1677 Ga0495666_0006761
1678 Ga0495666_0035650
1679 Ga0495642_0000003
1680 Ga0495642_0000245
1681 Ga0495654_0000225
1682 Ga0495654_0003093
1683 Ga0495654_0003282
1684 Ga0495654_0004064
1685 Ga0495654_0007273
1686 Ga0495654_0011129
1687 Ga0495654_0017099
1688 Ga0495654_0033827
1689 Ga0495654_0042546
1690 Ga0495654_0043339
1691 Ga0495586_0026747
1692 Ga0495586_0033140
1693 Ga0495587_0000989
1694 Ga0495587_0005793
1695 Ga0495609_0004230
1696 Ga0495609_0006067
1697 Ga0495609_0008112
1698 Ga0495621_0001365
1699 Ga0495597_0001245
1700 Ga0495597_0001251
1701 Ga0495597_0005566
1702 Ga0495597_0008380
1703 Ga0495597_0015109
1704 Ga0495597_0015948
1705 Ga0495597_0021618
1706 Ga0495645_0018444
1707 Ga0495645_0133200
1708 Ga0495622_0004166
1709 Ga0495622_0005166
1710 Ga0495622_0007233
1711 Ga0495622_0008458
1712 Ga0495633_0000612
1713 Ga0495633_0005129
1714 Ga0495656_0004477
1715 Ga0495656_0014077
1716 Ga0495668_0000728
1717 Ga0495668_0001396
1718 Ga0495668_0011121
1719 Ga0495634_0000572
1720 Ga0495634_0006857
1721 Ga0495634_0011150
1722 Ga0495611_0002819
1723 Ga0495625_0000838
1724 Ga0495625_0001956
1725 Ga0495625_0012219
1726 Ga0495625_0018882
1727 Ga0495625_0034474
1728 Ga0495625_0053431
1729 Ga0495625_0081578
1730 Ga0495625_0097604
1731 Ga0495635_0000115
1732 Ga0495635_0000594
1733 Ga0495635_0060343
1734 Ga0495635_0196965
1735 Ga0495659_0000208
1736 Ga0495659_0035154
1737 Ga0495661_0000100
1738 Ga0495661_0004882
1739 Ga0495661_0030206
1740 Ga0495661_0034374
1741 Ga0495661_0071738
1742 Ga0495661_0076183
1743 Ga0495661_0148413
1744 Ga0495588_0005387
1745 Ga0495588_0006858
1746 Ga0495588_0024007
1747 Ga0495588_0089190
1748 Ga0495623_0004300
1749 Ga0495646_0003836
1750 Ga0495646_0007178
1751 Ga0495647_0006055
1752 Ga0495658_0012040
1753 Ga0495658_0012173
1754 Ga0495658_0022014
1755 Ga0495613_0001100
1756 Ga0495613_0007322
1757 Ga0495613_0008530
1758 Ga0495613_0011859
1759 Ga0495613_0014931
1760 Ga0495624_0000975
1761 Ga0495670_0000596
1762 Ga0495670_0010570
1763 Ga0495671_0000066
1764 Ga0495671_0000459
1765 Ga0495671_0000814
1766 Ga0495671_0001652
1767 Ga0495671_0004212
1768 Ga0495671_0004620
1769 Ga0495671_0010838
1770 Ga0495671_0013033
1771 Ga0495671_0014481
1772 Ga0495671_0100446
1773 Ga0495649_0000404
1774 Ga0495649_0003432
1775 Ga0495649_0004074
1776 Ga0495649_0005118
1777 Ga0495649_0010434
1778 Ga0495649_0010488
1779 Ga0495649_0010623
1780 Ga0495649_0012992
1781 Ga0495589_0002746
1782 Ga0495589_0002978
1783 Ga0495589_0003332
1784 Ga0495589_0004860
1785 Ga0495589_0010325
1786 Ga0495589_0011597
1787 Ga0495660_0003045
1788 Ga0495660_0005353
1789 Ga0495660_0006453
1790 Ga0495660_0014849
1791 Ga0495660_0015082
1792 Ga0495660_0018297
1793 Ga0495660_0018860
1794 Ga0495660_0038757
1795 Ga0495660_0046073
1796 Ga0495581_0000838
1797 Ga0495604_0001248
1798 Ga0495604_0021351
1799 Ga0495674_0005618
1800 Ga0495672_0000185
1801 Ga0495672_0000247
1802 Ga0495672_0002156
1803 Ga0495672_0002436
1804 Ga0495672_0003437
1805 Ga0495672_0006184
1806 Ga0495672_0006235
1807 Ga0495672_0008726
1808 Ga0495672_0014421
1809 Ga0495672_0059405
1810 Ga0495672_0069994
1811 Ga0495676_0007185
1812 Ga0495676_0177801
1813 Ga0495680_0000029
1814 Ga0495680_0019446
1815 Ga0495680_0019504
1816 Ga0495680_0115936
1817 Ga0495683_0000037
1818 Ga0495683_0000674
1819 Ga0495683_0006806
1820 Ga0495683_0009191
1821 Ga0495683_0014115
1822 Ga0495683_0100629
1823 Ga0495683_0118524
1824 Ga0495675_0004640
1825 Ga0495677_0001883
1826 Ga0495679_000336
1827 Ga0495679_000402
1828 Ga0495679_001939
1829 Ga0495679_003604
1830 Ga0495679_004478
1831 Ga0495685_044248
1832 Ga0495673_0000093
1833 Ga0495673_0000184
1834 Ga0495673_0000760
1835 Ga0495673_0003126
1836 Ga0495673_0008563
1837 Ga0495673_0014513
1838 Ga0495673_0023907
1839 Ga0495681_0000082
1840 Ga0495681_0000156
1841 Ga0495681_0001246
1842 Ga0495681_0004206
1843 Ga0495681_0006108
1844 Ga0495681_0007287
1845 Ga0495681_0010952
1846 Ga0495681_0014931
1847 Ga0495684_0005960
1848 Ga0495686_0000789
1849 Ga0495686_0009134
1850 Ga0495686_0045490
1851 Ga0495686_0181060
1852 Ga0495593_0008525
1853 Ga0495593_0086790
1854 Ga0495602_0001183
1855 Ga0495602_0048266
1856 Ga0495626_0000087
1857 Ga0495626_0000331
1858 Ga0495626_0000525
1859 Ga0495626_0003549
1860 Ga0495626_0004136
1861 Ga0495626_0006636
1862 Ga0495626_0010989
1863 Ga0496100_0003273
1864 Ga0496101_0014908
1865 Ga0496102_0000073
1866 Ga0496102_0006064
1867 Ga0496102_0172769
1868 Ga0496102_0188412
1869 Ga0496102_0293371
1870 Ga0496103_0000755
1871 Ga0496103_0039847
1872 Ga0496103_0085825
1873 Ga0496104_0007070
1874 Ga0496104_0032491
1875 Ga0496104_0045553
1876 Ga0496104_0250296
1877 Ga0496105_0001071
1878 Ga0496105_0010006
1879 Ga0496105_0094327
1880 Ga0496105_0137051
1881 Ga0496105_0254820
1882 Ga0496106_0013682
1883 Ga0496106_0016835
1884 Ga0496107_0001015
1885 Ga0496108_0033953
1886 Ga0496109_0006467
1887 Ga0496109_0011659
1888 Ga0496109_0011744
1889 Ga0496110_0000749
1890 Ga0496110_0016249
1891 Ga0496110_0039290
1892 Ga0496110_0233382
1893 Ga0496111_0005059
1894 Ga0496111_0030020
1895 Ga0496112_0011589
1896 Ga0496112_0011995
1897 Ga0496112_0068238
1898 Ga0496113_0016702
1899 Ga0496113_0043997
1900 Ga0496113_0291445
1901 Ga0496114_0004273
1902 Ga0496114_0004355
1903 Ga0496115_0013919
1904 Ga0496115_0016363
1905 Ga0496115_0038374
1906 Ga0496117_0015411
1907 Ga0496118_0003254
1908 Ga0496118_0026400
1909 Ga0496118_0041093
1910 Ga0496118_0072060
1911 Ga0496119_0002302
1912 Ga0496120_0002631
1913 Ga0496121_0043621
1914 Ga0496121_0052891
1915 Ga0496124_0024592
1916 Ga0496124_0081763
1917 Ga0496125_0035340
1918 Ga0496125_0061303
1919 Ga0495678_000542
1920 Ga0495678_004994
1921 Ga0495678_011420
1922 Ga0495678_016219
1923 Ga0495678_020921
1924 Ga0495678_061258
1925 Ga0495682_0000020
1926 Ga0495682_0000279
1927 Ga0495682_0011355
1928 Ga0495682_0042637
1929 Ga0501034_0078672
1930 Ga0501034_0114590
1931 Ga0501034_0124515
1932 Ga0501034_0143140
1933 Ga0501036_0016758
1934 Ga0501038_0003978
1935 Ga0501039_0007453
1936 Ga0501039_0028547
1937 Ga0501039_0130473
1938 Ga0501040_0002910
1939 Ga0501040_0027158
1940 Ga0501041_0020253
1941 Ga0501042_0004113
1942 Ga0501042_0024795
1943 Ga0501042_0230246
1944 Ga0501043_0113733
1945 Ga0501046_0006557
1946 Ga0501048_0000282
1947 Ga0501048_0001950
1948 Ga0501068_0001757
1949 Ga0501068_0021133
1950 Ga0501068_0026405
1951 Ga0501069_0165234
1952 Ga0501070_0085056
1953 Ga0501071_0099108
1954 Ga0501072_0001734
1955 Ga0501073_0008757
1956 Ga0501073_0070336
1957 Ga0501074_0004678
1958 Ga0501074_0005711
1959 Ga0501074_0047764
1960 Ga0501074_0086539
1961 Ga0501076_0000955
1962 Ga0501238_000771
1963 Ga0501079_0000142
1964 Ga0501079_0001187
1965 Ga0501079_0002370
1966 Ga0501080_0002846
1967 Ga0501080_0069979
1968 Ga0501080_0080217
1969 Ga0501080_0104938
1970 Ga0501081_0000147
1971 Ga0501081_0000552
1972 Ga0501083_0081976
1973 Ga0501035_0159671
1974 Ga0501035_0265255
1975 Ga0501044_0146499
1976 Ga0501045_0000401
1977 Ga0501045_0069893
1978 nmdc:mga03683_11227_c1
1979 nmdc:mga00v17_525_c1
1980 nmdc:mga00v17_84836_c1
1981 nmdc:mga05p37_234465_c1
1982 nmdc:mga05p37_277179_c1
1983 nmdc:mga09592_108376_c1
1984 nmdc:mga09592_218298_c1
1985 nmdc:mga09592_28022_c1
1986 nmdc:mga09592_53045_c1
1987 nmdc:mga09592_7612_c1
1988 nmdc:mga0qj67_148576_c1
1989 nmdc:mga0qj67_195516_c1
1990 nmdc:mga0qj67_4366_c1
1991 nmdc:mga0qj67_5391_c1
1992 nmdc:mga06r32_13988_c1
1993 nmdc:mga06r32_70979_c1
1994 nmdc:mga08y16_109806_c1
1995 nmdc:mga08y16_14457_c1
1996 nmdc:mga08y16_205111_c1
1997 nmdc:mga08y16_2161_c1
1998 nmdc:mga0n895_249507_c1
1999 nmdc:mga0rr50_36990_c1
2000 Ga0495619_0011851
2001 Ga0500586_036145
2002 Ga0500588_0061140
2003 Ga0500616_0006666
2004 Ga0500616_0010386
2005 Ga0500622_0023584
2006 Ga0500636_0116461
2007 Ga0500637_0014962
2008 Ga0500637_0064324
2009 Ga0501084_0008950
2010 Ga0501084_0012410
2011 Ga0501082_0005214
2012 Ga0501082_0013531
2013 Ga0501082_0083364
2014 Ga0466962_0024978
2015 Ga0530510_0009039
2016 Ga0530510_0040239
2017 2511258189
2018 2511277120
2019 2511292024
2020 2511298825
2021 2511301453
2022 2511314730
2023 2511320526
2024 2511333733
2025 2511340091
2026 2511346834
2027 2511348314
2028 2511357207
2029 2511371719
2030 2511389348
2031 2535485293
2032 2643953427
2033 2644021169
2034 2644188236
2035 2739261859
2036 2765464326
2037 2770194653
2038 2809214402
2039 2819657787
2040 2837651949
2041 2839994241
2042 2842873045
2043 2904551888
2044 2904579085
2045 2919122087
2046 2928521975
2047 2939641542
2048 2939654907
2049 2954014668
2050 3000407783
2051 3007513702
2052 3007625074
2053 8056128234
2054 8056178745

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

119

368

0.88

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

48

347

0.86

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

88

378

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oyt-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine 0.9707 23 360
7oyz-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d in complex with spermidine 0.9704 23 360
7oyu-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine 0.9695 23 360
7oyy-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutation s247d in complex with spermidine 0.9676 22 360
7oys-assembly1.cif.gz_A e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine 0.9666 22 360
ID Description Score Start End Superfamily
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9878 25 128 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9745 25 328 3.40.190.10
af_P31133_32_136_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9693 25 128 3.40.190.10
af_Q2G2A8_37_140_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9688 25 130 3.40.190.10
3ttnB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9685 25 328 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5R2MU04-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.9923 156 251 GO:0015846
GO:0019808
GO:0042597
AF-A0A530N1C4-F1-model_v4 deleted 0.99 20 342
AF-A0A2N3AV69-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.988 39 362 GO:0015846
GO:0019808
GO:0042597
AF-A0A2M7Y8B4-F1-model_v4 Spermidine/putrescine ABC transporter substrate-binding protein PotF 0.9839 94 362 GO:0015846
GO:0019808
GO:0042597
AF-A0A3M4DHW7-F1-model_v4 deleted 0.983 68 362

Map