F488540
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1027 | 445 | 2054 | 364 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10248924|Ga0207674_102489242 |
| Length | 411 |
| Sequence | MSASNLPDSALLRGLTQRRLGRRDALRISGLSALGAALAACGVQGKATPGANLSAAPDVVSKFWTGKAKVGHVDFASWPLYMDPKHPQLKQFTKETGIKVNYDVFDSNEVLQTKLLAGNTGYDVVVPSASFLETQIKAGVFQKLDRSKLPNWKNLDPEILRRLALHDPGNEYAVNHMWGTTSLGYNVKKIKAIDPNAPVDSWNMIFDPKEISKFKSCGVSVLDAPDEVIGIALAYLGRDPNSEKDDDLKAAEDLLMKIRPSIRMIHSSQYIDSLANGDICLSLGWSGDVLQAKSRAEEAKQGVDIALSVPKEGTIIWFDMYAIPADAPHPDNAHAFINYMMRPDVAAANSDFVHYANGNAASLQLIDPAVRNDPGVYPPKETMDKLFPNLAHSPEYTRKMNRVWTRFTTGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 82 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 119 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 120 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 188 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 192 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 204 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 206 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 207 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 208 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 210 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 216 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 217 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 228 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 229 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 230 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 231 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 232 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 233 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 234 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 235 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 236 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 237 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 238 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 239 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 240 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 241 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 242 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 243 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 244 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 250 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 251 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 252 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 253 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 254 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 354 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 355 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 356 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 357 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 358 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 359 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 360 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 381 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 389 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 399 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 400 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 401 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 402 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 404 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 407 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 408 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 409 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 410 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 411 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 412 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 413 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 414 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 415 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 416 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 417 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 418 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 419 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 420 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 421 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 422 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 423 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 424 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 425 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 426 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 427 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 428 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 429 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 430 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 431 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 432 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 433 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 434 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 435 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 436 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 437 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 438 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 439 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 440 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 441 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 442 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 443 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 444 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 445 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.01 |
| Metatranscriptomes | 0.29 |
| Isolates | 3.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.56 |
| Nodule | 1.56 |
| Rhizoplane | 4.38 |
| Rhizosphere | 89.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207674_10248924 | 3300026116 | Bacteria | 1724 |
| 2 | MRS2a_Contig_16 | 2124908027 | Bacteria | 42770 |
| 3 | SwRhRL2b_contig_953756 | 2162886007 | Bacteria | 6740 |
| 4 | LJNas_1001711 | 3300000546 | Bacteria | 2966 |
| 5 | Ga0055530_10012102 | 3300003791 | Bacteria | 3036 |
| 6 | Ga0065714_10000072 | 3300005288 | Bacteria | 12678 |
| 7 | Ga0065714_10005237 | 3300005288 | Bacteria | 5203 |
| 8 | Ga0065714_10066226 | 3300005288 | Bacteria | 7325 |
| 9 | Ga0065714_10067131 | 3300005288 | Bacteria | 5852 |
| 10 | Ga0065714_10075957 | 3300005288 | Bacteria | 2844 |
| 11 | Ga0065704_10000383 | 3300005289 | Bacteria | 25333 |
| 12 | Ga0065712_10008655 | 3300005290 | Bacteria | 3770 |
| 13 | Ga0065712_10070719 | 3300005290 | Bacteria | 5763 |
| 14 | Ga0065712_10097359 | 3300005290 | Bacteria | 2153 |
| 15 | Ga0065715_10005206 | 3300005293 | Bacteria | 4027 |
| 16 | Ga0065715_10179943 | 3300005293 | Bacteria | 1484 |
| 17 | Ga0065707_10086325 | 3300005295 | Bacteria | 5532 |
| 18 | Ga0065707_10171212 | 3300005295 | Unclassified | 1467 |
| 19 | Ga0070676_10016552 | 3300005328 | Bacteria | 4078 |
| 20 | Ga0070676_10026332 | 3300005328 | Bacteria | 3292 |
| 21 | Ga0070676_10080007 | 3300005328 | Bacteria | 1980 |
| 22 | Ga0070683_100058980 | 3300005329 | Bacteria | 3566 |
| 23 | Ga0070690_100003222 | 3300005330 | Bacteria | 8903 |
| 24 | Ga0070690_100004347 | 3300005330 | Bacteria | 7857 |
| 25 | Ga0070690_100057243 | 3300005330 | Bacteria | 2501 |
| 26 | Ga0070670_100156086 | 3300005331 | Bacteria | 1976 |
| 27 | Ga0068869_100012109 | 3300005334 | Bacteria | 5686 |
| 28 | Ga0070666_10000962 | 3300005335 | Bacteria | 17567 |
| 29 | Ga0070666_10011348 | 3300005335 | Bacteria | 5590 |
| 30 | Ga0070666_10121936 | 3300005335 | Bacteria | 1808 |
| 31 | Ga0070680_100013082 | 3300005336 | Bacteria | 6459 |
| 32 | Ga0070680_100035452 | 3300005336 | Bacteria | 4028 |
| 33 | Ga0070680_100083582 | 3300005336 | Bacteria | 2636 |
| 34 | Ga0068868_100004028 | 3300005338 | Bacteria | 10248 |
| 35 | Ga0068868_100049291 | 3300005338 | Bacteria | 3305 |
| 36 | Ga0070689_100003911 | 3300005340 | Bacteria | 9982 |
| 37 | Ga0070687_100009013 | 3300005343 | Bacteria | 4255 |
| 38 | Ga0070687_100049552 | 3300005343 | Bacteria | 2165 |
| 39 | Ga0070661_100006248 | 3300005344 | Bacteria | 8219 |
| 40 | Ga0070668_100278649 | 3300005347 | Bacteria | 1396 |
| 41 | Ga0070669_100005076 | 3300005353 | Bacteria | 9515 |
| 42 | Ga0070669_100013419 | 3300005353 | Bacteria | 5826 |
| 43 | Ga0070669_100056750 | 3300005353 | Bacteria | 2871 |
| 44 | Ga0070669_100076753 | 3300005353 | Bacteria | 2481 |
| 45 | Ga0070675_100001269 | 3300005354 | Bacteria | 18440 |
| 46 | Ga0070675_100182374 | 3300005354 | Bacteria | 1815 |
| 47 | Ga0070671_100001534 | 3300005355 | Bacteria | 17343 |
| 48 | Ga0070674_100009909 | 3300005356 | Bacteria | 5735 |
| 49 | Ga0070673_100082082 | 3300005364 | Bacteria | 2616 |
| 50 | Ga0070673_100170866 | 3300005364 | Bacteria | 1855 |
| 51 | Ga0070688_100032026 | 3300005365 | Bacteria | 3167 |
| 52 | Ga0070659_100158956 | 3300005366 | Bacteria | 1847 |
| 53 | Ga0070667_100003021 | 3300005367 | Bacteria | 14456 |
| 54 | Ga0070667_100114387 | 3300005367 | Bacteria | 2343 |
| 55 | Ga0070709_10007519 | 3300005434 | Bacteria | 5977 |
| 56 | Ga0070709_10035426 | 3300005434 | Bacteria | 3033 |
| 57 | Ga0070714_100006553 | 3300005435 | Bacteria | 9004 |
| 58 | Ga0070714_100098538 | 3300005435 | Bacteria | 2572 |
| 59 | Ga0070713_100012067 | 3300005436 | Bacteria | 6326 |
| 60 | Ga0070713_100056713 | 3300005436 | Bacteria | 3258 |
| 61 | Ga0070713_100136448 | 3300005436 | Bacteria | 2168 |
| 62 | Ga0070713_100194413 | 3300005436 | Bacteria | 1829 |
| 63 | Ga0070711_100002860 | 3300005439 | Bacteria | 9931 |
| 64 | Ga0070711_100079964 | 3300005439 | Bacteria | 2326 |
| 65 | Ga0070711_100182802 | 3300005439 | Bacteria | 1606 |
| 66 | Ga0070694_100226894 | 3300005444 | Bacteria | 1404 |
| 67 | Ga0070678_100001008 | 3300005456 | Bacteria | 14634 |
| 68 | Ga0070662_100003902 | 3300005457 | Bacteria | 9349 |
| 69 | Ga0070662_100014075 | 3300005457 | Bacteria | 5335 |
| 70 | Ga0070662_100017390 | 3300005457 | Bacteria | 4848 |
| 71 | Ga0070662_100028108 | 3300005457 | Bacteria | 3911 |
| 72 | Ga0070681_10001577 | 3300005458 | Bacteria | 20233 |
| 73 | Ga0070681_10001582 | 3300005458 | Bacteria | 20207 |
| 74 | Ga0070681_10022982 | 3300005458 | Bacteria | 6267 |
| 75 | Ga0070681_10024376 | 3300005458 | Bacteria | 6090 |
| 76 | Ga0070681_10104148 | 3300005458 | Bacteria | 2780 |
| 77 | Ga0068867_100022954 | 3300005459 | Bacteria | 4464 |
| 78 | Ga0068867_100027329 | 3300005459 | Bacteria | 4099 |
| 79 | Ga0070698_100092786 | 3300005471 | Bacteria | 3000 |
| 80 | Ga0070699_100023197 | 3300005518 | Bacteria | 5347 |
| 81 | Ga0070699_100245641 | 3300005518 | Bacteria | 1599 |
| 82 | Ga0070679_100000469 | 3300005530 | Bacteria | 34407 |
| 83 | Ga0070679_100025516 | 3300005530 | Bacteria | 5801 |
| 84 | Ga0070679_100034185 | 3300005530 | Bacteria | 5037 |
| 85 | Ga0070679_100133096 | 3300005530 | Bacteria | 2467 |
| 86 | Ga0070684_100000389 | 3300005535 | Bacteria | 30433 |
| 87 | Ga0068853_100235807 | 3300005539 | Bacteria | 1675 |
| 88 | Ga0070672_100004629 | 3300005543 | Bacteria | 9012 |
| 89 | Ga0070672_100011940 | 3300005543 | Bacteria | 6072 |
| 90 | Ga0070672_100047307 | 3300005543 | Bacteria | 3337 |
| 91 | Ga0070672_100291995 | 3300005543 | Bacteria | 1380 |
| 92 | Ga0070695_100001122 | 3300005545 | Bacteria | 14667 |
| 93 | Ga0070696_100000233 | 3300005546 | Bacteria | 33711 |
| 94 | Ga0070696_100059238 | 3300005546 | Bacteria | 2676 |
| 95 | Ga0070696_100069992 | 3300005546 | Bacteria | 2467 |
| 96 | Ga0070693_100066758 | 3300005547 | Bacteria | 2106 |
| 97 | Ga0070665_100002122 | 3300005548 | Bacteria | 22146 |
| 98 | Ga0070665_100006304 | 3300005548 | Bacteria | 12110 |
| 99 | Ga0070665_100027331 | 3300005548 | Bacteria | 5747 |
| 100 | Ga0070665_100077491 | 3300005548 | Bacteria | 3331 |
| 101 | Ga0070704_100007227 | 3300005549 | Bacteria | 6604 |
| 102 | Ga0068855_100001482 | 3300005563 | Bacteria | 29366 |
| 103 | Ga0068855_100001944 | 3300005563 | Bacteria | 25660 |
| 104 | Ga0068855_100020801 | 3300005563 | Bacteria | 7868 |
| 105 | Ga0068855_100032489 | 3300005563 | Bacteria | 6231 |
| 106 | Ga0070664_100002633 | 3300005564 | Bacteria | 14471 |
| 107 | Ga0068857_100013260 | 3300005577 | Bacteria | 7179 |
| 108 | Ga0068857_100091965 | 3300005577 | Bacteria | 2716 |
| 109 | Ga0068854_100276653 | 3300005578 | Bacteria | 1350 |
| 110 | Ga0068856_100008652 | 3300005614 | Bacteria | 9902 |
| 111 | Ga0070702_100034486 | 3300005615 | Bacteria | 2790 |
| 112 | Ga0068859_100008619 | 3300005617 | Bacteria | 10304 |
| 113 | Ga0068859_100043274 | 3300005617 | Bacteria | 4526 |
| 114 | Ga0068859_100109922 | 3300005617 | Bacteria | 2818 |
| 115 | Ga0068864_100004892 | 3300005618 | Bacteria | 10973 |
| 116 | Ga0068866_10008386 | 3300005718 | Bacteria | 4354 |
| 117 | Ga0068861_100014206 | 3300005719 | Bacteria | 5586 |
| 118 | Ga0068861_100023752 | 3300005719 | Bacteria | 4426 |
| 119 | Ga0068861_100084466 | 3300005719 | Bacteria | 2492 |
| 120 | Ga0068861_100111892 | 3300005719 | Bacteria | 2189 |
| 121 | Ga0068861_100318503 | 3300005719 | Bacteria | 1354 |
| 122 | Ga0068870_10088817 | 3300005840 | Bacteria | 1724 |
| 123 | Ga0068863_100005440 | 3300005841 | Bacteria | 12546 |
| 124 | Ga0068863_100011401 | 3300005841 | Bacteria | 8601 |
| 125 | Ga0068858_100012168 | 3300005842 | Bacteria | 8112 |
| 126 | Ga0068858_100019147 | 3300005842 | Bacteria | 6404 |
| 127 | Ga0068858_100326704 | 3300005842 | Bacteria | 1467 |
| 128 | Ga0068858_100391105 | 3300005842 | Bacteria | 1335 |
| 129 | Ga0068860_100004196 | 3300005843 | Bacteria | 14770 |
| 130 | Ga0068860_100007155 | 3300005843 | Bacteria | 11163 |
| 131 | Ga0068860_100021474 | 3300005843 | Bacteria | 6251 |
| 132 | Ga0068862_100004849 | 3300005844 | Bacteria | 11328 |
| 133 | Ga0068862_100042263 | 3300005844 | Bacteria | 3882 |
| 134 | Ga0070717_10296058 | 3300006028 | Bacteria | 1438 |
| 135 | Ga0075364_10000792 | 3300006051 | Bacteria | 16666 |
| 136 | Ga0075432_10002709 | 3300006058 | Bacteria | 5924 |
| 137 | Ga0075432_10004298 | 3300006058 | Bacteria | 4850 |
| 138 | Ga0070715_10003057 | 3300006163 | Bacteria | 5248 |
| 139 | Ga0070716_100000449 | 3300006173 | Bacteria | 17023 |
| 140 | Ga0070716_100042537 | 3300006173 | Bacteria | 2536 |
| 141 | Ga0070712_100007685 | 3300006175 | Bacteria | 6742 |
| 142 | Ga0070712_100159298 | 3300006175 | Bacteria | 1741 |
| 143 | Ga0070712_100216295 | 3300006175 | Bacteria | 1514 |
| 144 | Ga0075362_10007547 | 3300006177 | Bacteria | 4125 |
| 145 | Ga0097621_100031096 | 3300006237 | Bacteria | 4233 |
| 146 | Ga0097621_100091567 | 3300006237 | Bacteria | 2545 |
| 147 | Ga0068871_100058698 | 3300006358 | Bacteria | 3133 |
| 148 | Ga0068871_100186058 | 3300006358 | Bacteria | 1787 |
| 149 | Ga0068871_100203953 | 3300006358 | Bacteria | 1708 |
| 150 | Ga0068871_100321155 | 3300006358 | Bacteria | 1363 |
| 151 | Ga0075428_100010582 | 3300006844 | Bacteria | 10252 |
| 152 | Ga0075428_100068346 | 3300006844 | Bacteria | 3886 |
| 153 | Ga0075428_100116803 | 3300006844 | Bacteria | 2906 |
| 154 | Ga0075428_100151919 | 3300006844 | Bacteria | 2515 |
| 155 | Ga0075430_100007468 | 3300006846 | Bacteria | 9227 |
| 156 | Ga0075430_100031773 | 3300006846 | Bacteria | 4481 |
| 157 | Ga0075430_100053905 | 3300006846 | Bacteria | 3385 |
| 158 | Ga0075431_100007866 | 3300006847 | Bacteria | 10627 |
| 159 | Ga0075431_100009924 | 3300006847 | Bacteria | 9565 |
| 160 | Ga0075431_100081783 | 3300006847 | Bacteria | 3335 |
| 161 | Ga0075431_100335748 | 3300006847 | Bacteria | 1521 |
| 162 | Ga0075429_100034978 | 3300006880 | Bacteria | 4366 |
| 163 | Ga0075429_100044334 | 3300006880 | Bacteria | 3870 |
| 164 | Ga0068865_100000735 | 3300006881 | Bacteria | 18419 |
| 165 | Ga0097620_100008619 | 3300006931 | Bacteria | 10304 |
| 166 | Ga0097620_100043275 | 3300006931 | Bacteria | 4526 |
| 167 | Ga0097620_100109919 | 3300006931 | Bacteria | 2818 |
| 168 | Ga0079104_1000068 | 3300006946 | Bacteria | 154984 |
| 169 | Ga0099826_10083695 | 3300006948 | Bacteria | 1977 |
| 170 | Ga0075435_100010333 | 3300007076 | Bacteria | 6823 |
| 171 | Ga0099794_10059459 | 3300007265 | Bacteria | 1854 |
| 172 | Ga0099795_10000022 | 3300007788 | Bacteria | 52585 |
| 173 | Ga0105251_10009643 | 3300009011 | Bacteria | 5682 |
| 174 | Ga0105244_10006047 | 3300009036 | Bacteria | 7930 |
| 175 | Ga0105244_10030412 | 3300009036 | Bacteria | 2874 |
| 176 | Ga0105250_10006223 | 3300009092 | Bacteria | 5239 |
| 177 | Ga0105250_10061266 | 3300009092 | Bacteria | 1513 |
| 178 | Ga0105250_10061724 | 3300009092 | Bacteria | 1507 |
| 179 | Ga0105240_10002127 | 3300009093 | Bacteria | 32338 |
| 180 | Ga0105240_10002705 | 3300009093 | Bacteria | 28172 |
| 181 | Ga0105240_10003826 | 3300009093 | Bacteria | 23268 |
| 182 | Ga0105240_10024889 | 3300009093 | Bacteria | 7880 |
| 183 | Ga0105240_10032775 | 3300009093 | Bacteria | 6721 |
| 184 | Ga0105240_10130983 | 3300009093 | Bacteria | 3008 |
| 185 | Ga0105240_10328419 | 3300009093 | Bacteria | 1741 |
| 186 | Ga0111539_10033108 | 3300009094 | Bacteria | 6275 |
| 187 | Ga0111539_10076554 | 3300009094 | Bacteria | 3939 |
| 188 | Ga0111539_10077583 | 3300009094 | Bacteria | 3910 |
| 189 | Ga0111539_10201499 | 3300009094 | Bacteria | 2321 |
| 190 | Ga0111539_10267558 | 3300009094 | Bacteria | 1990 |
| 191 | Ga0111539_10564067 | 3300009094 | Bacteria | 1326 |
| 192 | Ga0105245_10007920 | 3300009098 | Bacteria | 9291 |
| 193 | Ga0105245_10023209 | 3300009098 | Bacteria | 5445 |
| 194 | Ga0105247_10012409 | 3300009101 | Bacteria | 5117 |
| 195 | Ga0105247_10111901 | 3300009101 | Bacteria | 1758 |
| 196 | Ga0105247_10121127 | 3300009101 | Bacteria | 1695 |
| 197 | Ga0114129_10000367 | 3300009147 | Bacteria | 52338 |
| 198 | Ga0114129_10087255 | 3300009147 | Bacteria | 4327 |
| 199 | Ga0114129_10447332 | 3300009147 | Bacteria | 1695 |
| 200 | Ga0105243_10027562 | 3300009148 | Bacteria | 4353 |
| 201 | Ga0105243_10041735 | 3300009148 | Bacteria | 3588 |
| 202 | Ga0105241_10007997 | 3300009174 | Bacteria | 7778 |
| 203 | Ga0105242_10005298 | 3300009176 | Bacteria | 9957 |
| 204 | Ga0105242_10082584 | 3300009176 | Bacteria | 2689 |
| 205 | Ga0105242_10321662 | 3300009176 | Bacteria | 1419 |
| 206 | Ga0105248_10001404 | 3300009177 | Bacteria | 26898 |
| 207 | Ga0105248_10005489 | 3300009177 | Bacteria | 13923 |
| 208 | Ga0105237_10008371 | 3300009545 | Bacteria | 11215 |
| 209 | Ga0105237_10127911 | 3300009545 | Bacteria | 2534 |
| 210 | Ga0105238_10005376 | 3300009551 | Bacteria | 12659 |
| 211 | Ga0105238_10006381 | 3300009551 | Bacteria | 11732 |
| 212 | Ga0105238_10161450 | 3300009551 | Bacteria | 2216 |
| 213 | Ga0105249_10184405 | 3300009553 | Bacteria | 2033 |
| 214 | Ga0099796_10000025 | 3300010159 | Bacteria | 37858 |
| 215 | Ga0105239_10005723 | 3300010375 | Bacteria | 14518 |
| 216 | Ga0105239_10052494 | 3300010375 | Bacteria | 4471 |
| 217 | Ga0105239_10216510 | 3300010375 | Bacteria | 2147 |
| 218 | Ga0105246_10006341 | 3300011119 | Bacteria | 7222 |
| 219 | Ga0157370_10001472 | 3300013104 | Bacteria | 29117 |
| 220 | Ga0157369_10065057 | 3300013105 | Bacteria | 3926 |
| 221 | Ga0157369_10297375 | 3300013105 | Bacteria | 1680 |
| 222 | Ga0157374_10007656 | 3300013296 | Bacteria | 9220 |
| 223 | Ga0157374_10014556 | 3300013296 | Bacteria | 6885 |
| 224 | Ga0157374_10156555 | 3300013296 | Bacteria | 2218 |
| 225 | Ga0157374_10308818 | 3300013296 | Bacteria | 1565 |
| 226 | Ga0157374_10376833 | 3300013296 | Bacteria | 1413 |
| 227 | Ga0157378_10004873 | 3300013297 | Bacteria | 11772 |
| 228 | Ga0157378_10122887 | 3300013297 | Bacteria | 2395 |
| 229 | Ga0157378_10152685 | 3300013297 | Bacteria | 2153 |
| 230 | Ga0163162_10020035 | 3300013306 | Bacteria | 6569 |
| 231 | Ga0163162_10067923 | 3300013306 | Bacteria | 3616 |
| 232 | Ga0163162_10111624 | 3300013306 | Bacteria | 2832 |
| 233 | Ga0163162_10126118 | 3300013306 | Bacteria | 2666 |
| 234 | Ga0157375_10010708 | 3300013308 | Bacteria | 8080 |
| 235 | Ga0157375_10018198 | 3300013308 | Bacteria | 6367 |
| 236 | Ga0157375_10039263 | 3300013308 | Bacteria | 4555 |
| 237 | Ga0157375_10087488 | 3300013308 | Bacteria | 3168 |
| 238 | Ga0163163_10000485 | 3300014325 | Bacteria | 35984 |
| 239 | Ga0163163_10025005 | 3300014325 | Bacteria | 5688 |
| 240 | Ga0163163_10101260 | 3300014325 | Bacteria | 2903 |
| 241 | Ga0163163_10109176 | 3300014325 | Bacteria | 2794 |
| 242 | Ga0163163_10259556 | 3300014325 | Bacteria | 1788 |
| 243 | Ga0157380_10025900 | 3300014326 | Bacteria | 4450 |
| 244 | Ga0157380_10031338 | 3300014326 | Bacteria | 4081 |
| 245 | Ga0157380_10137624 | 3300014326 | Unclassified | 2093 |
| 246 | Ga0182008_10000655 | 3300014497 | Bacteria | 25237 |
| 247 | Ga0157377_10040514 | 3300014745 | Bacteria | 2580 |
| 248 | Ga0157377_10106531 | 3300014745 | Bacteria | 1679 |
| 249 | Ga0157379_10006630 | 3300014968 | Bacteria | 9989 |
| 250 | Ga0157379_10009851 | 3300014968 | Bacteria | 8327 |
| 251 | Ga0157379_10060155 | 3300014968 | Bacteria | 3396 |
| 252 | Ga0157379_10160111 | 3300014968 | Bacteria | 2032 |
| 253 | Ga0157376_10014926 | 3300014969 | Bacteria | 5852 |
| 254 | Ga0157376_10129844 | 3300014969 | Bacteria | 2247 |
| 255 | Ga0157376_10296935 | 3300014969 | Bacteria | 1528 |
| 256 | Ga0182005_1001019 | 3300015265 | Bacteria | 11956 |
| 257 | Ga0182005_1001549 | 3300015265 | Bacteria | 9106 |
| 258 | Ga0182005_1005470 | 3300015265 | Bacteria | 3964 |
| 259 | Ga0182005_1006564 | 3300015265 | Bacteria | 3540 |
| 260 | Ga0163161_10000986 | 3300017792 | Bacteria | 21775 |
| 261 | Ga0163161_10012623 | 3300017792 | Bacteria | 5869 |
| 262 | Ga0163161_10036963 | 3300017792 | Bacteria | 3499 |
| 263 | Ga0163161_10072485 | 3300017792 | Bacteria | 2522 |
| 264 | Ga0163161_10081043 | 3300017792 | Bacteria | 2389 |
| 265 | Ga0213874_10025026 | 3300021377 | Bacteria | 1680 |
| 266 | Ga0213871_10024524 | 3300021441 | Bacteria | 1528 |
| 267 | Ga0209676_1003062 | 3300025292 | Bacteria | 10785 |
| 268 | Ga0209050_1000229 | 3300025298 | Bacteria | 123110 |
| 269 | Ga0207696_1001869 | 3300025711 | Bacteria | 10797 |
| 270 | Ga0207696_1005521 | 3300025711 | Bacteria | 5233 |
| 271 | Ga0207655_1002567 | 3300025728 | Bacteria | 14523 |
| 272 | Ga0207655_1035489 | 3300025728 | Bacteria | 2225 |
| 273 | Ga0207713_1007553 | 3300025735 | Bacteria | 6388 |
| 274 | Ga0207713_1007696 | 3300025735 | Bacteria | 6300 |
| 275 | Ga0207713_1007941 | 3300025735 | Bacteria | 6182 |
| 276 | Ga0207692_10069265 | 3300025898 | Bacteria | 1853 |
| 277 | Ga0207642_10012317 | 3300025899 | Bacteria | 3084 |
| 278 | Ga0207688_10003915 | 3300025901 | Bacteria | 8118 |
| 279 | Ga0207680_10020513 | 3300025903 | Bacteria | 3559 |
| 280 | Ga0207699_10009239 | 3300025906 | Bacteria | 4899 |
| 281 | Ga0207699_10019729 | 3300025906 | Bacteria | 3601 |
| 282 | Ga0207699_10047568 | 3300025906 | Bacteria | 2516 |
| 283 | Ga0207645_10001223 | 3300025907 | Bacteria | 21174 |
| 284 | Ga0207645_10008199 | 3300025907 | Bacteria | 7310 |
| 285 | Ga0207645_10020611 | 3300025907 | Bacteria | 4312 |
| 286 | Ga0207645_10031001 | 3300025907 | Bacteria | 3444 |
| 287 | Ga0207643_10015755 | 3300025908 | Bacteria | 4117 |
| 288 | Ga0207643_10054417 | 3300025908 | Bacteria | 2275 |
| 289 | Ga0207654_10059460 | 3300025911 | Bacteria | 2229 |
| 290 | Ga0207707_10000122 | 3300025912 | Bacteria | 80159 |
| 291 | Ga0207707_10010048 | 3300025912 | Bacteria | 8208 |
| 292 | Ga0207707_10026203 | 3300025912 | Bacteria | 5096 |
| 293 | Ga0207707_10036563 | 3300025912 | Bacteria | 4292 |
| 294 | Ga0207707_10051542 | 3300025912 | Bacteria | 3584 |
| 295 | Ga0207695_10003540 | 3300025913 | Bacteria | 21874 |
| 296 | Ga0207695_10009529 | 3300025913 | Bacteria | 12008 |
| 297 | Ga0207695_10024867 | 3300025913 | Bacteria | 6721 |
| 298 | Ga0207695_10076336 | 3300025913 | Bacteria | 3406 |
| 299 | Ga0207695_10224006 | 3300025913 | Bacteria | 1787 |
| 300 | Ga0207695_10282383 | 3300025913 | Bacteria | 1554 |
| 301 | Ga0207671_10023246 | 3300025914 | Bacteria | 4676 |
| 302 | Ga0207671_10150432 | 3300025914 | Bacteria | 1798 |
| 303 | Ga0207693_10000083 | 3300025915 | Bacteria | 84611 |
| 304 | Ga0207693_10018817 | 3300025915 | Bacteria | 5496 |
| 305 | Ga0207693_10067420 | 3300025915 | Bacteria | 2802 |
| 306 | Ga0207663_10014494 | 3300025916 | Bacteria | 4317 |
| 307 | Ga0207663_10068245 | 3300025916 | Bacteria | 2283 |
| 308 | Ga0207663_10103380 | 3300025916 | Bacteria | 1918 |
| 309 | Ga0207660_10004896 | 3300025917 | Bacteria | 8723 |
| 310 | Ga0207660_10125130 | 3300025917 | Bacteria | 1951 |
| 311 | Ga0207662_10017279 | 3300025918 | Bacteria | 4079 |
| 312 | Ga0207662_10049888 | 3300025918 | Bacteria | 2484 |
| 313 | Ga0207649_10015857 | 3300025920 | Bacteria | 4237 |
| 314 | Ga0207652_10000613 | 3300025921 | Bacteria | 35518 |
| 315 | Ga0207652_10054368 | 3300025921 | Bacteria | 3442 |
| 316 | Ga0207681_10023771 | 3300025923 | Bacteria | 3924 |
| 317 | Ga0207681_10035475 | 3300025923 | Bacteria | 3286 |
| 318 | Ga0207681_10115901 | 3300025923 | Bacteria | 1956 |
| 319 | Ga0207694_10003403 | 3300025924 | Bacteria | 12669 |
| 320 | Ga0207650_10151323 | 3300025925 | Bacteria | 1831 |
| 321 | Ga0207700_10019447 | 3300025928 | Bacteria | 4588 |
| 322 | Ga0207664_10002133 | 3300025929 | Bacteria | 13018 |
| 323 | Ga0207664_10092412 | 3300025929 | Bacteria | 2483 |
| 324 | Ga0207644_10054804 | 3300025931 | Bacteria | 2872 |
| 325 | Ga0207706_10004326 | 3300025933 | Bacteria | 13333 |
| 326 | Ga0207706_10011127 | 3300025933 | Bacteria | 8199 |
| 327 | Ga0207706_10022865 | 3300025933 | Bacteria | 5610 |
| 328 | Ga0207706_10049227 | 3300025933 | Bacteria | 3725 |
| 329 | Ga0207706_10123377 | 3300025933 | Bacteria | 2279 |
| 330 | Ga0207686_10012915 | 3300025934 | Bacteria | 4606 |
| 331 | Ga0207709_10100092 | 3300025935 | Bacteria | 1914 |
| 332 | Ga0207670_10018344 | 3300025936 | Bacteria | 4252 |
| 333 | Ga0207704_10004318 | 3300025938 | Bacteria | 6496 |
| 334 | Ga0207704_10026508 | 3300025938 | Bacteria | 3181 |
| 335 | Ga0207665_10000587 | 3300025939 | Bacteria | 24539 |
| 336 | Ga0207691_10001448 | 3300025940 | Bacteria | 23639 |
| 337 | Ga0207691_10003491 | 3300025940 | Bacteria | 15299 |
| 338 | Ga0207691_10025122 | 3300025940 | Bacteria | 5596 |
| 339 | Ga0207691_10063046 | 3300025940 | Bacteria | 3362 |
| 340 | Ga0207691_10089162 | 3300025940 | Bacteria | 2766 |
| 341 | Ga0207711_10010034 | 3300025941 | Bacteria | 7872 |
| 342 | Ga0207711_10069829 | 3300025941 | Bacteria | 3046 |
| 343 | Ga0207689_10002923 | 3300025942 | Bacteria | 15774 |
| 344 | Ga0207689_10119325 | 3300025942 | Bacteria | 2170 |
| 345 | Ga0207679_10004598 | 3300025945 | Bacteria | 8586 |
| 346 | Ga0207667_10000798 | 3300025949 | Bacteria | 40876 |
| 347 | Ga0207667_10004634 | 3300025949 | Bacteria | 16866 |
| 348 | Ga0207667_10010115 | 3300025949 | Bacteria | 11052 |
| 349 | Ga0207667_10045147 | 3300025949 | Bacteria | 4668 |
| 350 | Ga0207651_10065531 | 3300025960 | Bacteria | 2548 |
| 351 | Ga0207712_10135138 | 3300025961 | Bacteria | 1885 |
| 352 | Ga0207668_10018342 | 3300025972 | Bacteria | 4401 |
| 353 | Ga0207658_10015483 | 3300025986 | Bacteria | 5231 |
| 354 | Ga0207658_10033045 | 3300025986 | Bacteria | 3687 |
| 355 | Ga0207658_10102880 | 3300025986 | Bacteria | 2241 |
| 356 | Ga0207677_10011599 | 3300026023 | Bacteria | 5032 |
| 357 | Ga0207703_10013397 | 3300026035 | Bacteria | 6391 |
| 358 | Ga0207703_10020264 | 3300026035 | Bacteria | 5200 |
| 359 | Ga0207703_10034034 | 3300026035 | Bacteria | 4041 |
| 360 | Ga0207639_10187658 | 3300026041 | Bacteria | 1764 |
| 361 | Ga0207702_10014159 | 3300026078 | Bacteria | 6624 |
| 362 | Ga0207702_10050952 | 3300026078 | Bacteria | 3497 |
| 363 | Ga0207641_10010458 | 3300026088 | Bacteria | 7625 |
| 364 | Ga0207641_10013892 | 3300026088 | Bacteria | 6604 |
| 365 | Ga0207641_10107192 | 3300026088 | Bacteria | 2471 |
| 366 | Ga0207648_10003080 | 3300026089 | Bacteria | 17612 |
| 367 | Ga0207648_10017129 | 3300026089 | Bacteria | 6604 |
| 368 | Ga0207648_10031254 | 3300026089 | Bacteria | 4707 |
| 369 | Ga0207676_10000965 | 3300026095 | Bacteria | 22224 |
| 370 | Ga0207676_10162691 | 3300026095 | Bacteria | 1935 |
| 371 | Ga0207674_10019239 | 3300026116 | Bacteria | 7402 |
| 372 | Ga0207674_10038183 | 3300026116 | Bacteria | 4989 |
| 373 | Ga0207674_10106883 | 3300026116 | Bacteria | 2775 |
| 374 | Ga0207674_10123226 | 3300026116 | Bacteria | 2558 |
| 375 | Ga0207675_100011407 | 3300026118 | Bacteria | 8317 |
| 376 | Ga0207675_100021455 | 3300026118 | Bacteria | 6016 |
| 377 | Ga0207675_100021604 | 3300026118 | Bacteria | 5994 |
| 378 | Ga0207675_100025193 | 3300026118 | Bacteria | 5536 |
| 379 | Ga0207675_100044724 | 3300026118 | Bacteria | 4138 |
| 380 | Ga0207675_100120239 | 3300026118 | Bacteria | 2485 |
| 381 | Ga0207683_10004897 | 3300026121 | Bacteria | 11526 |
| 382 | Ga0207683_10015951 | 3300026121 | Bacteria | 6394 |
| 383 | Ga0209281_1000168 | 3300027111 | Bacteria | 155116 |
| 384 | Ga0209179_1000130 | 3300027512 | Bacteria | 8124 |
| 385 | Ga0209968_1002478 | 3300027526 | Bacteria | 2791 |
| 386 | Ga0210002_1000931 | 3300027617 | Bacteria | 4034 |
| 387 | Ga0209983_1003838 | 3300027665 | Bacteria | 3184 |
| 388 | Ga0209971_1001319 | 3300027682 | Bacteria | 6164 |
| 389 | Ga0209966_1008616 | 3300027695 | Bacteria | 1813 |
| 390 | Ga0209998_10003556 | 3300027717 | Bacteria | 3396 |
| 391 | Ga0209974_10000854 | 3300027876 | Bacteria | 10513 |
| 392 | Ga0209974_10000908 | 3300027876 | Bacteria | 10305 |
| 393 | Ga0209974_10015078 | 3300027876 | Bacteria | 2566 |
| 394 | Ga0207428_10007665 | 3300027907 | Bacteria | 9826 |
| 395 | Ga0207428_10031774 | 3300027907 | Bacteria | 4350 |
| 396 | Ga0207428_10037263 | 3300027907 | Bacteria | 3958 |
| 397 | Ga0207428_10054420 | 3300027907 | Bacteria | 3188 |
| 398 | Ga0207428_10175028 | 3300027907 | Bacteria | 1624 |
| 399 | Ga0265356_1002354 | 3300028017 | Bacteria | 2543 |
| 400 | Ga0268266_10001602 | 3300028379 | Bacteria | 26388 |
| 401 | Ga0268266_10078755 | 3300028379 | Bacteria | 2868 |
| 402 | Ga0268265_10004447 | 3300028380 | Bacteria | 9730 |
| 403 | Ga0268265_10010052 | 3300028380 | Bacteria | 6389 |
| 404 | Ga0268265_10027069 | 3300028380 | Bacteria | 4087 |
| 405 | Ga0268265_10081988 | 3300028380 | Bacteria | 2549 |
| 406 | Ga0268264_10008436 | 3300028381 | Bacteria | 8568 |
| 407 | Ga0265326_10003138 | 3300028558 | Bacteria | 5468 |
| 408 | Ga0265319_1034522 | 3300028563 | Bacteria | 1739 |
| 409 | Ga0265334_10010215 | 3300028573 | Bacteria | 3960 |
| 410 | Ga0265318_10001836 | 3300028577 | Bacteria | 12018 |
| 411 | Ga0265338_10027362 | 3300028800 | Bacteria | 5722 |
| 412 | Ga0265770_1000007 | 3300030878 | Bacteria | 20558 |
| 413 | Ga0265771_1000279 | 3300031010 | Bacteria | 1680 |
| 414 | Ga0265330_10004483 | 3300031235 | Bacteria | 7083 |
| 415 | Ga0265332_10003174 | 3300031238 | Bacteria | 8001 |
| 416 | Ga0265328_10001169 | 3300031239 | Bacteria | 12122 |
| 417 | Ga0265328_10001255 | 3300031239 | Bacteria | 11736 |
| 418 | Ga0265325_10014663 | 3300031241 | Bacteria | 4422 |
| 419 | Ga0265329_10002693 | 3300031242 | Bacteria | 7987 |
| 420 | Ga0265340_10031574 | 3300031247 | Bacteria | 2648 |
| 421 | Ga0265316_10087366 | 3300031344 | Bacteria | 2382 |
| 422 | Ga0307513_10300521 | 3300031456 | Bacteria | 1372 |
| 423 | Ga0307509_10002372 | 3300031507 | Bacteria | 30641 |
| 424 | Ga0307408_100167094 | 3300031548 | Bacteria | 1753 |
| 425 | Ga0316579_10006989 | 3300031691 | Bacteria | 4637 |
| 426 | Ga0265314_10005988 | 3300031711 | Bacteria | 10844 |
| 427 | Ga0316576_10016733 | 3300031727 | Bacteria | 4964 |
| 428 | Ga0316578_10032798 | 3300031728 | Bacteria | 2970 |
| 429 | Ga0307516_10003963 | 3300031730 | Bacteria | 18595 |
| 430 | Ga0316577_10012050 | 3300031733 | Bacteria | 4700 |
| 431 | Ga0307406_10054867 | 3300031901 | Bacteria | 2545 |
| 432 | Ga0307407_10026194 | 3300031903 | Bacteria | 3085 |
| 433 | Ga0307412_10083076 | 3300031911 | Bacteria | 2219 |
| 434 | Ga0307409_100002517 | 3300031995 | Bacteria | 9603 |
| 435 | Ga0307416_100022288 | 3300032002 | Bacteria | 4569 |
| 436 | Ga0307416_100373857 | 3300032002 | Bacteria | 1452 |
| 437 | Ga0307415_100040526 | 3300032126 | Bacteria | 3086 |
| 438 | Ga0307415_100125851 | 3300032126 | Bacteria | 1931 |
| 439 | Ga0316583_10043007 | 3300032133 | Bacteria | 1596 |
| 440 | Ga0316585_10009072 | 3300032137 | Bacteria | 2894 |
| 441 | Ga0316585_10026871 | 3300032137 | Bacteria | 1793 |
| 442 | Ga0316588_1029669 | 3300033528 | Bacteria | 1280 |
| 443 | Ga0373934_0021534 | 3300035086 | Bacteria | 2483 |
| 444 | Ga0373946_0018068 | 3300035171 | Bacteria | 2703 |
| 445 | Ga0316574_0015922 | 3300035398 | Bacteria | 4370 |
| 446 | Ga0316574_0082030 | 3300035398 | Bacteria | 2048 |
| 447 | Ga0316574_0148528 | 3300035398 | Bacteria | 1511 |
| 448 | Ga0373927_0006326 | 3300035695 | Bacteria | 8071 |
| 449 | Ga0373927_0009759 | 3300035695 | Bacteria | 6436 |
| 450 | Ga0373947_0088407 | 3300035725 | Bacteria | 1928 |
| 451 | Ga0316582_0053540 | 3300036647 | Bacteria | 2567 |
| 452 | Ga0373925_0005652 | 3300037068 | Bacteria | 9305 |
| 453 | Ga0237819_01035 | 3300038705 | Bacteria | 8308 |
| 454 | Ga0436360_0255389 | 3300039438 | Bacteria | 5832 |
| 455 | Ga0436360_0257108 | 3300039438 | Bacteria | 2602 |
| 456 | Ga0436363_0564042 | 3300039450 | Bacteria | 1560 |
| 457 | Ga0436363_0826655 | 3300039450 | Bacteria | 1865 |
| 458 | Ga0436362_0359256 | 3300039453 | Bacteria | 3298 |
| 459 | Ga0439438_000155 | 3300041405 | Bacteria | 31230 |
| 460 | Ga0439438_006304 | 3300041405 | Bacteria | 4211 |
| 461 | Ga0439447_000840 | 3300041407 | Bacteria | 11258 |
| 462 | Ga0439447_007663 | 3300041407 | Bacteria | 3401 |
| 463 | Ga0439466_0001516 | 3300041411 | Bacteria | 9079 |
| 464 | Ga0439466_0010091 | 3300041411 | Bacteria | 3512 |
| 465 | Ga0439466_0015719 | 3300041411 | Bacteria | 2748 |
| 466 | Ga0439432_014891 | 3300042006 | Bacteria | 2629 |
| 467 | Ga0439451_001251 | 3300042009 | Bacteria | 5025 |
| 468 | Ga0439452_001295 | 3300042010 | Bacteria | 10559 |
| 469 | Ga0439456_000015 | 3300042013 | Bacteria | 66691 |
| 470 | Ga0450920_000277 | 3300042122 | Bacteria | 7716 |
| 471 | Ga0450922_000055 | 3300042124 | Bacteria | 10075 |
| 472 | Ga0450896_005081 | 3300042133 | Bacteria | 1792 |
| 473 | Ga0450902_000197 | 3300042137 | Bacteria | 7063 |
| 474 | Ga0450902_000877 | 3300042137 | Bacteria | 3916 |
| 475 | Ga0450903_001073 | 3300042138 | Bacteria | 5210 |
| 476 | Ga0450904_000756 | 3300042139 | Bacteria | 5594 |
| 477 | Ga0450905_003315 | 3300042142 | Bacteria | 2113 |
| 478 | Ga0450906_011247 | 3300042145 | Bacteria | 1677 |
| 479 | Ga0450907_000997 | 3300042146 | Bacteria | 6667 |
| 480 | Ga0451577_0013334 | 3300042876 | Bacteria | 7697 |
| 481 | Ga0451577_0062323 | 3300042876 | Bacteria | 3326 |
| 482 | Ga0451577_0112387 | 3300042876 | Bacteria | 2438 |
| 483 | Ga0466969_0002997 | 3300044656 | Bacteria | 8993 |
| 484 | Ga0466969_0003345 | 3300044656 | Bacteria | 8536 |
| 485 | Ga0466969_0053179 | 3300044656 | Bacteria | 1988 |
| 486 | Ga0466966_0004455 | 3300044684 | Bacteria | 9235 |
| 487 | Ga0466966_0087835 | 3300044684 | Bacteria | 1932 |
| 488 | Ga0466961_0001050 | 3300044693 | Bacteria | 17009 |
| 489 | Ga0466964_0022702 | 3300044706 | Bacteria | 2436 |
| 490 | Ga0453684_0167831 | 3300044712 | Bacteria | 2589 |
| 491 | Ga0466971_0009912 | 3300044719 | Bacteria | 4161 |
| 492 | Ga0466970_0007100 | 3300044765 | Bacteria | 5603 |
| 493 | Ga0466957_0004657 | 3300044842 | Bacteria | 7664 |
| 494 | Ga0466959_0035356 | 3300045049 | Bacteria | 3696 |
| 495 | Ga0466959_0060878 | 3300045049 | Bacteria | 2746 |
| 496 | Ga0466959_0144119 | 3300045049 | Bacteria | 1681 |
| 497 | Ga0451576_0023197 | 3300045051 | Bacteria | 6722 |
| 498 | Ga0451576_0077150 | 3300045051 | Bacteria | 3467 |
| 499 | Ga0451576_0079861 | 3300045051 | Bacteria | 3404 |
| 500 | Ga0495617_000474 | 3300046452 | Bacteria | 21327 |
| 501 | Ga0495617_003460 | 3300046452 | Bacteria | 5939 |
| 502 | Ga0495617_003692 | 3300046452 | Bacteria | 5708 |
| 503 | Ga0495617_004104 | 3300046452 | Bacteria | 5348 |
| 504 | Ga0495617_006049 | 3300046452 | Bacteria | 4262 |
| 505 | Ga0495617_012387 | 3300046452 | Bacteria | 2905 |
| 506 | Ga0495617_061351 | 3300046452 | Bacteria | 1243 |
| 507 | Ga0495627_000534 | 3300046453 | Bacteria | 31440 |
| 508 | Ga0495627_000640 | 3300046453 | Bacteria | 27419 |
| 509 | Ga0495627_007012 | 3300046453 | Bacteria | 4369 |
| 510 | Ga0495627_012974 | 3300046453 | Bacteria | 2941 |
| 511 | Ga0495627_052243 | 3300046453 | Bacteria | 1226 |
| 512 | Ga0495592_0005399 | 3300046454 | Bacteria | 9435 |
| 513 | Ga0495603_0001283 | 3300046455 | Bacteria | 14634 |
| 514 | Ga0495603_0005913 | 3300046455 | Bacteria | 7313 |
| 515 | Ga0495590_0000130 | 3300046457 | Bacteria | 44477 |
| 516 | Ga0495590_0003711 | 3300046457 | Bacteria | 6217 |
| 517 | Ga0495590_0005128 | 3300046457 | Bacteria | 5212 |
| 518 | Ga0495590_0010681 | 3300046457 | Bacteria | 3441 |
| 519 | Ga0495591_000021 | 3300046458 | Bacteria | 203554 |
| 520 | Ga0495591_000150 | 3300046458 | Bacteria | 73568 |
| 521 | Ga0495591_000273 | 3300046458 | Bacteria | 48617 |
| 522 | Ga0495591_002178 | 3300046458 | Bacteria | 11216 |
| 523 | Ga0495591_002505 | 3300046458 | Bacteria | 10150 |
| 524 | Ga0495591_007189 | 3300046458 | Bacteria | 4769 |
| 525 | Ga0495591_008436 | 3300046458 | Bacteria | 4220 |
| 526 | Ga0495591_009648 | 3300046458 | Bacteria | 3815 |
| 527 | Ga0495629_0000490 | 3300046459 | Bacteria | 33122 |
| 528 | Ga0495629_0013707 | 3300046459 | Bacteria | 5850 |
| 529 | Ga0495629_0111232 | 3300046459 | Bacteria | 1910 |
| 530 | Ga0495638_0000947 | 3300046460 | Bacteria | 29436 |
| 531 | Ga0495638_0001168 | 3300046460 | Bacteria | 25231 |
| 532 | Ga0495638_0001991 | 3300046460 | Bacteria | 17423 |
| 533 | Ga0495638_0002314 | 3300046460 | Bacteria | 15692 |
| 534 | Ga0495638_0003073 | 3300046460 | Bacteria | 13255 |
| 535 | Ga0495638_0005036 | 3300046460 | Bacteria | 9915 |
| 536 | Ga0495638_0007477 | 3300046460 | Bacteria | 7829 |
| 537 | Ga0495638_0008564 | 3300046460 | Bacteria | 7239 |
| 538 | Ga0495638_0009288 | 3300046460 | Bacteria | 6911 |
| 539 | Ga0495638_0009651 | 3300046460 | Bacteria | 6751 |
| 540 | Ga0495638_0018895 | 3300046460 | Bacteria | 4568 |
| 541 | Ga0495638_0020025 | 3300046460 | Bacteria | 4422 |
| 542 | Ga0495638_0028419 | 3300046460 | Bacteria | 3612 |
| 543 | Ga0495638_0115045 | 3300046460 | Bacteria | 1594 |
| 544 | Ga0495641_0012212 | 3300046461 | Bacteria | 4821 |
| 545 | Ga0495653_0070080 | 3300046463 | Bacteria | 2624 |
| 546 | Ga0495650_0003285 | 3300046471 | Bacteria | 11957 |
| 547 | Ga0495650_0004517 | 3300046471 | Bacteria | 9500 |
| 548 | Ga0495650_0005241 | 3300046471 | Bacteria | 8506 |
| 549 | Ga0495650_0009160 | 3300046471 | Bacteria | 5669 |
| 550 | Ga0495650_0022637 | 3300046471 | Bacteria | 3010 |
| 551 | Ga0495580_0002317 | 3300046472 | Bacteria | 16600 |
| 552 | Ga0495580_0097407 | 3300046472 | Bacteria | 2046 |
| 553 | Ga0495580_0131295 | 3300046472 | Bacteria | 1737 |
| 554 | Ga0495582_0003939 | 3300046473 | Bacteria | 8341 |
| 555 | Ga0495582_0010605 | 3300046473 | Bacteria | 5069 |
| 556 | Ga0495605_0000480 | 3300046474 | Bacteria | 35032 |
| 557 | Ga0495605_0002173 | 3300046474 | Bacteria | 12250 |
| 558 | Ga0495605_0002997 | 3300046474 | Bacteria | 10199 |
| 559 | Ga0495605_0006888 | 3300046474 | Bacteria | 6491 |
| 560 | Ga0495639_0004319 | 3300046475 | Bacteria | 6095 |
| 561 | Ga0495639_0005800 | 3300046475 | Bacteria | 5314 |
| 562 | Ga0495639_0022287 | 3300046475 | Bacteria | 2778 |
| 563 | Ga0495584_0000067 | 3300046491 | Bacteria | 73689 |
| 564 | Ga0495584_0000917 | 3300046491 | Bacteria | 18791 |
| 565 | Ga0495584_0001601 | 3300046491 | Bacteria | 13348 |
| 566 | Ga0495584_0020071 | 3300046491 | Bacteria | 3394 |
| 567 | Ga0495584_0083289 | 3300046491 | Bacteria | 1610 |
| 568 | Ga0495585_0000030 | 3300046492 | Bacteria | 145184 |
| 569 | Ga0495585_0000056 | 3300046492 | Bacteria | 113739 |
| 570 | Ga0495585_0000335 | 3300046492 | Bacteria | 45891 |
| 571 | Ga0495585_0000871 | 3300046492 | Bacteria | 25767 |
| 572 | Ga0495585_0003232 | 3300046492 | Bacteria | 11116 |
| 573 | Ga0495585_0003534 | 3300046492 | Bacteria | 10511 |
| 574 | Ga0495585_0005465 | 3300046492 | Bacteria | 8005 |
| 575 | Ga0495585_0006863 | 3300046492 | Bacteria | 7022 |
| 576 | Ga0495585_0062042 | 3300046492 | Bacteria | 2053 |
| 577 | Ga0495594_0001605 | 3300046499 | Bacteria | 11772 |
| 578 | Ga0495594_0002194 | 3300046499 | Bacteria | 10147 |
| 579 | Ga0495596_0000012 | 3300046500 | Bacteria | 125996 |
| 580 | Ga0495596_0006906 | 3300046500 | Bacteria | 5172 |
| 581 | Ga0495607_0001305 | 3300046501 | Bacteria | 22209 |
| 582 | Ga0495607_0006997 | 3300046501 | Bacteria | 7853 |
| 583 | Ga0495607_0012999 | 3300046501 | Bacteria | 5473 |
| 584 | Ga0495607_0014897 | 3300046501 | Bacteria | 5053 |
| 585 | Ga0495607_0020256 | 3300046501 | Bacteria | 4209 |
| 586 | Ga0495583_0000112 | 3300046506 | Bacteria | 138078 |
| 587 | Ga0495583_0003028 | 3300046506 | Bacteria | 13394 |
| 588 | Ga0495583_0004042 | 3300046506 | Bacteria | 10794 |
| 589 | Ga0495606_0002318 | 3300046507 | Bacteria | 22431 |
| 590 | Ga0495606_0004165 | 3300046507 | Bacteria | 14658 |
| 591 | Ga0495606_0007763 | 3300046507 | Bacteria | 9494 |
| 592 | Ga0495606_0009647 | 3300046507 | Bacteria | 8131 |
| 593 | Ga0495606_0083686 | 3300046507 | Bacteria | 1977 |
| 594 | Ga0495610_0003225 | 3300046512 | Bacteria | 12903 |
| 595 | Ga0495610_0003495 | 3300046512 | Bacteria | 12221 |
| 596 | Ga0495610_0004389 | 3300046512 | Bacteria | 10438 |
| 597 | Ga0495610_0004415 | 3300046512 | Bacteria | 10403 |
| 598 | Ga0495610_0010870 | 3300046512 | Bacteria | 5619 |
| 599 | Ga0495610_0014754 | 3300046512 | Bacteria | 4574 |
| 600 | Ga0495610_0017503 | 3300046512 | Bacteria | 4083 |
| 601 | Ga0495610_0030494 | 3300046512 | Bacteria | 2825 |
| 602 | Ga0495616_0000251 | 3300046513 | Bacteria | 43349 |
| 603 | Ga0495616_0001505 | 3300046513 | Bacteria | 16092 |
| 604 | Ga0495616_0003694 | 3300046513 | Bacteria | 9775 |
| 605 | Ga0495616_0006088 | 3300046513 | Bacteria | 7354 |
| 606 | Ga0495616_0011509 | 3300046513 | Bacteria | 5063 |
| 607 | Ga0495616_0020835 | 3300046513 | Bacteria | 3561 |
| 608 | Ga0495616_0048391 | 3300046513 | Bacteria | 2137 |
| 609 | Ga0495620_0000860 | 3300046515 | Bacteria | 18785 |
| 610 | Ga0495620_0003461 | 3300046515 | Bacteria | 9033 |
| 611 | Ga0495620_0004610 | 3300046515 | Bacteria | 7747 |
| 612 | Ga0495620_0009266 | 3300046515 | Bacteria | 5242 |
| 613 | Ga0495630_0003131 | 3300046517 | Bacteria | 11476 |
| 614 | Ga0495630_0022286 | 3300046517 | Bacteria | 4679 |
| 615 | Ga0495631_0000002 | 3300046518 | Bacteria | 178694 |
| 616 | Ga0495631_0005996 | 3300046518 | Bacteria | 6321 |
| 617 | Ga0495631_0008277 | 3300046518 | Bacteria | 5243 |
| 618 | Ga0495632_0002079 | 3300046519 | Bacteria | 15668 |
| 619 | Ga0495632_0003562 | 3300046519 | Bacteria | 10990 |
| 620 | Ga0495632_0004142 | 3300046519 | Bacteria | 9959 |
| 621 | Ga0495632_0004772 | 3300046519 | Bacteria | 9129 |
| 622 | Ga0495632_0005080 | 3300046519 | Bacteria | 8801 |
| 623 | Ga0495632_0006324 | 3300046519 | Bacteria | 7641 |
| 624 | Ga0495632_0007608 | 3300046519 | Bacteria | 6776 |
| 625 | Ga0495632_0008901 | 3300046519 | Bacteria | 6099 |
| 626 | Ga0495632_0009802 | 3300046519 | Bacteria | 5736 |
| 627 | Ga0495632_0014646 | 3300046519 | Bacteria | 4428 |
| 628 | Ga0495632_0077697 | 3300046519 | Bacteria | 1587 |
| 629 | Ga0495632_0096544 | 3300046519 | Bacteria | 1396 |
| 630 | Ga0495637_0000246 | 3300046520 | Bacteria | 42500 |
| 631 | Ga0495637_0001056 | 3300046520 | Bacteria | 17210 |
| 632 | Ga0495637_0002226 | 3300046520 | Bacteria | 10798 |
| 633 | Ga0495637_0003199 | 3300046520 | Bacteria | 8740 |
| 634 | Ga0495637_0003357 | 3300046520 | Bacteria | 8514 |
| 635 | Ga0495637_0004380 | 3300046520 | Bacteria | 7321 |
| 636 | Ga0495637_0013128 | 3300046520 | Bacteria | 3939 |
| 637 | Ga0495643_0004092 | 3300046522 | Bacteria | 10388 |
| 638 | Ga0495643_0010664 | 3300046522 | Bacteria | 5646 |
| 639 | Ga0495644_0000025 | 3300046523 | Bacteria | 75756 |
| 640 | Ga0495644_0000545 | 3300046523 | Bacteria | 15914 |
| 641 | Ga0495648_0000246 | 3300046524 | Bacteria | 61159 |
| 642 | Ga0495648_0000981 | 3300046524 | Bacteria | 29447 |
| 643 | Ga0495648_0001566 | 3300046524 | Bacteria | 22326 |
| 644 | Ga0495648_0002585 | 3300046524 | Bacteria | 16582 |
| 645 | Ga0495648_0007688 | 3300046524 | Bacteria | 8592 |
| 646 | Ga0495648_0015779 | 3300046524 | Bacteria | 5464 |
| 647 | Ga0495648_0026386 | 3300046524 | Bacteria | 3912 |
| 648 | Ga0495648_0034013 | 3300046524 | Bacteria | 3323 |
| 649 | Ga0495666_0002299 | 3300046526 | Bacteria | 9524 |
| 650 | Ga0495666_0006761 | 3300046526 | Bacteria | 5765 |
| 651 | Ga0495666_0035650 | 3300046526 | Bacteria | 2424 |
| 652 | Ga0495642_0000003 | 3300046528 | Bacteria | 185425 |
| 653 | Ga0495642_0000245 | 3300046528 | Bacteria | 30611 |
| 654 | Ga0495654_0000225 | 3300046530 | Bacteria | 52679 |
| 655 | Ga0495654_0003093 | 3300046530 | Bacteria | 10351 |
| 656 | Ga0495654_0003282 | 3300046530 | Bacteria | 9979 |
| 657 | Ga0495654_0004064 | 3300046530 | Bacteria | 8786 |
| 658 | Ga0495654_0007273 | 3300046530 | Bacteria | 6202 |
| 659 | Ga0495654_0011129 | 3300046530 | Bacteria | 4884 |
| 660 | Ga0495654_0017099 | 3300046530 | Bacteria | 3818 |
| 661 | Ga0495654_0033827 | 3300046530 | Bacteria | 2584 |
| 662 | Ga0495654_0042546 | 3300046530 | Bacteria | 2254 |
| 663 | Ga0495654_0043339 | 3300046530 | Bacteria | 2230 |
| 664 | Ga0495586_0026747 | 3300046535 | Bacteria | 3087 |
| 665 | Ga0495586_0033140 | 3300046535 | Bacteria | 2772 |
| 666 | Ga0495587_0000989 | 3300046536 | Bacteria | 18668 |
| 667 | Ga0495587_0005793 | 3300046536 | Bacteria | 8045 |
| 668 | Ga0495609_0004230 | 3300046538 | Bacteria | 7930 |
| 669 | Ga0495609_0006067 | 3300046538 | Bacteria | 6222 |
| 670 | Ga0495609_0008112 | 3300046538 | Bacteria | 5170 |
| 671 | Ga0495621_0001365 | 3300046539 | Bacteria | 6314 |
| 672 | Ga0495597_0001245 | 3300046542 | Bacteria | 18852 |
| 673 | Ga0495597_0001251 | 3300046542 | Bacteria | 18767 |
| 674 | Ga0495597_0005566 | 3300046542 | Bacteria | 6649 |
| 675 | Ga0495597_0008380 | 3300046542 | Bacteria | 5182 |
| 676 | Ga0495597_0015109 | 3300046542 | Bacteria | 3660 |
| 677 | Ga0495597_0015948 | 3300046542 | Bacteria | 3552 |
| 678 | Ga0495597_0021618 | 3300046542 | Bacteria | 2989 |
| 679 | Ga0495645_0018444 | 3300046543 | Bacteria | 5011 |
| 680 | Ga0495645_0133200 | 3300046543 | Bacteria | 1740 |
| 681 | Ga0495622_0004166 | 3300046557 | Bacteria | 6746 |
| 682 | Ga0495622_0005166 | 3300046557 | Bacteria | 6051 |
| 683 | Ga0495622_0007233 | 3300046557 | Bacteria | 5153 |
| 684 | Ga0495622_0008458 | 3300046557 | Bacteria | 4764 |
| 685 | Ga0495633_0000612 | 3300046558 | Bacteria | 33866 |
| 686 | Ga0495633_0005129 | 3300046558 | Bacteria | 8125 |
| 687 | Ga0495656_0004477 | 3300046615 | Bacteria | 4790 |
| 688 | Ga0495656_0014077 | 3300046615 | Bacteria | 2991 |
| 689 | Ga0495668_0000728 | 3300046616 | Bacteria | 39499 |
| 690 | Ga0495668_0001396 | 3300046616 | Bacteria | 23512 |
| 691 | Ga0495668_0011121 | 3300046616 | Bacteria | 5407 |
| 692 | Ga0495634_0000572 | 3300046642 | Bacteria | 35710 |
| 693 | Ga0495634_0006857 | 3300046642 | Bacteria | 8617 |
| 694 | Ga0495634_0011150 | 3300046642 | Bacteria | 6555 |
| 695 | Ga0495611_0002819 | 3300046648 | Bacteria | 7775 |
| 696 | Ga0495625_0000838 | 3300046660 | Bacteria | 42224 |
| 697 | Ga0495625_0001956 | 3300046660 | Bacteria | 23279 |
| 698 | Ga0495625_0012219 | 3300046660 | Bacteria | 6964 |
| 699 | Ga0495625_0018882 | 3300046660 | Bacteria | 5368 |
| 700 | Ga0495625_0034474 | 3300046660 | Bacteria | 3736 |
| 701 | Ga0495625_0053431 | 3300046660 | Bacteria | 2889 |
| 702 | Ga0495625_0081578 | 3300046660 | Bacteria | 2251 |
| 703 | Ga0495625_0097604 | 3300046660 | Bacteria | 2022 |
| 704 | Ga0495635_0000115 | 3300046663 | Bacteria | 47781 |
| 705 | Ga0495635_0000594 | 3300046663 | Bacteria | 23281 |
| 706 | Ga0495635_0060343 | 3300046663 | Bacteria | 2607 |
| 707 | Ga0495635_0196965 | 3300046663 | Bacteria | 1367 |
| 708 | Ga0495659_0000208 | 3300046664 | Bacteria | 25391 |
| 709 | Ga0495659_0035154 | 3300046664 | Bacteria | 1765 |
| 710 | Ga0495661_0000100 | 3300046665 | Bacteria | 104957 |
| 711 | Ga0495661_0004882 | 3300046665 | Bacteria | 9600 |
| 712 | Ga0495661_0030206 | 3300046665 | Bacteria | 3453 |
| 713 | Ga0495661_0034374 | 3300046665 | Bacteria | 3190 |
| 714 | Ga0495661_0071738 | 3300046665 | Bacteria | 2022 |
| 715 | Ga0495661_0076183 | 3300046665 | Bacteria | 1947 |
| 716 | Ga0495661_0148413 | 3300046665 | Bacteria | 1268 |
| 717 | Ga0495588_0005387 | 3300046674 | Bacteria | 5689 |
| 718 | Ga0495588_0006858 | 3300046674 | Bacteria | 5159 |
| 719 | Ga0495588_0024007 | 3300046674 | Bacteria | 3025 |
| 720 | Ga0495588_0089190 | 3300046674 | Bacteria | 1614 |
| 721 | Ga0495623_0004300 | 3300046679 | Bacteria | 9372 |
| 722 | Ga0495646_0003836 | 3300046680 | Bacteria | 9393 |
| 723 | Ga0495646_0007178 | 3300046680 | Bacteria | 7075 |
| 724 | Ga0495647_0006055 | 3300046681 | Bacteria | 3986 |
| 725 | Ga0495658_0012040 | 3300046683 | Bacteria | 4369 |
| 726 | Ga0495658_0012173 | 3300046683 | Bacteria | 4347 |
| 727 | Ga0495658_0022014 | 3300046683 | Bacteria | 3367 |
| 728 | Ga0495613_0001100 | 3300046689 | Bacteria | 20643 |
| 729 | Ga0495613_0007322 | 3300046689 | Bacteria | 8217 |
| 730 | Ga0495613_0008530 | 3300046689 | Bacteria | 7605 |
| 731 | Ga0495613_0011859 | 3300046689 | Bacteria | 6476 |
| 732 | Ga0495613_0014931 | 3300046689 | Bacteria | 5763 |
| 733 | Ga0495624_0000975 | 3300046690 | Bacteria | 22598 |
| 734 | Ga0495670_0000596 | 3300046691 | Bacteria | 17241 |
| 735 | Ga0495670_0010570 | 3300046691 | Bacteria | 4536 |
| 736 | Ga0495671_0000066 | 3300046692 | Bacteria | 105167 |
| 737 | Ga0495671_0000459 | 3300046692 | Bacteria | 31939 |
| 738 | Ga0495671_0000814 | 3300046692 | Bacteria | 22295 |
| 739 | Ga0495671_0001652 | 3300046692 | Bacteria | 14603 |
| 740 | Ga0495671_0004212 | 3300046692 | Bacteria | 8659 |
| 741 | Ga0495671_0004620 | 3300046692 | Bacteria | 8178 |
| 742 | Ga0495671_0010838 | 3300046692 | Bacteria | 5039 |
| 743 | Ga0495671_0013033 | 3300046692 | Bacteria | 4521 |
| 744 | Ga0495671_0014481 | 3300046692 | Bacteria | 4243 |
| 745 | Ga0495671_0100446 | 3300046692 | Bacteria | 1414 |
| 746 | Ga0495649_0000404 | 3300046694 | Bacteria | 37432 |
| 747 | Ga0495649_0003432 | 3300046694 | Bacteria | 10695 |
| 748 | Ga0495649_0004074 | 3300046694 | Bacteria | 9614 |
| 749 | Ga0495649_0005118 | 3300046694 | Bacteria | 8414 |
| 750 | Ga0495649_0010434 | 3300046694 | Bacteria | 5477 |
| 751 | Ga0495649_0010488 | 3300046694 | Bacteria | 5464 |
| 752 | Ga0495649_0010623 | 3300046694 | Bacteria | 5424 |
| 753 | Ga0495649_0012992 | 3300046694 | Bacteria | 4820 |
| 754 | Ga0495589_0002746 | 3300046794 | Bacteria | 9739 |
| 755 | Ga0495589_0002978 | 3300046794 | Bacteria | 9333 |
| 756 | Ga0495589_0003332 | 3300046794 | Bacteria | 8718 |
| 757 | Ga0495589_0004860 | 3300046794 | Bacteria | 7129 |
| 758 | Ga0495589_0010325 | 3300046794 | Bacteria | 4849 |
| 759 | Ga0495589_0011597 | 3300046794 | Bacteria | 4575 |
| 760 | Ga0495660_0003045 | 3300046810 | Bacteria | 10458 |
| 761 | Ga0495660_0005353 | 3300046810 | Bacteria | 7684 |
| 762 | Ga0495660_0006453 | 3300046810 | Bacteria | 6937 |
| 763 | Ga0495660_0014849 | 3300046810 | Bacteria | 4503 |
| 764 | Ga0495660_0015082 | 3300046810 | Bacteria | 4468 |
| 765 | Ga0495660_0018297 | 3300046810 | Bacteria | 4027 |
| 766 | Ga0495660_0018860 | 3300046810 | Bacteria | 3961 |
| 767 | Ga0495660_0038757 | 3300046810 | Bacteria | 2648 |
| 768 | Ga0495660_0046073 | 3300046810 | Bacteria | 2392 |
| 769 | Ga0495581_0000838 | 3300047315 | Bacteria | 16367 |
| 770 | Ga0495604_0001248 | 3300047317 | Bacteria | 20850 |
| 771 | Ga0495604_0021351 | 3300047317 | Bacteria | 5168 |
| 772 | Ga0495674_0005618 | 3300047319 | Bacteria | 12021 |
| 773 | Ga0495672_0000185 | 3300047320 | Bacteria | 90160 |
| 774 | Ga0495672_0000247 | 3300047320 | Bacteria | 75920 |
| 775 | Ga0495672_0002156 | 3300047320 | Bacteria | 18395 |
| 776 | Ga0495672_0002436 | 3300047320 | Bacteria | 17130 |
| 777 | Ga0495672_0003437 | 3300047320 | Bacteria | 13558 |
| 778 | Ga0495672_0006184 | 3300047320 | Bacteria | 9337 |
| 779 | Ga0495672_0006235 | 3300047320 | Bacteria | 9300 |
| 780 | Ga0495672_0008726 | 3300047320 | Bacteria | 7433 |
| 781 | Ga0495672_0014421 | 3300047320 | Bacteria | 5412 |
| 782 | Ga0495672_0059405 | 3300047320 | Bacteria | 2212 |
| 783 | Ga0495672_0069994 | 3300047320 | Bacteria | 1989 |
| 784 | Ga0495676_0007185 | 3300047321 | Bacteria | 10215 |
| 785 | Ga0495676_0177801 | 3300047321 | Bacteria | 1493 |
| 786 | Ga0495680_0000029 | 3300047322 | Bacteria | 112033 |
| 787 | Ga0495680_0019446 | 3300047322 | Bacteria | 5732 |
| 788 | Ga0495680_0019504 | 3300047322 | Bacteria | 5720 |
| 789 | Ga0495680_0115936 | 3300047322 | Bacteria | 1981 |
| 790 | Ga0495683_0000037 | 3300047323 | Bacteria | 140632 |
| 791 | Ga0495683_0000674 | 3300047323 | Bacteria | 25217 |
| 792 | Ga0495683_0006806 | 3300047323 | Bacteria | 6212 |
| 793 | Ga0495683_0009191 | 3300047323 | Bacteria | 5267 |
| 794 | Ga0495683_0014115 | 3300047323 | Bacteria | 4162 |
| 795 | Ga0495683_0100629 | 3300047323 | Bacteria | 1390 |
| 796 | Ga0495683_0118524 | 3300047323 | Bacteria | 1258 |
| 797 | Ga0495675_0004640 | 3300047444 | Bacteria | 8349 |
| 798 | Ga0495677_0001883 | 3300047445 | Bacteria | 8384 |
| 799 | Ga0495679_000336 | 3300047446 | Bacteria | 37066 |
| 800 | Ga0495679_000402 | 3300047446 | Bacteria | 32396 |
| 801 | Ga0495679_001939 | 3300047446 | Bacteria | 11047 |
| 802 | Ga0495679_003604 | 3300047446 | Bacteria | 7393 |
| 803 | Ga0495679_004478 | 3300047446 | Bacteria | 6425 |
| 804 | Ga0495685_044248 | 3300047447 | Bacteria | 1518 |
| 805 | Ga0495673_0000093 | 3300047469 | Bacteria | 185841 |
| 806 | Ga0495673_0000184 | 3300047469 | Bacteria | 101002 |
| 807 | Ga0495673_0000760 | 3300047469 | Bacteria | 30610 |
| 808 | Ga0495673_0003126 | 3300047469 | Bacteria | 11084 |
| 809 | Ga0495673_0008563 | 3300047469 | Bacteria | 5734 |
| 810 | Ga0495673_0014513 | 3300047469 | Bacteria | 4093 |
| 811 | Ga0495673_0023907 | 3300047469 | Bacteria | 2962 |
| 812 | Ga0495681_0000082 | 3300047470 | Bacteria | 83609 |
| 813 | Ga0495681_0000156 | 3300047470 | Bacteria | 57235 |
| 814 | Ga0495681_0001246 | 3300047470 | Bacteria | 19318 |
| 815 | Ga0495681_0004206 | 3300047470 | Bacteria | 9870 |
| 816 | Ga0495681_0006108 | 3300047470 | Bacteria | 7958 |
| 817 | Ga0495681_0007287 | 3300047470 | Bacteria | 7097 |
| 818 | Ga0495681_0010952 | 3300047470 | Bacteria | 5445 |
| 819 | Ga0495681_0014931 | 3300047470 | Bacteria | 4425 |
| 820 | Ga0495684_0005960 | 3300047471 | Bacteria | 9468 |
| 821 | Ga0495686_0000789 | 3300047472 | Bacteria | 41293 |
| 822 | Ga0495686_0009134 | 3300047472 | Bacteria | 7181 |
| 823 | Ga0495686_0045490 | 3300047472 | Bacteria | 2777 |
| 824 | Ga0495686_0181060 | 3300047472 | Bacteria | 1221 |
| 825 | Ga0495593_0008525 | 3300047673 | Bacteria | 5959 |
| 826 | Ga0495593_0086790 | 3300047673 | Bacteria | 1613 |
| 827 | Ga0495602_0001183 | 3300048088 | Bacteria | 25616 |
| 828 | Ga0495602_0048266 | 3300048088 | Bacteria | 3828 |
| 829 | Ga0495626_0000087 | 3300048091 | Bacteria | 122878 |
| 830 | Ga0495626_0000331 | 3300048091 | Bacteria | 50083 |
| 831 | Ga0495626_0000525 | 3300048091 | Bacteria | 38289 |
| 832 | Ga0495626_0003549 | 3300048091 | Bacteria | 9956 |
| 833 | Ga0495626_0004136 | 3300048091 | Bacteria | 9007 |
| 834 | Ga0495626_0006636 | 3300048091 | Bacteria | 6560 |
| 835 | Ga0495626_0010989 | 3300048091 | Bacteria | 4804 |
| 836 | Ga0496100_0003273 | 3300048903 | Bacteria | 8417 |
| 837 | Ga0496101_0014908 | 3300048904 | Bacteria | 5230 |
| 838 | Ga0496102_0000073 | 3300048905 | Bacteria | 149887 |
| 839 | Ga0496102_0006064 | 3300048905 | Bacteria | 10305 |
| 840 | Ga0496102_0172769 | 3300048905 | Bacteria | 2034 |
| 841 | Ga0496102_0188412 | 3300048905 | Bacteria | 1944 |
| 842 | Ga0496102_0293371 | 3300048905 | Bacteria | 1533 |
| 843 | Ga0496103_0000755 | 3300048906 | Bacteria | 23849 |
| 844 | Ga0496103_0039847 | 3300048906 | Bacteria | 2887 |
| 845 | Ga0496103_0085825 | 3300048906 | Bacteria | 1984 |
| 846 | Ga0496104_0007070 | 3300048907 | Bacteria | 9899 |
| 847 | Ga0496104_0032491 | 3300048907 | Bacteria | 4857 |
| 848 | Ga0496104_0045553 | 3300048907 | Bacteria | 4126 |
| 849 | Ga0496104_0250296 | 3300048907 | Bacteria | 1684 |
| 850 | Ga0496105_0001071 | 3300048908 | Bacteria | 18940 |
| 851 | Ga0496105_0010006 | 3300048908 | Bacteria | 7441 |
| 852 | Ga0496105_0094327 | 3300048908 | Bacteria | 2471 |
| 853 | Ga0496105_0137051 | 3300048908 | Bacteria | 2016 |
| 854 | Ga0496105_0254820 | 3300048908 | Bacteria | 1421 |
| 855 | Ga0496106_0013682 | 3300048909 | Bacteria | 5992 |
| 856 | Ga0496106_0016835 | 3300048909 | Bacteria | 5409 |
| 857 | Ga0496107_0001015 | 3300048910 | Bacteria | 16758 |
| 858 | Ga0496108_0033953 | 3300048911 | Bacteria | 4237 |
| 859 | Ga0496109_0006467 | 3300048912 | Bacteria | 9867 |
| 860 | Ga0496109_0011659 | 3300048912 | Bacteria | 7559 |
| 861 | Ga0496109_0011744 | 3300048912 | Bacteria | 7536 |
| 862 | Ga0496110_0000749 | 3300048913 | Bacteria | 22420 |
| 863 | Ga0496110_0016249 | 3300048913 | Bacteria | 6210 |
| 864 | Ga0496110_0039290 | 3300048913 | Bacteria | 4120 |
| 865 | Ga0496110_0233382 | 3300048913 | Bacteria | 1673 |
| 866 | Ga0496111_0005059 | 3300048914 | Bacteria | 8392 |
| 867 | Ga0496111_0030020 | 3300048914 | Bacteria | 3864 |
| 868 | Ga0496112_0011589 | 3300048915 | Bacteria | 8060 |
| 869 | Ga0496112_0011995 | 3300048915 | Bacteria | 7946 |
| 870 | Ga0496112_0068238 | 3300048915 | Bacteria | 3511 |
| 871 | Ga0496113_0016702 | 3300048916 | Bacteria | 5075 |
| 872 | Ga0496113_0043997 | 3300048916 | Bacteria | 3306 |
| 873 | Ga0496113_0291445 | 3300048916 | Bacteria | 1306 |
| 874 | Ga0496114_0004273 | 3300048917 | Bacteria | 11058 |
| 875 | Ga0496114_0004355 | 3300048917 | Bacteria | 10956 |
| 876 | Ga0496115_0013919 | 3300048918 | Bacteria | 6087 |
| 877 | Ga0496115_0016363 | 3300048918 | Bacteria | 5646 |
| 878 | Ga0496115_0038374 | 3300048918 | Bacteria | 3801 |
| 879 | Ga0496117_0015411 | 3300048920 | Bacteria | 6519 |
| 880 | Ga0496118_0003254 | 3300048921 | Bacteria | 20709 |
| 881 | Ga0496118_0026400 | 3300048921 | Bacteria | 4950 |
| 882 | Ga0496118_0041093 | 3300048921 | Bacteria | 3666 |
| 883 | Ga0496118_0072060 | 3300048921 | Bacteria | 2484 |
| 884 | Ga0496119_0002302 | 3300048922 | Bacteria | 21116 |
| 885 | Ga0496120_0002631 | 3300048923 | Bacteria | 17782 |
| 886 | Ga0496121_0043621 | 3300048924 | Bacteria | 3880 |
| 887 | Ga0496121_0052891 | 3300048924 | Bacteria | 3406 |
| 888 | Ga0496124_0024592 | 3300048927 | Bacteria | 5471 |
| 889 | Ga0496124_0081763 | 3300048927 | Bacteria | 2653 |
| 890 | Ga0496125_0035340 | 3300048928 | Bacteria | 4386 |
| 891 | Ga0496125_0061303 | 3300048928 | Bacteria | 3017 |
| 892 | Ga0495678_000542 | 3300049459 | Bacteria | 36459 |
| 893 | Ga0495678_004994 | 3300049459 | Bacteria | 7476 |
| 894 | Ga0495678_011420 | 3300049459 | Bacteria | 4255 |
| 895 | Ga0495678_016219 | 3300049459 | Bacteria | 3412 |
| 896 | Ga0495678_020921 | 3300049459 | Bacteria | 2887 |
| 897 | Ga0495678_061258 | 3300049459 | Bacteria | 1412 |
| 898 | Ga0495682_0000020 | 3300049460 | Bacteria | 210849 |
| 899 | Ga0495682_0000279 | 3300049460 | Bacteria | 40020 |
| 900 | Ga0495682_0011355 | 3300049460 | Bacteria | 3429 |
| 901 | Ga0495682_0042637 | 3300049460 | Bacteria | 1663 |
| 902 | Ga0501034_0078672 | 3300049571 | Bacteria | 3301 |
| 903 | Ga0501034_0114590 | 3300049571 | Bacteria | 2684 |
| 904 | Ga0501034_0124515 | 3300049571 | Bacteria | 2563 |
| 905 | Ga0501034_0143140 | 3300049571 | Bacteria | 2370 |
| 906 | Ga0501036_0016758 | 3300049572 | Bacteria | 6121 |
| 907 | Ga0501038_0003978 | 3300049574 | Bacteria | 13728 |
| 908 | Ga0501039_0007453 | 3300049575 | Bacteria | 8349 |
| 909 | Ga0501039_0028547 | 3300049575 | Bacteria | 4295 |
| 910 | Ga0501039_0130473 | 3300049575 | Bacteria | 1972 |
| 911 | Ga0501040_0002910 | 3300049576 | Bacteria | 11068 |
| 912 | Ga0501040_0027158 | 3300049576 | Bacteria | 3852 |
| 913 | Ga0501041_0020253 | 3300049577 | Bacteria | 3975 |
| 914 | Ga0501042_0004113 | 3300049578 | Bacteria | 9244 |
| 915 | Ga0501042_0024795 | 3300049578 | Bacteria | 4209 |
| 916 | Ga0501042_0230246 | 3300049578 | Bacteria | 1337 |
| 917 | Ga0501043_0113733 | 3300049579 | Bacteria | 2125 |
| 918 | Ga0501046_0006557 | 3300049580 | Bacteria | 10291 |
| 919 | Ga0501048_0000282 | 3300049582 | Bacteria | 34461 |
| 920 | Ga0501048_0001950 | 3300049582 | Bacteria | 15676 |
| 921 | Ga0501068_0001757 | 3300049584 | Bacteria | 11522 |
| 922 | Ga0501068_0021133 | 3300049584 | Bacteria | 3799 |
| 923 | Ga0501068_0026405 | 3300049584 | Bacteria | 3421 |
| 924 | Ga0501069_0165234 | 3300049585 | Bacteria | 1275 |
| 925 | Ga0501070_0085056 | 3300049586 | Bacteria | 2618 |
| 926 | Ga0501071_0099108 | 3300049587 | Bacteria | 2147 |
| 927 | Ga0501072_0001734 | 3300049588 | Bacteria | 16263 |
| 928 | Ga0501073_0008757 | 3300049589 | Bacteria | 7490 |
| 929 | Ga0501073_0070336 | 3300049589 | Bacteria | 2438 |
| 930 | Ga0501074_0004678 | 3300049590 | Bacteria | 9797 |
| 931 | Ga0501074_0005711 | 3300049590 | Bacteria | 8970 |
| 932 | Ga0501074_0047764 | 3300049590 | Bacteria | 3093 |
| 933 | Ga0501074_0086539 | 3300049590 | Bacteria | 2245 |
| 934 | Ga0501076_0000955 | 3300049592 | Bacteria | 18891 |
| 935 | Ga0501238_000771 | 3300049671 | Bacteria | 3617 |
| 936 | Ga0501079_0000142 | 3300049741 | Bacteria | 39341 |
| 937 | Ga0501079_0001187 | 3300049741 | Bacteria | 18244 |
| 938 | Ga0501079_0002370 | 3300049741 | Bacteria | 13690 |
| 939 | Ga0501080_0002846 | 3300049742 | Bacteria | 15209 |
| 940 | Ga0501080_0069979 | 3300049742 | Bacteria | 3263 |
| 941 | Ga0501080_0080217 | 3300049742 | Bacteria | 3033 |
| 942 | Ga0501080_0104938 | 3300049742 | Bacteria | 2621 |
| 943 | Ga0501081_0000147 | 3300049743 | Bacteria | 32041 |
| 944 | Ga0501081_0000552 | 3300049743 | Bacteria | 21253 |
| 945 | Ga0501083_0081976 | 3300049744 | Bacteria | 2138 |
| 946 | Ga0501035_0159671 | 3300049822 | Bacteria | 1952 |
| 947 | Ga0501035_0265255 | 3300049822 | Bacteria | 1455 |
| 948 | Ga0501044_0146499 | 3300049823 | Bacteria | 2346 |
| 949 | Ga0501045_0000401 | 3300049824 | Bacteria | 26284 |
| 950 | Ga0501045_0069893 | 3300049824 | Bacteria | 2582 |
| 951 | nmdc:mga03683_11227_c1 | 3300050489 | Bacteria | 3236 |
| 952 | nmdc:mga00v17_525_c1 | 3300050491 | Bacteria | 21487 |
| 953 | nmdc:mga00v17_84836_c1 | 3300050491 | Bacteria | 1983 |
| 954 | nmdc:mga05p37_234465_c1 | 3300050507 | Bacteria | 2210 |
| 955 | nmdc:mga05p37_277179_c1 | 3300050507 | Bacteria | 2001 |
| 956 | nmdc:mga09592_108376_c1 | 3300050508 | Bacteria | 2382 |
| 957 | nmdc:mga09592_218298_c1 | 3300050508 | Bacteria | 1652 |
| 958 | nmdc:mga09592_28022_c1 | 3300050508 | Bacteria | 4677 |
| 959 | nmdc:mga09592_53045_c1 | 3300050508 | Bacteria | 3423 |
| 960 | nmdc:mga09592_7612_c1 | 3300050508 | Bacteria | 8811 |
| 961 | nmdc:mga0qj67_148576_c1 | 3300050509 | Bacteria | 1900 |
| 962 | nmdc:mga0qj67_195516_c1 | 3300050509 | Bacteria | 1643 |
| 963 | nmdc:mga0qj67_4366_c1 | 3300050509 | Bacteria | 10243 |
| 964 | nmdc:mga0qj67_5391_c1 | 3300050509 | Bacteria | 9335 |
| 965 | nmdc:mga06r32_13988_c1 | 3300050510 | Bacteria | 7279 |
| 966 | nmdc:mga06r32_70979_c1 | 3300050510 | Bacteria | 3369 |
| 967 | nmdc:mga08y16_109806_c1 | 3300050511 | Bacteria | 2872 |
| 968 | nmdc:mga08y16_14457_c1 | 3300050511 | Bacteria | 8303 |
| 969 | nmdc:mga08y16_205111_c1 | 3300050511 | Bacteria | 2043 |
| 970 | nmdc:mga08y16_2161_c1 | 3300050511 | Bacteria | 20167 |
| 971 | nmdc:mga0n895_249507_c1 | 3300050512 | Bacteria | 1801 |
| 972 | nmdc:mga0rr50_36990_c1 | 3300050513 | Bacteria | 3520 |
| 973 | Ga0495619_0011851 | 3300053085 | Bacteria | 5491 |
| 974 | Ga0500586_036145 | 3300053145 | Bacteria | 1655 |
| 975 | Ga0500588_0061140 | 3300053146 | Bacteria | 1207 |
| 976 | Ga0500616_0006666 | 3300053153 | Bacteria | 7509 |
| 977 | Ga0500616_0010386 | 3300053153 | Bacteria | 5573 |
| 978 | Ga0500622_0023584 | 3300053156 | Bacteria | 3258 |
| 979 | Ga0500636_0116461 | 3300053177 | Bacteria | 1504 |
| 980 | Ga0500637_0014962 | 3300053178 | Bacteria | 4100 |
| 981 | Ga0500637_0064324 | 3300053178 | Bacteria | 2104 |
| 982 | Ga0501084_0008950 | 3300054114 | Bacteria | 8282 |
| 983 | Ga0501084_0012410 | 3300054114 | Bacteria | 7060 |
| 984 | Ga0501082_0005214 | 3300060353 | Bacteria | 11299 |
| 985 | Ga0501082_0013531 | 3300060353 | Bacteria | 7010 |
| 986 | Ga0501082_0083364 | 3300060353 | Bacteria | 2758 |
| 987 | Ga0466962_0024978 | 3300061719 | Bacteria | 2868 |
| 988 | Ga0530510_0009039 | 3300061734 | Bacteria | 6983 |
| 989 | Ga0530510_0040239 | 3300061734 | Bacteria | 3373 |
| 990 | 2511258189 | 2511231004 | Bacteria | 6669789 |
| 991 | 2511277120 | 2511231008 | Bacteria | 6624100 |
| 992 | 2511292024 | 2511231010 | Bacteria | 6373152 |
| 993 | 2511298825 | 2511231011 | Bacteria | 6149768 |
| 994 | 2511301453 | 2511231012 | Bacteria | 6738011 |
| 995 | 2511314730 | 2511231014 | Bacteria | 6462302 |
| 996 | 2511320526 | 2511231015 | Bacteria | 6598026 |
| 997 | 2511333733 | 2511231017 | Bacteria | 6503007 |
| 998 | 2511340091 | 2511231018 | Bacteria | 6436256 |
| 999 | 2511346834 | 2511231019 | Bacteria | 6520662 |
| 1000 | 2511348314 | 2511231020 | Bacteria | 6115223 |
| 1001 | 2511357207 | 2511231021 | Bacteria | 7302637 |
| 1002 | 2511371719 | 2511231023 | Bacteria | 6808468 |
| 1003 | 2511389348 | 2511231027 | Bacteria | 5013807 |
| 1004 | 2535485293 | 2534681786 | Bacteria | 3308809 |
| 1005 | 2643953427 | 2643221589 | Bacteria | 6250934 |
| 1006 | 2644021169 | 2643221602 | Bacteria | 6249926 |
| 1007 | 2644188236 | 2643221633 | Bacteria | 6733554 |
| 1008 | 2739261859 | 2738543015 | Bacteria | 6750701 |
| 1009 | 2765464326 | 2765235802 | Bacteria | 5618596 |
| 1010 | 2770194653 | 2767802442 | Bacteria | 5747986 |
| 1011 | 2809214402 | 2808606445 | Bacteria | 6057339 |
| 1012 | 2819657787 | 2818991456 | Bacteria | 6123676 |
| 1013 | 2837651949 | 2837651117 | Bacteria | 3772164 |
| 1014 | 2839994241 | 2839993093 | Bacteria | 5512535 |
| 1015 | 2842873045 | 2842871566 | Bacteria | 4827117 |
| 1016 | 2904551888 | 2904550169 | Bacteria | 6221258 |
| 1017 | 2904579085 | 2904578770 | Bacteria | 5302906 |
| 1018 | 2919122087 | 2919119836 | Bacteria | 5208557 |
| 1019 | 2928521975 | 2928521798 | Bacteria | 4960112 |
| 1020 | 2939641542 | 2939636861 | Bacteria | 6297853 |
| 1021 | 2939654907 | 2939651529 | Bacteria | 5895393 |
| 1022 | 2954014668 | 2954011201 | Bacteria | 4762601 |
| 1023 | 3000407783 | 3000405567 | Bacteria | 3779330 |
| 1024 | 3007513702 | 3007511990 | Bacteria | 6481491 |
| 1025 | 3007625074 | 3007619802 | Bacteria | 6411688 |
| 1026 | 8056128234 | 8056125926 | Bacteria | 6228218 |
| 1027 | 8056178745 | 8056177738 | Bacteria | 6748268 |
| 1028 | Ga0207674_10248924 | |||
| 1029 | MRS2a_Contig_16 | |||
| 1030 | SwRhRL2b_contig_953756 | |||
| 1031 | LJNas_1001711 | |||
| 1032 | Ga0055530_10012102 | |||
| 1033 | Ga0065714_10000072 | |||
| 1034 | Ga0065714_10005237 | |||
| 1035 | Ga0065714_10066226 | |||
| 1036 | Ga0065714_10067131 | |||
| 1037 | Ga0065714_10075957 | |||
| 1038 | Ga0065704_10000383 | |||
| 1039 | Ga0065712_10008655 | |||
| 1040 | Ga0065712_10070719 | |||
| 1041 | Ga0065712_10097359 | |||
| 1042 | Ga0065715_10005206 | |||
| 1043 | Ga0065715_10179943 | |||
| 1044 | Ga0065707_10086325 | |||
| 1045 | Ga0065707_10171212 | |||
| 1046 | Ga0070676_10016552 | |||
| 1047 | Ga0070676_10026332 | |||
| 1048 | Ga0070676_10080007 | |||
| 1049 | Ga0070683_100058980 | |||
| 1050 | Ga0070690_100003222 | |||
| 1051 | Ga0070690_100004347 | |||
| 1052 | Ga0070690_100057243 | |||
| 1053 | Ga0070670_100156086 | |||
| 1054 | Ga0068869_100012109 | |||
| 1055 | Ga0070666_10000962 | |||
| 1056 | Ga0070666_10011348 | |||
| 1057 | Ga0070666_10121936 | |||
| 1058 | Ga0070680_100013082 | |||
| 1059 | Ga0070680_100035452 | |||
| 1060 | Ga0070680_100083582 | |||
| 1061 | Ga0068868_100004028 | |||
| 1062 | Ga0068868_100049291 | |||
| 1063 | Ga0070689_100003911 | |||
| 1064 | Ga0070687_100009013 | |||
| 1065 | Ga0070687_100049552 | |||
| 1066 | Ga0070661_100006248 | |||
| 1067 | Ga0070668_100278649 | |||
| 1068 | Ga0070669_100005076 | |||
| 1069 | Ga0070669_100013419 | |||
| 1070 | Ga0070669_100056750 | |||
| 1071 | Ga0070669_100076753 | |||
| 1072 | Ga0070675_100001269 | |||
| 1073 | Ga0070675_100182374 | |||
| 1074 | Ga0070671_100001534 | |||
| 1075 | Ga0070674_100009909 | |||
| 1076 | Ga0070673_100082082 | |||
| 1077 | Ga0070673_100170866 | |||
| 1078 | Ga0070688_100032026 | |||
| 1079 | Ga0070659_100158956 | |||
| 1080 | Ga0070667_100003021 | |||
| 1081 | Ga0070667_100114387 | |||
| 1082 | Ga0070709_10007519 | |||
| 1083 | Ga0070709_10035426 | |||
| 1084 | Ga0070714_100006553 | |||
| 1085 | Ga0070714_100098538 | |||
| 1086 | Ga0070713_100012067 | |||
| 1087 | Ga0070713_100056713 | |||
| 1088 | Ga0070713_100136448 | |||
| 1089 | Ga0070713_100194413 | |||
| 1090 | Ga0070711_100002860 | |||
| 1091 | Ga0070711_100079964 | |||
| 1092 | Ga0070711_100182802 | |||
| 1093 | Ga0070694_100226894 | |||
| 1094 | Ga0070678_100001008 | |||
| 1095 | Ga0070662_100003902 | |||
| 1096 | Ga0070662_100014075 | |||
| 1097 | Ga0070662_100017390 | |||
| 1098 | Ga0070662_100028108 | |||
| 1099 | Ga0070681_10001577 | |||
| 1100 | Ga0070681_10001582 | |||
| 1101 | Ga0070681_10022982 | |||
| 1102 | Ga0070681_10024376 | |||
| 1103 | Ga0070681_10104148 | |||
| 1104 | Ga0068867_100022954 | |||
| 1105 | Ga0068867_100027329 | |||
| 1106 | Ga0070698_100092786 | |||
| 1107 | Ga0070699_100023197 | |||
| 1108 | Ga0070699_100245641 | |||
| 1109 | Ga0070679_100000469 | |||
| 1110 | Ga0070679_100025516 | |||
| 1111 | Ga0070679_100034185 | |||
| 1112 | Ga0070679_100133096 | |||
| 1113 | Ga0070684_100000389 | |||
| 1114 | Ga0068853_100235807 | |||
| 1115 | Ga0070672_100004629 | |||
| 1116 | Ga0070672_100011940 | |||
| 1117 | Ga0070672_100047307 | |||
| 1118 | Ga0070672_100291995 | |||
| 1119 | Ga0070695_100001122 | |||
| 1120 | Ga0070696_100000233 | |||
| 1121 | Ga0070696_100059238 | |||
| 1122 | Ga0070696_100069992 | |||
| 1123 | Ga0070693_100066758 | |||
| 1124 | Ga0070665_100002122 | |||
| 1125 | Ga0070665_100006304 | |||
| 1126 | Ga0070665_100027331 | |||
| 1127 | Ga0070665_100077491 | |||
| 1128 | Ga0070704_100007227 | |||
| 1129 | Ga0068855_100001482 | |||
| 1130 | Ga0068855_100001944 | |||
| 1131 | Ga0068855_100020801 | |||
| 1132 | Ga0068855_100032489 | |||
| 1133 | Ga0070664_100002633 | |||
| 1134 | Ga0068857_100013260 | |||
| 1135 | Ga0068857_100091965 | |||
| 1136 | Ga0068854_100276653 | |||
| 1137 | Ga0068856_100008652 | |||
| 1138 | Ga0070702_100034486 | |||
| 1139 | Ga0068859_100008619 | |||
| 1140 | Ga0068859_100043274 | |||
| 1141 | Ga0068859_100109922 | |||
| 1142 | Ga0068864_100004892 | |||
| 1143 | Ga0068866_10008386 | |||
| 1144 | Ga0068861_100014206 | |||
| 1145 | Ga0068861_100023752 | |||
| 1146 | Ga0068861_100084466 | |||
| 1147 | Ga0068861_100111892 | |||
| 1148 | Ga0068861_100318503 | |||
| 1149 | Ga0068870_10088817 | |||
| 1150 | Ga0068863_100005440 | |||
| 1151 | Ga0068863_100011401 | |||
| 1152 | Ga0068858_100012168 | |||
| 1153 | Ga0068858_100019147 | |||
| 1154 | Ga0068858_100326704 | |||
| 1155 | Ga0068858_100391105 | |||
| 1156 | Ga0068860_100004196 | |||
| 1157 | Ga0068860_100007155 | |||
| 1158 | Ga0068860_100021474 | |||
| 1159 | Ga0068862_100004849 | |||
| 1160 | Ga0068862_100042263 | |||
| 1161 | Ga0070717_10296058 | |||
| 1162 | Ga0075364_10000792 | |||
| 1163 | Ga0075432_10002709 | |||
| 1164 | Ga0075432_10004298 | |||
| 1165 | Ga0070715_10003057 | |||
| 1166 | Ga0070716_100000449 | |||
| 1167 | Ga0070716_100042537 | |||
| 1168 | Ga0070712_100007685 | |||
| 1169 | Ga0070712_100159298 | |||
| 1170 | Ga0070712_100216295 | |||
| 1171 | Ga0075362_10007547 | |||
| 1172 | Ga0097621_100031096 | |||
| 1173 | Ga0097621_100091567 | |||
| 1174 | Ga0068871_100058698 | |||
| 1175 | Ga0068871_100186058 | |||
| 1176 | Ga0068871_100203953 | |||
| 1177 | Ga0068871_100321155 | |||
| 1178 | Ga0075428_100010582 | |||
| 1179 | Ga0075428_100068346 | |||
| 1180 | Ga0075428_100116803 | |||
| 1181 | Ga0075428_100151919 | |||
| 1182 | Ga0075430_100007468 | |||
| 1183 | Ga0075430_100031773 | |||
| 1184 | Ga0075430_100053905 | |||
| 1185 | Ga0075431_100007866 | |||
| 1186 | Ga0075431_100009924 | |||
| 1187 | Ga0075431_100081783 | |||
| 1188 | Ga0075431_100335748 | |||
| 1189 | Ga0075429_100034978 | |||
| 1190 | Ga0075429_100044334 | |||
| 1191 | Ga0068865_100000735 | |||
| 1192 | Ga0097620_100008619 | |||
| 1193 | Ga0097620_100043275 | |||
| 1194 | Ga0097620_100109919 | |||
| 1195 | Ga0079104_1000068 | |||
| 1196 | Ga0099826_10083695 | |||
| 1197 | Ga0075435_100010333 | |||
| 1198 | Ga0099794_10059459 | |||
| 1199 | Ga0099795_10000022 | |||
| 1200 | Ga0105251_10009643 | |||
| 1201 | Ga0105244_10006047 | |||
| 1202 | Ga0105244_10030412 | |||
| 1203 | Ga0105250_10006223 | |||
| 1204 | Ga0105250_10061266 | |||
| 1205 | Ga0105250_10061724 | |||
| 1206 | Ga0105240_10002127 | |||
| 1207 | Ga0105240_10002705 | |||
| 1208 | Ga0105240_10003826 | |||
| 1209 | Ga0105240_10024889 | |||
| 1210 | Ga0105240_10032775 | |||
| 1211 | Ga0105240_10130983 | |||
| 1212 | Ga0105240_10328419 | |||
| 1213 | Ga0111539_10033108 | |||
| 1214 | Ga0111539_10076554 | |||
| 1215 | Ga0111539_10077583 | |||
| 1216 | Ga0111539_10201499 | |||
| 1217 | Ga0111539_10267558 | |||
| 1218 | Ga0111539_10564067 | |||
| 1219 | Ga0105245_10007920 | |||
| 1220 | Ga0105245_10023209 | |||
| 1221 | Ga0105247_10012409 | |||
| 1222 | Ga0105247_10111901 | |||
| 1223 | Ga0105247_10121127 | |||
| 1224 | Ga0114129_10000367 | |||
| 1225 | Ga0114129_10087255 | |||
| 1226 | Ga0114129_10447332 | |||
| 1227 | Ga0105243_10027562 | |||
| 1228 | Ga0105243_10041735 | |||
| 1229 | Ga0105241_10007997 | |||
| 1230 | Ga0105242_10005298 | |||
| 1231 | Ga0105242_10082584 | |||
| 1232 | Ga0105242_10321662 | |||
| 1233 | Ga0105248_10001404 | |||
| 1234 | Ga0105248_10005489 | |||
| 1235 | Ga0105237_10008371 | |||
| 1236 | Ga0105237_10127911 | |||
| 1237 | Ga0105238_10005376 | |||
| 1238 | Ga0105238_10006381 | |||
| 1239 | Ga0105238_10161450 | |||
| 1240 | Ga0105249_10184405 | |||
| 1241 | Ga0099796_10000025 | |||
| 1242 | Ga0105239_10005723 | |||
| 1243 | Ga0105239_10052494 | |||
| 1244 | Ga0105239_10216510 | |||
| 1245 | Ga0105246_10006341 | |||
| 1246 | Ga0157370_10001472 | |||
| 1247 | Ga0157369_10065057 | |||
| 1248 | Ga0157369_10297375 | |||
| 1249 | Ga0157374_10007656 | |||
| 1250 | Ga0157374_10014556 | |||
| 1251 | Ga0157374_10156555 | |||
| 1252 | Ga0157374_10308818 | |||
| 1253 | Ga0157374_10376833 | |||
| 1254 | Ga0157378_10004873 | |||
| 1255 | Ga0157378_10122887 | |||
| 1256 | Ga0157378_10152685 | |||
| 1257 | Ga0163162_10020035 | |||
| 1258 | Ga0163162_10067923 | |||
| 1259 | Ga0163162_10111624 | |||
| 1260 | Ga0163162_10126118 | |||
| 1261 | Ga0157375_10010708 | |||
| 1262 | Ga0157375_10018198 | |||
| 1263 | Ga0157375_10039263 | |||
| 1264 | Ga0157375_10087488 | |||
| 1265 | Ga0163163_10000485 | |||
| 1266 | Ga0163163_10025005 | |||
| 1267 | Ga0163163_10101260 | |||
| 1268 | Ga0163163_10109176 | |||
| 1269 | Ga0163163_10259556 | |||
| 1270 | Ga0157380_10025900 | |||
| 1271 | Ga0157380_10031338 | |||
| 1272 | Ga0157380_10137624 | |||
| 1273 | Ga0182008_10000655 | |||
| 1274 | Ga0157377_10040514 | |||
| 1275 | Ga0157377_10106531 | |||
| 1276 | Ga0157379_10006630 | |||
| 1277 | Ga0157379_10009851 | |||
| 1278 | Ga0157379_10060155 | |||
| 1279 | Ga0157379_10160111 | |||
| 1280 | Ga0157376_10014926 | |||
| 1281 | Ga0157376_10129844 | |||
| 1282 | Ga0157376_10296935 | |||
| 1283 | Ga0182005_1001019 | |||
| 1284 | Ga0182005_1001549 | |||
| 1285 | Ga0182005_1005470 | |||
| 1286 | Ga0182005_1006564 | |||
| 1287 | Ga0163161_10000986 | |||
| 1288 | Ga0163161_10012623 | |||
| 1289 | Ga0163161_10036963 | |||
| 1290 | Ga0163161_10072485 | |||
| 1291 | Ga0163161_10081043 | |||
| 1292 | Ga0213874_10025026 | |||
| 1293 | Ga0213871_10024524 | |||
| 1294 | Ga0209676_1003062 | |||
| 1295 | Ga0209050_1000229 | |||
| 1296 | Ga0207696_1001869 | |||
| 1297 | Ga0207696_1005521 | |||
| 1298 | Ga0207655_1002567 | |||
| 1299 | Ga0207655_1035489 | |||
| 1300 | Ga0207713_1007553 | |||
| 1301 | Ga0207713_1007696 | |||
| 1302 | Ga0207713_1007941 | |||
| 1303 | Ga0207692_10069265 | |||
| 1304 | Ga0207642_10012317 | |||
| 1305 | Ga0207688_10003915 | |||
| 1306 | Ga0207680_10020513 | |||
| 1307 | Ga0207699_10009239 | |||
| 1308 | Ga0207699_10019729 | |||
| 1309 | Ga0207699_10047568 | |||
| 1310 | Ga0207645_10001223 | |||
| 1311 | Ga0207645_10008199 | |||
| 1312 | Ga0207645_10020611 | |||
| 1313 | Ga0207645_10031001 | |||
| 1314 | Ga0207643_10015755 | |||
| 1315 | Ga0207643_10054417 | |||
| 1316 | Ga0207654_10059460 | |||
| 1317 | Ga0207707_10000122 | |||
| 1318 | Ga0207707_10010048 | |||
| 1319 | Ga0207707_10026203 | |||
| 1320 | Ga0207707_10036563 | |||
| 1321 | Ga0207707_10051542 | |||
| 1322 | Ga0207695_10003540 | |||
| 1323 | Ga0207695_10009529 | |||
| 1324 | Ga0207695_10024867 | |||
| 1325 | Ga0207695_10076336 | |||
| 1326 | Ga0207695_10224006 | |||
| 1327 | Ga0207695_10282383 | |||
| 1328 | Ga0207671_10023246 | |||
| 1329 | Ga0207671_10150432 | |||
| 1330 | Ga0207693_10000083 | |||
| 1331 | Ga0207693_10018817 | |||
| 1332 | Ga0207693_10067420 | |||
| 1333 | Ga0207663_10014494 | |||
| 1334 | Ga0207663_10068245 | |||
| 1335 | Ga0207663_10103380 | |||
| 1336 | Ga0207660_10004896 | |||
| 1337 | Ga0207660_10125130 | |||
| 1338 | Ga0207662_10017279 | |||
| 1339 | Ga0207662_10049888 | |||
| 1340 | Ga0207649_10015857 | |||
| 1341 | Ga0207652_10000613 | |||
| 1342 | Ga0207652_10054368 | |||
| 1343 | Ga0207681_10023771 | |||
| 1344 | Ga0207681_10035475 | |||
| 1345 | Ga0207681_10115901 | |||
| 1346 | Ga0207694_10003403 | |||
| 1347 | Ga0207650_10151323 | |||
| 1348 | Ga0207700_10019447 | |||
| 1349 | Ga0207664_10002133 | |||
| 1350 | Ga0207664_10092412 | |||
| 1351 | Ga0207644_10054804 | |||
| 1352 | Ga0207706_10004326 | |||
| 1353 | Ga0207706_10011127 | |||
| 1354 | Ga0207706_10022865 | |||
| 1355 | Ga0207706_10049227 | |||
| 1356 | Ga0207706_10123377 | |||
| 1357 | Ga0207686_10012915 | |||
| 1358 | Ga0207709_10100092 | |||
| 1359 | Ga0207670_10018344 | |||
| 1360 | Ga0207704_10004318 | |||
| 1361 | Ga0207704_10026508 | |||
| 1362 | Ga0207665_10000587 | |||
| 1363 | Ga0207691_10001448 | |||
| 1364 | Ga0207691_10003491 | |||
| 1365 | Ga0207691_10025122 | |||
| 1366 | Ga0207691_10063046 | |||
| 1367 | Ga0207691_10089162 | |||
| 1368 | Ga0207711_10010034 | |||
| 1369 | Ga0207711_10069829 | |||
| 1370 | Ga0207689_10002923 | |||
| 1371 | Ga0207689_10119325 | |||
| 1372 | Ga0207679_10004598 | |||
| 1373 | Ga0207667_10000798 | |||
| 1374 | Ga0207667_10004634 | |||
| 1375 | Ga0207667_10010115 | |||
| 1376 | Ga0207667_10045147 | |||
| 1377 | Ga0207651_10065531 | |||
| 1378 | Ga0207712_10135138 | |||
| 1379 | Ga0207668_10018342 | |||
| 1380 | Ga0207658_10015483 | |||
| 1381 | Ga0207658_10033045 | |||
| 1382 | Ga0207658_10102880 | |||
| 1383 | Ga0207677_10011599 | |||
| 1384 | Ga0207703_10013397 | |||
| 1385 | Ga0207703_10020264 | |||
| 1386 | Ga0207703_10034034 | |||
| 1387 | Ga0207639_10187658 | |||
| 1388 | Ga0207702_10014159 | |||
| 1389 | Ga0207702_10050952 | |||
| 1390 | Ga0207641_10010458 | |||
| 1391 | Ga0207641_10013892 | |||
| 1392 | Ga0207641_10107192 | |||
| 1393 | Ga0207648_10003080 | |||
| 1394 | Ga0207648_10017129 | |||
| 1395 | Ga0207648_10031254 | |||
| 1396 | Ga0207676_10000965 | |||
| 1397 | Ga0207676_10162691 | |||
| 1398 | Ga0207674_10019239 | |||
| 1399 | Ga0207674_10038183 | |||
| 1400 | Ga0207674_10106883 | |||
| 1401 | Ga0207674_10123226 | |||
| 1402 | Ga0207675_100011407 | |||
| 1403 | Ga0207675_100021455 | |||
| 1404 | Ga0207675_100021604 | |||
| 1405 | Ga0207675_100025193 | |||
| 1406 | Ga0207675_100044724 | |||
| 1407 | Ga0207675_100120239 | |||
| 1408 | Ga0207683_10004897 | |||
| 1409 | Ga0207683_10015951 | |||
| 1410 | Ga0209281_1000168 | |||
| 1411 | Ga0209179_1000130 | |||
| 1412 | Ga0209968_1002478 | |||
| 1413 | Ga0210002_1000931 | |||
| 1414 | Ga0209983_1003838 | |||
| 1415 | Ga0209971_1001319 | |||
| 1416 | Ga0209966_1008616 | |||
| 1417 | Ga0209998_10003556 | |||
| 1418 | Ga0209974_10000854 | |||
| 1419 | Ga0209974_10000908 | |||
| 1420 | Ga0209974_10015078 | |||
| 1421 | Ga0207428_10007665 | |||
| 1422 | Ga0207428_10031774 | |||
| 1423 | Ga0207428_10037263 | |||
| 1424 | Ga0207428_10054420 | |||
| 1425 | Ga0207428_10175028 | |||
| 1426 | Ga0265356_1002354 | |||
| 1427 | Ga0268266_10001602 | |||
| 1428 | Ga0268266_10078755 | |||
| 1429 | Ga0268265_10004447 | |||
| 1430 | Ga0268265_10010052 | |||
| 1431 | Ga0268265_10027069 | |||
| 1432 | Ga0268265_10081988 | |||
| 1433 | Ga0268264_10008436 | |||
| 1434 | Ga0265326_10003138 | |||
| 1435 | Ga0265319_1034522 | |||
| 1436 | Ga0265334_10010215 | |||
| 1437 | Ga0265318_10001836 | |||
| 1438 | Ga0265338_10027362 | |||
| 1439 | Ga0265770_1000007 | |||
| 1440 | Ga0265771_1000279 | |||
| 1441 | Ga0265330_10004483 | |||
| 1442 | Ga0265332_10003174 | |||
| 1443 | Ga0265328_10001169 | |||
| 1444 | Ga0265328_10001255 | |||
| 1445 | Ga0265325_10014663 | |||
| 1446 | Ga0265329_10002693 | |||
| 1447 | Ga0265340_10031574 | |||
| 1448 | Ga0265316_10087366 | |||
| 1449 | Ga0307513_10300521 | |||
| 1450 | Ga0307509_10002372 | |||
| 1451 | Ga0307408_100167094 | |||
| 1452 | Ga0316579_10006989 | |||
| 1453 | Ga0265314_10005988 | |||
| 1454 | Ga0316576_10016733 | |||
| 1455 | Ga0316578_10032798 | |||
| 1456 | Ga0307516_10003963 | |||
| 1457 | Ga0316577_10012050 | |||
| 1458 | Ga0307406_10054867 | |||
| 1459 | Ga0307407_10026194 | |||
| 1460 | Ga0307412_10083076 | |||
| 1461 | Ga0307409_100002517 | |||
| 1462 | Ga0307416_100022288 | |||
| 1463 | Ga0307416_100373857 | |||
| 1464 | Ga0307415_100040526 | |||
| 1465 | Ga0307415_100125851 | |||
| 1466 | Ga0316583_10043007 | |||
| 1467 | Ga0316585_10009072 | |||
| 1468 | Ga0316585_10026871 | |||
| 1469 | Ga0316588_1029669 | |||
| 1470 | Ga0373934_0021534 | |||
| 1471 | Ga0373946_0018068 | |||
| 1472 | Ga0316574_0015922 | |||
| 1473 | Ga0316574_0082030 | |||
| 1474 | Ga0316574_0148528 | |||
| 1475 | Ga0373927_0006326 | |||
| 1476 | Ga0373927_0009759 | |||
| 1477 | Ga0373947_0088407 | |||
| 1478 | Ga0316582_0053540 | |||
| 1479 | Ga0373925_0005652 | |||
| 1480 | Ga0237819_01035 | |||
| 1481 | Ga0436360_0255389 | |||
| 1482 | Ga0436360_0257108 | |||
| 1483 | Ga0436363_0564042 | |||
| 1484 | Ga0436363_0826655 | |||
| 1485 | Ga0436362_0359256 | |||
| 1486 | Ga0439438_000155 | |||
| 1487 | Ga0439438_006304 | |||
| 1488 | Ga0439447_000840 | |||
| 1489 | Ga0439447_007663 | |||
| 1490 | Ga0439466_0001516 | |||
| 1491 | Ga0439466_0010091 | |||
| 1492 | Ga0439466_0015719 | |||
| 1493 | Ga0439432_014891 | |||
| 1494 | Ga0439451_001251 | |||
| 1495 | Ga0439452_001295 | |||
| 1496 | Ga0439456_000015 | |||
| 1497 | Ga0450920_000277 | |||
| 1498 | Ga0450922_000055 | |||
| 1499 | Ga0450896_005081 | |||
| 1500 | Ga0450902_000197 | |||
| 1501 | Ga0450902_000877 | |||
| 1502 | Ga0450903_001073 | |||
| 1503 | Ga0450904_000756 | |||
| 1504 | Ga0450905_003315 | |||
| 1505 | Ga0450906_011247 | |||
| 1506 | Ga0450907_000997 | |||
| 1507 | Ga0451577_0013334 | |||
| 1508 | Ga0451577_0062323 | |||
| 1509 | Ga0451577_0112387 | |||
| 1510 | Ga0466969_0002997 | |||
| 1511 | Ga0466969_0003345 | |||
| 1512 | Ga0466969_0053179 | |||
| 1513 | Ga0466966_0004455 | |||
| 1514 | Ga0466966_0087835 | |||
| 1515 | Ga0466961_0001050 | |||
| 1516 | Ga0466964_0022702 | |||
| 1517 | Ga0453684_0167831 | |||
| 1518 | Ga0466971_0009912 | |||
| 1519 | Ga0466970_0007100 | |||
| 1520 | Ga0466957_0004657 | |||
| 1521 | Ga0466959_0035356 | |||
| 1522 | Ga0466959_0060878 | |||
| 1523 | Ga0466959_0144119 | |||
| 1524 | Ga0451576_0023197 | |||
| 1525 | Ga0451576_0077150 | |||
| 1526 | Ga0451576_0079861 | |||
| 1527 | Ga0495617_000474 | |||
| 1528 | Ga0495617_003460 | |||
| 1529 | Ga0495617_003692 | |||
| 1530 | Ga0495617_004104 | |||
| 1531 | Ga0495617_006049 | |||
| 1532 | Ga0495617_012387 | |||
| 1533 | Ga0495617_061351 | |||
| 1534 | Ga0495627_000534 | |||
| 1535 | Ga0495627_000640 | |||
| 1536 | Ga0495627_007012 | |||
| 1537 | Ga0495627_012974 | |||
| 1538 | Ga0495627_052243 | |||
| 1539 | Ga0495592_0005399 | |||
| 1540 | Ga0495603_0001283 | |||
| 1541 | Ga0495603_0005913 | |||
| 1542 | Ga0495590_0000130 | |||
| 1543 | Ga0495590_0003711 | |||
| 1544 | Ga0495590_0005128 | |||
| 1545 | Ga0495590_0010681 | |||
| 1546 | Ga0495591_000021 | |||
| 1547 | Ga0495591_000150 | |||
| 1548 | Ga0495591_000273 | |||
| 1549 | Ga0495591_002178 | |||
| 1550 | Ga0495591_002505 | |||
| 1551 | Ga0495591_007189 | |||
| 1552 | Ga0495591_008436 | |||
| 1553 | Ga0495591_009648 | |||
| 1554 | Ga0495629_0000490 | |||
| 1555 | Ga0495629_0013707 | |||
| 1556 | Ga0495629_0111232 | |||
| 1557 | Ga0495638_0000947 | |||
| 1558 | Ga0495638_0001168 | |||
| 1559 | Ga0495638_0001991 | |||
| 1560 | Ga0495638_0002314 | |||
| 1561 | Ga0495638_0003073 | |||
| 1562 | Ga0495638_0005036 | |||
| 1563 | Ga0495638_0007477 | |||
| 1564 | Ga0495638_0008564 | |||
| 1565 | Ga0495638_0009288 | |||
| 1566 | Ga0495638_0009651 | |||
| 1567 | Ga0495638_0018895 | |||
| 1568 | Ga0495638_0020025 | |||
| 1569 | Ga0495638_0028419 | |||
| 1570 | Ga0495638_0115045 | |||
| 1571 | Ga0495641_0012212 | |||
| 1572 | Ga0495653_0070080 | |||
| 1573 | Ga0495650_0003285 | |||
| 1574 | Ga0495650_0004517 | |||
| 1575 | Ga0495650_0005241 | |||
| 1576 | Ga0495650_0009160 | |||
| 1577 | Ga0495650_0022637 | |||
| 1578 | Ga0495580_0002317 | |||
| 1579 | Ga0495580_0097407 | |||
| 1580 | Ga0495580_0131295 | |||
| 1581 | Ga0495582_0003939 | |||
| 1582 | Ga0495582_0010605 | |||
| 1583 | Ga0495605_0000480 | |||
| 1584 | Ga0495605_0002173 | |||
| 1585 | Ga0495605_0002997 | |||
| 1586 | Ga0495605_0006888 | |||
| 1587 | Ga0495639_0004319 | |||
| 1588 | Ga0495639_0005800 | |||
| 1589 | Ga0495639_0022287 | |||
| 1590 | Ga0495584_0000067 | |||
| 1591 | Ga0495584_0000917 | |||
| 1592 | Ga0495584_0001601 | |||
| 1593 | Ga0495584_0020071 | |||
| 1594 | Ga0495584_0083289 | |||
| 1595 | Ga0495585_0000030 | |||
| 1596 | Ga0495585_0000056 | |||
| 1597 | Ga0495585_0000335 | |||
| 1598 | Ga0495585_0000871 | |||
| 1599 | Ga0495585_0003232 | |||
| 1600 | Ga0495585_0003534 | |||
| 1601 | Ga0495585_0005465 | |||
| 1602 | Ga0495585_0006863 | |||
| 1603 | Ga0495585_0062042 | |||
| 1604 | Ga0495594_0001605 | |||
| 1605 | Ga0495594_0002194 | |||
| 1606 | Ga0495596_0000012 | |||
| 1607 | Ga0495596_0006906 | |||
| 1608 | Ga0495607_0001305 | |||
| 1609 | Ga0495607_0006997 | |||
| 1610 | Ga0495607_0012999 | |||
| 1611 | Ga0495607_0014897 | |||
| 1612 | Ga0495607_0020256 | |||
| 1613 | Ga0495583_0000112 | |||
| 1614 | Ga0495583_0003028 | |||
| 1615 | Ga0495583_0004042 | |||
| 1616 | Ga0495606_0002318 | |||
| 1617 | Ga0495606_0004165 | |||
| 1618 | Ga0495606_0007763 | |||
| 1619 | Ga0495606_0009647 | |||
| 1620 | Ga0495606_0083686 | |||
| 1621 | Ga0495610_0003225 | |||
| 1622 | Ga0495610_0003495 | |||
| 1623 | Ga0495610_0004389 | |||
| 1624 | Ga0495610_0004415 | |||
| 1625 | Ga0495610_0010870 | |||
| 1626 | Ga0495610_0014754 | |||
| 1627 | Ga0495610_0017503 | |||
| 1628 | Ga0495610_0030494 | |||
| 1629 | Ga0495616_0000251 | |||
| 1630 | Ga0495616_0001505 | |||
| 1631 | Ga0495616_0003694 | |||
| 1632 | Ga0495616_0006088 | |||
| 1633 | Ga0495616_0011509 | |||
| 1634 | Ga0495616_0020835 | |||
| 1635 | Ga0495616_0048391 | |||
| 1636 | Ga0495620_0000860 | |||
| 1637 | Ga0495620_0003461 | |||
| 1638 | Ga0495620_0004610 | |||
| 1639 | Ga0495620_0009266 | |||
| 1640 | Ga0495630_0003131 | |||
| 1641 | Ga0495630_0022286 | |||
| 1642 | Ga0495631_0000002 | |||
| 1643 | Ga0495631_0005996 | |||
| 1644 | Ga0495631_0008277 | |||
| 1645 | Ga0495632_0002079 | |||
| 1646 | Ga0495632_0003562 | |||
| 1647 | Ga0495632_0004142 | |||
| 1648 | Ga0495632_0004772 | |||
| 1649 | Ga0495632_0005080 | |||
| 1650 | Ga0495632_0006324 | |||
| 1651 | Ga0495632_0007608 | |||
| 1652 | Ga0495632_0008901 | |||
| 1653 | Ga0495632_0009802 | |||
| 1654 | Ga0495632_0014646 | |||
| 1655 | Ga0495632_0077697 | |||
| 1656 | Ga0495632_0096544 | |||
| 1657 | Ga0495637_0000246 | |||
| 1658 | Ga0495637_0001056 | |||
| 1659 | Ga0495637_0002226 | |||
| 1660 | Ga0495637_0003199 | |||
| 1661 | Ga0495637_0003357 | |||
| 1662 | Ga0495637_0004380 | |||
| 1663 | Ga0495637_0013128 | |||
| 1664 | Ga0495643_0004092 | |||
| 1665 | Ga0495643_0010664 | |||
| 1666 | Ga0495644_0000025 | |||
| 1667 | Ga0495644_0000545 | |||
| 1668 | Ga0495648_0000246 | |||
| 1669 | Ga0495648_0000981 | |||
| 1670 | Ga0495648_0001566 | |||
| 1671 | Ga0495648_0002585 | |||
| 1672 | Ga0495648_0007688 | |||
| 1673 | Ga0495648_0015779 | |||
| 1674 | Ga0495648_0026386 | |||
| 1675 | Ga0495648_0034013 | |||
| 1676 | Ga0495666_0002299 | |||
| 1677 | Ga0495666_0006761 | |||
| 1678 | Ga0495666_0035650 | |||
| 1679 | Ga0495642_0000003 | |||
| 1680 | Ga0495642_0000245 | |||
| 1681 | Ga0495654_0000225 | |||
| 1682 | Ga0495654_0003093 | |||
| 1683 | Ga0495654_0003282 | |||
| 1684 | Ga0495654_0004064 | |||
| 1685 | Ga0495654_0007273 | |||
| 1686 | Ga0495654_0011129 | |||
| 1687 | Ga0495654_0017099 | |||
| 1688 | Ga0495654_0033827 | |||
| 1689 | Ga0495654_0042546 | |||
| 1690 | Ga0495654_0043339 | |||
| 1691 | Ga0495586_0026747 | |||
| 1692 | Ga0495586_0033140 | |||
| 1693 | Ga0495587_0000989 | |||
| 1694 | Ga0495587_0005793 | |||
| 1695 | Ga0495609_0004230 | |||
| 1696 | Ga0495609_0006067 | |||
| 1697 | Ga0495609_0008112 | |||
| 1698 | Ga0495621_0001365 | |||
| 1699 | Ga0495597_0001245 | |||
| 1700 | Ga0495597_0001251 | |||
| 1701 | Ga0495597_0005566 | |||
| 1702 | Ga0495597_0008380 | |||
| 1703 | Ga0495597_0015109 | |||
| 1704 | Ga0495597_0015948 | |||
| 1705 | Ga0495597_0021618 | |||
| 1706 | Ga0495645_0018444 | |||
| 1707 | Ga0495645_0133200 | |||
| 1708 | Ga0495622_0004166 | |||
| 1709 | Ga0495622_0005166 | |||
| 1710 | Ga0495622_0007233 | |||
| 1711 | Ga0495622_0008458 | |||
| 1712 | Ga0495633_0000612 | |||
| 1713 | Ga0495633_0005129 | |||
| 1714 | Ga0495656_0004477 | |||
| 1715 | Ga0495656_0014077 | |||
| 1716 | Ga0495668_0000728 | |||
| 1717 | Ga0495668_0001396 | |||
| 1718 | Ga0495668_0011121 | |||
| 1719 | Ga0495634_0000572 | |||
| 1720 | Ga0495634_0006857 | |||
| 1721 | Ga0495634_0011150 | |||
| 1722 | Ga0495611_0002819 | |||
| 1723 | Ga0495625_0000838 | |||
| 1724 | Ga0495625_0001956 | |||
| 1725 | Ga0495625_0012219 | |||
| 1726 | Ga0495625_0018882 | |||
| 1727 | Ga0495625_0034474 | |||
| 1728 | Ga0495625_0053431 | |||
| 1729 | Ga0495625_0081578 | |||
| 1730 | Ga0495625_0097604 | |||
| 1731 | Ga0495635_0000115 | |||
| 1732 | Ga0495635_0000594 | |||
| 1733 | Ga0495635_0060343 | |||
| 1734 | Ga0495635_0196965 | |||
| 1735 | Ga0495659_0000208 | |||
| 1736 | Ga0495659_0035154 | |||
| 1737 | Ga0495661_0000100 | |||
| 1738 | Ga0495661_0004882 | |||
| 1739 | Ga0495661_0030206 | |||
| 1740 | Ga0495661_0034374 | |||
| 1741 | Ga0495661_0071738 | |||
| 1742 | Ga0495661_0076183 | |||
| 1743 | Ga0495661_0148413 | |||
| 1744 | Ga0495588_0005387 | |||
| 1745 | Ga0495588_0006858 | |||
| 1746 | Ga0495588_0024007 | |||
| 1747 | Ga0495588_0089190 | |||
| 1748 | Ga0495623_0004300 | |||
| 1749 | Ga0495646_0003836 | |||
| 1750 | Ga0495646_0007178 | |||
| 1751 | Ga0495647_0006055 | |||
| 1752 | Ga0495658_0012040 | |||
| 1753 | Ga0495658_0012173 | |||
| 1754 | Ga0495658_0022014 | |||
| 1755 | Ga0495613_0001100 | |||
| 1756 | Ga0495613_0007322 | |||
| 1757 | Ga0495613_0008530 | |||
| 1758 | Ga0495613_0011859 | |||
| 1759 | Ga0495613_0014931 | |||
| 1760 | Ga0495624_0000975 | |||
| 1761 | Ga0495670_0000596 | |||
| 1762 | Ga0495670_0010570 | |||
| 1763 | Ga0495671_0000066 | |||
| 1764 | Ga0495671_0000459 | |||
| 1765 | Ga0495671_0000814 | |||
| 1766 | Ga0495671_0001652 | |||
| 1767 | Ga0495671_0004212 | |||
| 1768 | Ga0495671_0004620 | |||
| 1769 | Ga0495671_0010838 | |||
| 1770 | Ga0495671_0013033 | |||
| 1771 | Ga0495671_0014481 | |||
| 1772 | Ga0495671_0100446 | |||
| 1773 | Ga0495649_0000404 | |||
| 1774 | Ga0495649_0003432 | |||
| 1775 | Ga0495649_0004074 | |||
| 1776 | Ga0495649_0005118 | |||
| 1777 | Ga0495649_0010434 | |||
| 1778 | Ga0495649_0010488 | |||
| 1779 | Ga0495649_0010623 | |||
| 1780 | Ga0495649_0012992 | |||
| 1781 | Ga0495589_0002746 | |||
| 1782 | Ga0495589_0002978 | |||
| 1783 | Ga0495589_0003332 | |||
| 1784 | Ga0495589_0004860 | |||
| 1785 | Ga0495589_0010325 | |||
| 1786 | Ga0495589_0011597 | |||
| 1787 | Ga0495660_0003045 | |||
| 1788 | Ga0495660_0005353 | |||
| 1789 | Ga0495660_0006453 | |||
| 1790 | Ga0495660_0014849 | |||
| 1791 | Ga0495660_0015082 | |||
| 1792 | Ga0495660_0018297 | |||
| 1793 | Ga0495660_0018860 | |||
| 1794 | Ga0495660_0038757 | |||
| 1795 | Ga0495660_0046073 | |||
| 1796 | Ga0495581_0000838 | |||
| 1797 | Ga0495604_0001248 | |||
| 1798 | Ga0495604_0021351 | |||
| 1799 | Ga0495674_0005618 | |||
| 1800 | Ga0495672_0000185 | |||
| 1801 | Ga0495672_0000247 | |||
| 1802 | Ga0495672_0002156 | |||
| 1803 | Ga0495672_0002436 | |||
| 1804 | Ga0495672_0003437 | |||
| 1805 | Ga0495672_0006184 | |||
| 1806 | Ga0495672_0006235 | |||
| 1807 | Ga0495672_0008726 | |||
| 1808 | Ga0495672_0014421 | |||
| 1809 | Ga0495672_0059405 | |||
| 1810 | Ga0495672_0069994 | |||
| 1811 | Ga0495676_0007185 | |||
| 1812 | Ga0495676_0177801 | |||
| 1813 | Ga0495680_0000029 | |||
| 1814 | Ga0495680_0019446 | |||
| 1815 | Ga0495680_0019504 | |||
| 1816 | Ga0495680_0115936 | |||
| 1817 | Ga0495683_0000037 | |||
| 1818 | Ga0495683_0000674 | |||
| 1819 | Ga0495683_0006806 | |||
| 1820 | Ga0495683_0009191 | |||
| 1821 | Ga0495683_0014115 | |||
| 1822 | Ga0495683_0100629 | |||
| 1823 | Ga0495683_0118524 | |||
| 1824 | Ga0495675_0004640 | |||
| 1825 | Ga0495677_0001883 | |||
| 1826 | Ga0495679_000336 | |||
| 1827 | Ga0495679_000402 | |||
| 1828 | Ga0495679_001939 | |||
| 1829 | Ga0495679_003604 | |||
| 1830 | Ga0495679_004478 | |||
| 1831 | Ga0495685_044248 | |||
| 1832 | Ga0495673_0000093 | |||
| 1833 | Ga0495673_0000184 | |||
| 1834 | Ga0495673_0000760 | |||
| 1835 | Ga0495673_0003126 | |||
| 1836 | Ga0495673_0008563 | |||
| 1837 | Ga0495673_0014513 | |||
| 1838 | Ga0495673_0023907 | |||
| 1839 | Ga0495681_0000082 | |||
| 1840 | Ga0495681_0000156 | |||
| 1841 | Ga0495681_0001246 | |||
| 1842 | Ga0495681_0004206 | |||
| 1843 | Ga0495681_0006108 | |||
| 1844 | Ga0495681_0007287 | |||
| 1845 | Ga0495681_0010952 | |||
| 1846 | Ga0495681_0014931 | |||
| 1847 | Ga0495684_0005960 | |||
| 1848 | Ga0495686_0000789 | |||
| 1849 | Ga0495686_0009134 | |||
| 1850 | Ga0495686_0045490 | |||
| 1851 | Ga0495686_0181060 | |||
| 1852 | Ga0495593_0008525 | |||
| 1853 | Ga0495593_0086790 | |||
| 1854 | Ga0495602_0001183 | |||
| 1855 | Ga0495602_0048266 | |||
| 1856 | Ga0495626_0000087 | |||
| 1857 | Ga0495626_0000331 | |||
| 1858 | Ga0495626_0000525 | |||
| 1859 | Ga0495626_0003549 | |||
| 1860 | Ga0495626_0004136 | |||
| 1861 | Ga0495626_0006636 | |||
| 1862 | Ga0495626_0010989 | |||
| 1863 | Ga0496100_0003273 | |||
| 1864 | Ga0496101_0014908 | |||
| 1865 | Ga0496102_0000073 | |||
| 1866 | Ga0496102_0006064 | |||
| 1867 | Ga0496102_0172769 | |||
| 1868 | Ga0496102_0188412 | |||
| 1869 | Ga0496102_0293371 | |||
| 1870 | Ga0496103_0000755 | |||
| 1871 | Ga0496103_0039847 | |||
| 1872 | Ga0496103_0085825 | |||
| 1873 | Ga0496104_0007070 | |||
| 1874 | Ga0496104_0032491 | |||
| 1875 | Ga0496104_0045553 | |||
| 1876 | Ga0496104_0250296 | |||
| 1877 | Ga0496105_0001071 | |||
| 1878 | Ga0496105_0010006 | |||
| 1879 | Ga0496105_0094327 | |||
| 1880 | Ga0496105_0137051 | |||
| 1881 | Ga0496105_0254820 | |||
| 1882 | Ga0496106_0013682 | |||
| 1883 | Ga0496106_0016835 | |||
| 1884 | Ga0496107_0001015 | |||
| 1885 | Ga0496108_0033953 | |||
| 1886 | Ga0496109_0006467 | |||
| 1887 | Ga0496109_0011659 | |||
| 1888 | Ga0496109_0011744 | |||
| 1889 | Ga0496110_0000749 | |||
| 1890 | Ga0496110_0016249 | |||
| 1891 | Ga0496110_0039290 | |||
| 1892 | Ga0496110_0233382 | |||
| 1893 | Ga0496111_0005059 | |||
| 1894 | Ga0496111_0030020 | |||
| 1895 | Ga0496112_0011589 | |||
| 1896 | Ga0496112_0011995 | |||
| 1897 | Ga0496112_0068238 | |||
| 1898 | Ga0496113_0016702 | |||
| 1899 | Ga0496113_0043997 | |||
| 1900 | Ga0496113_0291445 | |||
| 1901 | Ga0496114_0004273 | |||
| 1902 | Ga0496114_0004355 | |||
| 1903 | Ga0496115_0013919 | |||
| 1904 | Ga0496115_0016363 | |||
| 1905 | Ga0496115_0038374 | |||
| 1906 | Ga0496117_0015411 | |||
| 1907 | Ga0496118_0003254 | |||
| 1908 | Ga0496118_0026400 | |||
| 1909 | Ga0496118_0041093 | |||
| 1910 | Ga0496118_0072060 | |||
| 1911 | Ga0496119_0002302 | |||
| 1912 | Ga0496120_0002631 | |||
| 1913 | Ga0496121_0043621 | |||
| 1914 | Ga0496121_0052891 | |||
| 1915 | Ga0496124_0024592 | |||
| 1916 | Ga0496124_0081763 | |||
| 1917 | Ga0496125_0035340 | |||
| 1918 | Ga0496125_0061303 | |||
| 1919 | Ga0495678_000542 | |||
| 1920 | Ga0495678_004994 | |||
| 1921 | Ga0495678_011420 | |||
| 1922 | Ga0495678_016219 | |||
| 1923 | Ga0495678_020921 | |||
| 1924 | Ga0495678_061258 | |||
| 1925 | Ga0495682_0000020 | |||
| 1926 | Ga0495682_0000279 | |||
| 1927 | Ga0495682_0011355 | |||
| 1928 | Ga0495682_0042637 | |||
| 1929 | Ga0501034_0078672 | |||
| 1930 | Ga0501034_0114590 | |||
| 1931 | Ga0501034_0124515 | |||
| 1932 | Ga0501034_0143140 | |||
| 1933 | Ga0501036_0016758 | |||
| 1934 | Ga0501038_0003978 | |||
| 1935 | Ga0501039_0007453 | |||
| 1936 | Ga0501039_0028547 | |||
| 1937 | Ga0501039_0130473 | |||
| 1938 | Ga0501040_0002910 | |||
| 1939 | Ga0501040_0027158 | |||
| 1940 | Ga0501041_0020253 | |||
| 1941 | Ga0501042_0004113 | |||
| 1942 | Ga0501042_0024795 | |||
| 1943 | Ga0501042_0230246 | |||
| 1944 | Ga0501043_0113733 | |||
| 1945 | Ga0501046_0006557 | |||
| 1946 | Ga0501048_0000282 | |||
| 1947 | Ga0501048_0001950 | |||
| 1948 | Ga0501068_0001757 | |||
| 1949 | Ga0501068_0021133 | |||
| 1950 | Ga0501068_0026405 | |||
| 1951 | Ga0501069_0165234 | |||
| 1952 | Ga0501070_0085056 | |||
| 1953 | Ga0501071_0099108 | |||
| 1954 | Ga0501072_0001734 | |||
| 1955 | Ga0501073_0008757 | |||
| 1956 | Ga0501073_0070336 | |||
| 1957 | Ga0501074_0004678 | |||
| 1958 | Ga0501074_0005711 | |||
| 1959 | Ga0501074_0047764 | |||
| 1960 | Ga0501074_0086539 | |||
| 1961 | Ga0501076_0000955 | |||
| 1962 | Ga0501238_000771 | |||
| 1963 | Ga0501079_0000142 | |||
| 1964 | Ga0501079_0001187 | |||
| 1965 | Ga0501079_0002370 | |||
| 1966 | Ga0501080_0002846 | |||
| 1967 | Ga0501080_0069979 | |||
| 1968 | Ga0501080_0080217 | |||
| 1969 | Ga0501080_0104938 | |||
| 1970 | Ga0501081_0000147 | |||
| 1971 | Ga0501081_0000552 | |||
| 1972 | Ga0501083_0081976 | |||
| 1973 | Ga0501035_0159671 | |||
| 1974 | Ga0501035_0265255 | |||
| 1975 | Ga0501044_0146499 | |||
| 1976 | Ga0501045_0000401 | |||
| 1977 | Ga0501045_0069893 | |||
| 1978 | nmdc:mga03683_11227_c1 | |||
| 1979 | nmdc:mga00v17_525_c1 | |||
| 1980 | nmdc:mga00v17_84836_c1 | |||
| 1981 | nmdc:mga05p37_234465_c1 | |||
| 1982 | nmdc:mga05p37_277179_c1 | |||
| 1983 | nmdc:mga09592_108376_c1 | |||
| 1984 | nmdc:mga09592_218298_c1 | |||
| 1985 | nmdc:mga09592_28022_c1 | |||
| 1986 | nmdc:mga09592_53045_c1 | |||
| 1987 | nmdc:mga09592_7612_c1 | |||
| 1988 | nmdc:mga0qj67_148576_c1 | |||
| 1989 | nmdc:mga0qj67_195516_c1 | |||
| 1990 | nmdc:mga0qj67_4366_c1 | |||
| 1991 | nmdc:mga0qj67_5391_c1 | |||
| 1992 | nmdc:mga06r32_13988_c1 | |||
| 1993 | nmdc:mga06r32_70979_c1 | |||
| 1994 | nmdc:mga08y16_109806_c1 | |||
| 1995 | nmdc:mga08y16_14457_c1 | |||
| 1996 | nmdc:mga08y16_205111_c1 | |||
| 1997 | nmdc:mga08y16_2161_c1 | |||
| 1998 | nmdc:mga0n895_249507_c1 | |||
| 1999 | nmdc:mga0rr50_36990_c1 | |||
| 2000 | Ga0495619_0011851 | |||
| 2001 | Ga0500586_036145 | |||
| 2002 | Ga0500588_0061140 | |||
| 2003 | Ga0500616_0006666 | |||
| 2004 | Ga0500616_0010386 | |||
| 2005 | Ga0500622_0023584 | |||
| 2006 | Ga0500636_0116461 | |||
| 2007 | Ga0500637_0014962 | |||
| 2008 | Ga0500637_0064324 | |||
| 2009 | Ga0501084_0008950 | |||
| 2010 | Ga0501084_0012410 | |||
| 2011 | Ga0501082_0005214 | |||
| 2012 | Ga0501082_0013531 | |||
| 2013 | Ga0501082_0083364 | |||
| 2014 | Ga0466962_0024978 | |||
| 2015 | Ga0530510_0009039 | |||
| 2016 | Ga0530510_0040239 | |||
| 2017 | 2511258189 | |||
| 2018 | 2511277120 | |||
| 2019 | 2511292024 | |||
| 2020 | 2511298825 | |||
| 2021 | 2511301453 | |||
| 2022 | 2511314730 | |||
| 2023 | 2511320526 | |||
| 2024 | 2511333733 | |||
| 2025 | 2511340091 | |||
| 2026 | 2511346834 | |||
| 2027 | 2511348314 | |||
| 2028 | 2511357207 | |||
| 2029 | 2511371719 | |||
| 2030 | 2511389348 | |||
| 2031 | 2535485293 | |||
| 2032 | 2643953427 | |||
| 2033 | 2644021169 | |||
| 2034 | 2644188236 | |||
| 2035 | 2739261859 | |||
| 2036 | 2765464326 | |||
| 2037 | 2770194653 | |||
| 2038 | 2809214402 | |||
| 2039 | 2819657787 | |||
| 2040 | 2837651949 | |||
| 2041 | 2839994241 | |||
| 2042 | 2842873045 | |||
| 2043 | 2904551888 | |||
| 2044 | 2904579085 | |||
| 2045 | 2919122087 | |||
| 2046 | 2928521975 | |||
| 2047 | 2939641542 | |||
| 2048 | 2939654907 | |||
| 2049 | 2954014668 | |||
| 2050 | 3000407783 | |||
| 2051 | 3007513702 | |||
| 2052 | 3007625074 | |||
| 2053 | 8056128234 | |||
| 2054 | 8056178745 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7oyt-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d f88l in complex with spermidine | 0.9707 | 23 | 360 |
| 7oyz-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d in complex with spermidine | 0.9704 | 23 | 360 |
| 7oyu-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s f88y in complex with spermidine | 0.9695 | 23 | 360 |
| 7oyy-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutation s247d in complex with spermidine | 0.9676 | 22 | 360 |
| 7oys-assembly1.cif.gz_A | e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine | 0.9666 | 22 | 360 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P31133_32_136_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9878 | 25 | 128 | 3.40.190.10 |
| 3ttnB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9745 | 25 | 328 | 3.40.190.10 |
| af_P31133_32_136_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9693 | 25 | 128 | 3.40.190.10 |
| af_Q2G2A8_37_140_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9688 | 25 | 130 | 3.40.190.10 |
| 3ttnB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9685 | 25 | 328 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5R2MU04-F1-model_v4 | Spermidine/putrescine ABC transporter substrate-binding protein PotF | 0.9923 | 156 | 251 |
GO:0015846
GO:0019808 GO:0042597 |
| AF-A0A530N1C4-F1-model_v4 | deleted | 0.99 | 20 | 342 |
|
| AF-A0A2N3AV69-F1-model_v4 | Spermidine/putrescine ABC transporter substrate-binding protein PotF | 0.988 | 39 | 362 |
GO:0015846
GO:0019808 GO:0042597 |
| AF-A0A2M7Y8B4-F1-model_v4 | Spermidine/putrescine ABC transporter substrate-binding protein PotF | 0.9839 | 94 | 362 |
GO:0015846
GO:0019808 GO:0042597 |
| AF-A0A3M4DHW7-F1-model_v4 | deleted | 0.983 | 68 | 362 |
|