F488541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1027 | 496 | 2054 | 372 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_41038_c1|nmdc:mga0k408_41038_c1_987_2234 |
| Length | 415 |
| Sequence | MRAASRSIDALDPGHWRSPDKVRQNRAQFRLHRSTKRQRRQSMLIGVPLETAAGETRVAVTPETAKKLKAQGHTLKVQSGAGVAASVPDAAYEAAGAEITDATGAFGCDLVLKVRSPLHSELSMMKTGAAVVGMLNPFDADGLHRLAGAGVTGFALEAAPRTTRAQSMDVLSSQANIAGYKAVMIAADKYQRFFPMLMTAAGTVKAARVVILGVGVAGLQAIATAKRLGAVIEASDVRPSVKEQVESLGAKFIDVSYDTPEEKEAAEGVGGYAKPMPQSWLDRQKVEVAKRVAAADVVITTALIPGRAAPVLVTEEMVKAMKPGSVIVDLAAPNGGNCPLTEAGKTVVKHGVTLVGETNLPALVAADASALYARNVLDFLKLVITKEGTFHVPMDDDIVAACLMTQGGEVKRANK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 18 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 20 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 122 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 193 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 202 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 205 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 207 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 211 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 214 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 215 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 245 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 248 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 249 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 250 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 251 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 252 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 253 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 254 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 255 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 256 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 257 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 258 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 259 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 260 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 366 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 367 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 368 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 369 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 370 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 371 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 372 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 373 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 374 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 375 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 377 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 386 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 387 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 388 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 389 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 390 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 398 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 399 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 401 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 403 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 404 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 405 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 406 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 408 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 409 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 410 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 411 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 413 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 414 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 415 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 416 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 417 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 418 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 419 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 420 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 421 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 422 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 423 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 424 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 425 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 426 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 427 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 428 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 429 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 430 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 431 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 432 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 433 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 434 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 435 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 436 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 437 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 438 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 439 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 440 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 441 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 442 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 443 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 444 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 445 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 446 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 447 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 448 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 449 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 450 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 451 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 452 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 453 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 454 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 455 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 456 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 457 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 458 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 459 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 460 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 461 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 462 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 463 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 464 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 465 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 466 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 467 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 468 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 469 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 470 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 471 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 472 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 473 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 474 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 475 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 476 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 477 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 478 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 479 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 480 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 481 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 482 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 483 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 484 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 485 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 486 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 487 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 488 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 489 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 490 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 491 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 492 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 493 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 494 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 495 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 496 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.14 |
| Metatranscriptomes | 0.29 |
| Isolates | 8.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.4 |
| Nodule | 1.56 |
| Rhizoplane | 3.99 |
| Rhizosphere | 61.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga0k408_41038_c1 | 3300050493 | Bacteria | 2664 |
| 2 | JGI24740J21852_10002979 | 3300001979 | Bacteria | 7499 |
| 3 | JGI24739J22299_10002019 | 3300001989 | Bacteria | 7768 |
| 4 | JGI24739J22299_10002611 | 3300001989 | Bacteria | 6939 |
| 5 | JGI24735J21928_10000321 | 3300002067 | Bacteria | 16677 |
| 6 | JGI24735J21928_10004512 | 3300002067 | Bacteria | 4682 |
| 7 | JGI24738J21930_10005717 | 3300002075 | Bacteria | 2959 |
| 8 | JGI25155J39150_1000042 | 3300002704 | Bacteria | 88585 |
| 9 | JGI25156J39149_1000053 | 3300002705 | Bacteria | 88796 |
| 10 | JGI25156J39149_1003037 | 3300002705 | Bacteria | 5696 |
| 11 | JGI25156J39149_1003053 | 3300002705 | Bacteria | 5674 |
| 12 | JGI25154J39366_1000082 | 3300002738 | Bacteria | 88767 |
| 13 | JGI25157J39369_1000072 | 3300002741 | Bacteria | 88796 |
| 14 | JGI25150J39212_1002959 | 3300002774 | Bacteria | 4094 |
| 15 | JGI25159J45721_1003277 | 3300002987 | Bacteria | 5791 |
| 16 | JGI25151J46595_10009109 | 3300003187 | Bacteria | 4728 |
| 17 | JGI25151J46595_10023163 | 3300003187 | Bacteria | 2564 |
| 18 | JGI25151J46595_10053555 | 3300003187 | Bacteria | 1347 |
| 19 | JGI25165J46597_1001342 | 3300003214 | Bacteria | 13757 |
| 20 | JGI25153J46596_10001249 | 3300003215 | Bacteria | 15301 |
| 21 | JGI26128J50194_1000014 | 3300003347 | Bacteria | 5558 |
| 22 | JGI25160J50197_1000188 | 3300003354 | Bacteria | 52036 |
| 23 | JGI25161J50226_1000007 | 3300003374 | Bacteria | 256181 |
| 24 | Ga0006554J51385_1036275 | 3300003567 | Bacteria | 2243 |
| 25 | Ga0006562J51391_1047714 | 3300003578 | Bacteria | 3659 |
| 26 | Ga0006562J51391_1047716 | 3300003578 | Bacteria | 1770 |
| 27 | Ga0055539_1000536 | 3300003752 | Bacteria | 11499 |
| 28 | Ga0055533_1002147 | 3300003756 | Bacteria | 4718 |
| 29 | Ga0055525_1000053 | 3300003759 | Bacteria | 218067 |
| 30 | Ga0055542_1000013 | 3300003762 | Bacteria | 387560 |
| 31 | Ga0055526_1012883 | 3300003771 | Bacteria | 3595 |
| 32 | Ga0055526_1015140 | 3300003771 | Bacteria | 3113 |
| 33 | Ga0055526_1023769 | 3300003771 | Bacteria | 2033 |
| 34 | Ga0055537_1005041 | 3300003773 | Bacteria | 3618 |
| 35 | Ga0055524_1000148 | 3300003775 | Bacteria | 83128 |
| 36 | Ga0055524_1000213 | 3300003775 | Bacteria | 61225 |
| 37 | Ga0055536_1000526 | 3300003781 | Bacteria | 26477 |
| 38 | Ga0055536_1009279 | 3300003781 | Bacteria | 4094 |
| 39 | Ga0055536_1028413 | 3300003781 | Bacteria | 1524 |
| 40 | Ga0055536_1028847 | 3300003781 | Bacteria | 1504 |
| 41 | Ga0055534_1000726 | 3300003784 | Bacteria | 15931 |
| 42 | Ga0055534_1002320 | 3300003784 | Bacteria | 6670 |
| 43 | Ga0055534_1003088 | 3300003784 | Bacteria | 5422 |
| 44 | Ga0055528_1007035 | 3300003790 | Bacteria | 5028 |
| 45 | Ga0055528_1011042 | 3300003790 | Bacteria | 3618 |
| 46 | Ga0055530_10000233 | 3300003791 | Bacteria | 49812 |
| 47 | Ga0055530_10007767 | 3300003791 | Bacteria | 4444 |
| 48 | Ga0055530_10007960 | 3300003791 | Bacteria | 4335 |
| 49 | Ga0055530_10008285 | 3300003791 | Bacteria | 4195 |
| 50 | Ga0055540_1000018 | 3300003792 | Bacteria | 218360 |
| 51 | Ga0055540_1000176 | 3300003792 | Bacteria | 63046 |
| 52 | Ga0055531_10000135 | 3300003794 | Bacteria | 83831 |
| 53 | Ga0055531_10000850 | 3300003794 | Bacteria | 25221 |
| 54 | Ga0055531_10002836 | 3300003794 | Bacteria | 11342 |
| 55 | Ga0055531_10007099 | 3300003794 | Bacteria | 6188 |
| 56 | Ga0055531_10043465 | 3300003794 | Bacteria | 1271 |
| 57 | Ga0055531_10043509 | 3300003794 | Bacteria | 1270 |
| 58 | Ga0055543_1000842 | 3300004625 | Bacteria | 14843 |
| 59 | Ga0065165_1013122 | 3300005262 | Bacteria | 3316 |
| 60 | Ga0065165_1025541 | 3300005262 | Bacteria | 1961 |
| 61 | Ga0065707_10087951 | 3300005295 | Bacteria | 4833 |
| 62 | Ga0070658_10002933 | 3300005327 | Bacteria | 14139 |
| 63 | Ga0070676_10019022 | 3300005328 | Bacteria | 3816 |
| 64 | Ga0070676_10044513 | 3300005328 | Bacteria | 2583 |
| 65 | Ga0070670_100063696 | 3300005331 | Bacteria | 3164 |
| 66 | Ga0070670_100083241 | 3300005331 | Bacteria | 2749 |
| 67 | Ga0070670_100216812 | 3300005331 | Bacteria | 1665 |
| 68 | Ga0070670_100300305 | 3300005331 | Bacteria | 1404 |
| 69 | Ga0068869_100004605 | 3300005334 | Bacteria | 8594 |
| 70 | Ga0068869_100091722 | 3300005334 | Bacteria | 2285 |
| 71 | Ga0068869_100276724 | 3300005334 | Bacteria | 1348 |
| 72 | Ga0070666_10067889 | 3300005335 | Bacteria | 2421 |
| 73 | Ga0070682_100080255 | 3300005337 | Bacteria | 2109 |
| 74 | Ga0068868_100002058 | 3300005338 | Bacteria | 13824 |
| 75 | Ga0068868_100049592 | 3300005338 | Bacteria | 3295 |
| 76 | Ga0068868_100125503 | 3300005338 | Bacteria | 2096 |
| 77 | Ga0068868_100263391 | 3300005338 | Bacteria | 1454 |
| 78 | Ga0070660_100156926 | 3300005339 | Bacteria | 1832 |
| 79 | Ga0070689_100034608 | 3300005340 | Bacteria | 3854 |
| 80 | Ga0070687_100075811 | 3300005343 | Bacteria | 1820 |
| 81 | Ga0070687_100076885 | 3300005343 | Bacteria | 1809 |
| 82 | Ga0070661_100005909 | 3300005344 | Bacteria | 8425 |
| 83 | Ga0070661_100093593 | 3300005344 | Bacteria | 2227 |
| 84 | Ga0070661_100346673 | 3300005344 | Bacteria | 1164 |
| 85 | Ga0070668_100009964 | 3300005347 | Bacteria | 7040 |
| 86 | Ga0070675_100000203 | 3300005354 | Bacteria | 37729 |
| 87 | Ga0070675_100005491 | 3300005354 | Bacteria | 9708 |
| 88 | Ga0070675_100017687 | 3300005354 | Bacteria | 5670 |
| 89 | Ga0070671_100010136 | 3300005355 | Bacteria | 7568 |
| 90 | Ga0070671_100011587 | 3300005355 | Bacteria | 7094 |
| 91 | Ga0070671_100108908 | 3300005355 | Bacteria | 2326 |
| 92 | Ga0070671_100169807 | 3300005355 | Bacteria | 1844 |
| 93 | Ga0070671_100318780 | 3300005355 | Bacteria | 1324 |
| 94 | Ga0070674_100052167 | 3300005356 | Bacteria | 2820 |
| 95 | Ga0070674_100057781 | 3300005356 | Bacteria | 2694 |
| 96 | Ga0070674_100125280 | 3300005356 | Bacteria | 1907 |
| 97 | Ga0070673_100060820 | 3300005364 | Bacteria | 2994 |
| 98 | Ga0070673_100105185 | 3300005364 | Bacteria | 2331 |
| 99 | Ga0070688_100035286 | 3300005365 | Bacteria | 3037 |
| 100 | Ga0070659_100011689 | 3300005366 | Bacteria | 6498 |
| 101 | Ga0070659_100054814 | 3300005366 | Bacteria | 3141 |
| 102 | Ga0070659_100058177 | 3300005366 | Bacteria | 3050 |
| 103 | Ga0070667_100021414 | 3300005367 | Bacteria | 5369 |
| 104 | Ga0070667_100096863 | 3300005367 | Bacteria | 2545 |
| 105 | Ga0070667_100304029 | 3300005367 | Bacteria | 1436 |
| 106 | Ga0070714_100077741 | 3300005435 | Bacteria | 2883 |
| 107 | Ga0070663_100003487 | 3300005455 | Bacteria | 9072 |
| 108 | Ga0070663_100235793 | 3300005455 | Bacteria | 1442 |
| 109 | Ga0070678_100000925 | 3300005456 | Bacteria | 15083 |
| 110 | Ga0070678_100161723 | 3300005456 | Bacteria | 1815 |
| 111 | Ga0070678_100304817 | 3300005456 | Bacteria | 1355 |
| 112 | Ga0070662_100002619 | 3300005457 | Bacteria | 11101 |
| 113 | Ga0070662_100012490 | 3300005457 | Bacteria | 5632 |
| 114 | Ga0070662_100081276 | 3300005457 | Bacteria | 2414 |
| 115 | Ga0068867_100000036 | 3300005459 | Bacteria | 81113 |
| 116 | Ga0068867_100054879 | 3300005459 | Bacteria | 2944 |
| 117 | Ga0068867_100070233 | 3300005459 | Bacteria | 2618 |
| 118 | Ga0068867_100108564 | 3300005459 | Bacteria | 2129 |
| 119 | Ga0068867_100127254 | 3300005459 | Bacteria | 1975 |
| 120 | Ga0068867_100127629 | 3300005459 | Bacteria | 1972 |
| 121 | Ga0070706_100000719 | 3300005467 | Bacteria | 37271 |
| 122 | Ga0070707_100048898 | 3300005468 | Bacteria | 4052 |
| 123 | Ga0070679_100012792 | 3300005530 | Bacteria | 8029 |
| 124 | Ga0070679_100075705 | 3300005530 | Bacteria | 3355 |
| 125 | Ga0070679_100080076 | 3300005530 | Bacteria | 3256 |
| 126 | Ga0068853_100014870 | 3300005539 | Bacteria | 6390 |
| 127 | Ga0068853_100200363 | 3300005539 | Bacteria | 1816 |
| 128 | Ga0068853_100237170 | 3300005539 | Bacteria | 1670 |
| 129 | Ga0070672_100053623 | 3300005543 | Bacteria | 3153 |
| 130 | Ga0070672_100070303 | 3300005543 | Bacteria | 2781 |
| 131 | Ga0070672_100082186 | 3300005543 | Bacteria | 2584 |
| 132 | Ga0070672_100112051 | 3300005543 | Bacteria | 2225 |
| 133 | Ga0070695_100295728 | 3300005545 | Bacteria | 1195 |
| 134 | Ga0070665_100158221 | 3300005548 | Bacteria | 2267 |
| 135 | Ga0070665_100202071 | 3300005548 | Bacteria | 1988 |
| 136 | Ga0068855_100015898 | 3300005563 | Bacteria | 9053 |
| 137 | Ga0070664_100020774 | 3300005564 | Bacteria | 5409 |
| 138 | Ga0070664_100294451 | 3300005564 | Bacteria | 1465 |
| 139 | Ga0068854_100123553 | 3300005578 | Bacteria | 1968 |
| 140 | Ga0068854_100334182 | 3300005578 | Bacteria | 1235 |
| 141 | Ga0068856_100179611 | 3300005614 | Bacteria | 2129 |
| 142 | Ga0068852_100122083 | 3300005616 | Bacteria | 2387 |
| 143 | Ga0068852_100287369 | 3300005616 | Bacteria | 1587 |
| 144 | Ga0068852_100300940 | 3300005616 | Bacteria | 1552 |
| 145 | Ga0068859_100087739 | 3300005617 | Bacteria | 3159 |
| 146 | Ga0068859_100287334 | 3300005617 | Bacteria | 1737 |
| 147 | Ga0068864_100000196 | 3300005618 | Bacteria | 55294 |
| 148 | Ga0068861_100001918 | 3300005719 | Bacteria | 13388 |
| 149 | Ga0068861_100277618 | 3300005719 | Bacteria | 1441 |
| 150 | Ga0068851_10011910 | 3300005834 | Bacteria | 4090 |
| 151 | Ga0068863_100314491 | 3300005841 | Bacteria | 1520 |
| 152 | Ga0068858_100000578 | 3300005842 | Bacteria | 38346 |
| 153 | Ga0068858_100003067 | 3300005842 | Bacteria | 16738 |
| 154 | Ga0068860_100118065 | 3300005843 | Bacteria | 2539 |
| 155 | Ga0068860_100161066 | 3300005843 | Bacteria | 2163 |
| 156 | Ga0068862_100097108 | 3300005844 | Bacteria | 2572 |
| 157 | Ga0068862_100133296 | 3300005844 | Bacteria | 2199 |
| 158 | Ga0075365_10008212 | 3300006038 | Bacteria | 5909 |
| 159 | Ga0075368_10014592 | 3300006042 | Bacteria | 2904 |
| 160 | Ga0075368_10067103 | 3300006042 | Bacteria | 1443 |
| 161 | Ga0075364_10040717 | 3300006051 | Bacteria | 3014 |
| 162 | Ga0075362_10002462 | 3300006177 | Bacteria | 6226 |
| 163 | Ga0075362_10018548 | 3300006177 | Bacteria | 2881 |
| 164 | Ga0075362_10020327 | 3300006177 | Bacteria | 2773 |
| 165 | Ga0075367_10031303 | 3300006178 | Bacteria | 3054 |
| 166 | Ga0075367_10042274 | 3300006178 | Bacteria | 2666 |
| 167 | Ga0075367_10124082 | 3300006178 | Bacteria | 1593 |
| 168 | Ga0075366_10001452 | 3300006195 | Bacteria | 11798 |
| 169 | Ga0075366_10006086 | 3300006195 | Bacteria | 6577 |
| 170 | Ga0075366_10011562 | 3300006195 | Bacteria | 4985 |
| 171 | Ga0075366_10029907 | 3300006195 | Bacteria | 3201 |
| 172 | Ga0075366_10033364 | 3300006195 | Bacteria | 3032 |
| 173 | Ga0075366_10061328 | 3300006195 | Bacteria | 2235 |
| 174 | Ga0097621_100129536 | 3300006237 | Bacteria | 2146 |
| 175 | Ga0097621_100226926 | 3300006237 | Bacteria | 1629 |
| 176 | Ga0075370_10000620 | 3300006353 | Bacteria | 13703 |
| 177 | Ga0075370_10010931 | 3300006353 | Bacteria | 4759 |
| 178 | Ga0075370_10105034 | 3300006353 | Bacteria | 1637 |
| 179 | Ga0075430_100008182 | 3300006846 | Bacteria | 8838 |
| 180 | Ga0075429_100015843 | 3300006880 | Bacteria | 6528 |
| 181 | Ga0068865_100210001 | 3300006881 | Bacteria | 1516 |
| 182 | Ga0097620_100087729 | 3300006931 | Bacteria | 3159 |
| 183 | Ga0097620_100287349 | 3300006931 | Bacteria | 1737 |
| 184 | Ga0079104_1000012 | 3300006946 | Bacteria | 355143 |
| 185 | Ga0079104_1000170 | 3300006946 | Bacteria | 92339 |
| 186 | Ga0079104_1017203 | 3300006946 | Bacteria | 2086 |
| 187 | Ga0079104_1025121 | 3300006946 | Bacteria | 1560 |
| 188 | Ga0105251_10000298 | 3300009011 | Bacteria | 49831 |
| 189 | Ga0105251_10000578 | 3300009011 | Bacteria | 34039 |
| 190 | Ga0105244_10007870 | 3300009036 | Bacteria | 6722 |
| 191 | Ga0105244_10092900 | 3300009036 | Bacteria | 1482 |
| 192 | Ga0105250_10000214 | 3300009092 | Bacteria | 47939 |
| 193 | Ga0105240_10000945 | 3300009093 | Bacteria | 51693 |
| 194 | Ga0105240_10184155 | 3300009093 | Bacteria | 2461 |
| 195 | Ga0105247_10106168 | 3300009101 | Bacteria | 1801 |
| 196 | Ga0105243_10002148 | 3300009148 | Bacteria | 16656 |
| 197 | Ga0105243_10008147 | 3300009148 | Bacteria | 8047 |
| 198 | Ga0105243_10029092 | 3300009148 | Bacteria | 4247 |
| 199 | Ga0105243_10066692 | 3300009148 | Bacteria | 2895 |
| 200 | Ga0105243_10287379 | 3300009148 | Bacteria | 1484 |
| 201 | Ga0105241_10180813 | 3300009174 | Bacteria | 1749 |
| 202 | Ga0105248_10021617 | 3300009177 | Bacteria | 7126 |
| 203 | Ga0105248_10093998 | 3300009177 | Bacteria | 3376 |
| 204 | Ga0105237_10011900 | 3300009545 | Bacteria | 9201 |
| 205 | Ga0105237_10045591 | 3300009545 | Bacteria | 4411 |
| 206 | Ga0105237_10062346 | 3300009545 | Bacteria | 3728 |
| 207 | Ga0105238_10030518 | 3300009551 | Bacteria | 5487 |
| 208 | Ga0105238_10293595 | 3300009551 | Bacteria | 1608 |
| 209 | Ga0105238_10434781 | 3300009551 | Bacteria | 1308 |
| 210 | Ga0105239_10150700 | 3300010375 | Bacteria | 2595 |
| 211 | Ga0157373_10064705 | 3300013100 | Bacteria | 2588 |
| 212 | Ga0157371_10178122 | 3300013102 | Bacteria | 1520 |
| 213 | Ga0157370_10000583 | 3300013104 | Bacteria | 45511 |
| 214 | Ga0157370_10037869 | 3300013104 | Bacteria | 4669 |
| 215 | Ga0157370_10070544 | 3300013104 | Bacteria | 3298 |
| 216 | Ga0157369_10007613 | 3300013105 | Bacteria | 12461 |
| 217 | Ga0157369_10026376 | 3300013105 | Bacteria | 6446 |
| 218 | Ga0157374_10036523 | 3300013296 | Bacteria | 4501 |
| 219 | Ga0157374_10039525 | 3300013296 | Bacteria | 4342 |
| 220 | Ga0157374_10143374 | 3300013296 | Bacteria | 2319 |
| 221 | Ga0157378_10235571 | 3300013297 | Bacteria | 1746 |
| 222 | Ga0163162_10000817 | 3300013306 | Bacteria | 28890 |
| 223 | Ga0163162_10061068 | 3300013306 | Bacteria | 3806 |
| 224 | Ga0163162_10136950 | 3300013306 | Bacteria | 2560 |
| 225 | Ga0157372_10070826 | 3300013307 | Bacteria | 3925 |
| 226 | Ga0157375_10131913 | 3300013308 | Bacteria | 2619 |
| 227 | Ga0163163_10110969 | 3300014325 | Bacteria | 2771 |
| 228 | Ga0157380_10021561 | 3300014326 | Bacteria | 4834 |
| 229 | Ga0157380_10307617 | 3300014326 | Bacteria | 1463 |
| 230 | Ga0182008_10013567 | 3300014497 | Bacteria | 4284 |
| 231 | Ga0182008_10033037 | 3300014497 | Bacteria | 2597 |
| 232 | Ga0182008_10137599 | 3300014497 | Bacteria | 1220 |
| 233 | Ga0157377_10000036 | 3300014745 | Bacteria | 116358 |
| 234 | Ga0157377_10181049 | 3300014745 | Bacteria | 1325 |
| 235 | Ga0157379_10072333 | 3300014968 | Bacteria | 3084 |
| 236 | Ga0157379_10152287 | 3300014968 | Bacteria | 2086 |
| 237 | Ga0157379_10153651 | 3300014968 | Bacteria | 2076 |
| 238 | Ga0182006_1016005 | 3300015261 | Bacteria | 3205 |
| 239 | Ga0182007_10001643 | 3300015262 | Bacteria | 11837 |
| 240 | Ga0182007_10004201 | 3300015262 | Bacteria | 6587 |
| 241 | Ga0163161_10000533 | 3300017792 | Bacteria | 31107 |
| 242 | Ga0163161_10024309 | 3300017792 | Bacteria | 4280 |
| 243 | Ga0163161_10182948 | 3300017792 | Bacteria | 1608 |
| 244 | Ga0213872_10000023 | 3300021361 | Bacteria | 157443 |
| 245 | Ga0213872_10000033 | 3300021361 | Bacteria | 135667 |
| 246 | Ga0213872_10000226 | 3300021361 | Bacteria | 49354 |
| 247 | Ga0213872_10001044 | 3300021361 | Bacteria | 19293 |
| 248 | Ga0213872_10008848 | 3300021361 | Bacteria | 4853 |
| 249 | Ga0213872_10021420 | 3300021361 | Bacteria | 2977 |
| 250 | Ga0209435_100019 | 3300025206 | Bacteria | 260989 |
| 251 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 252 | Ga0209674_100092 | 3300025226 | Bacteria | 172272 |
| 253 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 254 | Ga0209672_100561 | 3300025228 | Bacteria | 19776 |
| 255 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 256 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 257 | Ga0209563_103139 | 3300025230 | Bacteria | 3497 |
| 258 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 259 | Ga0209258_100020 | 3300025242 | Bacteria | 565241 |
| 260 | Ga0207425_1001908 | 3300025245 | Bacteria | 7911 |
| 261 | Ga0207425_1004700 | 3300025245 | Bacteria | 4033 |
| 262 | Ga0209646_1000038 | 3300025246 | Bacteria | 353982 |
| 263 | Ga0209026_1000048 | 3300025250 | Bacteria | 257264 |
| 264 | Ga0209677_100060 | 3300025253 | Bacteria | 155728 |
| 265 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 266 | Ga0209148_1000031 | 3300025254 | Bacteria | 564601 |
| 267 | Ga0209759_1000038 | 3300025256 | Bacteria | 257264 |
| 268 | Ga0209759_1000053 | 3300025256 | Bacteria | 212789 |
| 269 | Ga0209759_1000342 | 3300025256 | Bacteria | 61422 |
| 270 | Ga0209129_1000055 | 3300025258 | Bacteria | 261708 |
| 271 | Ga0209129_1004101 | 3300025258 | Bacteria | 5928 |
| 272 | Ga0209129_1004821 | 3300025258 | Bacteria | 5083 |
| 273 | Ga0209129_1006445 | 3300025258 | Bacteria | 3786 |
| 274 | Ga0209233_1000204 | 3300025261 | Bacteria | 118907 |
| 275 | Ga0209565_1000041 | 3300025263 | Bacteria | 251081 |
| 276 | Ga0209565_1000807 | 3300025263 | Bacteria | 17937 |
| 277 | Ga0209565_1006087 | 3300025263 | Bacteria | 3425 |
| 278 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 279 | Ga0209673_1000009 | 3300025273 | Bacteria | 620735 |
| 280 | Ga0209673_1001770 | 3300025273 | Bacteria | 17941 |
| 281 | Ga0209130_1000835 | 3300025284 | Bacteria | 25749 |
| 282 | Ga0209130_1000878 | 3300025284 | Bacteria | 24573 |
| 283 | Ga0209130_1001181 | 3300025284 | Bacteria | 18680 |
| 284 | Ga0209130_1001582 | 3300025284 | Bacteria | 14304 |
| 285 | Ga0209130_1007797 | 3300025284 | Bacteria | 3251 |
| 286 | Ga0209675_1000473 | 3300025291 | Bacteria | 30855 |
| 287 | Ga0209675_1001263 | 3300025291 | Bacteria | 15156 |
| 288 | Ga0209675_1003615 | 3300025291 | Bacteria | 7263 |
| 289 | Ga0209675_1010614 | 3300025291 | Bacteria | 3128 |
| 290 | Ga0209675_1011102 | 3300025291 | Bacteria | 3009 |
| 291 | Ga0209675_1026810 | 3300025291 | Bacteria | 1427 |
| 292 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 293 | Ga0209676_1000040 | 3300025292 | Bacteria | 438184 |
| 294 | Ga0209676_1000464 | 3300025292 | Bacteria | 68185 |
| 295 | Ga0209676_1000578 | 3300025292 | Bacteria | 55144 |
| 296 | Ga0209676_1003527 | 3300025292 | Bacteria | 9539 |
| 297 | Ga0209676_1009942 | 3300025292 | Bacteria | 4030 |
| 298 | Ga0209025_1000065 | 3300025294 | Bacteria | 300915 |
| 299 | Ga0209025_1000359 | 3300025294 | Bacteria | 97475 |
| 300 | Ga0209025_1000728 | 3300025294 | Bacteria | 55852 |
| 301 | Ga0209025_1001383 | 3300025294 | Bacteria | 32383 |
| 302 | Ga0209025_1007166 | 3300025294 | Bacteria | 8419 |
| 303 | Ga0209025_1013780 | 3300025294 | Bacteria | 5047 |
| 304 | Ga0209025_1014797 | 3300025294 | Bacteria | 4764 |
| 305 | Ga0209025_1020655 | 3300025294 | Bacteria | 3587 |
| 306 | Ga0209025_1060235 | 3300025294 | Bacteria | 1427 |
| 307 | Ga0209564_1000101 | 3300025295 | Bacteria | 222879 |
| 308 | Ga0209564_1000875 | 3300025295 | Bacteria | 40039 |
| 309 | Ga0209564_1001904 | 3300025295 | Bacteria | 18680 |
| 310 | Ga0209564_1011249 | 3300025295 | Bacteria | 4029 |
| 311 | Ga0209564_1016536 | 3300025295 | Bacteria | 2928 |
| 312 | Ga0209758_1000042 | 3300025297 | Bacteria | 407145 |
| 313 | Ga0209758_1000268 | 3300025297 | Bacteria | 103231 |
| 314 | Ga0209758_1003499 | 3300025297 | Bacteria | 14183 |
| 315 | Ga0209758_1013492 | 3300025297 | Bacteria | 4448 |
| 316 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 317 | Ga0209050_1000021 | 3300025298 | Bacteria | 574406 |
| 318 | Ga0209050_1003242 | 3300025298 | Bacteria | 12258 |
| 319 | Ga0209050_1011817 | 3300025298 | Bacteria | 4087 |
| 320 | Ga0209050_1020365 | 3300025298 | Bacteria | 2471 |
| 321 | Ga0209256_1000003 | 3300025299 | Bacteria | 1661127 |
| 322 | Ga0209256_1000271 | 3300025299 | Bacteria | 90540 |
| 323 | Ga0209256_1000454 | 3300025299 | Bacteria | 61876 |
| 324 | Ga0209256_1001042 | 3300025299 | Bacteria | 32384 |
| 325 | Ga0207426_1000091 | 3300025302 | Bacteria | 280561 |
| 326 | Ga0207426_1000659 | 3300025302 | Bacteria | 42288 |
| 327 | Ga0207426_1000842 | 3300025302 | Bacteria | 32384 |
| 328 | Ga0207426_1001760 | 3300025302 | Bacteria | 16400 |
| 329 | Ga0207426_1002540 | 3300025302 | Bacteria | 11444 |
| 330 | Ga0209051_1000004 | 3300025303 | Bacteria | 1155596 |
| 331 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 332 | Ga0209051_1000028 | 3300025303 | Bacteria | 404269 |
| 333 | Ga0209051_1003347 | 3300025303 | Bacteria | 10565 |
| 334 | Ga0209051_1008840 | 3300025303 | Bacteria | 5272 |
| 335 | Ga0209257_1000016 | 3300025304 | Bacteria | 908015 |
| 336 | Ga0209257_1000043 | 3300025304 | Bacteria | 512127 |
| 337 | Ga0209257_1000048 | 3300025304 | Bacteria | 455536 |
| 338 | Ga0209257_1000214 | 3300025304 | Bacteria | 136547 |
| 339 | Ga0209257_1000360 | 3300025304 | Bacteria | 92894 |
| 340 | Ga0209257_1002238 | 3300025304 | Bacteria | 19855 |
| 341 | Ga0209257_1003715 | 3300025304 | Bacteria | 12680 |
| 342 | Ga0209257_1008978 | 3300025304 | Bacteria | 5491 |
| 343 | Ga0209257_1011767 | 3300025304 | Bacteria | 4156 |
| 344 | Ga0209257_1012696 | 3300025304 | Bacteria | 3854 |
| 345 | Ga0207655_1006752 | 3300025728 | Bacteria | 7550 |
| 346 | Ga0207713_1000612 | 3300025735 | Bacteria | 35126 |
| 347 | Ga0207713_1010327 | 3300025735 | Bacteria | 5180 |
| 348 | Ga0207682_10008066 | 3300025893 | Bacteria | 4177 |
| 349 | Ga0207688_10037909 | 3300025901 | Bacteria | 2674 |
| 350 | Ga0207647_10010124 | 3300025904 | Bacteria | 6667 |
| 351 | Ga0207647_10013609 | 3300025904 | Bacteria | 5633 |
| 352 | Ga0207645_10007189 | 3300025907 | Bacteria | 7894 |
| 353 | Ga0207645_10018118 | 3300025907 | Bacteria | 4641 |
| 354 | Ga0207684_10007603 | 3300025910 | Bacteria | 9729 |
| 355 | Ga0207654_10177945 | 3300025911 | Bacteria | 1386 |
| 356 | Ga0207695_10234831 | 3300025913 | Bacteria | 1736 |
| 357 | Ga0207695_10310227 | 3300025913 | Bacteria | 1468 |
| 358 | Ga0207695_10327640 | 3300025913 | Bacteria | 1420 |
| 359 | Ga0207695_10354934 | 3300025913 | Bacteria | 1353 |
| 360 | Ga0207671_10039095 | 3300025914 | Bacteria | 3515 |
| 361 | Ga0207660_10036283 | 3300025917 | Bacteria | 3426 |
| 362 | Ga0207660_10156103 | 3300025917 | Bacteria | 1757 |
| 363 | Ga0207657_10127588 | 3300025919 | Bacteria | 2088 |
| 364 | Ga0207652_10013943 | 3300025921 | Bacteria | 6507 |
| 365 | Ga0207652_10045417 | 3300025921 | Bacteria | 3745 |
| 366 | Ga0207694_10064586 | 3300025924 | Bacteria | 2852 |
| 367 | Ga0207650_10031814 | 3300025925 | Bacteria | 3813 |
| 368 | Ga0207650_10136111 | 3300025925 | Bacteria | 1927 |
| 369 | Ga0207650_10249170 | 3300025925 | Bacteria | 1438 |
| 370 | Ga0207659_10198932 | 3300025926 | Bacteria | 1599 |
| 371 | Ga0207659_10209311 | 3300025926 | Bacteria | 1562 |
| 372 | Ga0207644_10005230 | 3300025931 | Bacteria | 8472 |
| 373 | Ga0207644_10019445 | 3300025931 | Bacteria | 4607 |
| 374 | Ga0207644_10279820 | 3300025931 | Bacteria | 1339 |
| 375 | Ga0207690_10002461 | 3300025932 | Bacteria | 11193 |
| 376 | Ga0207690_10130089 | 3300025932 | Bacteria | 1841 |
| 377 | Ga0207706_10000266 | 3300025933 | Bacteria | 56883 |
| 378 | Ga0207706_10088156 | 3300025933 | Bacteria | 2728 |
| 379 | Ga0207706_10328171 | 3300025933 | Bacteria | 1331 |
| 380 | Ga0207686_10016083 | 3300025934 | Bacteria | 4194 |
| 381 | Ga0207709_10000141 | 3300025935 | Bacteria | 101455 |
| 382 | Ga0207709_10000672 | 3300025935 | Bacteria | 27636 |
| 383 | Ga0207709_10008115 | 3300025935 | Bacteria | 5817 |
| 384 | Ga0207709_10022099 | 3300025935 | Bacteria | 3607 |
| 385 | Ga0207709_10046956 | 3300025935 | Bacteria | 2623 |
| 386 | Ga0207670_10236280 | 3300025936 | Bacteria | 1406 |
| 387 | Ga0207669_10057605 | 3300025937 | Bacteria | 2366 |
| 388 | Ga0207669_10075822 | 3300025937 | Bacteria | 2132 |
| 389 | Ga0207669_10088495 | 3300025937 | Bacteria | 2008 |
| 390 | Ga0207691_10013332 | 3300025940 | Bacteria | 7873 |
| 391 | Ga0207691_10089596 | 3300025940 | Bacteria | 2758 |
| 392 | Ga0207691_10092065 | 3300025940 | Bacteria | 2715 |
| 393 | Ga0207711_10006876 | 3300025941 | Bacteria | 9551 |
| 394 | Ga0207711_10020488 | 3300025941 | Bacteria | 5514 |
| 395 | Ga0207711_10038203 | 3300025941 | Bacteria | 4081 |
| 396 | Ga0207711_10058849 | 3300025941 | Bacteria | 3308 |
| 397 | Ga0207711_10176227 | 3300025941 | Bacteria | 1942 |
| 398 | Ga0207689_10001693 | 3300025942 | Bacteria | 20955 |
| 399 | Ga0207689_10064878 | 3300025942 | Bacteria | 3004 |
| 400 | Ga0207679_10003077 | 3300025945 | Bacteria | 10332 |
| 401 | Ga0207667_10283623 | 3300025949 | Bacteria | 1692 |
| 402 | Ga0207667_10378211 | 3300025949 | Bacteria | 1443 |
| 403 | Ga0207651_10027934 | 3300025960 | Bacteria | 3551 |
| 404 | Ga0207658_10024595 | 3300025986 | Bacteria | 4214 |
| 405 | Ga0207658_10070699 | 3300025986 | Bacteria | 2641 |
| 406 | Ga0207658_10086679 | 3300025986 | Bacteria | 2415 |
| 407 | Ga0207658_10090122 | 3300025986 | Bacteria | 2376 |
| 408 | Ga0207658_10110068 | 3300025986 | Bacteria | 2176 |
| 409 | Ga0207658_10304857 | 3300025986 | Bacteria | 1373 |
| 410 | Ga0207677_10001015 | 3300026023 | Bacteria | 15452 |
| 411 | Ga0207677_10010554 | 3300026023 | Bacteria | 5234 |
| 412 | Ga0207677_10195167 | 3300026023 | Bacteria | 1605 |
| 413 | Ga0207703_10007781 | 3300026035 | Bacteria | 8483 |
| 414 | Ga0207703_10022928 | 3300026035 | Bacteria | 4903 |
| 415 | Ga0207703_10180344 | 3300026035 | Bacteria | 1863 |
| 416 | Ga0207639_10024503 | 3300026041 | Bacteria | 4367 |
| 417 | Ga0207678_10008575 | 3300026067 | Bacteria | 9006 |
| 418 | Ga0207678_10030802 | 3300026067 | Bacteria | 4685 |
| 419 | Ga0207678_10032552 | 3300026067 | Bacteria | 4543 |
| 420 | Ga0207702_10023292 | 3300026078 | Bacteria | 5134 |
| 421 | Ga0207641_10016767 | 3300026088 | Bacteria | 5999 |
| 422 | Ga0207641_10188737 | 3300026088 | Bacteria | 1893 |
| 423 | Ga0207648_10000037 | 3300026089 | Bacteria | 120856 |
| 424 | Ga0207648_10041815 | 3300026089 | Bacteria | 4025 |
| 425 | Ga0207648_10051645 | 3300026089 | Bacteria | 3594 |
| 426 | Ga0207648_10134830 | 3300026089 | Bacteria | 2175 |
| 427 | Ga0207648_10146040 | 3300026089 | Bacteria | 2086 |
| 428 | Ga0207676_10005140 | 3300026095 | Bacteria | 9262 |
| 429 | Ga0207676_10065709 | 3300026095 | Bacteria | 2889 |
| 430 | Ga0207676_10111148 | 3300026095 | Bacteria | 2293 |
| 431 | Ga0207676_10217743 | 3300026095 | Bacteria | 1698 |
| 432 | Ga0207676_10243260 | 3300026095 | Bacteria | 1615 |
| 433 | Ga0207674_10047037 | 3300026116 | Bacteria | 4426 |
| 434 | Ga0207674_10184856 | 3300026116 | Bacteria | 2035 |
| 435 | Ga0207674_10280324 | 3300026116 | Bacteria | 1615 |
| 436 | Ga0207675_100002105 | 3300026118 | Bacteria | 19716 |
| 437 | Ga0207675_100160176 | 3300026118 | Bacteria | 2146 |
| 438 | Ga0207675_100217524 | 3300026118 | Bacteria | 1840 |
| 439 | Ga0207675_100488154 | 3300026118 | Bacteria | 1225 |
| 440 | Ga0207675_100528983 | 3300026118 | Bacteria | 1176 |
| 441 | Ga0207683_10090382 | 3300026121 | Bacteria | 2727 |
| 442 | Ga0207683_10126385 | 3300026121 | Bacteria | 2298 |
| 443 | Ga0207683_10200916 | 3300026121 | Bacteria | 1812 |
| 444 | Ga0207698_10169338 | 3300026142 | Bacteria | 1921 |
| 445 | Ga0209281_1000039 | 3300027111 | Bacteria | 355150 |
| 446 | Ga0209281_1000072 | 3300027111 | Bacteria | 273114 |
| 447 | Ga0209969_1000798 | 3300027360 | Bacteria | 4227 |
| 448 | Ga0209981_1007516 | 3300027378 | Bacteria | 1471 |
| 449 | Ga0209996_1000695 | 3300027395 | Bacteria | 4025 |
| 450 | Ga0209999_1006689 | 3300027543 | Bacteria | 2073 |
| 451 | Ga0209282_1029830 | 3300027666 | Bacteria | 3363 |
| 452 | Ga0209966_1000856 | 3300027695 | Bacteria | 5930 |
| 453 | Ga0268266_10146010 | 3300028379 | Bacteria | 2127 |
| 454 | Ga0268264_10028545 | 3300028381 | Bacteria | 4564 |
| 455 | Ga0268264_10080924 | 3300028381 | Bacteria | 2775 |
| 456 | Ga0268264_10247546 | 3300028381 | Bacteria | 1654 |
| 457 | Ga0307517_10112060 | 3300028786 | Bacteria | 2069 |
| 458 | Ga0307515_10000179 | 3300028794 | Bacteria | 156716 |
| 459 | Ga0307515_10000586 | 3300028794 | Bacteria | 85517 |
| 460 | Ga0307515_10017937 | 3300028794 | Bacteria | 12853 |
| 461 | Ga0307515_10018687 | 3300028794 | Bacteria | 12518 |
| 462 | Ga0307515_10039346 | 3300028794 | Bacteria | 7526 |
| 463 | Ga0307515_10050608 | 3300028794 | Bacteria | 6216 |
| 464 | Ga0307515_10092450 | 3300028794 | Bacteria | 3765 |
| 465 | Ga0307515_10118376 | 3300028794 | Bacteria | 3023 |
| 466 | Ga0307515_10128603 | 3300028794 | Bacteria | 2807 |
| 467 | Ga0307515_10178772 | 3300028794 | Bacteria | 2081 |
| 468 | Ga0307515_10185711 | 3300028794 | Bacteria | 2009 |
| 469 | Ga0265338_10000113 | 3300028800 | Bacteria | 150993 |
| 470 | Ga0307512_10056371 | 3300030522 | Bacteria | 3087 |
| 471 | Ga0307512_10172530 | 3300030522 | Bacteria | 1236 |
| 472 | Ga0265332_10053299 | 3300031238 | Bacteria | 1736 |
| 473 | Ga0265328_10000002 | 3300031239 | Bacteria | 275819 |
| 474 | Ga0265340_10066536 | 3300031247 | Bacteria | 1714 |
| 475 | Ga0265331_10012849 | 3300031250 | Bacteria | 4519 |
| 476 | Ga0265327_10000020 | 3300031251 | Bacteria | 424552 |
| 477 | Ga0265327_10005210 | 3300031251 | Bacteria | 10972 |
| 478 | Ga0307513_10000543 | 3300031456 | Bacteria | 53868 |
| 479 | Ga0307513_10000653 | 3300031456 | Bacteria | 49874 |
| 480 | Ga0307513_10034448 | 3300031456 | Bacteria | 5683 |
| 481 | Ga0307513_10048415 | 3300031456 | Bacteria | 4614 |
| 482 | Ga0307513_10108803 | 3300031456 | Bacteria | 2771 |
| 483 | Ga0307509_10001648 | 3300031507 | Bacteria | 37411 |
| 484 | Ga0307509_10004900 | 3300031507 | Bacteria | 18966 |
| 485 | Ga0307509_10010962 | 3300031507 | Bacteria | 11047 |
| 486 | Ga0307509_10167947 | 3300031507 | Bacteria | 2079 |
| 487 | Ga0307408_100000073 | 3300031548 | Bacteria | 113106 |
| 488 | Ga0307408_100002072 | 3300031548 | Bacteria | 14440 |
| 489 | Ga0307408_100018250 | 3300031548 | Bacteria | 4709 |
| 490 | Ga0307408_100048239 | 3300031548 | Bacteria | 3054 |
| 491 | Ga0307408_100060229 | 3300031548 | Bacteria | 2766 |
| 492 | Ga0307408_100145298 | 3300031548 | Bacteria | 1866 |
| 493 | Ga0307508_10000649 | 3300031616 | Bacteria | 41802 |
| 494 | Ga0307514_10000746 | 3300031649 | Bacteria | 55099 |
| 495 | Ga0307514_10063798 | 3300031649 | Bacteria | 2796 |
| 496 | Ga0307516_10004295 | 3300031730 | Bacteria | 17687 |
| 497 | Ga0307516_10004304 | 3300031730 | Bacteria | 17665 |
| 498 | Ga0307516_10006051 | 3300031730 | Bacteria | 14298 |
| 499 | Ga0307516_10009811 | 3300031730 | Bacteria | 10620 |
| 500 | Ga0307516_10021887 | 3300031730 | Bacteria | 6568 |
| 501 | Ga0307516_10048733 | 3300031730 | Bacteria | 4168 |
| 502 | Ga0307516_10055606 | 3300031730 | Bacteria | 3862 |
| 503 | Ga0307516_10076649 | 3300031730 | Bacteria | 3195 |
| 504 | Ga0307405_10138244 | 3300031731 | Bacteria | 1694 |
| 505 | Ga0307406_10142822 | 3300031901 | Bacteria | 1697 |
| 506 | Ga0307407_10002551 | 3300031903 | Bacteria | 7164 |
| 507 | Ga0307412_10000014 | 3300031911 | Bacteria | 353795 |
| 508 | Ga0307412_10045203 | 3300031911 | Bacteria | 2877 |
| 509 | Ga0307412_10132804 | 3300031911 | Bacteria | 1811 |
| 510 | Ga0307412_10216962 | 3300031911 | Bacteria | 1464 |
| 511 | Ga0307409_100003515 | 3300031995 | Bacteria | 8540 |
| 512 | Ga0307409_100004354 | 3300031995 | Bacteria | 7940 |
| 513 | Ga0307416_100015237 | 3300032002 | Bacteria | 5303 |
| 514 | Ga0307416_100149319 | 3300032002 | Bacteria | 2140 |
| 515 | Ga0307414_10285708 | 3300032004 | Bacteria | 1388 |
| 516 | Ga0307414_10349355 | 3300032004 | Bacteria | 1269 |
| 517 | Ga0307411_10250012 | 3300032005 | Bacteria | 1393 |
| 518 | Ga0307415_100015503 | 3300032126 | Bacteria | 4515 |
| 519 | Ga0307507_10071231 | 3300033179 | Bacteria | 3145 |
| 520 | Ga0307510_10003840 | 3300033180 | Bacteria | 17605 |
| 521 | Ga0307510_10186159 | 3300033180 | Bacteria | 1631 |
| 522 | Ga0373930_0015587 | 3300034816 | Bacteria | 1428 |
| 523 | Ga0373950_0006176 | 3300034818 | Bacteria | 1818 |
| 524 | Ga0373939_0000056 | 3300035114 | Bacteria | 39684 |
| 525 | Ga0373946_0030925 | 3300035171 | Bacteria | 2140 |
| 526 | Ga0373955_0028213 | 3300035172 | Bacteria | 2909 |
| 527 | Ga0373924_0018195 | 3300035410 | Bacteria | 2705 |
| 528 | Ga0373931_0004502 | 3300035691 | Bacteria | 6371 |
| 529 | Ga0373931_0005160 | 3300035691 | Bacteria | 6020 |
| 530 | Ga0373931_0042854 | 3300035691 | Bacteria | 2381 |
| 531 | Ga0373933_0149166 | 3300035724 | Bacteria | 1480 |
| 532 | Ga0373937_0043909 | 3300036401 | Bacteria | 4082 |
| 533 | Ga0373925_0002961 | 3300037068 | Bacteria | 13405 |
| 534 | Ga0395899_0006799 | 3300037312 | Bacteria | 8863 |
| 535 | Ga0395899_0061653 | 3300037312 | Bacteria | 2762 |
| 536 | Ga0395900_0001185 | 3300037418 | Bacteria | 32334 |
| 537 | Ga0395900_0020073 | 3300037418 | Bacteria | 6815 |
| 538 | Ga0395900_0101074 | 3300037418 | Bacteria | 2961 |
| 539 | Ga0395900_0156275 | 3300037418 | Bacteria | 2329 |
| 540 | Ga0395900_0343002 | 3300037418 | Bacteria | 1469 |
| 541 | Ga0395898_0000792 | 3300037466 | Bacteria | 53811 |
| 542 | Ga0395898_0000973 | 3300037466 | Bacteria | 45223 |
| 543 | Ga0395898_0012269 | 3300037466 | Bacteria | 8861 |
| 544 | Ga0395898_0022071 | 3300037466 | Bacteria | 6449 |
| 545 | Ga0395898_0309972 | 3300037466 | Bacteria | 1505 |
| 546 | Ga0395905_0000279 | 3300037471 | Bacteria | 75846 |
| 547 | Ga0395905_0003420 | 3300037471 | Bacteria | 16979 |
| 548 | Ga0395905_0004718 | 3300037471 | Bacteria | 14081 |
| 549 | Ga0395905_0020785 | 3300037471 | Bacteria | 6215 |
| 550 | Ga0395905_0026482 | 3300037471 | Bacteria | 5466 |
| 551 | Ga0395905_0043858 | 3300037471 | Bacteria | 4196 |
| 552 | Ga0395905_0056046 | 3300037471 | Bacteria | 3688 |
| 553 | Ga0395905_0199413 | 3300037471 | Bacteria | 1876 |
| 554 | Ga0395905_0406557 | 3300037471 | Bacteria | 1256 |
| 555 | Ga0395901_0000034 | 3300038443 | Bacteria | 230365 |
| 556 | Ga0395901_0000665 | 3300038443 | Bacteria | 39507 |
| 557 | Ga0395901_0003064 | 3300038443 | Bacteria | 16847 |
| 558 | Ga0395901_0035576 | 3300038443 | Bacteria | 5146 |
| 559 | Ga0395901_0056313 | 3300038443 | Bacteria | 4089 |
| 560 | Ga0395901_0073503 | 3300038443 | Bacteria | 3566 |
| 561 | Ga0395901_0223637 | 3300038443 | Bacteria | 1967 |
| 562 | Ga0436365_0034357 | 3300039437 | Bacteria | 1980 |
| 563 | Ga0436361_0060434 | 3300039447 | Bacteria | 165633 |
| 564 | Ga0436361_0096676 | 3300039447 | Bacteria | 32751 |
| 565 | Ga0436361_0199744 | 3300039447 | Bacteria | 17215 |
| 566 | Ga0436361_0247389 | 3300039447 | Bacteria | 2767 |
| 567 | Ga0436361_0547369 | 3300039447 | Bacteria | 17117 |
| 568 | Ga0436361_0678863 | 3300039447 | Bacteria | 3279 |
| 569 | Ga0436361_1032254 | 3300039447 | Bacteria | 5642 |
| 570 | Ga0436361_1216292 | 3300039447 | Bacteria | 2962 |
| 571 | Ga0439466_0033666 | 3300041411 | Bacteria | 1740 |
| 572 | Ga0451849_0172705 | 3300041505 | Bacteria | 1298 |
| 573 | Ga0451853_3907472 | 3300041512 | Bacteria | 2365 |
| 574 | Ga0439449_0009421 | 3300042007 | Bacteria | 3702 |
| 575 | Ga0439449_0012852 | 3300042007 | Bacteria | 3148 |
| 576 | Ga0450888_001409 | 3300042126 | Bacteria | 2300 |
| 577 | Ga0450890_001891 | 3300042127 | Bacteria | 2966 |
| 578 | Ga0450891_000764 | 3300042129 | Bacteria | 3356 |
| 579 | Ga0450898_000843 | 3300042134 | Bacteria | 3816 |
| 580 | Ga0450898_007899 | 3300042134 | Bacteria | 1666 |
| 581 | Ga0450889_000232 | 3300042144 | Bacteria | 6211 |
| 582 | Ga0439446_0039427 | 3300042156 | Bacteria | 1388 |
| 583 | Ga0439446_0039946 | 3300042156 | Bacteria | 1380 |
| 584 | Ga0439464_0010255 | 3300042439 | Bacteria | 2473 |
| 585 | Ga0450918_000166 | 3300042531 | Bacteria | 14753 |
| 586 | Ga0466969_0000021 | 3300044656 | Bacteria | 99939 |
| 587 | Ga0466969_0018764 | 3300044656 | Bacteria | 3600 |
| 588 | Ga0466969_0040275 | 3300044656 | Bacteria | 2340 |
| 589 | Ga0466972_0000369 | 3300044658 | Bacteria | 24350 |
| 590 | Ga0453683_0001471 | 3300044673 | Bacteria | 20249 |
| 591 | Ga0466966_0017215 | 3300044684 | Bacteria | 4778 |
| 592 | Ga0466961_0014114 | 3300044693 | Bacteria | 5125 |
| 593 | Ga0466963_0018445 | 3300044694 | Bacteria | 4363 |
| 594 | Ga0466964_0021473 | 3300044706 | Bacteria | 2497 |
| 595 | Ga0453684_0074727 | 3300044712 | Bacteria | 4265 |
| 596 | Ga0466971_0008465 | 3300044719 | Bacteria | 4487 |
| 597 | Ga0466968_0035939 | 3300044735 | Bacteria | 2074 |
| 598 | Ga0466970_0080436 | 3300044765 | Bacteria | 1761 |
| 599 | Ga0466970_0091379 | 3300044765 | Bacteria | 1652 |
| 600 | Ga0466957_0011664 | 3300044842 | Bacteria | 5078 |
| 601 | Ga0466957_0088814 | 3300044842 | Bacteria | 1934 |
| 602 | Ga0466960_0007907 | 3300044901 | Bacteria | 4339 |
| 603 | Ga0466959_0000061 | 3300045049 | Bacteria | 76186 |
| 604 | Ga0466959_0000469 | 3300045049 | Bacteria | 23529 |
| 605 | Ga0466959_0074252 | 3300045049 | Bacteria | 2459 |
| 606 | Ga0451576_0007077 | 3300045051 | Bacteria | 13550 |
| 607 | Ga0466958_0067368 | 3300045836 | Bacteria | 2187 |
| 608 | Ga0466967_0340785 | 3300045976 | Bacteria | 1450 |
| 609 | Ga0495627_015304 | 3300046453 | Bacteria | 2650 |
| 610 | Ga0495592_0000202 | 3300046454 | Bacteria | 50799 |
| 611 | Ga0495592_0032830 | 3300046454 | Bacteria | 3915 |
| 612 | Ga0495603_0000061 | 3300046455 | Bacteria | 47189 |
| 613 | Ga0495603_0031531 | 3300046455 | Bacteria | 3191 |
| 614 | Ga0495590_0002144 | 3300046457 | Bacteria | 8285 |
| 615 | Ga0495590_0005540 | 3300046457 | Bacteria | 4997 |
| 616 | Ga0495590_0011292 | 3300046457 | Bacteria | 3342 |
| 617 | Ga0495590_0063850 | 3300046457 | Bacteria | 1288 |
| 618 | Ga0495591_009123 | 3300046458 | Bacteria | 3972 |
| 619 | Ga0495629_0001290 | 3300046459 | Bacteria | 19718 |
| 620 | Ga0495629_0015864 | 3300046459 | Bacteria | 5413 |
| 621 | Ga0495629_0018854 | 3300046459 | Bacteria | 4932 |
| 622 | Ga0495638_0013011 | 3300046460 | Bacteria | 5682 |
| 623 | Ga0495638_0016323 | 3300046460 | Bacteria | 4976 |
| 624 | Ga0495638_0113878 | 3300046460 | Bacteria | 1604 |
| 625 | Ga0495651_0043369 | 3300046462 | Bacteria | 3490 |
| 626 | Ga0495651_0053440 | 3300046462 | Bacteria | 3109 |
| 627 | Ga0495653_0002232 | 3300046463 | Bacteria | 15312 |
| 628 | Ga0495653_0026176 | 3300046463 | Bacteria | 4680 |
| 629 | Ga0495653_0162756 | 3300046463 | Bacteria | 1548 |
| 630 | Ga0495650_0002229 | 3300046471 | Bacteria | 16240 |
| 631 | Ga0495650_0011469 | 3300046471 | Bacteria | 4851 |
| 632 | Ga0495650_0018003 | 3300046471 | Bacteria | 3524 |
| 633 | Ga0495650_0030462 | 3300046471 | Bacteria | 2444 |
| 634 | Ga0495650_0031593 | 3300046471 | Bacteria | 2380 |
| 635 | Ga0495650_0045474 | 3300046471 | Bacteria | 1848 |
| 636 | Ga0495580_0000075 | 3300046472 | Bacteria | 62029 |
| 637 | Ga0495580_0000355 | 3300046472 | Bacteria | 37382 |
| 638 | Ga0495580_0001997 | 3300046472 | Bacteria | 17956 |
| 639 | Ga0495580_0012787 | 3300046472 | Bacteria | 6433 |
| 640 | Ga0495580_0030785 | 3300046472 | Bacteria | 3883 |
| 641 | Ga0495580_0032648 | 3300046472 | Bacteria | 3755 |
| 642 | Ga0495580_0042162 | 3300046472 | Bacteria | 3252 |
| 643 | Ga0495580_0106395 | 3300046472 | Bacteria | 1948 |
| 644 | Ga0495582_0005669 | 3300046473 | Bacteria | 6951 |
| 645 | Ga0495582_0017765 | 3300046473 | Bacteria | 3888 |
| 646 | Ga0495582_0051825 | 3300046473 | Bacteria | 2263 |
| 647 | Ga0495605_0028150 | 3300046474 | Bacteria | 2903 |
| 648 | Ga0495605_0075258 | 3300046474 | Bacteria | 1588 |
| 649 | Ga0495662_0059380 | 3300046476 | Bacteria | 1847 |
| 650 | Ga0495662_0082641 | 3300046476 | Bacteria | 1563 |
| 651 | Ga0495664_0000846 | 3300046477 | Bacteria | 15733 |
| 652 | Ga0495664_0019967 | 3300046477 | Bacteria | 3859 |
| 653 | Ga0495664_0020748 | 3300046477 | Bacteria | 3792 |
| 654 | Ga0495664_0044914 | 3300046477 | Bacteria | 2619 |
| 655 | Ga0495664_0080875 | 3300046477 | Bacteria | 1947 |
| 656 | Ga0495664_0136046 | 3300046477 | Bacteria | 1489 |
| 657 | Ga0495584_0018764 | 3300046491 | Bacteria | 3516 |
| 658 | Ga0495596_0038280 | 3300046500 | Bacteria | 1896 |
| 659 | Ga0495607_0072024 | 3300046501 | Bacteria | 1925 |
| 660 | Ga0495583_0000470 | 3300046506 | Bacteria | 59563 |
| 661 | Ga0495606_0026665 | 3300046507 | Bacteria | 4115 |
| 662 | Ga0495606_0036127 | 3300046507 | Bacteria | 3370 |
| 663 | Ga0495606_0061003 | 3300046507 | Bacteria | 2413 |
| 664 | Ga0495608_0013295 | 3300046511 | Bacteria | 5712 |
| 665 | Ga0495608_0027175 | 3300046511 | Bacteria | 3895 |
| 666 | Ga0495610_0019484 | 3300046512 | Bacteria | 3794 |
| 667 | Ga0495616_0001957 | 3300046513 | Bacteria | 13861 |
| 668 | Ga0495618_0015758 | 3300046514 | Bacteria | 4614 |
| 669 | Ga0495620_0011888 | 3300046515 | Bacteria | 4523 |
| 670 | Ga0495628_0003215 | 3300046516 | Bacteria | 14648 |
| 671 | Ga0495628_0005256 | 3300046516 | Bacteria | 11353 |
| 672 | Ga0495628_0032735 | 3300046516 | Bacteria | 4195 |
| 673 | Ga0495628_0062926 | 3300046516 | Bacteria | 2907 |
| 674 | Ga0495630_0007675 | 3300046517 | Bacteria | 7713 |
| 675 | Ga0495630_0015204 | 3300046517 | Bacteria | 5615 |
| 676 | Ga0495631_0001674 | 3300046518 | Bacteria | 13181 |
| 677 | Ga0495632_0019929 | 3300046519 | Bacteria | 3644 |
| 678 | Ga0495637_0038887 | 3300046520 | Bacteria | 2057 |
| 679 | Ga0495644_0051136 | 3300046523 | Bacteria | 1551 |
| 680 | Ga0495648_0003206 | 3300046524 | Bacteria | 14517 |
| 681 | Ga0495648_0021111 | 3300046524 | Bacteria | 4520 |
| 682 | Ga0495648_0067028 | 3300046524 | Bacteria | 2101 |
| 683 | Ga0495648_0120442 | 3300046524 | Bacteria | 1411 |
| 684 | Ga0495666_0000352 | 3300046526 | Bacteria | 20167 |
| 685 | Ga0495666_0006489 | 3300046526 | Bacteria | 5890 |
| 686 | Ga0495666_0017082 | 3300046526 | Bacteria | 3613 |
| 687 | Ga0495666_0036648 | 3300046526 | Bacteria | 2388 |
| 688 | Ga0495642_0019286 | 3300046528 | Bacteria | 2673 |
| 689 | Ga0495642_0027241 | 3300046528 | Bacteria | 2273 |
| 690 | Ga0495652_0000989 | 3300046529 | Bacteria | 32515 |
| 691 | Ga0495652_0053204 | 3300046529 | Bacteria | 3451 |
| 692 | Ga0495652_0109225 | 3300046529 | Bacteria | 2227 |
| 693 | Ga0495652_0144497 | 3300046529 | Bacteria | 1867 |
| 694 | Ga0495654_0000313 | 3300046530 | Bacteria | 42607 |
| 695 | Ga0495654_0029804 | 3300046530 | Bacteria | 2781 |
| 696 | Ga0495654_0048656 | 3300046530 | Bacteria | 2079 |
| 697 | Ga0495665_0001524 | 3300046531 | Bacteria | 12356 |
| 698 | Ga0495665_0025108 | 3300046531 | Bacteria | 3202 |
| 699 | Ga0495640_0057527 | 3300046533 | Bacteria | 2653 |
| 700 | Ga0495586_0000331 | 3300046535 | Bacteria | 29858 |
| 701 | Ga0495621_0049996 | 3300046539 | Bacteria | 1493 |
| 702 | Ga0495597_0000324 | 3300046542 | Bacteria | 43211 |
| 703 | Ga0495597_0003579 | 3300046542 | Bacteria | 8964 |
| 704 | Ga0495597_0026975 | 3300046542 | Bacteria | 2637 |
| 705 | Ga0495645_0001024 | 3300046543 | Bacteria | 19022 |
| 706 | Ga0495645_0042991 | 3300046543 | Bacteria | 3296 |
| 707 | Ga0495645_0047836 | 3300046543 | Bacteria | 3116 |
| 708 | Ga0495645_0048319 | 3300046543 | Bacteria | 3100 |
| 709 | Ga0495645_0058444 | 3300046543 | Bacteria | 2797 |
| 710 | Ga0495645_0068506 | 3300046543 | Bacteria | 2561 |
| 711 | Ga0495667_0060510 | 3300046559 | Bacteria | 2484 |
| 712 | Ga0495634_0001775 | 3300046642 | Bacteria | 18665 |
| 713 | Ga0495634_0009389 | 3300046642 | Bacteria | 7215 |
| 714 | Ga0495634_0020262 | 3300046642 | Bacteria | 4718 |
| 715 | Ga0495634_0026729 | 3300046642 | Bacteria | 4025 |
| 716 | Ga0495634_0073505 | 3300046642 | Bacteria | 2248 |
| 717 | Ga0495625_0003699 | 3300046660 | Bacteria | 14950 |
| 718 | Ga0495625_0005064 | 3300046660 | Bacteria | 12200 |
| 719 | Ga0495625_0025052 | 3300046660 | Bacteria | 4529 |
| 720 | Ga0495635_0033976 | 3300046663 | Bacteria | 3538 |
| 721 | Ga0495661_0015426 | 3300046665 | Bacteria | 5099 |
| 722 | Ga0495588_0061469 | 3300046674 | Bacteria | 1945 |
| 723 | Ga0495599_0001618 | 3300046678 | Bacteria | 12986 |
| 724 | Ga0495599_0058871 | 3300046678 | Bacteria | 2403 |
| 725 | Ga0495599_0072650 | 3300046678 | Bacteria | 2147 |
| 726 | Ga0495599_0083127 | 3300046678 | Bacteria | 2000 |
| 727 | Ga0495623_0017258 | 3300046679 | Bacteria | 4663 |
| 728 | Ga0495623_0020002 | 3300046679 | Bacteria | 4327 |
| 729 | Ga0495623_0020188 | 3300046679 | Bacteria | 4306 |
| 730 | Ga0495646_0002604 | 3300046680 | Bacteria | 11126 |
| 731 | Ga0495658_0046179 | 3300046683 | Bacteria | 2448 |
| 732 | Ga0495669_0026207 | 3300046684 | Bacteria | 2546 |
| 733 | Ga0495669_0097566 | 3300046684 | Bacteria | 1363 |
| 734 | Ga0495613_0010110 | 3300046689 | Bacteria | 7012 |
| 735 | Ga0495613_0102309 | 3300046689 | Bacteria | 2068 |
| 736 | Ga0495624_0000363 | 3300046690 | Bacteria | 36049 |
| 737 | Ga0495624_0003119 | 3300046690 | Bacteria | 12390 |
| 738 | Ga0495624_0053935 | 3300046690 | Bacteria | 2536 |
| 739 | Ga0495671_0009412 | 3300046692 | Bacteria | 5455 |
| 740 | Ga0495671_0057883 | 3300046692 | Bacteria | 1918 |
| 741 | Ga0495671_0081281 | 3300046692 | Bacteria | 1588 |
| 742 | Ga0495671_0089492 | 3300046692 | Bacteria | 1507 |
| 743 | Ga0495649_0000822 | 3300046694 | Bacteria | 24937 |
| 744 | Ga0495649_0006905 | 3300046694 | Bacteria | 7022 |
| 745 | Ga0495649_0052374 | 3300046694 | Bacteria | 2211 |
| 746 | Ga0495589_0014850 | 3300046794 | Bacteria | 4006 |
| 747 | Ga0495589_0044084 | 3300046794 | Bacteria | 2219 |
| 748 | Ga0495600_0016905 | 3300046809 | Bacteria | 4637 |
| 749 | Ga0495600_0140725 | 3300046809 | Bacteria | 1566 |
| 750 | Ga0495660_0044360 | 3300046810 | Bacteria | 2446 |
| 751 | Ga0495660_0045874 | 3300046810 | Bacteria | 2398 |
| 752 | Ga0495660_0072937 | 3300046810 | Bacteria | 1817 |
| 753 | Ga0495581_0003283 | 3300047315 | Bacteria | 9282 |
| 754 | Ga0495581_0013366 | 3300047315 | Bacteria | 4760 |
| 755 | Ga0495604_0011468 | 3300047317 | Bacteria | 7037 |
| 756 | Ga0495604_0048049 | 3300047317 | Bacteria | 3320 |
| 757 | Ga0495604_0058536 | 3300047317 | Bacteria | 2959 |
| 758 | Ga0495636_0019618 | 3300047318 | Bacteria | 2720 |
| 759 | Ga0495674_0001528 | 3300047319 | Bacteria | 22619 |
| 760 | Ga0495674_0007431 | 3300047319 | Bacteria | 10470 |
| 761 | Ga0495674_0263813 | 3300047319 | Bacteria | 1414 |
| 762 | Ga0495672_0067805 | 3300047320 | Bacteria | 2031 |
| 763 | Ga0495676_0046071 | 3300047321 | Bacteria | 3544 |
| 764 | Ga0495676_0047219 | 3300047321 | Bacteria | 3484 |
| 765 | Ga0495676_0056190 | 3300047321 | Bacteria | 3114 |
| 766 | Ga0495676_0056442 | 3300047321 | Bacteria | 3105 |
| 767 | Ga0495680_0001067 | 3300047322 | Bacteria | 30366 |
| 768 | Ga0495680_0069956 | 3300047322 | Bacteria | 2677 |
| 769 | Ga0495680_0108499 | 3300047322 | Bacteria | 2060 |
| 770 | Ga0495680_0152553 | 3300047322 | Bacteria | 1683 |
| 771 | Ga0495683_0000982 | 3300047323 | Bacteria | 19938 |
| 772 | Ga0495683_0001226 | 3300047323 | Bacteria | 17482 |
| 773 | Ga0495683_0026673 | 3300047323 | Bacteria | 2956 |
| 774 | Ga0495683_0034431 | 3300047323 | Bacteria | 2576 |
| 775 | Ga0495687_000011 | 3300047443 | Bacteria | 397225 |
| 776 | Ga0495687_004295 | 3300047443 | Bacteria | 9723 |
| 777 | Ga0495687_010847 | 3300047443 | Bacteria | 4951 |
| 778 | Ga0495687_023976 | 3300047443 | Bacteria | 2908 |
| 779 | Ga0495675_0003465 | 3300047444 | Bacteria | 9507 |
| 780 | Ga0495675_0021774 | 3300047444 | Bacteria | 4083 |
| 781 | Ga0495675_0033807 | 3300047444 | Bacteria | 3263 |
| 782 | Ga0495675_0037275 | 3300047444 | Bacteria | 3096 |
| 783 | Ga0495675_0127393 | 3300047444 | Bacteria | 1584 |
| 784 | Ga0495679_004005 | 3300047446 | Bacteria | 6931 |
| 785 | Ga0495679_013721 | 3300047446 | Bacteria | 3027 |
| 786 | Ga0495673_0001480 | 3300047469 | Bacteria | 18590 |
| 787 | Ga0495673_0023528 | 3300047469 | Bacteria | 2995 |
| 788 | Ga0495684_0031937 | 3300047471 | Bacteria | 4042 |
| 789 | Ga0495684_0033437 | 3300047471 | Bacteria | 3943 |
| 790 | Ga0495684_0141904 | 3300047471 | Bacteria | 1801 |
| 791 | Ga0495686_0000014 | 3300047472 | Bacteria | 474014 |
| 792 | Ga0495686_0000951 | 3300047472 | Bacteria | 35821 |
| 793 | Ga0495686_0003264 | 3300047472 | Bacteria | 14218 |
| 794 | Ga0495686_0052381 | 3300047472 | Bacteria | 2559 |
| 795 | Ga0495593_0008899 | 3300047673 | Bacteria | 5827 |
| 796 | Ga0495593_0012509 | 3300047673 | Bacteria | 4849 |
| 797 | Ga0495593_0054467 | 3300047673 | Bacteria | 2108 |
| 798 | Ga0495593_0096547 | 3300047673 | Bacteria | 1518 |
| 799 | Ga0495602_0000840 | 3300048088 | Bacteria | 29575 |
| 800 | Ga0495602_0019126 | 3300048088 | Bacteria | 6812 |
| 801 | Ga0495602_0051840 | 3300048088 | Bacteria | 3650 |
| 802 | Ga0495602_0086976 | 3300048088 | Bacteria | 2607 |
| 803 | Ga0495614_0000415 | 3300048089 | Bacteria | 17457 |
| 804 | Ga0496100_0025511 | 3300048903 | Bacteria | 3615 |
| 805 | Ga0496100_0097154 | 3300048903 | Bacteria | 2022 |
| 806 | Ga0496101_0020204 | 3300048904 | Bacteria | 4554 |
| 807 | Ga0496101_0039935 | 3300048904 | Bacteria | 3341 |
| 808 | Ga0496101_0135901 | 3300048904 | Bacteria | 1871 |
| 809 | Ga0496102_0002932 | 3300048905 | Bacteria | 14477 |
| 810 | Ga0496102_0014445 | 3300048905 | Bacteria | 6862 |
| 811 | Ga0496102_0036848 | 3300048905 | Bacteria | 4408 |
| 812 | Ga0496102_0042312 | 3300048905 | Bacteria | 4128 |
| 813 | Ga0496103_0003880 | 3300048906 | Bacteria | 9094 |
| 814 | Ga0496103_0015711 | 3300048906 | Bacteria | 4512 |
| 815 | Ga0496103_0056558 | 3300048906 | Bacteria | 2435 |
| 816 | Ga0496103_0156163 | 3300048906 | Bacteria | 1462 |
| 817 | Ga0496103_0214917 | 3300048906 | Bacteria | 1236 |
| 818 | Ga0496104_0011855 | 3300048907 | Bacteria | 7825 |
| 819 | Ga0496104_0126711 | 3300048907 | Bacteria | 2452 |
| 820 | Ga0496105_0067134 | 3300048908 | Bacteria | 2961 |
| 821 | Ga0496105_0076845 | 3300048908 | Bacteria | 2757 |
| 822 | Ga0496106_0000031 | 3300048909 | Bacteria | 135370 |
| 823 | Ga0496106_0027500 | 3300048909 | Bacteria | 4236 |
| 824 | Ga0496106_0055318 | 3300048909 | Bacteria | 2999 |
| 825 | Ga0496107_0044529 | 3300048910 | Bacteria | 3190 |
| 826 | Ga0496107_0054459 | 3300048910 | Bacteria | 2887 |
| 827 | Ga0496107_0063931 | 3300048910 | Bacteria | 2667 |
| 828 | Ga0496109_0247860 | 3300048912 | Bacteria | 1677 |
| 829 | Ga0496110_0010964 | 3300048913 | Bacteria | 7394 |
| 830 | Ga0496110_0105996 | 3300048913 | Bacteria | 2522 |
| 831 | Ga0496111_0020171 | 3300048914 | Bacteria | 4638 |
| 832 | Ga0496112_0012551 | 3300048915 | Bacteria | 7784 |
| 833 | Ga0496112_0134973 | 3300048915 | Bacteria | 2438 |
| 834 | Ga0496113_0027379 | 3300048916 | Bacteria | 4087 |
| 835 | Ga0496113_0087884 | 3300048916 | Bacteria | 2390 |
| 836 | Ga0496114_0001956 | 3300048917 | Bacteria | 15672 |
| 837 | Ga0496114_0039800 | 3300048917 | Bacteria | 3890 |
| 838 | Ga0496114_0310684 | 3300048917 | Bacteria | 1392 |
| 839 | Ga0496115_0060206 | 3300048918 | Bacteria | 3059 |
| 840 | Ga0496116_0018304 | 3300048919 | Bacteria | 5405 |
| 841 | Ga0496116_0041241 | 3300048919 | Bacteria | 3169 |
| 842 | Ga0496116_0062584 | 3300048919 | Bacteria | 2402 |
| 843 | Ga0496117_0003214 | 3300048920 | Bacteria | 19309 |
| 844 | Ga0496117_0021232 | 3300048920 | Bacteria | 5262 |
| 845 | Ga0496117_0022484 | 3300048920 | Bacteria | 5056 |
| 846 | Ga0496117_0025830 | 3300048920 | Bacteria | 4606 |
| 847 | Ga0496117_0066755 | 3300048920 | Bacteria | 2438 |
| 848 | Ga0496117_0102829 | 3300048920 | Bacteria | 1802 |
| 849 | Ga0496117_0120039 | 3300048920 | Bacteria | 1617 |
| 850 | Ga0496117_0124770 | 3300048920 | Bacteria | 1574 |
| 851 | Ga0496118_0000282 | 3300048921 | Bacteria | 89232 |
| 852 | Ga0496118_0020881 | 3300048921 | Bacteria | 5791 |
| 853 | Ga0496118_0061068 | 3300048921 | Bacteria | 2794 |
| 854 | Ga0496118_0087064 | 3300048921 | Bacteria | 2168 |
| 855 | Ga0496119_0129341 | 3300048922 | Bacteria | 1378 |
| 856 | Ga0496121_0000166 | 3300048924 | Bacteria | 145051 |
| 857 | Ga0496121_0000978 | 3300048924 | Bacteria | 51196 |
| 858 | Ga0496121_0005335 | 3300048924 | Bacteria | 16526 |
| 859 | Ga0496121_0021965 | 3300048924 | Bacteria | 6221 |
| 860 | Ga0496121_0032610 | 3300048924 | Bacteria | 4731 |
| 861 | Ga0496121_0039151 | 3300048924 | Bacteria | 4184 |
| 862 | Ga0496121_0078972 | 3300048924 | Bacteria | 2614 |
| 863 | Ga0496121_0247476 | 3300048924 | Bacteria | 1238 |
| 864 | Ga0496122_0000080 | 3300048925 | Bacteria | 212397 |
| 865 | Ga0496122_0154867 | 3300048925 | Bacteria | 1408 |
| 866 | Ga0496123_0000072 | 3300048926 | Bacteria | 198524 |
| 867 | Ga0496123_0056457 | 3300048926 | Bacteria | 2566 |
| 868 | Ga0496123_0133206 | 3300048926 | Bacteria | 1372 |
| 869 | Ga0496124_0000388 | 3300048927 | Bacteria | 80485 |
| 870 | Ga0496124_0003175 | 3300048927 | Bacteria | 20312 |
| 871 | Ga0496124_0057750 | 3300048927 | Bacteria | 3268 |
| 872 | Ga0496124_0091590 | 3300048927 | Bacteria | 2477 |
| 873 | Ga0496124_0140919 | 3300048927 | Bacteria | 1903 |
| 874 | Ga0496125_0007888 | 3300048928 | Bacteria | 11243 |
| 875 | Ga0496125_0013117 | 3300048928 | Bacteria | 8171 |
| 876 | Ga0496125_0044880 | 3300048928 | Bacteria | 3729 |
| 877 | Ga0496125_0182520 | 3300048928 | Bacteria | 1396 |
| 878 | Ga0496126_0002411 | 3300048929 | Bacteria | 25348 |
| 879 | Ga0496126_0003835 | 3300048929 | Bacteria | 18607 |
| 880 | Ga0496126_0006864 | 3300048929 | Bacteria | 12621 |
| 881 | Ga0496126_0177709 | 3300048929 | Bacteria | 1810 |
| 882 | Ga0495682_0001086 | 3300049460 | Bacteria | 15952 |
| 883 | Ga0495682_0003755 | 3300049460 | Bacteria | 6680 |
| 884 | Ga0501294_002318 | 3300049517 | Bacteria | 1819 |
| 885 | Ga0501032_0025224 | 3300049569 | Bacteria | 4099 |
| 886 | Ga0501038_0025134 | 3300049574 | Bacteria | 5310 |
| 887 | Ga0501043_0000012 | 3300049579 | Bacteria | 188907 |
| 888 | Ga0501046_0000030 | 3300049580 | Bacteria | 187803 |
| 889 | Ga0501047_0001222 | 3300049581 | Bacteria | 25487 |
| 890 | Ga0501069_0057421 | 3300049585 | Bacteria | 2169 |
| 891 | Ga0501070_0012507 | 3300049586 | Bacteria | 7159 |
| 892 | Ga0501074_0013990 | 3300049590 | Bacteria | 5832 |
| 893 | Ga0501198_000003 | 3300049649 | Bacteria | 175301 |
| 894 | Ga0501222_000014 | 3300049662 | Bacteria | 83609 |
| 895 | Ga0501223_005994 | 3300049663 | Bacteria | 2528 |
| 896 | Ga0501265_000615 | 3300049762 | Bacteria | 3841 |
| 897 | Ga0501266_001410 | 3300049763 | Bacteria | 3069 |
| 898 | Ga0501035_0072640 | 3300049822 | Bacteria | 3045 |
| 899 | Ga0501045_0031337 | 3300049824 | Bacteria | 3851 |
| 900 | nmdc:mga00v17_20131_c1 | 3300050491 | Bacteria | 3819 |
| 901 | nmdc:mga00v17_31607_c1 | 3300050491 | Bacteria | 3123 |
| 902 | nmdc:mga0yw44_19466_c1 | 3300050492 | Bacteria | 3745 |
| 903 | nmdc:mga0k408_177875_c1 | 3300050493 | Bacteria | 1269 |
| 904 | nmdc:mga0k408_18366_c1 | 3300050493 | Bacteria | 3903 |
| 905 | nmdc:mga0k408_2047_c1 | 3300050493 | Bacteria | 10780 |
| 906 | nmdc:mga0k408_54783_c1 | 3300050493 | Bacteria | 2312 |
| 907 | nmdc:mga0k408_7277_c1 | 3300050493 | Bacteria | 4095 |
| 908 | nmdc:mga0k408_72968_c1 | 3300050493 | Bacteria | 2005 |
| 909 | nmdc:mga0k408_91249_c1 | 3300050493 | Bacteria | 1790 |
| 910 | nmdc:mga07m45_14324_c1 | 3300050496 | Bacteria | 4222 |
| 911 | nmdc:mga07m45_22816_c1 | 3300050496 | Bacteria | 3419 |
| 912 | nmdc:mga07m45_32984_c1 | 3300050496 | Bacteria | 2874 |
| 913 | nmdc:mga07m45_42024_c1 | 3300050496 | Bacteria | 2562 |
| 914 | nmdc:mga05p37_523886_c1 | 3300050507 | Bacteria | 1355 |
| 915 | Ga0495619_0157217 | 3300053085 | Bacteria | 1569 |
| 916 | Ga0500646_0009218 | 3300053090 | Bacteria | 2527 |
| 917 | Ga0500651_0000420 | 3300053093 | Bacteria | 22746 |
| 918 | Ga0500571_000013 | 3300053110 | Bacteria | 71532 |
| 919 | Ga0500593_007015 | 3300053117 | Bacteria | 4554 |
| 920 | Ga0500594_0000195 | 3300053118 | Bacteria | 15186 |
| 921 | Ga0500597_021317 | 3300053120 | Bacteria | 2559 |
| 922 | Ga0500607_012134 | 3300053121 | Bacteria | 5069 |
| 923 | Ga0500608_008747 | 3300053122 | Bacteria | 4271 |
| 924 | Ga0500655_001318 | 3300053133 | Bacteria | 4705 |
| 925 | Ga0500658_0000012 | 3300053134 | Bacteria | 160010 |
| 926 | Ga0500658_0000799 | 3300053134 | Bacteria | 13053 |
| 927 | Ga0500658_0002681 | 3300053134 | Bacteria | 6842 |
| 928 | Ga0500658_0035960 | 3300053134 | Bacteria | 1963 |
| 929 | Ga0500559_0002514 | 3300053136 | Bacteria | 9423 |
| 930 | Ga0500559_0036011 | 3300053136 | Bacteria | 2139 |
| 931 | Ga0500568_0001449 | 3300053139 | Bacteria | 15231 |
| 932 | Ga0500573_0012096 | 3300053140 | Bacteria | 4843 |
| 933 | Ga0500616_0034450 | 3300053153 | Bacteria | 2757 |
| 934 | Ga0500636_0059561 | 3300053177 | Bacteria | 2231 |
| 935 | Ga0500645_000061 | 3300053730 | Bacteria | 85703 |
| 936 | Ga0500645_011337 | 3300053730 | Bacteria | 2915 |
| 937 | Ga0500645_022110 | 3300053730 | Bacteria | 1959 |
| 938 | Ga0590071_002714 | 3300059421 | Bacteria | 4437 |
| 939 | Ga0466962_0018907 | 3300061719 | Bacteria | 3310 |
| 940 | 2501413779 | 2501025504 | Bacteria | 8008976 |
| 941 | 2509129341 | 2508501125 | Bacteria | 7208311 |
| 942 | 2511094952 | 2510917014 | Bacteria | 8296963 |
| 943 | 2511104611 | 2510917015 | Bacteria | 7950052 |
| 944 | 2511245322 | 2511231002 | Bacteria | 5042903 |
| 945 | 2513226765 | 2513020051 | Bacteria | 6053213 |
| 946 | 2513551527 | 2513237082 | Bacteria | 8640282 |
| 947 | 2513560177 | 2513237083 | Bacteria | 8410967 |
| 948 | 2513962505 | 2513237151 | Bacteria | 6309801 |
| 949 | 2515679466 | 2515154122 | Bacteria | 8609520 |
| 950 | 2516016934 | 2515154189 | Bacteria | 9629850 |
| 951 | 2527079095 | 2526164713 | Bacteria | 6780608 |
| 952 | 2587757756 | 2585428062 | Bacteria | 6842168 |
| 953 | 2599622234 | 2599185214 | Bacteria | 8209958 |
| 954 | 2599676943 | 2599185226 | Bacteria | 8233575 |
| 955 | 2599680359 | 2599185227 | Bacteria | 8246414 |
| 956 | 2599692375 | 2599185229 | Bacteria | 8216126 |
| 957 | 2600813634 | 2600255067 | Bacteria | 6795583 |
| 958 | 2643741685 | 2643221544 | Bacteria | 5886209 |
| 959 | 2643934954 | 2643221585 | Bacteria | 5812563 |
| 960 | 2644058381 | 2643221609 | Bacteria | 6756331 |
| 961 | 2644073432 | 2643221611 | Bacteria | 6820941 |
| 962 | 2644220470 | 2643221639 | Bacteria | 6649903 |
| 963 | 2644246692 | 2643221644 | Bacteria | 6865017 |
| 964 | 2644259394 | 2643221646 | Bacteria | 6433402 |
| 965 | 2644303826 | 2643221654 | Bacteria | 5273570 |
| 966 | 2644316441 | 2643221656 | Bacteria | 5809961 |
| 967 | 2644326423 | 2643221658 | Bacteria | 6064537 |
| 968 | 2644469538 | 2643221683 | Bacteria | 5749203 |
| 969 | 2722881162 | 2721755523 | Bacteria | 6430384 |
| 970 | 2738719474 | 2738541277 | Bacteria | 7458140 |
| 971 | 2738723664 | 2738541277 | Bacteria | 7458140 |
| 972 | 2738820161 | 2738541296 | Bacteria | 7285013 |
| 973 | 2738832641 | 2738541298 | Bacteria | 7286732 |
| 974 | 2738874168 | 2738541306 | Bacteria | 7284992 |
| 975 | 2738884529 | 2738541307 | Bacteria | 8606193 |
| 976 | 2739053629 | 2738541337 | Bacteria | 6183410 |
| 977 | 2739185798 | 2738543002 | Bacteria | 7284546 |
| 978 | 2739220766 | 2738543008 | Bacteria | 7282815 |
| 979 | 2739247015 | 2738543012 | Bacteria | 7115078 |
| 980 | 2739283704 | 2738543019 | Bacteria | 7459457 |
| 981 | 2739284395 | 2738543019 | Bacteria | 7459457 |
| 982 | 2746091747 | 2744054900 | Bacteria | 8399525 |
| 983 | 2746093867 | 2744054901 | Bacteria | 8397047 |
| 984 | 2746095357 | 2744054901 | Bacteria | 8397047 |
| 985 | 2753565827 | 2751185846 | Bacteria | 7242164 |
| 986 | 2816469705 | 2816332133 | Bacteria | 7249298 |
| 987 | 2819598972 | 2818991446 | Bacteria | 7757362 |
| 988 | 2819620826 | 2818991450 | Bacteria | 6962147 |
| 989 | 2831270758 | 2831265667 | Bacteria | 7184833 |
| 990 | 2838058806 | 2838054893 | Bacteria | 7451788 |
| 991 | 2839141103 | 2839138175 | Bacteria | 6549354 |
| 992 | 2842462087 | 2842454564 | Bacteria | 8730687 |
| 993 | 2842720633 | 2842718218 | Bacteria | 4560148 |
| 994 | 2842738607 | 2842733646 | Bacteria | 5716726 |
| 995 | 2842750027 | 2842747753 | Bacteria | 5578255 |
| 996 | 2857366482 | 2857357740 | Bacteria | 9937880 |
| 997 | 2883094692 | 2883087390 | Bacteria | 9532701 |
| 998 | 2885202471 | 2885198086 | Bacteria | 7212419 |
| 999 | 2885216124 | 2885211737 | Bacteria | 7212420 |
| 1000 | 2899929792 | 2899924645 | Bacteria | 7487985 |
| 1001 | 2900636288 | 2900634093 | Bacteria | 10263517 |
| 1002 | 2902689253 | 2902682994 | Bacteria | 8951596 |
| 1003 | 2928042267 | 2928037797 | Bacteria | 7273642 |
| 1004 | 2928050036 | 2928044640 | Bacteria | 7271509 |
| 1005 | 2928054617 | 2928051484 | Bacteria | 7773759 |
| 1006 | 2928070204 | 2928064002 | Bacteria | 7419480 |
| 1007 | 2928074133 | 2928070936 | Bacteria | 8062541 |
| 1008 | 2928086393 | 2928084124 | Bacteria | 7159212 |
| 1009 | 2928109626 | 2928108538 | Bacteria | 7360024 |
| 1010 | 2928118897 | 2928115317 | Bacteria | 6477646 |
| 1011 | 2928136920 | 2928135762 | Bacteria | 7259641 |
| 1012 | 2928506448 | 2928503688 | Bacteria | 7268108 |
| 1013 | 2929160834 | 2929160207 | Bacteria | 9075316 |
| 1014 | 2929162304 | 2929160207 | Bacteria | 9075316 |
| 1015 | 2929168459 | 2929160207 | Bacteria | 9075316 |
| 1016 | 2939634357 | 2939631187 | Bacteria | 6118131 |
| 1017 | 2945915669 | 2945909444 | Bacteria | 7065066 |
| 1018 | 2945935378 | 2945934425 | Bacteria | 7444609 |
| 1019 | 2945950327 | 2945945610 | Bacteria | 5951079 |
| 1020 | 2945988898 | 2945984333 | Bacteria | 7358892 |
| 1021 | 2974321788 | 2974320154 | Bacteria | 4571377 |
| 1022 | 2990704071 | 2990703756 | Bacteria | 7715990 |
| 1023 | 642422228 | 641736151 | Bacteria | 7477263 |
| 1024 | 642425835 | 641736151 | Bacteria | 7477263 |
| 1025 | 642620255 | 642555113 | Bacteria | 8214658 |
| 1026 | 8003957444 | 8003955200 | Bacteria | 8601927 |
| 1027 | 8020953811 | 8020953355 | Bacteria | 7439080 |
| 1028 | nmdc:mga0k408_41038_c1 | |||
| 1029 | JGI24740J21852_10002979 | |||
| 1030 | JGI24739J22299_10002019 | |||
| 1031 | JGI24739J22299_10002611 | |||
| 1032 | JGI24735J21928_10000321 | |||
| 1033 | JGI24735J21928_10004512 | |||
| 1034 | JGI24738J21930_10005717 | |||
| 1035 | JGI25155J39150_1000042 | |||
| 1036 | JGI25156J39149_1000053 | |||
| 1037 | JGI25156J39149_1003037 | |||
| 1038 | JGI25156J39149_1003053 | |||
| 1039 | JGI25154J39366_1000082 | |||
| 1040 | JGI25157J39369_1000072 | |||
| 1041 | JGI25150J39212_1002959 | |||
| 1042 | JGI25159J45721_1003277 | |||
| 1043 | JGI25151J46595_10009109 | |||
| 1044 | JGI25151J46595_10023163 | |||
| 1045 | JGI25151J46595_10053555 | |||
| 1046 | JGI25165J46597_1001342 | |||
| 1047 | JGI25153J46596_10001249 | |||
| 1048 | JGI26128J50194_1000014 | |||
| 1049 | JGI25160J50197_1000188 | |||
| 1050 | JGI25161J50226_1000007 | |||
| 1051 | Ga0006554J51385_1036275 | |||
| 1052 | Ga0006562J51391_1047714 | |||
| 1053 | Ga0006562J51391_1047716 | |||
| 1054 | Ga0055539_1000536 | |||
| 1055 | Ga0055533_1002147 | |||
| 1056 | Ga0055525_1000053 | |||
| 1057 | Ga0055542_1000013 | |||
| 1058 | Ga0055526_1012883 | |||
| 1059 | Ga0055526_1015140 | |||
| 1060 | Ga0055526_1023769 | |||
| 1061 | Ga0055537_1005041 | |||
| 1062 | Ga0055524_1000148 | |||
| 1063 | Ga0055524_1000213 | |||
| 1064 | Ga0055536_1000526 | |||
| 1065 | Ga0055536_1009279 | |||
| 1066 | Ga0055536_1028413 | |||
| 1067 | Ga0055536_1028847 | |||
| 1068 | Ga0055534_1000726 | |||
| 1069 | Ga0055534_1002320 | |||
| 1070 | Ga0055534_1003088 | |||
| 1071 | Ga0055528_1007035 | |||
| 1072 | Ga0055528_1011042 | |||
| 1073 | Ga0055530_10000233 | |||
| 1074 | Ga0055530_10007767 | |||
| 1075 | Ga0055530_10007960 | |||
| 1076 | Ga0055530_10008285 | |||
| 1077 | Ga0055540_1000018 | |||
| 1078 | Ga0055540_1000176 | |||
| 1079 | Ga0055531_10000135 | |||
| 1080 | Ga0055531_10000850 | |||
| 1081 | Ga0055531_10002836 | |||
| 1082 | Ga0055531_10007099 | |||
| 1083 | Ga0055531_10043465 | |||
| 1084 | Ga0055531_10043509 | |||
| 1085 | Ga0055543_1000842 | |||
| 1086 | Ga0065165_1013122 | |||
| 1087 | Ga0065165_1025541 | |||
| 1088 | Ga0065707_10087951 | |||
| 1089 | Ga0070658_10002933 | |||
| 1090 | Ga0070676_10019022 | |||
| 1091 | Ga0070676_10044513 | |||
| 1092 | Ga0070670_100063696 | |||
| 1093 | Ga0070670_100083241 | |||
| 1094 | Ga0070670_100216812 | |||
| 1095 | Ga0070670_100300305 | |||
| 1096 | Ga0068869_100004605 | |||
| 1097 | Ga0068869_100091722 | |||
| 1098 | Ga0068869_100276724 | |||
| 1099 | Ga0070666_10067889 | |||
| 1100 | Ga0070682_100080255 | |||
| 1101 | Ga0068868_100002058 | |||
| 1102 | Ga0068868_100049592 | |||
| 1103 | Ga0068868_100125503 | |||
| 1104 | Ga0068868_100263391 | |||
| 1105 | Ga0070660_100156926 | |||
| 1106 | Ga0070689_100034608 | |||
| 1107 | Ga0070687_100075811 | |||
| 1108 | Ga0070687_100076885 | |||
| 1109 | Ga0070661_100005909 | |||
| 1110 | Ga0070661_100093593 | |||
| 1111 | Ga0070661_100346673 | |||
| 1112 | Ga0070668_100009964 | |||
| 1113 | Ga0070675_100000203 | |||
| 1114 | Ga0070675_100005491 | |||
| 1115 | Ga0070675_100017687 | |||
| 1116 | Ga0070671_100010136 | |||
| 1117 | Ga0070671_100011587 | |||
| 1118 | Ga0070671_100108908 | |||
| 1119 | Ga0070671_100169807 | |||
| 1120 | Ga0070671_100318780 | |||
| 1121 | Ga0070674_100052167 | |||
| 1122 | Ga0070674_100057781 | |||
| 1123 | Ga0070674_100125280 | |||
| 1124 | Ga0070673_100060820 | |||
| 1125 | Ga0070673_100105185 | |||
| 1126 | Ga0070688_100035286 | |||
| 1127 | Ga0070659_100011689 | |||
| 1128 | Ga0070659_100054814 | |||
| 1129 | Ga0070659_100058177 | |||
| 1130 | Ga0070667_100021414 | |||
| 1131 | Ga0070667_100096863 | |||
| 1132 | Ga0070667_100304029 | |||
| 1133 | Ga0070714_100077741 | |||
| 1134 | Ga0070663_100003487 | |||
| 1135 | Ga0070663_100235793 | |||
| 1136 | Ga0070678_100000925 | |||
| 1137 | Ga0070678_100161723 | |||
| 1138 | Ga0070678_100304817 | |||
| 1139 | Ga0070662_100002619 | |||
| 1140 | Ga0070662_100012490 | |||
| 1141 | Ga0070662_100081276 | |||
| 1142 | Ga0068867_100000036 | |||
| 1143 | Ga0068867_100054879 | |||
| 1144 | Ga0068867_100070233 | |||
| 1145 | Ga0068867_100108564 | |||
| 1146 | Ga0068867_100127254 | |||
| 1147 | Ga0068867_100127629 | |||
| 1148 | Ga0070706_100000719 | |||
| 1149 | Ga0070707_100048898 | |||
| 1150 | Ga0070679_100012792 | |||
| 1151 | Ga0070679_100075705 | |||
| 1152 | Ga0070679_100080076 | |||
| 1153 | Ga0068853_100014870 | |||
| 1154 | Ga0068853_100200363 | |||
| 1155 | Ga0068853_100237170 | |||
| 1156 | Ga0070672_100053623 | |||
| 1157 | Ga0070672_100070303 | |||
| 1158 | Ga0070672_100082186 | |||
| 1159 | Ga0070672_100112051 | |||
| 1160 | Ga0070695_100295728 | |||
| 1161 | Ga0070665_100158221 | |||
| 1162 | Ga0070665_100202071 | |||
| 1163 | Ga0068855_100015898 | |||
| 1164 | Ga0070664_100020774 | |||
| 1165 | Ga0070664_100294451 | |||
| 1166 | Ga0068854_100123553 | |||
| 1167 | Ga0068854_100334182 | |||
| 1168 | Ga0068856_100179611 | |||
| 1169 | Ga0068852_100122083 | |||
| 1170 | Ga0068852_100287369 | |||
| 1171 | Ga0068852_100300940 | |||
| 1172 | Ga0068859_100087739 | |||
| 1173 | Ga0068859_100287334 | |||
| 1174 | Ga0068864_100000196 | |||
| 1175 | Ga0068861_100001918 | |||
| 1176 | Ga0068861_100277618 | |||
| 1177 | Ga0068851_10011910 | |||
| 1178 | Ga0068863_100314491 | |||
| 1179 | Ga0068858_100000578 | |||
| 1180 | Ga0068858_100003067 | |||
| 1181 | Ga0068860_100118065 | |||
| 1182 | Ga0068860_100161066 | |||
| 1183 | Ga0068862_100097108 | |||
| 1184 | Ga0068862_100133296 | |||
| 1185 | Ga0075365_10008212 | |||
| 1186 | Ga0075368_10014592 | |||
| 1187 | Ga0075368_10067103 | |||
| 1188 | Ga0075364_10040717 | |||
| 1189 | Ga0075362_10002462 | |||
| 1190 | Ga0075362_10018548 | |||
| 1191 | Ga0075362_10020327 | |||
| 1192 | Ga0075367_10031303 | |||
| 1193 | Ga0075367_10042274 | |||
| 1194 | Ga0075367_10124082 | |||
| 1195 | Ga0075366_10001452 | |||
| 1196 | Ga0075366_10006086 | |||
| 1197 | Ga0075366_10011562 | |||
| 1198 | Ga0075366_10029907 | |||
| 1199 | Ga0075366_10033364 | |||
| 1200 | Ga0075366_10061328 | |||
| 1201 | Ga0097621_100129536 | |||
| 1202 | Ga0097621_100226926 | |||
| 1203 | Ga0075370_10000620 | |||
| 1204 | Ga0075370_10010931 | |||
| 1205 | Ga0075370_10105034 | |||
| 1206 | Ga0075430_100008182 | |||
| 1207 | Ga0075429_100015843 | |||
| 1208 | Ga0068865_100210001 | |||
| 1209 | Ga0097620_100087729 | |||
| 1210 | Ga0097620_100287349 | |||
| 1211 | Ga0079104_1000012 | |||
| 1212 | Ga0079104_1000170 | |||
| 1213 | Ga0079104_1017203 | |||
| 1214 | Ga0079104_1025121 | |||
| 1215 | Ga0105251_10000298 | |||
| 1216 | Ga0105251_10000578 | |||
| 1217 | Ga0105244_10007870 | |||
| 1218 | Ga0105244_10092900 | |||
| 1219 | Ga0105250_10000214 | |||
| 1220 | Ga0105240_10000945 | |||
| 1221 | Ga0105240_10184155 | |||
| 1222 | Ga0105247_10106168 | |||
| 1223 | Ga0105243_10002148 | |||
| 1224 | Ga0105243_10008147 | |||
| 1225 | Ga0105243_10029092 | |||
| 1226 | Ga0105243_10066692 | |||
| 1227 | Ga0105243_10287379 | |||
| 1228 | Ga0105241_10180813 | |||
| 1229 | Ga0105248_10021617 | |||
| 1230 | Ga0105248_10093998 | |||
| 1231 | Ga0105237_10011900 | |||
| 1232 | Ga0105237_10045591 | |||
| 1233 | Ga0105237_10062346 | |||
| 1234 | Ga0105238_10030518 | |||
| 1235 | Ga0105238_10293595 | |||
| 1236 | Ga0105238_10434781 | |||
| 1237 | Ga0105239_10150700 | |||
| 1238 | Ga0157373_10064705 | |||
| 1239 | Ga0157371_10178122 | |||
| 1240 | Ga0157370_10000583 | |||
| 1241 | Ga0157370_10037869 | |||
| 1242 | Ga0157370_10070544 | |||
| 1243 | Ga0157369_10007613 | |||
| 1244 | Ga0157369_10026376 | |||
| 1245 | Ga0157374_10036523 | |||
| 1246 | Ga0157374_10039525 | |||
| 1247 | Ga0157374_10143374 | |||
| 1248 | Ga0157378_10235571 | |||
| 1249 | Ga0163162_10000817 | |||
| 1250 | Ga0163162_10061068 | |||
| 1251 | Ga0163162_10136950 | |||
| 1252 | Ga0157372_10070826 | |||
| 1253 | Ga0157375_10131913 | |||
| 1254 | Ga0163163_10110969 | |||
| 1255 | Ga0157380_10021561 | |||
| 1256 | Ga0157380_10307617 | |||
| 1257 | Ga0182008_10013567 | |||
| 1258 | Ga0182008_10033037 | |||
| 1259 | Ga0182008_10137599 | |||
| 1260 | Ga0157377_10000036 | |||
| 1261 | Ga0157377_10181049 | |||
| 1262 | Ga0157379_10072333 | |||
| 1263 | Ga0157379_10152287 | |||
| 1264 | Ga0157379_10153651 | |||
| 1265 | Ga0182006_1016005 | |||
| 1266 | Ga0182007_10001643 | |||
| 1267 | Ga0182007_10004201 | |||
| 1268 | Ga0163161_10000533 | |||
| 1269 | Ga0163161_10024309 | |||
| 1270 | Ga0163161_10182948 | |||
| 1271 | Ga0213872_10000023 | |||
| 1272 | Ga0213872_10000033 | |||
| 1273 | Ga0213872_10000226 | |||
| 1274 | Ga0213872_10001044 | |||
| 1275 | Ga0213872_10008848 | |||
| 1276 | Ga0213872_10021420 | |||
| 1277 | Ga0209435_100019 | |||
| 1278 | Ga0209674_100005 | |||
| 1279 | Ga0209674_100092 | |||
| 1280 | Ga0209672_100001 | |||
| 1281 | Ga0209672_100561 | |||
| 1282 | Ga0209147_100001 | |||
| 1283 | Ga0209563_100014 | |||
| 1284 | Ga0209563_103139 | |||
| 1285 | Ga0209258_100001 | |||
| 1286 | Ga0209258_100020 | |||
| 1287 | Ga0207425_1001908 | |||
| 1288 | Ga0207425_1004700 | |||
| 1289 | Ga0209646_1000038 | |||
| 1290 | Ga0209026_1000048 | |||
| 1291 | Ga0209677_100060 | |||
| 1292 | Ga0209148_1000003 | |||
| 1293 | Ga0209148_1000031 | |||
| 1294 | Ga0209759_1000038 | |||
| 1295 | Ga0209759_1000053 | |||
| 1296 | Ga0209759_1000342 | |||
| 1297 | Ga0209129_1000055 | |||
| 1298 | Ga0209129_1004101 | |||
| 1299 | Ga0209129_1004821 | |||
| 1300 | Ga0209129_1006445 | |||
| 1301 | Ga0209233_1000204 | |||
| 1302 | Ga0209565_1000041 | |||
| 1303 | Ga0209565_1000807 | |||
| 1304 | Ga0209565_1006087 | |||
| 1305 | Ga0209455_1000001 | |||
| 1306 | Ga0209673_1000009 | |||
| 1307 | Ga0209673_1001770 | |||
| 1308 | Ga0209130_1000835 | |||
| 1309 | Ga0209130_1000878 | |||
| 1310 | Ga0209130_1001181 | |||
| 1311 | Ga0209130_1001582 | |||
| 1312 | Ga0209130_1007797 | |||
| 1313 | Ga0209675_1000473 | |||
| 1314 | Ga0209675_1001263 | |||
| 1315 | Ga0209675_1003615 | |||
| 1316 | Ga0209675_1010614 | |||
| 1317 | Ga0209675_1011102 | |||
| 1318 | Ga0209675_1026810 | |||
| 1319 | Ga0209676_1000013 | |||
| 1320 | Ga0209676_1000040 | |||
| 1321 | Ga0209676_1000464 | |||
| 1322 | Ga0209676_1000578 | |||
| 1323 | Ga0209676_1003527 | |||
| 1324 | Ga0209676_1009942 | |||
| 1325 | Ga0209025_1000065 | |||
| 1326 | Ga0209025_1000359 | |||
| 1327 | Ga0209025_1000728 | |||
| 1328 | Ga0209025_1001383 | |||
| 1329 | Ga0209025_1007166 | |||
| 1330 | Ga0209025_1013780 | |||
| 1331 | Ga0209025_1014797 | |||
| 1332 | Ga0209025_1020655 | |||
| 1333 | Ga0209025_1060235 | |||
| 1334 | Ga0209564_1000101 | |||
| 1335 | Ga0209564_1000875 | |||
| 1336 | Ga0209564_1001904 | |||
| 1337 | Ga0209564_1011249 | |||
| 1338 | Ga0209564_1016536 | |||
| 1339 | Ga0209758_1000042 | |||
| 1340 | Ga0209758_1000268 | |||
| 1341 | Ga0209758_1003499 | |||
| 1342 | Ga0209758_1013492 | |||
| 1343 | Ga0209050_1000008 | |||
| 1344 | Ga0209050_1000021 | |||
| 1345 | Ga0209050_1003242 | |||
| 1346 | Ga0209050_1011817 | |||
| 1347 | Ga0209050_1020365 | |||
| 1348 | Ga0209256_1000003 | |||
| 1349 | Ga0209256_1000271 | |||
| 1350 | Ga0209256_1000454 | |||
| 1351 | Ga0209256_1001042 | |||
| 1352 | Ga0207426_1000091 | |||
| 1353 | Ga0207426_1000659 | |||
| 1354 | Ga0207426_1000842 | |||
| 1355 | Ga0207426_1001760 | |||
| 1356 | Ga0207426_1002540 | |||
| 1357 | Ga0209051_1000004 | |||
| 1358 | Ga0209051_1000005 | |||
| 1359 | Ga0209051_1000028 | |||
| 1360 | Ga0209051_1003347 | |||
| 1361 | Ga0209051_1008840 | |||
| 1362 | Ga0209257_1000016 | |||
| 1363 | Ga0209257_1000043 | |||
| 1364 | Ga0209257_1000048 | |||
| 1365 | Ga0209257_1000214 | |||
| 1366 | Ga0209257_1000360 | |||
| 1367 | Ga0209257_1002238 | |||
| 1368 | Ga0209257_1003715 | |||
| 1369 | Ga0209257_1008978 | |||
| 1370 | Ga0209257_1011767 | |||
| 1371 | Ga0209257_1012696 | |||
| 1372 | Ga0207655_1006752 | |||
| 1373 | Ga0207713_1000612 | |||
| 1374 | Ga0207713_1010327 | |||
| 1375 | Ga0207682_10008066 | |||
| 1376 | Ga0207688_10037909 | |||
| 1377 | Ga0207647_10010124 | |||
| 1378 | Ga0207647_10013609 | |||
| 1379 | Ga0207645_10007189 | |||
| 1380 | Ga0207645_10018118 | |||
| 1381 | Ga0207684_10007603 | |||
| 1382 | Ga0207654_10177945 | |||
| 1383 | Ga0207695_10234831 | |||
| 1384 | Ga0207695_10310227 | |||
| 1385 | Ga0207695_10327640 | |||
| 1386 | Ga0207695_10354934 | |||
| 1387 | Ga0207671_10039095 | |||
| 1388 | Ga0207660_10036283 | |||
| 1389 | Ga0207660_10156103 | |||
| 1390 | Ga0207657_10127588 | |||
| 1391 | Ga0207652_10013943 | |||
| 1392 | Ga0207652_10045417 | |||
| 1393 | Ga0207694_10064586 | |||
| 1394 | Ga0207650_10031814 | |||
| 1395 | Ga0207650_10136111 | |||
| 1396 | Ga0207650_10249170 | |||
| 1397 | Ga0207659_10198932 | |||
| 1398 | Ga0207659_10209311 | |||
| 1399 | Ga0207644_10005230 | |||
| 1400 | Ga0207644_10019445 | |||
| 1401 | Ga0207644_10279820 | |||
| 1402 | Ga0207690_10002461 | |||
| 1403 | Ga0207690_10130089 | |||
| 1404 | Ga0207706_10000266 | |||
| 1405 | Ga0207706_10088156 | |||
| 1406 | Ga0207706_10328171 | |||
| 1407 | Ga0207686_10016083 | |||
| 1408 | Ga0207709_10000141 | |||
| 1409 | Ga0207709_10000672 | |||
| 1410 | Ga0207709_10008115 | |||
| 1411 | Ga0207709_10022099 | |||
| 1412 | Ga0207709_10046956 | |||
| 1413 | Ga0207670_10236280 | |||
| 1414 | Ga0207669_10057605 | |||
| 1415 | Ga0207669_10075822 | |||
| 1416 | Ga0207669_10088495 | |||
| 1417 | Ga0207691_10013332 | |||
| 1418 | Ga0207691_10089596 | |||
| 1419 | Ga0207691_10092065 | |||
| 1420 | Ga0207711_10006876 | |||
| 1421 | Ga0207711_10020488 | |||
| 1422 | Ga0207711_10038203 | |||
| 1423 | Ga0207711_10058849 | |||
| 1424 | Ga0207711_10176227 | |||
| 1425 | Ga0207689_10001693 | |||
| 1426 | Ga0207689_10064878 | |||
| 1427 | Ga0207679_10003077 | |||
| 1428 | Ga0207667_10283623 | |||
| 1429 | Ga0207667_10378211 | |||
| 1430 | Ga0207651_10027934 | |||
| 1431 | Ga0207658_10024595 | |||
| 1432 | Ga0207658_10070699 | |||
| 1433 | Ga0207658_10086679 | |||
| 1434 | Ga0207658_10090122 | |||
| 1435 | Ga0207658_10110068 | |||
| 1436 | Ga0207658_10304857 | |||
| 1437 | Ga0207677_10001015 | |||
| 1438 | Ga0207677_10010554 | |||
| 1439 | Ga0207677_10195167 | |||
| 1440 | Ga0207703_10007781 | |||
| 1441 | Ga0207703_10022928 | |||
| 1442 | Ga0207703_10180344 | |||
| 1443 | Ga0207639_10024503 | |||
| 1444 | Ga0207678_10008575 | |||
| 1445 | Ga0207678_10030802 | |||
| 1446 | Ga0207678_10032552 | |||
| 1447 | Ga0207702_10023292 | |||
| 1448 | Ga0207641_10016767 | |||
| 1449 | Ga0207641_10188737 | |||
| 1450 | Ga0207648_10000037 | |||
| 1451 | Ga0207648_10041815 | |||
| 1452 | Ga0207648_10051645 | |||
| 1453 | Ga0207648_10134830 | |||
| 1454 | Ga0207648_10146040 | |||
| 1455 | Ga0207676_10005140 | |||
| 1456 | Ga0207676_10065709 | |||
| 1457 | Ga0207676_10111148 | |||
| 1458 | Ga0207676_10217743 | |||
| 1459 | Ga0207676_10243260 | |||
| 1460 | Ga0207674_10047037 | |||
| 1461 | Ga0207674_10184856 | |||
| 1462 | Ga0207674_10280324 | |||
| 1463 | Ga0207675_100002105 | |||
| 1464 | Ga0207675_100160176 | |||
| 1465 | Ga0207675_100217524 | |||
| 1466 | Ga0207675_100488154 | |||
| 1467 | Ga0207675_100528983 | |||
| 1468 | Ga0207683_10090382 | |||
| 1469 | Ga0207683_10126385 | |||
| 1470 | Ga0207683_10200916 | |||
| 1471 | Ga0207698_10169338 | |||
| 1472 | Ga0209281_1000039 | |||
| 1473 | Ga0209281_1000072 | |||
| 1474 | Ga0209969_1000798 | |||
| 1475 | Ga0209981_1007516 | |||
| 1476 | Ga0209996_1000695 | |||
| 1477 | Ga0209999_1006689 | |||
| 1478 | Ga0209282_1029830 | |||
| 1479 | Ga0209966_1000856 | |||
| 1480 | Ga0268266_10146010 | |||
| 1481 | Ga0268264_10028545 | |||
| 1482 | Ga0268264_10080924 | |||
| 1483 | Ga0268264_10247546 | |||
| 1484 | Ga0307517_10112060 | |||
| 1485 | Ga0307515_10000179 | |||
| 1486 | Ga0307515_10000586 | |||
| 1487 | Ga0307515_10017937 | |||
| 1488 | Ga0307515_10018687 | |||
| 1489 | Ga0307515_10039346 | |||
| 1490 | Ga0307515_10050608 | |||
| 1491 | Ga0307515_10092450 | |||
| 1492 | Ga0307515_10118376 | |||
| 1493 | Ga0307515_10128603 | |||
| 1494 | Ga0307515_10178772 | |||
| 1495 | Ga0307515_10185711 | |||
| 1496 | Ga0265338_10000113 | |||
| 1497 | Ga0307512_10056371 | |||
| 1498 | Ga0307512_10172530 | |||
| 1499 | Ga0265332_10053299 | |||
| 1500 | Ga0265328_10000002 | |||
| 1501 | Ga0265340_10066536 | |||
| 1502 | Ga0265331_10012849 | |||
| 1503 | Ga0265327_10000020 | |||
| 1504 | Ga0265327_10005210 | |||
| 1505 | Ga0307513_10000543 | |||
| 1506 | Ga0307513_10000653 | |||
| 1507 | Ga0307513_10034448 | |||
| 1508 | Ga0307513_10048415 | |||
| 1509 | Ga0307513_10108803 | |||
| 1510 | Ga0307509_10001648 | |||
| 1511 | Ga0307509_10004900 | |||
| 1512 | Ga0307509_10010962 | |||
| 1513 | Ga0307509_10167947 | |||
| 1514 | Ga0307408_100000073 | |||
| 1515 | Ga0307408_100002072 | |||
| 1516 | Ga0307408_100018250 | |||
| 1517 | Ga0307408_100048239 | |||
| 1518 | Ga0307408_100060229 | |||
| 1519 | Ga0307408_100145298 | |||
| 1520 | Ga0307508_10000649 | |||
| 1521 | Ga0307514_10000746 | |||
| 1522 | Ga0307514_10063798 | |||
| 1523 | Ga0307516_10004295 | |||
| 1524 | Ga0307516_10004304 | |||
| 1525 | Ga0307516_10006051 | |||
| 1526 | Ga0307516_10009811 | |||
| 1527 | Ga0307516_10021887 | |||
| 1528 | Ga0307516_10048733 | |||
| 1529 | Ga0307516_10055606 | |||
| 1530 | Ga0307516_10076649 | |||
| 1531 | Ga0307405_10138244 | |||
| 1532 | Ga0307406_10142822 | |||
| 1533 | Ga0307407_10002551 | |||
| 1534 | Ga0307412_10000014 | |||
| 1535 | Ga0307412_10045203 | |||
| 1536 | Ga0307412_10132804 | |||
| 1537 | Ga0307412_10216962 | |||
| 1538 | Ga0307409_100003515 | |||
| 1539 | Ga0307409_100004354 | |||
| 1540 | Ga0307416_100015237 | |||
| 1541 | Ga0307416_100149319 | |||
| 1542 | Ga0307414_10285708 | |||
| 1543 | Ga0307414_10349355 | |||
| 1544 | Ga0307411_10250012 | |||
| 1545 | Ga0307415_100015503 | |||
| 1546 | Ga0307507_10071231 | |||
| 1547 | Ga0307510_10003840 | |||
| 1548 | Ga0307510_10186159 | |||
| 1549 | Ga0373930_0015587 | |||
| 1550 | Ga0373950_0006176 | |||
| 1551 | Ga0373939_0000056 | |||
| 1552 | Ga0373946_0030925 | |||
| 1553 | Ga0373955_0028213 | |||
| 1554 | Ga0373924_0018195 | |||
| 1555 | Ga0373931_0004502 | |||
| 1556 | Ga0373931_0005160 | |||
| 1557 | Ga0373931_0042854 | |||
| 1558 | Ga0373933_0149166 | |||
| 1559 | Ga0373937_0043909 | |||
| 1560 | Ga0373925_0002961 | |||
| 1561 | Ga0395899_0006799 | |||
| 1562 | Ga0395899_0061653 | |||
| 1563 | Ga0395900_0001185 | |||
| 1564 | Ga0395900_0020073 | |||
| 1565 | Ga0395900_0101074 | |||
| 1566 | Ga0395900_0156275 | |||
| 1567 | Ga0395900_0343002 | |||
| 1568 | Ga0395898_0000792 | |||
| 1569 | Ga0395898_0000973 | |||
| 1570 | Ga0395898_0012269 | |||
| 1571 | Ga0395898_0022071 | |||
| 1572 | Ga0395898_0309972 | |||
| 1573 | Ga0395905_0000279 | |||
| 1574 | Ga0395905_0003420 | |||
| 1575 | Ga0395905_0004718 | |||
| 1576 | Ga0395905_0020785 | |||
| 1577 | Ga0395905_0026482 | |||
| 1578 | Ga0395905_0043858 | |||
| 1579 | Ga0395905_0056046 | |||
| 1580 | Ga0395905_0199413 | |||
| 1581 | Ga0395905_0406557 | |||
| 1582 | Ga0395901_0000034 | |||
| 1583 | Ga0395901_0000665 | |||
| 1584 | Ga0395901_0003064 | |||
| 1585 | Ga0395901_0035576 | |||
| 1586 | Ga0395901_0056313 | |||
| 1587 | Ga0395901_0073503 | |||
| 1588 | Ga0395901_0223637 | |||
| 1589 | Ga0436365_0034357 | |||
| 1590 | Ga0436361_0060434 | |||
| 1591 | Ga0436361_0096676 | |||
| 1592 | Ga0436361_0199744 | |||
| 1593 | Ga0436361_0247389 | |||
| 1594 | Ga0436361_0547369 | |||
| 1595 | Ga0436361_0678863 | |||
| 1596 | Ga0436361_1032254 | |||
| 1597 | Ga0436361_1216292 | |||
| 1598 | Ga0439466_0033666 | |||
| 1599 | Ga0451849_0172705 | |||
| 1600 | Ga0451853_3907472 | |||
| 1601 | Ga0439449_0009421 | |||
| 1602 | Ga0439449_0012852 | |||
| 1603 | Ga0450888_001409 | |||
| 1604 | Ga0450890_001891 | |||
| 1605 | Ga0450891_000764 | |||
| 1606 | Ga0450898_000843 | |||
| 1607 | Ga0450898_007899 | |||
| 1608 | Ga0450889_000232 | |||
| 1609 | Ga0439446_0039427 | |||
| 1610 | Ga0439446_0039946 | |||
| 1611 | Ga0439464_0010255 | |||
| 1612 | Ga0450918_000166 | |||
| 1613 | Ga0466969_0000021 | |||
| 1614 | Ga0466969_0018764 | |||
| 1615 | Ga0466969_0040275 | |||
| 1616 | Ga0466972_0000369 | |||
| 1617 | Ga0453683_0001471 | |||
| 1618 | Ga0466966_0017215 | |||
| 1619 | Ga0466961_0014114 | |||
| 1620 | Ga0466963_0018445 | |||
| 1621 | Ga0466964_0021473 | |||
| 1622 | Ga0453684_0074727 | |||
| 1623 | Ga0466971_0008465 | |||
| 1624 | Ga0466968_0035939 | |||
| 1625 | Ga0466970_0080436 | |||
| 1626 | Ga0466970_0091379 | |||
| 1627 | Ga0466957_0011664 | |||
| 1628 | Ga0466957_0088814 | |||
| 1629 | Ga0466960_0007907 | |||
| 1630 | Ga0466959_0000061 | |||
| 1631 | Ga0466959_0000469 | |||
| 1632 | Ga0466959_0074252 | |||
| 1633 | Ga0451576_0007077 | |||
| 1634 | Ga0466958_0067368 | |||
| 1635 | Ga0466967_0340785 | |||
| 1636 | Ga0495627_015304 | |||
| 1637 | Ga0495592_0000202 | |||
| 1638 | Ga0495592_0032830 | |||
| 1639 | Ga0495603_0000061 | |||
| 1640 | Ga0495603_0031531 | |||
| 1641 | Ga0495590_0002144 | |||
| 1642 | Ga0495590_0005540 | |||
| 1643 | Ga0495590_0011292 | |||
| 1644 | Ga0495590_0063850 | |||
| 1645 | Ga0495591_009123 | |||
| 1646 | Ga0495629_0001290 | |||
| 1647 | Ga0495629_0015864 | |||
| 1648 | Ga0495629_0018854 | |||
| 1649 | Ga0495638_0013011 | |||
| 1650 | Ga0495638_0016323 | |||
| 1651 | Ga0495638_0113878 | |||
| 1652 | Ga0495651_0043369 | |||
| 1653 | Ga0495651_0053440 | |||
| 1654 | Ga0495653_0002232 | |||
| 1655 | Ga0495653_0026176 | |||
| 1656 | Ga0495653_0162756 | |||
| 1657 | Ga0495650_0002229 | |||
| 1658 | Ga0495650_0011469 | |||
| 1659 | Ga0495650_0018003 | |||
| 1660 | Ga0495650_0030462 | |||
| 1661 | Ga0495650_0031593 | |||
| 1662 | Ga0495650_0045474 | |||
| 1663 | Ga0495580_0000075 | |||
| 1664 | Ga0495580_0000355 | |||
| 1665 | Ga0495580_0001997 | |||
| 1666 | Ga0495580_0012787 | |||
| 1667 | Ga0495580_0030785 | |||
| 1668 | Ga0495580_0032648 | |||
| 1669 | Ga0495580_0042162 | |||
| 1670 | Ga0495580_0106395 | |||
| 1671 | Ga0495582_0005669 | |||
| 1672 | Ga0495582_0017765 | |||
| 1673 | Ga0495582_0051825 | |||
| 1674 | Ga0495605_0028150 | |||
| 1675 | Ga0495605_0075258 | |||
| 1676 | Ga0495662_0059380 | |||
| 1677 | Ga0495662_0082641 | |||
| 1678 | Ga0495664_0000846 | |||
| 1679 | Ga0495664_0019967 | |||
| 1680 | Ga0495664_0020748 | |||
| 1681 | Ga0495664_0044914 | |||
| 1682 | Ga0495664_0080875 | |||
| 1683 | Ga0495664_0136046 | |||
| 1684 | Ga0495584_0018764 | |||
| 1685 | Ga0495596_0038280 | |||
| 1686 | Ga0495607_0072024 | |||
| 1687 | Ga0495583_0000470 | |||
| 1688 | Ga0495606_0026665 | |||
| 1689 | Ga0495606_0036127 | |||
| 1690 | Ga0495606_0061003 | |||
| 1691 | Ga0495608_0013295 | |||
| 1692 | Ga0495608_0027175 | |||
| 1693 | Ga0495610_0019484 | |||
| 1694 | Ga0495616_0001957 | |||
| 1695 | Ga0495618_0015758 | |||
| 1696 | Ga0495620_0011888 | |||
| 1697 | Ga0495628_0003215 | |||
| 1698 | Ga0495628_0005256 | |||
| 1699 | Ga0495628_0032735 | |||
| 1700 | Ga0495628_0062926 | |||
| 1701 | Ga0495630_0007675 | |||
| 1702 | Ga0495630_0015204 | |||
| 1703 | Ga0495631_0001674 | |||
| 1704 | Ga0495632_0019929 | |||
| 1705 | Ga0495637_0038887 | |||
| 1706 | Ga0495644_0051136 | |||
| 1707 | Ga0495648_0003206 | |||
| 1708 | Ga0495648_0021111 | |||
| 1709 | Ga0495648_0067028 | |||
| 1710 | Ga0495648_0120442 | |||
| 1711 | Ga0495666_0000352 | |||
| 1712 | Ga0495666_0006489 | |||
| 1713 | Ga0495666_0017082 | |||
| 1714 | Ga0495666_0036648 | |||
| 1715 | Ga0495642_0019286 | |||
| 1716 | Ga0495642_0027241 | |||
| 1717 | Ga0495652_0000989 | |||
| 1718 | Ga0495652_0053204 | |||
| 1719 | Ga0495652_0109225 | |||
| 1720 | Ga0495652_0144497 | |||
| 1721 | Ga0495654_0000313 | |||
| 1722 | Ga0495654_0029804 | |||
| 1723 | Ga0495654_0048656 | |||
| 1724 | Ga0495665_0001524 | |||
| 1725 | Ga0495665_0025108 | |||
| 1726 | Ga0495640_0057527 | |||
| 1727 | Ga0495586_0000331 | |||
| 1728 | Ga0495621_0049996 | |||
| 1729 | Ga0495597_0000324 | |||
| 1730 | Ga0495597_0003579 | |||
| 1731 | Ga0495597_0026975 | |||
| 1732 | Ga0495645_0001024 | |||
| 1733 | Ga0495645_0042991 | |||
| 1734 | Ga0495645_0047836 | |||
| 1735 | Ga0495645_0048319 | |||
| 1736 | Ga0495645_0058444 | |||
| 1737 | Ga0495645_0068506 | |||
| 1738 | Ga0495667_0060510 | |||
| 1739 | Ga0495634_0001775 | |||
| 1740 | Ga0495634_0009389 | |||
| 1741 | Ga0495634_0020262 | |||
| 1742 | Ga0495634_0026729 | |||
| 1743 | Ga0495634_0073505 | |||
| 1744 | Ga0495625_0003699 | |||
| 1745 | Ga0495625_0005064 | |||
| 1746 | Ga0495625_0025052 | |||
| 1747 | Ga0495635_0033976 | |||
| 1748 | Ga0495661_0015426 | |||
| 1749 | Ga0495588_0061469 | |||
| 1750 | Ga0495599_0001618 | |||
| 1751 | Ga0495599_0058871 | |||
| 1752 | Ga0495599_0072650 | |||
| 1753 | Ga0495599_0083127 | |||
| 1754 | Ga0495623_0017258 | |||
| 1755 | Ga0495623_0020002 | |||
| 1756 | Ga0495623_0020188 | |||
| 1757 | Ga0495646_0002604 | |||
| 1758 | Ga0495658_0046179 | |||
| 1759 | Ga0495669_0026207 | |||
| 1760 | Ga0495669_0097566 | |||
| 1761 | Ga0495613_0010110 | |||
| 1762 | Ga0495613_0102309 | |||
| 1763 | Ga0495624_0000363 | |||
| 1764 | Ga0495624_0003119 | |||
| 1765 | Ga0495624_0053935 | |||
| 1766 | Ga0495671_0009412 | |||
| 1767 | Ga0495671_0057883 | |||
| 1768 | Ga0495671_0081281 | |||
| 1769 | Ga0495671_0089492 | |||
| 1770 | Ga0495649_0000822 | |||
| 1771 | Ga0495649_0006905 | |||
| 1772 | Ga0495649_0052374 | |||
| 1773 | Ga0495589_0014850 | |||
| 1774 | Ga0495589_0044084 | |||
| 1775 | Ga0495600_0016905 | |||
| 1776 | Ga0495600_0140725 | |||
| 1777 | Ga0495660_0044360 | |||
| 1778 | Ga0495660_0045874 | |||
| 1779 | Ga0495660_0072937 | |||
| 1780 | Ga0495581_0003283 | |||
| 1781 | Ga0495581_0013366 | |||
| 1782 | Ga0495604_0011468 | |||
| 1783 | Ga0495604_0048049 | |||
| 1784 | Ga0495604_0058536 | |||
| 1785 | Ga0495636_0019618 | |||
| 1786 | Ga0495674_0001528 | |||
| 1787 | Ga0495674_0007431 | |||
| 1788 | Ga0495674_0263813 | |||
| 1789 | Ga0495672_0067805 | |||
| 1790 | Ga0495676_0046071 | |||
| 1791 | Ga0495676_0047219 | |||
| 1792 | Ga0495676_0056190 | |||
| 1793 | Ga0495676_0056442 | |||
| 1794 | Ga0495680_0001067 | |||
| 1795 | Ga0495680_0069956 | |||
| 1796 | Ga0495680_0108499 | |||
| 1797 | Ga0495680_0152553 | |||
| 1798 | Ga0495683_0000982 | |||
| 1799 | Ga0495683_0001226 | |||
| 1800 | Ga0495683_0026673 | |||
| 1801 | Ga0495683_0034431 | |||
| 1802 | Ga0495687_000011 | |||
| 1803 | Ga0495687_004295 | |||
| 1804 | Ga0495687_010847 | |||
| 1805 | Ga0495687_023976 | |||
| 1806 | Ga0495675_0003465 | |||
| 1807 | Ga0495675_0021774 | |||
| 1808 | Ga0495675_0033807 | |||
| 1809 | Ga0495675_0037275 | |||
| 1810 | Ga0495675_0127393 | |||
| 1811 | Ga0495679_004005 | |||
| 1812 | Ga0495679_013721 | |||
| 1813 | Ga0495673_0001480 | |||
| 1814 | Ga0495673_0023528 | |||
| 1815 | Ga0495684_0031937 | |||
| 1816 | Ga0495684_0033437 | |||
| 1817 | Ga0495684_0141904 | |||
| 1818 | Ga0495686_0000014 | |||
| 1819 | Ga0495686_0000951 | |||
| 1820 | Ga0495686_0003264 | |||
| 1821 | Ga0495686_0052381 | |||
| 1822 | Ga0495593_0008899 | |||
| 1823 | Ga0495593_0012509 | |||
| 1824 | Ga0495593_0054467 | |||
| 1825 | Ga0495593_0096547 | |||
| 1826 | Ga0495602_0000840 | |||
| 1827 | Ga0495602_0019126 | |||
| 1828 | Ga0495602_0051840 | |||
| 1829 | Ga0495602_0086976 | |||
| 1830 | Ga0495614_0000415 | |||
| 1831 | Ga0496100_0025511 | |||
| 1832 | Ga0496100_0097154 | |||
| 1833 | Ga0496101_0020204 | |||
| 1834 | Ga0496101_0039935 | |||
| 1835 | Ga0496101_0135901 | |||
| 1836 | Ga0496102_0002932 | |||
| 1837 | Ga0496102_0014445 | |||
| 1838 | Ga0496102_0036848 | |||
| 1839 | Ga0496102_0042312 | |||
| 1840 | Ga0496103_0003880 | |||
| 1841 | Ga0496103_0015711 | |||
| 1842 | Ga0496103_0056558 | |||
| 1843 | Ga0496103_0156163 | |||
| 1844 | Ga0496103_0214917 | |||
| 1845 | Ga0496104_0011855 | |||
| 1846 | Ga0496104_0126711 | |||
| 1847 | Ga0496105_0067134 | |||
| 1848 | Ga0496105_0076845 | |||
| 1849 | Ga0496106_0000031 | |||
| 1850 | Ga0496106_0027500 | |||
| 1851 | Ga0496106_0055318 | |||
| 1852 | Ga0496107_0044529 | |||
| 1853 | Ga0496107_0054459 | |||
| 1854 | Ga0496107_0063931 | |||
| 1855 | Ga0496109_0247860 | |||
| 1856 | Ga0496110_0010964 | |||
| 1857 | Ga0496110_0105996 | |||
| 1858 | Ga0496111_0020171 | |||
| 1859 | Ga0496112_0012551 | |||
| 1860 | Ga0496112_0134973 | |||
| 1861 | Ga0496113_0027379 | |||
| 1862 | Ga0496113_0087884 | |||
| 1863 | Ga0496114_0001956 | |||
| 1864 | Ga0496114_0039800 | |||
| 1865 | Ga0496114_0310684 | |||
| 1866 | Ga0496115_0060206 | |||
| 1867 | Ga0496116_0018304 | |||
| 1868 | Ga0496116_0041241 | |||
| 1869 | Ga0496116_0062584 | |||
| 1870 | Ga0496117_0003214 | |||
| 1871 | Ga0496117_0021232 | |||
| 1872 | Ga0496117_0022484 | |||
| 1873 | Ga0496117_0025830 | |||
| 1874 | Ga0496117_0066755 | |||
| 1875 | Ga0496117_0102829 | |||
| 1876 | Ga0496117_0120039 | |||
| 1877 | Ga0496117_0124770 | |||
| 1878 | Ga0496118_0000282 | |||
| 1879 | Ga0496118_0020881 | |||
| 1880 | Ga0496118_0061068 | |||
| 1881 | Ga0496118_0087064 | |||
| 1882 | Ga0496119_0129341 | |||
| 1883 | Ga0496121_0000166 | |||
| 1884 | Ga0496121_0000978 | |||
| 1885 | Ga0496121_0005335 | |||
| 1886 | Ga0496121_0021965 | |||
| 1887 | Ga0496121_0032610 | |||
| 1888 | Ga0496121_0039151 | |||
| 1889 | Ga0496121_0078972 | |||
| 1890 | Ga0496121_0247476 | |||
| 1891 | Ga0496122_0000080 | |||
| 1892 | Ga0496122_0154867 | |||
| 1893 | Ga0496123_0000072 | |||
| 1894 | Ga0496123_0056457 | |||
| 1895 | Ga0496123_0133206 | |||
| 1896 | Ga0496124_0000388 | |||
| 1897 | Ga0496124_0003175 | |||
| 1898 | Ga0496124_0057750 | |||
| 1899 | Ga0496124_0091590 | |||
| 1900 | Ga0496124_0140919 | |||
| 1901 | Ga0496125_0007888 | |||
| 1902 | Ga0496125_0013117 | |||
| 1903 | Ga0496125_0044880 | |||
| 1904 | Ga0496125_0182520 | |||
| 1905 | Ga0496126_0002411 | |||
| 1906 | Ga0496126_0003835 | |||
| 1907 | Ga0496126_0006864 | |||
| 1908 | Ga0496126_0177709 | |||
| 1909 | Ga0495682_0001086 | |||
| 1910 | Ga0495682_0003755 | |||
| 1911 | Ga0501294_002318 | |||
| 1912 | Ga0501032_0025224 | |||
| 1913 | Ga0501038_0025134 | |||
| 1914 | Ga0501043_0000012 | |||
| 1915 | Ga0501046_0000030 | |||
| 1916 | Ga0501047_0001222 | |||
| 1917 | Ga0501069_0057421 | |||
| 1918 | Ga0501070_0012507 | |||
| 1919 | Ga0501074_0013990 | |||
| 1920 | Ga0501198_000003 | |||
| 1921 | Ga0501222_000014 | |||
| 1922 | Ga0501223_005994 | |||
| 1923 | Ga0501265_000615 | |||
| 1924 | Ga0501266_001410 | |||
| 1925 | Ga0501035_0072640 | |||
| 1926 | Ga0501045_0031337 | |||
| 1927 | nmdc:mga00v17_20131_c1 | |||
| 1928 | nmdc:mga00v17_31607_c1 | |||
| 1929 | nmdc:mga0yw44_19466_c1 | |||
| 1930 | nmdc:mga0k408_177875_c1 | |||
| 1931 | nmdc:mga0k408_18366_c1 | |||
| 1932 | nmdc:mga0k408_2047_c1 | |||
| 1933 | nmdc:mga0k408_54783_c1 | |||
| 1934 | nmdc:mga0k408_7277_c1 | |||
| 1935 | nmdc:mga0k408_72968_c1 | |||
| 1936 | nmdc:mga0k408_91249_c1 | |||
| 1937 | nmdc:mga07m45_14324_c1 | |||
| 1938 | nmdc:mga07m45_22816_c1 | |||
| 1939 | nmdc:mga07m45_32984_c1 | |||
| 1940 | nmdc:mga07m45_42024_c1 | |||
| 1941 | nmdc:mga05p37_523886_c1 | |||
| 1942 | Ga0495619_0157217 | |||
| 1943 | Ga0500646_0009218 | |||
| 1944 | Ga0500651_0000420 | |||
| 1945 | Ga0500571_000013 | |||
| 1946 | Ga0500593_007015 | |||
| 1947 | Ga0500594_0000195 | |||
| 1948 | Ga0500597_021317 | |||
| 1949 | Ga0500607_012134 | |||
| 1950 | Ga0500608_008747 | |||
| 1951 | Ga0500655_001318 | |||
| 1952 | Ga0500658_0000012 | |||
| 1953 | Ga0500658_0000799 | |||
| 1954 | Ga0500658_0002681 | |||
| 1955 | Ga0500658_0035960 | |||
| 1956 | Ga0500559_0002514 | |||
| 1957 | Ga0500559_0036011 | |||
| 1958 | Ga0500568_0001449 | |||
| 1959 | Ga0500573_0012096 | |||
| 1960 | Ga0500616_0034450 | |||
| 1961 | Ga0500636_0059561 | |||
| 1962 | Ga0500645_000061 | |||
| 1963 | Ga0500645_011337 | |||
| 1964 | Ga0500645_022110 | |||
| 1965 | Ga0590071_002714 | |||
| 1966 | Ga0466962_0018907 | |||
| 1967 | 2501413779 | |||
| 1968 | 2509129341 | |||
| 1969 | 2511094952 | |||
| 1970 | 2511104611 | |||
| 1971 | 2511245322 | |||
| 1972 | 2513226765 | |||
| 1973 | 2513551527 | |||
| 1974 | 2513560177 | |||
| 1975 | 2513962505 | |||
| 1976 | 2515679466 | |||
| 1977 | 2516016934 | |||
| 1978 | 2527079095 | |||
| 1979 | 2587757756 | |||
| 1980 | 2599622234 | |||
| 1981 | 2599676943 | |||
| 1982 | 2599680359 | |||
| 1983 | 2599692375 | |||
| 1984 | 2600813634 | |||
| 1985 | 2643741685 | |||
| 1986 | 2643934954 | |||
| 1987 | 2644058381 | |||
| 1988 | 2644073432 | |||
| 1989 | 2644220470 | |||
| 1990 | 2644246692 | |||
| 1991 | 2644259394 | |||
| 1992 | 2644303826 | |||
| 1993 | 2644316441 | |||
| 1994 | 2644326423 | |||
| 1995 | 2644469538 | |||
| 1996 | 2722881162 | |||
| 1997 | 2738719474 | |||
| 1998 | 2738723664 | |||
| 1999 | 2738820161 | |||
| 2000 | 2738832641 | |||
| 2001 | 2738874168 | |||
| 2002 | 2738884529 | |||
| 2003 | 2739053629 | |||
| 2004 | 2739185798 | |||
| 2005 | 2739220766 | |||
| 2006 | 2739247015 | |||
| 2007 | 2739283704 | |||
| 2008 | 2739284395 | |||
| 2009 | 2746091747 | |||
| 2010 | 2746093867 | |||
| 2011 | 2746095357 | |||
| 2012 | 2753565827 | |||
| 2013 | 2816469705 | |||
| 2014 | 2819598972 | |||
| 2015 | 2819620826 | |||
| 2016 | 2831270758 | |||
| 2017 | 2838058806 | |||
| 2018 | 2839141103 | |||
| 2019 | 2842462087 | |||
| 2020 | 2842720633 | |||
| 2021 | 2842738607 | |||
| 2022 | 2842750027 | |||
| 2023 | 2857366482 | |||
| 2024 | 2883094692 | |||
| 2025 | 2885202471 | |||
| 2026 | 2885216124 | |||
| 2027 | 2899929792 | |||
| 2028 | 2900636288 | |||
| 2029 | 2902689253 | |||
| 2030 | 2928042267 | |||
| 2031 | 2928050036 | |||
| 2032 | 2928054617 | |||
| 2033 | 2928070204 | |||
| 2034 | 2928074133 | |||
| 2035 | 2928086393 | |||
| 2036 | 2928109626 | |||
| 2037 | 2928118897 | |||
| 2038 | 2928136920 | |||
| 2039 | 2928506448 | |||
| 2040 | 2929160834 | |||
| 2041 | 2929162304 | |||
| 2042 | 2929168459 | |||
| 2043 | 2939634357 | |||
| 2044 | 2945915669 | |||
| 2045 | 2945935378 | |||
| 2046 | 2945950327 | |||
| 2047 | 2945988898 | |||
| 2048 | 2974321788 | |||
| 2049 | 2990704071 | |||
| 2050 | 642422228 | |||
| 2051 | 642425835 | |||
| 2052 | 642620255 | |||
| 2053 | 8003957444 | |||
| 2054 | 8020953811 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dio-assembly1.cif.gz_B | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.9842 | 1 | 368 |
| 4dio-assembly1.cif.gz_A | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.9758 | 1 | 369 |
| 4dio-assembly1.cif.gz_A | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.973 | 1 | 369 |
| 1u2g-assembly1.cif.gz_A | transhydrogenase (di.adpr)2(diii.nadph)1 asymmetric complex | 0.9667 | 1 | 372 |
| 4dio-assembly1.cif.gz_B | the crystal structure of transhydrogenase from sinorhizobium meliloti | 0.9666 | 1 | 368 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8Q9E6_8_146_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9637 | 4 | 134 | 3.40.50.720 |
| 3p2yA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.961 | 1 | 134 | 3.40.50.720 |
| af_Q2FYJ2_1_126_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9596 | 1 | 115 | 3.40.50.720 |
| 1l7dA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9588 | 1 | 134 | 3.40.50.720 |
| af_Q2FXL7_2_109_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9573 | 3 | 104 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q5VLK0-F1-model_v4 | deleted | 1.004 | 1 | 87 |
|
| AF-A0A7Y1UXS1-F1-model_v4 | NAD(P)(+) transhydrogenase (Re/Si-specific) subunit alpha | 0.9995 | 2 | 69 |
GO:0000286
GO:0005886 GO:0006524 |
| AF-A0A848FDY0-F1-model_v4 | proton-translocating NAD(P)(+) transhydrogenase (EC 7.1.1.1) | 0.9987 | 1 | 122 |
GO:0005886
GO:0006740 GO:0050661 |
| AF-A0A3M3A4S3-F1-model_v4 | Alanine dehydrogenase/pyridine nucleotide transhydrogenase N-terminal domain-containing protein | 0.9984 | 1 | 91 |
GO:0000286
GO:0005886 GO:0006524 |
| AF-A0A4Q7GWA0-F1-model_v4 | deleted | 0.9979 | 1 | 113 |
|