F488550

General Info

Members Datasets Scaffolds Average Seq Length
1028 418 2056 242

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10049712|Ga0075364_100497125
Length 278
Sequence VPNTGKPRKDGFKTAVAAITLDLMVESLFSGFADISLPELILIGAMALVASVVGGVAGYGTGALMPLVLVPIVGAEPVVPILSLSALFTNSSRTAAFLPLVDWRRAAIVLVAAVPTCALGAWGYTMLTGTGAALVIGTMLIASVPLRRLMRRRGLVLSHRGLAAAAFAWGPLAGGTVGAGIILLSLLMAAGLEGAAVVATDAVVSIGIGLTKLLTFGLAGAVTAKVIAVALLIGGIAFPGAFFAKAMINRLPVHVHTVILDAVVAGGGAMMIVNAFAR

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
126 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
142 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
220 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
221 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
224 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
225 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
226 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
227 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
228 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
229 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
230 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
231 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
232 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
235 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
240 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
244 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
250 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
251 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
252 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
253 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
266 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
269 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
270 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
287 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
288 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
289 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
316 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
317 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
332 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
356 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
372 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
373 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
376 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
377 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
378 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
379 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
395 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
403 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
404 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
405 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
406 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
407 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
408 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
409 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
410 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
411 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
412 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
413 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
414 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
415 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
416 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
417 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
418 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 0
Rhizoplane 9.05
Rhizosphere 85.6
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10049712 3300006051 Bacteria 2735
2 JGI24752J21851_1009665 3300001976 Bacteria 1258
3 JGI24746J21847_1000660 3300001977 Bacteria 5285
4 JGI24739J22299_10005070 3300001989 Bacteria 5015
5 JGI24737J22298_10001725 3300001990 Bacteria 7790
6 JGI24738J21930_10014991 3300002075 Bacteria 1654
7 JGI24035J26624_1000749 3300002126 Bacteria 3043
8 JGI24742J22300_10000548 3300002244 Bacteria 5621
9 JGI24742J22300_10020073 3300002244 Bacteria 1137
10 JGI25406J46586_10006738 3300003203 Bacteria 5279
11 JGI25153J46596_10011635 3300003215 Bacteria 3870
12 JGI25404J52841_10005908 3300003659 Bacteria 2540
13 JGI25405J52794_10002353 3300003911 Bacteria 3245
14 Ga0065165_1001015 3300005262 Bacteria 34129
15 Ga0070658_10073615 3300005327 Bacteria 2801
16 Ga0070658_10181552 3300005327 Bacteria 1771
17 Ga0070658_10442188 3300005327 Bacteria 1120
18 Ga0070676_10004291 3300005328 Bacteria 7488
19 Ga0070683_100004677 3300005329 Bacteria 11310
20 Ga0070683_100149328 3300005329 Bacteria 2215
21 Ga0070683_100164431 3300005329 Bacteria 2105
22 Ga0070690_100008757 3300005330 Bacteria 5842
23 Ga0070690_100092134 3300005330 Bacteria 1998
24 Ga0070690_100103615 3300005330 Bacteria 1889
25 Ga0070670_100004378 3300005331 Bacteria 11820
26 Ga0070670_100016298 3300005331 Bacteria 6382
27 Ga0070670_100048139 3300005331 Bacteria 3668
28 Ga0068869_100000546 3300005334 Bacteria 21018
29 Ga0068869_100063996 3300005334 Bacteria 2704
30 Ga0070680_100035104 3300005336 Bacteria 4047
31 Ga0070680_100043638 3300005336 Bacteria 3642
32 Ga0070680_100070863 3300005336 Bacteria 2864
33 Ga0070680_100099086 3300005336 Bacteria 2418
34 Ga0070680_100442230 3300005336 Bacteria 1110
35 Ga0070680_100541981 3300005336 Bacteria 997
36 Ga0070682_100003445 3300005337 Bacteria 8766
37 Ga0070682_100110716 3300005337 Bacteria 1829
38 Ga0068868_100012769 3300005338 Bacteria 6144
39 Ga0068868_100209747 3300005338 Bacteria 1627
40 Ga0070660_100006773 3300005339 Bacteria 7953
41 Ga0070660_100036099 3300005339 Bacteria 3743
42 Ga0070660_100039013 3300005339 Bacteria 3609
43 Ga0070660_100217924 3300005339 Bacteria 1551
44 Ga0070689_100002392 3300005340 Bacteria 12238
45 Ga0070689_100023289 3300005340 Bacteria 4634
46 Ga0070689_100054606 3300005340 Bacteria 3093
47 Ga0070691_10003723 3300005341 Bacteria 6886
48 Ga0070691_10094042 3300005341 Bacteria 1481
49 Ga0070687_100001017 3300005343 Bacteria 9561
50 Ga0070661_100004096 3300005344 Bacteria 10046
51 Ga0070661_100191351 3300005344 Bacteria 1560
52 Ga0070692_10004423 3300005345 Bacteria 5871
53 Ga0070668_100008178 3300005347 Bacteria 7768
54 Ga0070668_100047207 3300005347 Bacteria 3310
55 Ga0070668_100497346 3300005347 Bacteria 1055
56 Ga0070669_100009976 3300005353 Bacteria 6754
57 Ga0070675_100010473 3300005354 Bacteria 7243
58 Ga0070671_100033814 3300005355 Bacteria 4230
59 Ga0070671_100076769 3300005355 Bacteria 2791
60 Ga0070674_100027012 3300005356 Bacteria 3757
61 Ga0070674_100088015 3300005356 Bacteria 2234
62 Ga0070673_100000050 3300005364 Bacteria 49499
63 Ga0070673_100057192 3300005364 Bacteria 3081
64 Ga0070688_100000781 3300005365 Bacteria 15764
65 Ga0070688_100005154 3300005365 Bacteria 6855
66 Ga0070659_100036287 3300005366 Bacteria 3842
67 Ga0070659_100336097 3300005366 Bacteria 1265
68 Ga0070667_100007711 3300005367 Bacteria 8923
69 Ga0070667_100114407 3300005367 Bacteria 2342
70 Ga0070667_100266149 3300005367 Bacteria 1536
71 Ga0070703_10029323 3300005406 Unclassified 1651
72 Ga0070709_10002579 3300005434 Bacteria 9800
73 Ga0070709_10015376 3300005434 Bacteria 4353
74 Ga0070709_10117887 3300005434 Bacteria 1795
75 Ga0070714_100006031 3300005435 Bacteria 9304
76 Ga0070714_100058980 3300005435 Bacteria 3290
77 Ga0070714_100263447 3300005435 Bacteria 1597
78 Ga0070713_100017576 3300005436 Bacteria 5412
79 Ga0070713_100055547 3300005436 Bacteria 3291
80 Ga0070713_100056884 3300005436 Bacteria 3254
81 Ga0070713_100243471 3300005436 Bacteria 1638
82 Ga0070710_10003313 3300005437 Bacteria 7639
83 Ga0070710_10021794 3300005437 Bacteria 3344
84 Ga0070710_10092281 3300005437 Bacteria 1788
85 Ga0070710_10153247 3300005437 Bacteria 1423
86 Ga0070701_10002148 3300005438 Bacteria 7507
87 Ga0070701_10437087 3300005438 Bacteria 837
88 Ga0070711_100022517 3300005439 Bacteria 4085
89 Ga0070711_100024455 3300005439 Bacteria 3939
90 Ga0070711_100027086 3300005439 Bacteria 3761
91 Ga0070705_100003118 3300005440 Bacteria 8153
92 Ga0070700_100002692 3300005441 Bacteria 9079
93 Ga0070694_100005972 3300005444 Bacteria 7383
94 Ga0070708_100269960 3300005445 Bacteria 1600
95 Ga0070663_100019695 3300005455 Bacteria 4455
96 Ga0070663_100044767 3300005455 Bacteria 3123
97 Ga0070663_100087995 3300005455 Bacteria 2296
98 Ga0070663_100272077 3300005455 Unclassified 1347
99 Ga0070663_100486178 3300005455 Unclassified 1023
100 Ga0070678_100000518 3300005456 Bacteria 18676
101 Ga0070678_100022233 3300005456 Bacteria 4197
102 Ga0070678_100055812 3300005456 Bacteria 2886
103 Ga0070678_100261512 3300005456 Bacteria 1456
104 Ga0070678_100429698 3300005456 Bacteria 1153
105 Ga0070662_100207506 3300005457 Bacteria 1557
106 Ga0070681_10011624 3300005458 Bacteria 8716
107 Ga0070681_10027987 3300005458 Bacteria 5666
108 Ga0070681_10196314 3300005458 Bacteria 1937
109 Ga0070681_10552107 3300005458 Bacteria 1066
110 Ga0068867_100084087 3300005459 Bacteria 2403
111 Ga0070685_10003674 3300005466 Bacteria 7777
112 Ga0070685_10014330 3300005466 Bacteria 4198
113 Ga0070707_100135839 3300005468 Bacteria 2392
114 Ga0070699_100010972 3300005518 Bacteria 7834
115 Ga0070679_100004048 3300005530 Bacteria 13502
116 Ga0070679_100007667 3300005530 Bacteria 10102
117 Ga0070679_100038301 3300005530 Bacteria 4766
118 Ga0070679_100103442 3300005530 Bacteria 2834
119 Ga0070679_100157769 3300005530 Bacteria 2243
120 Ga0070684_100004205 3300005535 Bacteria 10907
121 Ga0070697_100245505 3300005536 Bacteria 1530
122 Ga0070697_100652942 3300005536 Bacteria 926
123 Ga0068853_100042900 3300005539 Bacteria 3869
124 Ga0068853_100718527 3300005539 Bacteria 954
125 Ga0070672_100000643 3300005543 Bacteria 20456
126 Ga0070686_100081135 3300005544 Bacteria 2147
127 Ga0070695_100127165 3300005545 Bacteria 1751
128 Ga0070696_100147295 3300005546 Bacteria 1725
129 Ga0070693_100010080 3300005547 Bacteria 4718
130 Ga0070693_100015464 3300005547 Bacteria 3930
131 Ga0070665_100004366 3300005548 Bacteria 14875
132 Ga0070665_100098694 3300005548 Bacteria 2925
133 Ga0070665_100107354 3300005548 Bacteria 2794
134 Ga0070665_100205970 3300005548 Bacteria 1968
135 Ga0070704_100007534 3300005549 Bacteria 6481
136 Ga0068855_100035984 3300005563 Bacteria 5895
137 Ga0068855_100263615 3300005563 Bacteria 1919
138 Ga0070664_100045869 3300005564 Bacteria 3691
139 Ga0070664_100061029 3300005564 Bacteria 3212
140 Ga0070664_100273849 3300005564 Bacteria 1521
141 Ga0068857_100001038 3300005577 Bacteria 21487
142 Ga0068857_100193234 3300005577 Bacteria 1854
143 Ga0068854_100154785 3300005578 Bacteria 1770
144 Ga0068856_100009104 3300005614 Bacteria 9654
145 Ga0068856_100216401 3300005614 Bacteria 1931
146 Ga0068856_100705853 3300005614 Bacteria 1029
147 Ga0070702_100003907 3300005615 Bacteria 6754
148 Ga0070702_100045550 3300005615 Bacteria 2482
149 Ga0070702_100280699 3300005615 Bacteria 1143
150 Ga0068852_100024049 3300005616 Bacteria 4916
151 Ga0068852_100342276 3300005616 Bacteria 1458
152 Ga0068859_100125159 3300005617 Bacteria 2639
153 Ga0068859_100337060 3300005617 Bacteria 1602
154 Ga0068859_100582430 3300005617 Bacteria 1212
155 Ga0068859_101001040 3300005617 Bacteria 918
156 Ga0068864_100001882 3300005618 Bacteria 17235
157 Ga0068864_100227008 3300005618 Bacteria 1725
158 Ga0068864_100237471 3300005618 Bacteria 1688
159 Ga0068866_10000791 3300005718 Bacteria 14174
160 Ga0068866_10028400 3300005718 Bacteria 2665
161 Ga0068861_100002491 3300005719 Bacteria 12008
162 Ga0068870_10001431 3300005840 Bacteria 9645
163 Ga0068870_10026649 3300005840 Bacteria 2883
164 Ga0068863_100031598 3300005841 Bacteria 5051
165 Ga0068863_100097902 3300005841 Bacteria 2786
166 Ga0068863_100155588 3300005841 Bacteria 2189
167 Ga0068858_100028785 3300005842 Bacteria 5159
168 Ga0068858_100050653 3300005842 Bacteria 3843
169 Ga0068858_100131690 3300005842 Bacteria 2345
170 Ga0068860_100002530 3300005843 Bacteria 19153
171 Ga0068860_100213517 3300005843 Bacteria 1872
172 Ga0068860_100380951 3300005843 Bacteria 1392
173 Ga0068862_100011700 3300005844 Bacteria 7241
174 Ga0081455_10000081 3300005937 Bacteria 103752
175 Ga0081455_10016554 3300005937 Bacteria 7113
176 Ga0081455_10034433 3300005937 Bacteria 4537
177 Ga0081455_10049916 3300005937 Bacteria 3603
178 Ga0081455_10082000 3300005937 Bacteria 2639
179 Ga0081455_10138580 3300005937 Bacteria 1892
180 Ga0081538_10108327 3300005981 Bacteria 1372
181 Ga0081540_1000027 3300005983 Bacteria 151880
182 Ga0081540_1003265 3300005983 Bacteria 12889
183 Ga0081540_1025762 3300005983 Bacteria 3375
184 Ga0081539_10001260 3300005985 Bacteria 44845
185 Ga0081539_10029936 3300005985 Bacteria 3390
186 Ga0070717_10000485 3300006028 Bacteria 25249
187 Ga0070717_10000980 3300006028 Bacteria 19102
188 Ga0070717_10494912 3300006028 Bacteria 1104
189 Ga0075365_10001829 3300006038 Bacteria 9956
190 Ga0075365_10001918 3300006038 Bacteria 9807
191 Ga0075365_10018393 3300006038 Bacteria 4295
192 Ga0075365_10238853 3300006038 Bacteria 1276
193 Ga0075368_10023549 3300006042 Bacteria 2353
194 Ga0075363_100067153 3300006048 Bacteria 1942
195 Ga0075364_10010606 3300006051 Bacteria 5573
196 Ga0070715_10000289 3300006163 Bacteria 12366
197 Ga0070715_10001137 3300006163 Bacteria 7597
198 Ga0070716_100004371 3300006173 Bacteria 6749
199 Ga0070716_100085838 3300006173 Bacteria 1892
200 Ga0070712_100000210 3300006175 Bacteria 32927
201 Ga0070712_100000381 3300006175 Bacteria 25274
202 Ga0070712_100003511 3300006175 Bacteria 9649
203 Ga0075362_10004834 3300006177 Bacteria 4866
204 Ga0075367_10049089 3300006178 Bacteria 2487
205 Ga0075367_10087502 3300006178 Bacteria 1892
206 Ga0075366_10075432 3300006195 Bacteria 2012
207 Ga0075366_10316823 3300006195 Unclassified 955
208 Ga0097621_100001425 3300006237 Bacteria 16408
209 Ga0097621_100002618 3300006237 Bacteria 12322
210 Ga0097621_100070217 3300006237 Bacteria 2892
211 Ga0075370_10076893 3300006353 Bacteria 1915
212 Ga0068871_100006790 3300006358 Bacteria 8135
213 Ga0068871_100016863 3300006358 Bacteria 5513
214 Ga0068871_100124129 3300006358 Bacteria 2184
215 Ga0068871_100731276 3300006358 Bacteria 908
216 Ga0075428_100015591 3300006844 Bacteria 8426
217 Ga0075428_100500760 3300006844 Bacteria 1300
218 Ga0075428_100557035 3300006844 Bacteria 1225
219 Ga0075428_100863425 3300006844 Bacteria 961
220 Ga0075430_100099742 3300006846 Bacteria 2425
221 Ga0075430_100196520 3300006846 Bacteria 1676
222 Ga0075431_100067535 3300006847 Bacteria 3691
223 Ga0075431_100079885 3300006847 Bacteria 3376
224 Ga0075431_100441514 3300006847 Bacteria 1298
225 Ga0075433_10109293 3300006852 Bacteria 2453
226 Ga0075433_10199409 3300006852 Bacteria 1780
227 Ga0075434_100004560 3300006871 Bacteria 12511
228 Ga0075434_100031153 3300006871 Bacteria 5256
229 Ga0075434_100035379 3300006871 Bacteria 4938
230 Ga0075434_100043586 3300006871 Bacteria 4450
231 Ga0075434_100052243 3300006871 Bacteria 4060
232 Ga0075434_100053877 3300006871 Bacteria 3996
233 Ga0075434_100083203 3300006871 Bacteria 3198
234 Ga0075434_100132457 3300006871 Bacteria 2512
235 Ga0075434_100188580 3300006871 Bacteria 2082
236 Ga0075434_100383708 3300006871 Bacteria 1426
237 Ga0075429_100058070 3300006880 Bacteria 3370
238 Ga0068865_100001097 3300006881 Bacteria 15622
239 Ga0068865_100078168 3300006881 Bacteria 2366
240 Ga0068865_100411765 3300006881 Bacteria 1109
241 Ga0075436_100008403 3300006914 Bacteria 7059
242 Ga0075436_100334795 3300006914 Bacteria 1089
243 Ga0097620_100125151 3300006931 Bacteria 2639
244 Ga0097620_100337073 3300006931 Bacteria 1602
245 Ga0097620_100582456 3300006931 Bacteria 1212
246 Ga0097620_101000998 3300006931 Bacteria 918
247 Ga0075435_100014832 3300007076 Bacteria 5841
248 Ga0075435_100054758 3300007076 Bacteria 3220
249 Ga0075435_100134421 3300007076 Bacteria 2071
250 Ga0075435_100251387 3300007076 Bacteria 1505
251 Ga0075435_100518526 3300007076 Bacteria 1031
252 Ga0099795_10021163 3300007788 Bacteria 2129
253 Ga0105240_10067050 3300009093 Bacteria 4450
254 Ga0105240_10135711 3300009093 Bacteria 2947
255 Ga0111539_10011548 3300009094 Bacteria 11084
256 Ga0111539_10026539 3300009094 Bacteria 7080
257 Ga0111539_10050713 3300009094 Bacteria 4944
258 Ga0111539_10196327 3300009094 Bacteria 2354
259 Ga0111539_10203357 3300009094 Bacteria 2309
260 Ga0105245_10004787 3300009098 Bacteria 11946
261 Ga0105245_10197564 3300009098 Bacteria 1930
262 Ga0105245_10319031 3300009098 Bacteria 1530
263 Ga0105247_10003270 3300009101 Bacteria 10626
264 Ga0105247_10018149 3300009101 Bacteria 4219
265 Ga0105247_10024753 3300009101 Bacteria 3619
266 Ga0105247_10141527 3300009101 Unclassified 1577
267 Ga0105247_10378015 3300009101 Bacteria 1003
268 Ga0114129_10001669 3300009147 Bacteria 30222
269 Ga0114129_10006740 3300009147 Bacteria 16309
270 Ga0114129_10024067 3300009147 Bacteria 8629
271 Ga0114129_10035205 3300009147 Bacteria 7074
272 Ga0114129_10166040 3300009147 Bacteria 3012
273 Ga0114129_10309068 3300009147 Bacteria 2105
274 Ga0114129_10510661 3300009147 Bacteria 1568
275 Ga0114129_10542927 3300009147 Bacteria 1513
276 Ga0105243_10002400 3300009148 Bacteria 15707
277 Ga0105243_10004402 3300009148 Bacteria 11139
278 Ga0105243_10088625 3300009148 Bacteria 2542
279 Ga0105241_10008636 3300009174 Bacteria 7488
280 Ga0105241_10012784 3300009174 Bacteria 6160
281 Ga0105241_10470102 3300009174 Bacteria 1116
282 Ga0105242_10007578 3300009176 Bacteria 8356
283 Ga0105242_10023432 3300009176 Bacteria 4864
284 Ga0105242_10156399 3300009176 Bacteria 1992
285 Ga0105248_10010839 3300009177 Bacteria 10064
286 Ga0105248_10014218 3300009177 Bacteria 8762
287 Ga0105248_10049787 3300009177 Bacteria 4698
288 Ga0105248_10237669 3300009177 Bacteria 2051
289 Ga0105237_10158136 3300009545 Bacteria 2263
290 Ga0105238_10015699 3300009551 Bacteria 7667
291 Ga0105238_10063358 3300009551 Bacteria 3697
292 Ga0105238_10083461 3300009551 Bacteria 3184
293 Ga0105249_10336778 3300009553 Bacteria 1524
294 Ga0099796_10002132 3300010159 Bacteria 4257
295 Ga0105246_10025827 3300011119 Bacteria 3830
296 Ga0105246_10041134 3300011119 Bacteria 3122
297 Ga0157342_1003062 3300012507 Bacteria 1409
298 Ga0157373_10099718 3300013100 Bacteria 2044
299 Ga0157371_10158753 3300013102 Bacteria 1615
300 Ga0157369_10307822 3300013105 Bacteria 1648
301 Ga0157374_10001167 3300013296 Bacteria 22404
302 Ga0157374_10095661 3300013296 Bacteria 2840
303 Ga0157374_10344591 3300013296 Bacteria 1480
304 Ga0157378_10008023 3300013297 Bacteria 9217
305 Ga0157378_10020136 3300013297 Bacteria 5867
306 Ga0157378_10034938 3300013297 Bacteria 4444
307 Ga0157378_10088994 3300013297 Bacteria 2803
308 Ga0163162_10010853 3300013306 Bacteria 8866
309 Ga0163162_10194670 3300013306 Bacteria 2156
310 Ga0157372_10070864 3300013307 Bacteria 3923
311 Ga0157372_10216912 3300013307 Bacteria 2218
312 Ga0157375_10031874 3300013308 Bacteria 4992
313 Ga0163163_10007288 3300014325 Bacteria 9756
314 Ga0163163_10011174 3300014325 Bacteria 8131
315 Ga0163163_10041756 3300014325 Bacteria 4487
316 Ga0163163_10450329 3300014325 Bacteria 1347
317 Ga0157380_10001551 3300014326 Bacteria 15111
318 Ga0157380_10059935 3300014326 Bacteria 3039
319 Ga0157377_10070737 3300014745 Bacteria 2016
320 Ga0157379_10008646 3300014968 Bacteria 8866
321 Ga0157379_10202713 3300014968 Unclassified 1794
322 Ga0157379_10591223 3300014968 Bacteria 1035
323 Ga0157376_10062718 3300014969 Bacteria 3128
324 Ga0157376_11108952 3300014969 Bacteria 817
325 Ga0157376_11109594 3300014969 Bacteria 817
326 Ga0213876_10104415 3300021384 Bacteria 1503
327 Ga0228598_1031928 3300024227 Bacteria 1037
328 Ga0207666_1000153 3300025271 Bacteria 10663
329 Ga0209758_1000125 3300025297 Bacteria 189869
330 Ga0209758_1019110 3300025297 Bacteria 3324
331 Ga0207426_1000573 3300025302 Bacteria 49440
332 Ga0207697_10001059 3300025315 Bacteria 15198
333 Ga0207682_10002885 3300025893 Bacteria 7586
334 Ga0207692_10000282 3300025898 Bacteria 17493
335 Ga0207692_10020210 3300025898 Bacteria 3024
336 Ga0207692_10076128 3300025898 Bacteria 1782
337 Ga0207642_10000385 3300025899 Bacteria 13210
338 Ga0207642_10024406 3300025899 Bacteria 2430
339 Ga0207710_10000382 3300025900 Bacteria 30360
340 Ga0207710_10065532 3300025900 Bacteria 1656
341 Ga0207688_10001072 3300025901 Bacteria 13993
342 Ga0207688_10004597 3300025901 Bacteria 7515
343 Ga0207680_10046034 3300025903 Bacteria 2577
344 Ga0207647_10033262 3300025904 Bacteria 3302
345 Ga0207647_10048650 3300025904 Bacteria 2632
346 Ga0207685_10002544 3300025905 Bacteria 4206
347 Ga0207685_10006711 3300025905 Bacteria 3157
348 Ga0207699_10012918 3300025906 Bacteria 4257
349 Ga0207699_10032604 3300025906 Bacteria 2936
350 Ga0207699_10053630 3300025906 Bacteria 2391
351 Ga0207699_10185222 3300025906 Bacteria 1402
352 Ga0207645_10002745 3300025907 Bacteria 13711
353 Ga0207645_10110760 3300025907 Bacteria 1777
354 Ga0207643_10000004 3300025908 Bacteria 187006
355 Ga0207643_10000532 3300025908 Bacteria 24445
356 Ga0207705_10252777 3300025909 Bacteria 1344
357 Ga0207705_10260064 3300025909 Bacteria 1325
358 Ga0207684_10009569 3300025910 Bacteria 8549
359 Ga0207654_10008032 3300025911 Bacteria 5318
360 Ga0207707_10014644 3300025912 Bacteria 6833
361 Ga0207707_10095432 3300025912 Bacteria 2599
362 Ga0207707_10149498 3300025912 Bacteria 2042
363 Ga0207707_10257582 3300025912 Bacteria 1514
364 Ga0207695_10535643 3300025913 Bacteria 1052
365 Ga0207671_10382544 3300025914 Bacteria 1118
366 Ga0207693_10001038 3300025915 Bacteria 24865
367 Ga0207693_10002870 3300025915 Bacteria 14928
368 Ga0207693_10021249 3300025915 Bacteria 5158
369 Ga0207693_10051413 3300025915 Bacteria 3233
370 Ga0207693_10111293 3300025915 Bacteria 2148
371 Ga0207693_10113805 3300025915 Bacteria 2123
372 Ga0207663_10001206 3300025916 Bacteria 11940
373 Ga0207663_10020826 3300025916 Bacteria 3722
374 Ga0207663_10182611 3300025916 Bacteria 1499
375 Ga0207660_10084417 3300025917 Bacteria 2341
376 Ga0207660_10108359 3300025917 Bacteria 2086
377 Ga0207660_10171963 3300025917 Bacteria 1677
378 Ga0207660_10504782 3300025917 Bacteria 981
379 Ga0207662_10000392 3300025918 Bacteria 19588
380 Ga0207662_10009678 3300025918 Bacteria 5313
381 Ga0207657_10002007 3300025919 Bacteria 22003
382 Ga0207657_10007818 3300025919 Bacteria 10913
383 Ga0207657_10019229 3300025919 Bacteria 6492
384 Ga0207657_10124539 3300025919 Bacteria 2118
385 Ga0207649_10005404 3300025920 Bacteria 6918
386 Ga0207649_10176514 3300025920 Bacteria 1492
387 Ga0207649_10237596 3300025920 Bacteria 1306
388 Ga0207652_10040807 3300025921 Bacteria 3942
389 Ga0207652_10057538 3300025921 Bacteria 3349
390 Ga0207681_10203774 3300025923 Bacteria 1520
391 Ga0207694_10036064 3300025924 Bacteria 3794
392 Ga0207694_10052161 3300025924 Bacteria 3171
393 Ga0207650_10017240 3300025925 Bacteria 5055
394 Ga0207650_10180047 3300025925 Bacteria 1684
395 Ga0207650_10226842 3300025925 Bacteria 1505
396 Ga0207659_10000374 3300025926 Bacteria 26976
397 Ga0207687_10001956 3300025927 Bacteria 14176
398 Ga0207687_10003333 3300025927 Bacteria 10848
399 Ga0207687_10416250 3300025927 Bacteria 1108
400 Ga0207700_10029040 3300025928 Bacteria 3898
401 Ga0207700_10054514 3300025928 Bacteria 3002
402 Ga0207700_10063040 3300025928 Bacteria 2818
403 Ga0207700_10132844 3300025928 Bacteria 2035
404 Ga0207664_10012974 3300025929 Bacteria 5970
405 Ga0207664_10294781 3300025929 Bacteria 1426
406 Ga0207644_10004888 3300025931 Bacteria 8732
407 Ga0207690_10022501 3300025932 Bacteria 3923
408 Ga0207706_10017396 3300025933 Bacteria 6476
409 Ga0207706_10093282 3300025933 Bacteria 2648
410 Ga0207686_10028626 3300025934 Bacteria 3277
411 Ga0207686_10108717 3300025934 Bacteria 1866
412 Ga0207709_10008652 3300025935 Bacteria 5620
413 Ga0207670_10121973 3300025936 Unclassified 1896
414 Ga0207670_10303769 3300025936 Bacteria 1250
415 Ga0207670_10478287 3300025936 Bacteria 1008
416 Ga0207669_10000275 3300025937 Bacteria 23591
417 Ga0207669_10011700 3300025937 Bacteria 4283
418 Ga0207704_10016005 3300025938 Bacteria 3842
419 Ga0207704_10022163 3300025938 Bacteria 3397
420 Ga0207704_10087365 3300025938 Bacteria 2036
421 Ga0207665_10000541 3300025939 Bacteria 25458
422 Ga0207665_10011153 3300025939 Bacteria 5896
423 Ga0207665_10013741 3300025939 Bacteria 5325
424 Ga0207665_10403257 3300025939 Bacteria 1042
425 Ga0207691_10004396 3300025940 Bacteria 13666
426 Ga0207691_10030766 3300025940 Bacteria 5014
427 Ga0207711_10007738 3300025941 Bacteria 8978
428 Ga0207711_10021126 3300025941 Bacteria 5438
429 Ga0207711_10047684 3300025941 Bacteria 3664
430 Ga0207689_10002724 3300025942 Bacteria 16345
431 Ga0207689_10009477 3300025942 Bacteria 8407
432 Ga0207689_10576332 3300025942 Bacteria 946
433 Ga0207661_10055077 3300025944 Bacteria 3188
434 Ga0207661_10148872 3300025944 Bacteria 2022
435 Ga0207679_10001617 3300025945 Bacteria 14034
436 Ga0207679_10039424 3300025945 Bacteria 3373
437 Ga0207679_10156602 3300025945 Bacteria 1861
438 Ga0207679_10211104 3300025945 Bacteria 1628
439 Ga0207679_10235872 3300025945 Bacteria 1547
440 Ga0207679_10333306 3300025945 Bacteria 1317
441 Ga0207667_10234750 3300025949 Bacteria 1877
442 Ga0207651_10127427 3300025960 Bacteria 1942
443 Ga0207651_10292182 3300025960 Bacteria 1352
444 Ga0207712_10045788 3300025961 Bacteria 3031
445 Ga0207668_10118862 3300025972 Bacteria 1997
446 Ga0207668_10144878 3300025972 Unclassified 1831
447 Ga0207640_10005141 3300025981 Bacteria 7114
448 Ga0207658_10038686 3300025986 Bacteria 3438
449 Ga0207658_10076749 3300025986 Bacteria 2547
450 Ga0207658_10163522 3300025986 Bacteria 1826
451 Ga0207677_10044426 3300026023 Bacteria 2960
452 Ga0207677_10172528 3300026023 Bacteria 1693
453 Ga0207703_10001822 3300026035 Bacteria 19007
454 Ga0207703_10019332 3300026035 Bacteria 5322
455 Ga0207703_10511580 3300026035 Bacteria 1128
456 Ga0207639_10491558 3300026041 Bacteria 1120
457 Ga0207678_10002471 3300026067 Bacteria 16791
458 Ga0207678_10020636 3300026067 Bacteria 5775
459 Ga0207678_10020641 3300026067 Bacteria 5775
460 Ga0207678_10258142 3300026067 Unclassified 1493
461 Ga0207678_10267055 3300026067 Bacteria 1467
462 Ga0207678_10338961 3300026067 Bacteria 1295
463 Ga0207708_10001992 3300026075 Bacteria 15035
464 Ga0207702_10134688 3300026078 Bacteria 2227
465 Ga0207702_10266006 3300026078 Bacteria 1616
466 Ga0207702_10310503 3300026078 Bacteria 1499
467 Ga0207641_10013221 3300026088 Bacteria 6768
468 Ga0207641_10113659 3300026088 Bacteria 2405
469 Ga0207641_10132858 3300026088 Bacteria 2237
470 Ga0207641_10222589 3300026088 Bacteria 1750
471 Ga0207648_10004767 3300026089 Bacteria 13850
472 Ga0207648_10169900 3300026089 Bacteria 1927
473 Ga0207676_10002246 3300026095 Bacteria 13878
474 Ga0207676_10014005 3300026095 Bacteria 5758
475 Ga0207676_10541017 3300026095 Bacteria 1111
476 Ga0207674_10007733 3300026116 Bacteria 12510
477 Ga0207674_10077985 3300026116 Bacteria 3318
478 Ga0207675_100007986 3300026118 Bacteria 9973
479 Ga0207675_100131771 3300026118 Bacteria 2371
480 Ga0207683_10002044 3300026121 Bacteria 17862
481 Ga0207683_10063915 3300026121 Bacteria 3242
482 Ga0207698_10150582 3300026142 Unclassified 2018
483 Ga0207698_10483027 3300026142 Bacteria 1202
484 Ga0207698_10671905 3300026142 Bacteria 1028
485 Ga0207428_10000501 3300027907 Bacteria 46798
486 Ga0265357_1000379 3300028023 Bacteria 2483
487 Ga0268266_10003041 3300028379 Bacteria 17192
488 Ga0268266_10217814 3300028379 Bacteria 1753
489 Ga0268265_10016446 3300028380 Bacteria 5082
490 Ga0268265_10027065 3300028380 Bacteria 4088
491 Ga0268264_10339522 3300028381 Bacteria 1426
492 Ga0268264_10849295 3300028381 Bacteria 914
493 Ga0265318_10024190 3300028577 Bacteria 2412
494 Ga0265338_10028004 3300028800 Bacteria 5634
495 Ga0265338_10140153 3300028800 Bacteria 1895
496 Ga0265330_10004272 3300031235 Bacteria 7274
497 Ga0265330_10076126 3300031235 Bacteria 1448
498 Ga0265332_10000839 3300031238 Bacteria 18678
499 Ga0265332_10011394 3300031238 Bacteria 3953
500 Ga0265320_10006465 3300031240 Bacteria 7386
501 Ga0265325_10000073 3300031241 Bacteria 70109
502 Ga0265325_10001135 3300031241 Bacteria 19104
503 Ga0265325_10014684 3300031241 Bacteria 4419
504 Ga0265325_10044216 3300031241 Bacteria 2320
505 Ga0265325_10045055 3300031241 Bacteria 2294
506 Ga0265329_10012107 3300031242 Bacteria 3113
507 Ga0265329_10025533 3300031242 Bacteria 1954
508 Ga0265340_10000382 3300031247 Bacteria 23632
509 Ga0265340_10009552 3300031247 Bacteria 5201
510 Ga0265339_10001051 3300031249 Bacteria 20994
511 Ga0265339_10002691 3300031249 Bacteria 12639
512 Ga0265339_10062900 3300031249 Bacteria 1994
513 Ga0265339_10101044 3300031249 Bacteria 1501
514 Ga0265331_10019051 3300031250 Bacteria 3548
515 Ga0265331_10065609 3300031250 Bacteria 1706
516 Ga0265316_10110271 3300031344 Bacteria 2084
517 Ga0265313_10000024 3300031595 Bacteria 138587
518 Ga0265313_10000716 3300031595 Bacteria 34149
519 Ga0265313_10016138 3300031595 Bacteria 4310
520 Ga0265313_10022124 3300031595 Bacteria 3457
521 Ga0265313_10054389 3300031595 Bacteria 1901
522 Ga0265313_10085404 3300031595 Bacteria 1426
523 Ga0265314_10002492 3300031711 Bacteria 18802
524 Ga0265314_10038121 3300031711 Bacteria 3476
525 Ga0265342_10000179 3300031712 Bacteria 70615
526 Ga0265342_10000308 3300031712 Bacteria 55378
527 Ga0265342_10069743 3300031712 Bacteria 2052
528 Ga0265342_10088723 3300031712 Bacteria 1775
529 Ga0265342_10094730 3300031712 Bacteria 1708
530 Ga0265342_10104608 3300031712 Bacteria 1608
531 Ga0307409_100728911 3300031995 Bacteria 993
532 Ga0373930_0001440 3300034816 Bacteria 3539
533 Ga0373950_0002146 3300034818 Bacteria 2683
534 Ga0373950_0013499 3300034818 Bacteria 1364
535 Ga0373938_0018629 3300034957 Bacteria 1380
536 Ga0373926_0027127 3300035083 Bacteria 2005
537 Ga0373928_0005721 3300035084 Bacteria 2377
538 Ga0373928_0025134 3300035084 Bacteria 1282
539 Ga0373928_0034523 3300035084 Bacteria 1136
540 Ga0373934_0079192 3300035086 Bacteria 1319
541 Ga0373944_0021028 3300035089 Bacteria 1885
542 Ga0373949_0001783 3300035090 Bacteria 5906
543 Ga0373923_0009905 3300035111 Bacteria 3452
544 Ga0373923_0160727 3300035111 Bacteria 1025
545 Ga0373932_0088132 3300035112 Bacteria 991
546 Ga0373936_0153426 3300035113 Bacteria 999
547 Ga0373941_0003872 3300035115 Bacteria 3427
548 Ga0373941_0007122 3300035115 Bacteria 2724
549 Ga0373945_0018268 3300035116 Bacteria 2384
550 Ga0373945_0061574 3300035116 Bacteria 1402
551 Ga0373953_0002856 3300035117 Bacteria 5267
552 Ga0373954_0009066 3300035118 Bacteria 4375
553 Ga0373954_0010543 3300035118 Bacteria 4080
554 Ga0373956_0001142 3300035119 Bacteria 10971
555 Ga0373956_0050075 3300035119 Bacteria 1874
556 Ga0373956_0072650 3300035119 Bacteria 1571
557 Ga0373957_0003057 3300035120 Bacteria 4875
558 Ga0373957_0014833 3300035120 Bacteria 2670
559 Ga0373957_0028081 3300035120 Bacteria 2048
560 Ga0373960_0067388 3300035121 Bacteria 1099
561 Ga0373960_0095298 3300035121 Unclassified 957
562 Ga0373943_0007879 3300035170 Bacteria 4781
563 Ga0373943_0040473 3300035170 Bacteria 2250
564 Ga0373946_0001413 3300035171 Bacteria 8330
565 Ga0373946_0003685 3300035171 Bacteria 5427
566 Ga0373946_0133376 3300035171 Unclassified 1145
567 Ga0373955_0000504 3300035172 Bacteria 16576
568 Ga0373955_0004843 3300035172 Bacteria 6000
569 Ga0373955_0006423 3300035172 Bacteria 5356
570 Ga0373955_0118923 3300035172 Bacteria 1534
571 Ga0373961_0019628 3300035241 Bacteria 1778
572 Ga0373962_0010443 3300035242 Bacteria 2315
573 Ga0373924_0000932 3300035410 Bacteria 9223
574 Ga0373931_0045780 3300035691 Bacteria 2311
575 Ga0373931_0093004 3300035691 Bacteria 1683
576 Ga0373935_0000038 3300035692 Bacteria 51446
577 Ga0373935_0036156 3300035692 Bacteria 3086
578 Ga0373935_0117686 3300035692 Bacteria 1771
579 Ga0373935_0201173 3300035692 Bacteria 1376
580 Ga0373927_0008438 3300035695 Bacteria 6928
581 Ga0373927_0129562 3300035695 Bacteria 1647
582 Ga0373927_0307177 3300035695 Bacteria 1044
583 Ga0373927_0434125 3300035695 Bacteria 867
584 Ga0373933_0007752 3300035724 Bacteria 5864
585 Ga0373933_0011420 3300035724 Bacteria 4894
586 Ga0373933_0020352 3300035724 Bacteria 3761
587 Ga0373947_0000229 3300035725 Bacteria 31423
588 Ga0373947_0009320 3300035725 Bacteria 5640
589 Ga0373947_0027554 3300035725 Bacteria 3326
590 Ga0373947_0097450 3300035725 Bacteria 1843
591 Ga0373947_0140882 3300035725 Bacteria 1546
592 Ga0373937_0000004 3300036401 Bacteria 212269
593 Ga0373937_0000655 3300036401 Bacteria 30381
594 Ga0373937_0009675 3300036401 Bacteria 8398
595 Ga0373937_0053957 3300036401 Bacteria 3687
596 Ga0373937_0074055 3300036401 Bacteria 3142
597 Ga0373937_0261283 3300036401 Bacteria 1633
598 Ga0373937_0497149 3300036401 Bacteria 1159
599 Ga0373937_0672259 3300036401 Bacteria 981
600 Ga0373925_0000424 3300037068 Bacteria 42803
601 Ga0373925_0017194 3300037068 Bacteria 5238
602 Ga0373925_0030232 3300037068 Bacteria 3976
603 Ga0373925_0032039 3300037068 Bacteria 3867
604 Ga0373925_0155975 3300037068 Bacteria 1795
605 Ga0373925_0254939 3300037068 Bacteria 1408
606 Ga0395898_0326517 3300037466 Bacteria 1463
607 Ga0436365_0076921 3300039437 Bacteria 40502
608 Ga0436365_0432047 3300039437 Bacteria 2497
609 Ga0436365_0960142 3300039437 Bacteria 882
610 Ga0436360_0780623 3300039438 Bacteria 1035
611 Ga0436361_0685960 3300039447 Bacteria 1426
612 Ga0439453_0000181 3300041408 Bacteria 5943
613 Ga0451798_0958274 3300041458 Bacteria 826
614 Ga0451853_4041355 3300041512 Bacteria 2370
615 Ga0439443_000550 3300042003 Bacteria 3424
616 Ga0439446_0063269 3300042156 Bacteria 1121
617 Ga0439435_0000899 3300042436 Bacteria 5123
618 Ga0466966_0088104 3300044684 Bacteria 1929
619 Ga0466963_0005670 3300044694 Bacteria 7334
620 Ga0466963_0137821 3300044694 Bacteria 1689
621 Ga0466963_0418771 3300044694 Bacteria 945
622 Ga0466964_0158830 3300044706 Bacteria 1055
623 Ga0466957_0015548 3300044842 Bacteria 4445
624 Ga0466957_0420031 3300044842 Bacteria 917
625 Ga0466958_0015838 3300045836 Bacteria 4331
626 Ga0466967_0031688 3300045976 Bacteria 4454
627 Ga0466967_0033052 3300045976 Bacteria 4376
628 Ga0495627_039797 3300046453 Bacteria 1449
629 Ga0495592_0000032 3300046454 Bacteria 128274
630 Ga0495629_0001232 3300046459 Bacteria 20103
631 Ga0495629_0001465 3300046459 Bacteria 18592
632 Ga0495629_0107794 3300046459 Bacteria 1943
633 Ga0495638_0058828 3300046460 Bacteria 2381
634 Ga0495641_0010900 3300046461 Bacteria 5225
635 Ga0495651_0000799 3300046462 Bacteria 24378
636 Ga0495653_0000012 3300046463 Bacteria 266880
637 Ga0495653_0448518 3300046463 Bacteria 812
638 Ga0495580_0377740 3300046472 Bacteria 957
639 Ga0495582_0000570 3300046473 Bacteria 20403
640 Ga0495582_0031519 3300046473 Bacteria 2914
641 Ga0495605_0055488 3300046474 Bacteria 1914
642 Ga0495639_0027847 3300046475 Bacteria 2502
643 Ga0495639_0084793 3300046475 Bacteria 1480
644 Ga0495662_0032039 3300046476 Bacteria 2539
645 Ga0495662_0191079 3300046476 Bacteria 1010
646 Ga0495662_0191517 3300046476 Bacteria 1008
647 Ga0495664_0000004 3300046477 Bacteria 489411
648 Ga0495584_0040744 3300046491 Bacteria 2345
649 Ga0495584_0041179 3300046491 Bacteria 2332
650 Ga0495584_0124009 3300046491 Bacteria 1309
651 Ga0495594_0083376 3300046499 Bacteria 1787
652 Ga0495596_0108968 3300046500 Bacteria 1075
653 Ga0495608_0000017 3300046511 Bacteria 192929
654 Ga0495608_0009665 3300046511 Bacteria 6728
655 Ga0495618_0000006 3300046514 Bacteria 229906
656 Ga0495618_0019785 3300046514 Bacteria 4143
657 Ga0495628_0000001 3300046516 Bacteria 917742
658 Ga0495628_0004103 3300046516 Bacteria 12959
659 Ga0495630_0005871 3300046517 Bacteria 8684
660 Ga0495630_0017154 3300046517 Bacteria 5301
661 Ga0495630_0093365 3300046517 Bacteria 2274
662 Ga0495630_0131230 3300046517 Bacteria 1903
663 Ga0495637_0053136 3300046520 Bacteria 1688
664 Ga0495644_0041322 3300046523 Bacteria 1737
665 Ga0495666_0040048 3300046526 Bacteria 2273
666 Ga0495666_0159086 3300046526 Bacteria 1048
667 Ga0495652_0000002 3300046529 Bacteria 946606
668 Ga0495652_0027665 3300046529 Bacteria 4994
669 Ga0495652_0297466 3300046529 Bacteria 1175
670 Ga0495665_0032202 3300046531 Bacteria 2804
671 Ga0495640_0000001 3300046533 Bacteria 853827
672 Ga0495640_0008218 3300046533 Bacteria 8189
673 Ga0495640_0017302 3300046533 Bacteria 5375
674 Ga0495586_0082644 3300046535 Bacteria 1766
675 Ga0495586_0199705 3300046535 Bacteria 1133
676 Ga0495587_0000008 3300046536 Bacteria 271097
677 Ga0495587_0009997 3300046536 Bacteria 6057
678 Ga0495598_0001843 3300046537 Bacteria 4269
679 Ga0495645_0000002 3300046543 Bacteria 651644
680 Ga0495645_0044935 3300046543 Bacteria 3221
681 Ga0495633_0053006 3300046558 Bacteria 1910
682 Ga0495667_0000124 3300046559 Bacteria 55660
683 Ga0495667_0003621 3300046559 Bacteria 10387
684 Ga0495667_0020065 3300046559 Bacteria 4509
685 Ga0495656_0004314 3300046615 Bacteria 4861
686 Ga0495656_0007363 3300046615 Bacteria 3886
687 Ga0495634_0000003 3300046642 Bacteria 206222
688 Ga0495634_0057544 3300046642 Bacteria 2594
689 Ga0495634_0214514 3300046642 Bacteria 1190
690 Ga0495635_0000002 3300046663 Bacteria 490490
691 Ga0495635_0011233 3300046663 Bacteria 6278
692 Ga0495588_0055920 3300046674 Bacteria 2037
693 Ga0495657_0000054 3300046675 Bacteria 99620
694 Ga0495657_0005238 3300046675 Bacteria 10267
695 Ga0495657_0148490 3300046675 Bacteria 1457
696 Ga0495599_0000005 3300046678 Bacteria 300169
697 Ga0495599_0010640 3300046678 Bacteria 5630
698 Ga0495623_0000148 3300046679 Bacteria 43192
699 Ga0495623_0010769 3300046679 Bacteria 5921
700 Ga0495646_0000002 3300046680 Bacteria 310568
701 Ga0495647_0004214 3300046681 Bacteria 4657
702 Ga0495658_0000237 3300046683 Bacteria 31696
703 Ga0495658_0002178 3300046683 Bacteria 9911
704 Ga0495658_0006226 3300046683 Bacteria 5863
705 Ga0495658_0070105 3300046683 Bacteria 2033
706 Ga0495658_0218450 3300046683 Bacteria 1193
707 Ga0495669_0033891 3300046684 Bacteria 2250
708 Ga0495669_0109873 3300046684 Bacteria 1287
709 Ga0495613_0103162 3300046689 Bacteria 2059
710 Ga0495624_0026442 3300046690 Bacteria 3803
711 Ga0495624_0063231 3300046690 Bacteria 2313
712 Ga0495624_0066333 3300046690 Bacteria 2253
713 Ga0495624_0336260 3300046690 Bacteria 909
714 Ga0495670_0011251 3300046691 Bacteria 4398
715 Ga0495671_0025087 3300046692 Bacteria 3101
716 Ga0495589_0046648 3300046794 Bacteria 2150
717 Ga0495589_0069097 3300046794 Bacteria 1728
718 Ga0495600_0000012 3300046809 Bacteria 119798
719 Ga0495600_0057999 3300046809 Bacteria 2529
720 Ga0495600_0060644 3300046809 Bacteria 2470
721 Ga0495660_0170585 3300046810 Bacteria 1060
722 Ga0495581_0019117 3300047315 Bacteria 3977
723 Ga0495581_0300835 3300047315 Bacteria 937
724 Ga0495604_0000009 3300047317 Bacteria 326341
725 Ga0495604_0174391 3300047317 Bacteria 1509
726 Ga0495604_0211351 3300047317 Bacteria 1340
727 Ga0495674_0000002 3300047319 Bacteria 642785
728 Ga0495674_0047745 3300047319 Bacteria 3793
729 Ga0495674_0086497 3300047319 Bacteria 2684
730 Ga0495672_0175556 3300047320 Bacteria 1089
731 Ga0495676_0119787 3300047321 Bacteria 1916
732 Ga0495676_0158133 3300047321 Bacteria 1606
733 Ga0495680_0001385 3300047322 Bacteria 26203
734 Ga0495680_0012328 3300047322 Bacteria 7529
735 Ga0495680_0018500 3300047322 Bacteria 5910
736 Ga0495680_0097090 3300047322 Bacteria 2200
737 Ga0495675_0000028 3300047444 Bacteria 105848
738 Ga0495684_0000006 3300047471 Bacteria 247568
739 Ga0495684_0047360 3300047471 Bacteria 3288
740 Ga0495684_0196638 3300047471 Bacteria 1488
741 Ga0495684_0339281 3300047471 Unclassified 1070
742 Ga0495684_0343927 3300047471 Bacteria 1061
743 Ga0495593_0000140 3300047673 Bacteria 35205
744 Ga0495593_0057150 3300047673 Bacteria 2049
745 Ga0495593_0179692 3300047673 Bacteria 1066
746 Ga0495602_0000005 3300048088 Bacteria 325957
747 Ga0495602_0013847 3300048088 Bacteria 8223
748 Ga0495614_0051122 3300048089 Bacteria 1771
749 Ga0495626_0130530 3300048091 Bacteria 1073
750 Ga0496100_0003363 3300048903 Bacteria 8326
751 Ga0496100_0015869 3300048903 Bacteria 4409
752 Ga0496100_0041015 3300048903 Bacteria 2948
753 Ga0496100_0098257 3300048903 Bacteria 2012
754 Ga0496100_0169228 3300048903 Bacteria 1572
755 Ga0496100_0445511 3300048903 Unclassified 992
756 Ga0496101_0001983 3300048904 Bacteria 12419
757 Ga0496101_0023889 3300048904 Bacteria 4226
758 Ga0496101_0095327 3300048904 Bacteria 2219
759 Ga0496101_0362825 3300048904 Bacteria 1139
760 Ga0496102_0002793 3300048905 Bacteria 14888
761 Ga0496102_0016941 3300048905 Bacteria 6377
762 Ga0496102_0028300 3300048905 Bacteria 5005
763 Ga0496102_0039250 3300048905 Bacteria 4277
764 Ga0496102_0090073 3300048905 Bacteria 2838
765 Ga0496102_0573841 3300048905 Bacteria 1051
766 Ga0496103_0002369 3300048906 Bacteria 11883
767 Ga0496103_0020793 3300048906 Bacteria 3945
768 Ga0496103_0021619 3300048906 Bacteria 3871
769 Ga0496103_0120987 3300048906 Bacteria 1667
770 Ga0496104_0000092 3300048907 Bacteria 87232
771 Ga0496104_0018299 3300048907 Bacteria 6392
772 Ga0496104_0053307 3300048907 Bacteria 3820
773 Ga0496104_0099636 3300048907 Bacteria 2781
774 Ga0496104_0122512 3300048907 Bacteria 2496
775 Ga0496104_0225839 3300048907 Bacteria 1784
776 Ga0496104_0563007 3300048907 Bacteria 1050
777 Ga0496105_0002505 3300048908 Bacteria 13315
778 Ga0496105_0004200 3300048908 Bacteria 10816
779 Ga0496105_0007082 3300048908 Bacteria 8644
780 Ga0496105_0501735 3300048908 Bacteria 952
781 Ga0496105_0501954 3300048908 Unclassified 952
782 Ga0496105_0547419 3300048908 Bacteria 903
783 Ga0496106_0007123 3300048909 Bacteria 8258
784 Ga0496106_0010646 3300048909 Bacteria 6795
785 Ga0496106_0020424 3300048909 Bacteria 4915
786 Ga0496106_0086476 3300048909 Bacteria 2414
787 Ga0496106_0113396 3300048909 Bacteria 2113
788 Ga0496107_0005855 3300048910 Bacteria 8416
789 Ga0496107_0019014 3300048910 Bacteria 4844
790 Ga0496107_0057547 3300048910 Bacteria 2810
791 Ga0496107_0084405 3300048910 Bacteria 2317
792 Ga0496107_0113311 3300048910 Bacteria 1994
793 Ga0496107_0175623 3300048910 Unclassified 1590
794 Ga0496107_0295982 3300048910 Bacteria 1204
795 Ga0496108_0000951 3300048911 Bacteria 22499
796 Ga0496108_0009284 3300048911 Bacteria 7960
797 Ga0496108_0017326 3300048911 Bacteria 5892
798 Ga0496109_0004879 3300048912 Bacteria 11202
799 Ga0496109_0010573 3300048912 Bacteria 7892
800 Ga0496109_0017589 3300048912 Bacteria 6269
801 Ga0496109_0109183 3300048912 Bacteria 2571
802 Ga0496109_0120779 3300048912 Bacteria 2441
803 Ga0496109_0132660 3300048912 Bacteria 2326
804 Ga0496109_0255984 3300048912 Bacteria 1649
805 Ga0496110_0010330 3300048913 Bacteria 7588
806 Ga0496110_0025021 3300048913 Bacteria 5096
807 Ga0496110_0047745 3300048913 Bacteria 3750
808 Ga0496110_0064482 3300048913 Bacteria 3238
809 Ga0496110_0106657 3300048913 Bacteria 2514
810 Ga0496110_0178571 3300048913 Bacteria 1927
811 Ga0496111_0002467 3300048914 Bacteria 11163
812 Ga0496111_0015671 3300048914 Bacteria 5209
813 Ga0496111_0037699 3300048914 Bacteria 3460
814 Ga0496111_0077159 3300048914 Bacteria 2429
815 Ga0496111_0093737 3300048914 Bacteria 2202
816 Ga0496111_0206953 3300048914 Bacteria 1458
817 Ga0496112_0007378 3300048915 Bacteria 9759
818 Ga0496112_0023680 3300048915 Bacteria 5872
819 Ga0496112_0027458 3300048915 Bacteria 5487
820 Ga0496112_0060168 3300048915 Bacteria 3742
821 Ga0496112_0179824 3300048915 Bacteria 2079
822 Ga0496112_0297778 3300048915 Bacteria 1559
823 Ga0496112_0517234 3300048915 Bacteria 1128
824 Ga0496113_0000043 3300048916 Bacteria 52544
825 Ga0496113_0004559 3300048916 Bacteria 8532
826 Ga0496113_0022484 3300048916 Bacteria 4461
827 Ga0496113_0048900 3300048916 Bacteria 3147
828 Ga0496113_0113175 3300048916 Bacteria 2115
829 Ga0496113_0390828 3300048916 Bacteria 1116
830 Ga0496114_0036470 3300048917 Bacteria 4065
831 Ga0496114_0064599 3300048917 Bacteria 3065
832 Ga0496114_0087094 3300048917 Bacteria 2647
833 Ga0496114_0144870 3300048917 Bacteria 2059
834 Ga0496114_0765122 3300048917 Bacteria 843
835 Ga0496115_0002647 3300048918 Bacteria 12855
836 Ga0496115_0003701 3300048918 Bacteria 11002
837 Ga0496115_0008385 3300048918 Bacteria 7647
838 Ga0496115_0037995 3300048918 Bacteria 3819
839 Ga0496115_0076178 3300048918 Bacteria 2726
840 Ga0496115_0211523 3300048918 Bacteria 1601
841 Ga0496115_0342819 3300048918 Unclassified 1219
842 Ga0496118_0020061 3300048921 Bacteria 5944
843 Ga0496125_0071564 3300048928 Bacteria 2708
844 Ga0496126_0158448 3300048929 Bacteria 1936
845 Ga0501031_0045785 3300049568 Bacteria 2854
846 Ga0501032_0142322 3300049569 Bacteria 1579
847 Ga0501032_0153501 3300049569 Bacteria 1513
848 Ga0501032_0197791 3300049569 Bacteria 1312
849 Ga0501033_0059998 3300049570 Bacteria 2807
850 Ga0501033_0100363 3300049570 Bacteria 2112
851 Ga0501034_0022311 3300049571 Bacteria 6453
852 Ga0501034_0025437 3300049571 Bacteria 6026
853 Ga0501034_0057724 3300049571 Bacteria 3901
854 Ga0501034_0081484 3300049571 Bacteria 3238
855 Ga0501034_0479055 3300049571 Bacteria 1160
856 Ga0501036_0000177 3300049572 Bacteria 41942
857 Ga0501036_0004805 3300049572 Bacteria 10920
858 Ga0501036_0035608 3300049572 Bacteria 4211
859 Ga0501036_0037074 3300049572 Bacteria 4124
860 Ga0501036_0049253 3300049572 Bacteria 3567
861 Ga0501036_0191676 3300049572 Bacteria 1720
862 Ga0501037_0001926 3300049573 Bacteria 15044
863 Ga0501037_0007004 3300049573 Bacteria 8232
864 Ga0501038_0013458 3300049574 Bacteria 7457
865 Ga0501038_0176621 3300049574 Bacteria 1725
866 Ga0501038_0221024 3300049574 Bacteria 1511
867 Ga0501039_0073837 3300049575 Bacteria 2650
868 Ga0501039_0117190 3300049575 Bacteria 2085
869 Ga0501039_0183775 3300049575 Bacteria 1644
870 Ga0501041_0026039 3300049577 Bacteria 3516
871 Ga0501041_0552573 3300049577 Bacteria 734
872 Ga0501043_0008320 3300049579 Bacteria 8168
873 Ga0501043_0022538 3300049579 Bacteria 4938
874 Ga0501043_0024067 3300049579 Bacteria 4778
875 Ga0501046_0008241 3300049580 Bacteria 9099
876 Ga0501046_0013329 3300049580 Bacteria 6965
877 Ga0501046_0037763 3300049580 Bacteria 3880
878 Ga0501047_0000756 3300049581 Bacteria 33738
879 Ga0501047_0056933 3300049581 Bacteria 3781
880 Ga0501047_0086785 3300049581 Bacteria 3007
881 Ga0501047_0090581 3300049581 Bacteria 2935
882 Ga0501048_0000357 3300049582 Bacteria 31694
883 Ga0501048_0009539 3300049582 Bacteria 7285
884 Ga0501048_0277758 3300049582 Bacteria 1191
885 Ga0501067_0065035 3300049583 Bacteria 2019
886 Ga0501068_0002385 3300049584 Bacteria 9988
887 Ga0501068_0022450 3300049584 Bacteria 3690
888 Ga0501068_0067385 3300049584 Bacteria 2181
889 Ga0501068_0167547 3300049584 Bacteria 1386
890 Ga0501069_0000659 3300049585 Bacteria 16060
891 Ga0501069_0030171 3300049585 Bacteria 2977
892 Ga0501069_0140591 3300049585 Bacteria 1385
893 Ga0501070_0000711 3300049586 Bacteria 30493
894 Ga0501070_0021174 3300049586 Bacteria 5457
895 Ga0501070_0059888 3300049586 Bacteria 3156
896 Ga0501070_0123837 3300049586 Bacteria 2136
897 Ga0501070_0168615 3300049586 Bacteria 1804
898 Ga0501070_0228060 3300049586 Bacteria 1526
899 Ga0501071_0037406 3300049587 Bacteria 3466
900 Ga0501071_0049661 3300049587 Bacteria 3020
901 Ga0501071_0100595 3300049587 Bacteria 2131
902 Ga0501071_0125061 3300049587 Bacteria 1908
903 Ga0501071_0287214 3300049587 Bacteria 1245
904 Ga0501073_0022644 3300049589 Bacteria 4521
905 Ga0501073_0027377 3300049589 Bacteria 4076
906 Ga0501073_0043280 3300049589 Bacteria 3175
907 Ga0501073_0053332 3300049589 Bacteria 2831
908 Ga0501073_0213810 3300049589 Bacteria 1332
909 Ga0501074_0003367 3300049590 Bacteria 11324
910 Ga0501074_0025506 3300049590 Bacteria 4292
911 Ga0501074_0091376 3300049590 Bacteria 2180
912 Ga0501074_0179723 3300049590 Bacteria 1509
913 Ga0501074_0285235 3300049590 Bacteria 1173
914 Ga0501076_0004238 3300049592 Bacteria 10148
915 Ga0501076_0146074 3300049592 Unclassified 1923
916 Ga0501077_0046016 3300049593 Bacteria 2772
917 Ga0501079_0066503 3300049741 Bacteria 2781
918 Ga0501079_0184899 3300049741 Bacteria 1627
919 Ga0501079_0513541 3300049741 Bacteria 942
920 Ga0501079_0563086 3300049741 Bacteria 896
921 Ga0501080_0003552 3300049742 Bacteria 13734
922 Ga0501080_0012302 3300049742 Bacteria 7840
923 Ga0501080_0335063 3300049742 Bacteria 1368
924 Ga0501083_0007330 3300049744 Bacteria 7822
925 Ga0501083_0009300 3300049744 Bacteria 6937
926 Ga0501083_0045559 3300049744 Bacteria 2967
927 Ga0501083_0049616 3300049744 Bacteria 2828
928 Ga0501083_0089402 3300049744 Bacteria 2035
929 Ga0501083_0238909 3300049744 Bacteria 1183
930 Ga0501083_0246018 3300049744 Bacteria 1164
931 Ga0501035_0000703 3300049822 Bacteria 36519
932 Ga0501035_0014587 3300049822 Bacteria 7252
933 Ga0501035_0383105 3300049822 Bacteria 1172
934 Ga0501044_0009505 3300049823 Bacteria 10587
935 Ga0501044_0012398 3300049823 Bacteria 9228
936 Ga0501044_0028947 3300049823 Bacteria 5843
937 Ga0501044_0063013 3300049823 Bacteria 3789
938 Ga0501044_0246637 3300049823 Bacteria 1728
939 nmdc:mga03683_12606_c1 3300050489 Bacteria 3093
940 nmdc:mga03n38_134547_c1 3300050490 Bacteria 1229
941 nmdc:mga00v17_123895_c1 3300050491 Bacteria 1648
942 nmdc:mga00v17_43279_c1 3300050491 Bacteria 2711
943 nmdc:mga0yw44_10242_c2 3300050492 Bacteria 4376
944 nmdc:mga0yw44_1073_c2 3300050492 Bacteria 3816
945 nmdc:mga0yw44_28448_c1 3300050492 Bacteria 3215
946 nmdc:mga0yw44_339340_c1 3300050492 Bacteria 1010
947 nmdc:mga0yw44_813_c1 3300050492 Bacteria 11629
948 nmdc:mga0k408_102437_c1 3300050493 Bacteria 1688
949 nmdc:mga0k408_60181_c1 3300050493 Bacteria 2207
950 nmdc:mga07m45_133038_c1 3300050496 Bacteria 1439
951 nmdc:mga05p37_23570_c1 3300050507 Bacteria 7469
952 nmdc:mga05p37_6119_c1 3300050507 Bacteria 14175
953 nmdc:mga05p37_656200_c1 3300050507 Bacteria 1174
954 nmdc:mga05p37_66476_c1 3300050507 Bacteria 4435
955 nmdc:mga06r32_142613_c1 3300050510 Bacteria 2373
956 nmdc:mga06r32_215584_c1 3300050510 Bacteria 1333
957 nmdc:mga06r32_457892_c1 3300050510 Bacteria 1255
958 nmdc:mga06r32_473174_c1 3300050510 Bacteria 1231
959 nmdc:mga06r32_673857_c1 3300050510 Bacteria 1001
960 nmdc:mga08y16_100861_c1 3300050511 Bacteria 3005
961 nmdc:mga08y16_218924_c1 3300050511 Bacteria 1971
962 nmdc:mga08y16_281693_c1 3300050511 Bacteria 1715
963 nmdc:mga08y16_53580_c1 3300050511 Bacteria 4218
964 nmdc:mga08y16_68582_c1 3300050511 Bacteria 3697
965 nmdc:mga08y16_7940_c1 3300050511 Bacteria 11107
966 nmdc:mga0n895_128932_c1 3300050512 Bacteria 2554
967 nmdc:mga0n895_138128_c1 3300050512 Bacteria 2464
968 nmdc:mga0n895_212807_c1 3300050512 Bacteria 1963
969 nmdc:mga0n895_346872_c1 3300050512 Unclassified 1504
970 nmdc:mga0n895_70607_c1 3300050512 Bacteria 3461
971 nmdc:mga0n895_80372_c1 3300050512 Bacteria 3248
972 nmdc:mga0rr50_114313_c1 3300050513 Bacteria 2140
973 nmdc:mga0rr50_183946_c1 3300050513 Bacteria 1709
974 nmdc:mga0rr50_244589_c1 3300050513 Bacteria 1488
975 nmdc:mga0rr50_36677_c1 3300050513 Bacteria 3533
976 nmdc:mga0rr50_443475_c1 3300050513 Bacteria 1100
977 nmdc:mga0rr50_73707_c1 3300050513 Bacteria 2611
978 nmdc:mga08x19_140409_c1 3300050514 Bacteria 1631
979 nmdc:mga08x19_272733_c1 3300050514 Bacteria 1171
980 nmdc:mga08x19_4943_c1 3300050514 Bacteria 7874
981 nmdc:mga0a205_19073_c1 3300050515 Bacteria 6463
982 nmdc:mga0a205_30953_c1 3300050515 Bacteria 5126
983 nmdc:mga0a205_329112_c1 3300050515 Bacteria 1398
984 nmdc:mga0a205_439085_c1 3300050515 Bacteria 1166
985 Ga0495601_0000002 3300053077 Bacteria 528704
986 Ga0495601_0001735 3300053077 Bacteria 12053
987 Ga0495601_0013626 3300053077 Bacteria 4891
988 Ga0495601_0031821 3300053077 Bacteria 3280
989 Ga0495612_0000010 3300053078 Bacteria 227618
990 Ga0495612_0024655 3300053078 Bacteria 2414
991 Ga0495612_0043876 3300053078 Bacteria 1828
992 Ga0495612_0274639 3300053078 Bacteria 752
993 Ga0495595_0000026 3300053084 Bacteria 99949
994 Ga0495595_0007500 3300053084 Bacteria 4468
995 Ga0495595_0050761 3300053084 Bacteria 1922
996 Ga0495595_0071510 3300053084 Bacteria 1640
997 Ga0495595_0161542 3300053084 Bacteria 1105
998 Ga0495619_0000019 3300053085 Bacteria 209518
999 Ga0495619_0000484 3300053085 Bacteria 26647
1000 Ga0495619_0072501 3300053085 Bacteria 2306
1001 Ga0495619_0091849 3300053085 Bacteria 2055
1002 Ga0495619_0222827 3300053085 Bacteria 1306
1003 Ga0500643_000042 3300053087 Bacteria 158933
1004 Ga0500643_001251 3300053087 Bacteria 15060
1005 Ga0500644_0000533 3300053088 Bacteria 15780
1006 Ga0500646_0036379 3300053090 Bacteria 1371
1007 Ga0500647_0013260 3300053091 Bacteria 3725
1008 Ga0500651_0001643 3300053093 Bacteria 11381
1009 Ga0500557_000006 3300053105 Bacteria 141252
1010 Ga0500595_000002 3300053119 Bacteria 1074388
1011 Ga0500595_007280 3300053119 Bacteria 4596
1012 Ga0500642_0000040 3300053130 Bacteria 96160
1013 Ga0500652_000005 3300053131 Bacteria 171538
1014 Ga0500604_0017874 3300053151 Bacteria 1969
1015 Ga0500616_0000002 3300053153 Bacteria 1611257
1016 Ga0500636_0060032 3300053177 Bacteria 2221
1017 Ga0500636_0268572 3300053177 Bacteria 859
1018 Ga0500645_000156 3300053730 Bacteria 53110
1019 Ga0501084_0013592 3300054114 Bacteria 6737
1020 Ga0501084_0067860 3300054114 Bacteria 2985
1021 Ga0501084_0129722 3300054114 Bacteria 2122
1022 Ga0501084_0211552 3300054114 Bacteria 1636
1023 Ga0501082_0000285 3300060353 Bacteria 44550
1024 Ga0501082_0038227 3300060353 Bacteria 4141
1025 Ga0501082_0509380 3300060353 Bacteria 1052
1026 Ga0501082_0747162 3300060353 Bacteria 856
1027 Ga0466962_0083171 3300061719 Bacteria 1531
1028 Ga0530510_0392921 3300061734 Bacteria 1045
1029 Ga0075364_10049712
1030 JGI24752J21851_1009665
1031 JGI24746J21847_1000660
1032 JGI24739J22299_10005070
1033 JGI24737J22298_10001725
1034 JGI24738J21930_10014991
1035 JGI24035J26624_1000749
1036 JGI24742J22300_10000548
1037 JGI24742J22300_10020073
1038 JGI25406J46586_10006738
1039 JGI25153J46596_10011635
1040 JGI25404J52841_10005908
1041 JGI25405J52794_10002353
1042 Ga0065165_1001015
1043 Ga0070658_10073615
1044 Ga0070658_10181552
1045 Ga0070658_10442188
1046 Ga0070676_10004291
1047 Ga0070683_100004677
1048 Ga0070683_100149328
1049 Ga0070683_100164431
1050 Ga0070690_100008757
1051 Ga0070690_100092134
1052 Ga0070690_100103615
1053 Ga0070670_100004378
1054 Ga0070670_100016298
1055 Ga0070670_100048139
1056 Ga0068869_100000546
1057 Ga0068869_100063996
1058 Ga0070680_100035104
1059 Ga0070680_100043638
1060 Ga0070680_100070863
1061 Ga0070680_100099086
1062 Ga0070680_100442230
1063 Ga0070680_100541981
1064 Ga0070682_100003445
1065 Ga0070682_100110716
1066 Ga0068868_100012769
1067 Ga0068868_100209747
1068 Ga0070660_100006773
1069 Ga0070660_100036099
1070 Ga0070660_100039013
1071 Ga0070660_100217924
1072 Ga0070689_100002392
1073 Ga0070689_100023289
1074 Ga0070689_100054606
1075 Ga0070691_10003723
1076 Ga0070691_10094042
1077 Ga0070687_100001017
1078 Ga0070661_100004096
1079 Ga0070661_100191351
1080 Ga0070692_10004423
1081 Ga0070668_100008178
1082 Ga0070668_100047207
1083 Ga0070668_100497346
1084 Ga0070669_100009976
1085 Ga0070675_100010473
1086 Ga0070671_100033814
1087 Ga0070671_100076769
1088 Ga0070674_100027012
1089 Ga0070674_100088015
1090 Ga0070673_100000050
1091 Ga0070673_100057192
1092 Ga0070688_100000781
1093 Ga0070688_100005154
1094 Ga0070659_100036287
1095 Ga0070659_100336097
1096 Ga0070667_100007711
1097 Ga0070667_100114407
1098 Ga0070667_100266149
1099 Ga0070703_10029323
1100 Ga0070709_10002579
1101 Ga0070709_10015376
1102 Ga0070709_10117887
1103 Ga0070714_100006031
1104 Ga0070714_100058980
1105 Ga0070714_100263447
1106 Ga0070713_100017576
1107 Ga0070713_100055547
1108 Ga0070713_100056884
1109 Ga0070713_100243471
1110 Ga0070710_10003313
1111 Ga0070710_10021794
1112 Ga0070710_10092281
1113 Ga0070710_10153247
1114 Ga0070701_10002148
1115 Ga0070701_10437087
1116 Ga0070711_100022517
1117 Ga0070711_100024455
1118 Ga0070711_100027086
1119 Ga0070705_100003118
1120 Ga0070700_100002692
1121 Ga0070694_100005972
1122 Ga0070708_100269960
1123 Ga0070663_100019695
1124 Ga0070663_100044767
1125 Ga0070663_100087995
1126 Ga0070663_100272077
1127 Ga0070663_100486178
1128 Ga0070678_100000518
1129 Ga0070678_100022233
1130 Ga0070678_100055812
1131 Ga0070678_100261512
1132 Ga0070678_100429698
1133 Ga0070662_100207506
1134 Ga0070681_10011624
1135 Ga0070681_10027987
1136 Ga0070681_10196314
1137 Ga0070681_10552107
1138 Ga0068867_100084087
1139 Ga0070685_10003674
1140 Ga0070685_10014330
1141 Ga0070707_100135839
1142 Ga0070699_100010972
1143 Ga0070679_100004048
1144 Ga0070679_100007667
1145 Ga0070679_100038301
1146 Ga0070679_100103442
1147 Ga0070679_100157769
1148 Ga0070684_100004205
1149 Ga0070697_100245505
1150 Ga0070697_100652942
1151 Ga0068853_100042900
1152 Ga0068853_100718527
1153 Ga0070672_100000643
1154 Ga0070686_100081135
1155 Ga0070695_100127165
1156 Ga0070696_100147295
1157 Ga0070693_100010080
1158 Ga0070693_100015464
1159 Ga0070665_100004366
1160 Ga0070665_100098694
1161 Ga0070665_100107354
1162 Ga0070665_100205970
1163 Ga0070704_100007534
1164 Ga0068855_100035984
1165 Ga0068855_100263615
1166 Ga0070664_100045869
1167 Ga0070664_100061029
1168 Ga0070664_100273849
1169 Ga0068857_100001038
1170 Ga0068857_100193234
1171 Ga0068854_100154785
1172 Ga0068856_100009104
1173 Ga0068856_100216401
1174 Ga0068856_100705853
1175 Ga0070702_100003907
1176 Ga0070702_100045550
1177 Ga0070702_100280699
1178 Ga0068852_100024049
1179 Ga0068852_100342276
1180 Ga0068859_100125159
1181 Ga0068859_100337060
1182 Ga0068859_100582430
1183 Ga0068859_101001040
1184 Ga0068864_100001882
1185 Ga0068864_100227008
1186 Ga0068864_100237471
1187 Ga0068866_10000791
1188 Ga0068866_10028400
1189 Ga0068861_100002491
1190 Ga0068870_10001431
1191 Ga0068870_10026649
1192 Ga0068863_100031598
1193 Ga0068863_100097902
1194 Ga0068863_100155588
1195 Ga0068858_100028785
1196 Ga0068858_100050653
1197 Ga0068858_100131690
1198 Ga0068860_100002530
1199 Ga0068860_100213517
1200 Ga0068860_100380951
1201 Ga0068862_100011700
1202 Ga0081455_10000081
1203 Ga0081455_10016554
1204 Ga0081455_10034433
1205 Ga0081455_10049916
1206 Ga0081455_10082000
1207 Ga0081455_10138580
1208 Ga0081538_10108327
1209 Ga0081540_1000027
1210 Ga0081540_1003265
1211 Ga0081540_1025762
1212 Ga0081539_10001260
1213 Ga0081539_10029936
1214 Ga0070717_10000485
1215 Ga0070717_10000980
1216 Ga0070717_10494912
1217 Ga0075365_10001829
1218 Ga0075365_10001918
1219 Ga0075365_10018393
1220 Ga0075365_10238853
1221 Ga0075368_10023549
1222 Ga0075363_100067153
1223 Ga0075364_10010606
1224 Ga0070715_10000289
1225 Ga0070715_10001137
1226 Ga0070716_100004371
1227 Ga0070716_100085838
1228 Ga0070712_100000210
1229 Ga0070712_100000381
1230 Ga0070712_100003511
1231 Ga0075362_10004834
1232 Ga0075367_10049089
1233 Ga0075367_10087502
1234 Ga0075366_10075432
1235 Ga0075366_10316823
1236 Ga0097621_100001425
1237 Ga0097621_100002618
1238 Ga0097621_100070217
1239 Ga0075370_10076893
1240 Ga0068871_100006790
1241 Ga0068871_100016863
1242 Ga0068871_100124129
1243 Ga0068871_100731276
1244 Ga0075428_100015591
1245 Ga0075428_100500760
1246 Ga0075428_100557035
1247 Ga0075428_100863425
1248 Ga0075430_100099742
1249 Ga0075430_100196520
1250 Ga0075431_100067535
1251 Ga0075431_100079885
1252 Ga0075431_100441514
1253 Ga0075433_10109293
1254 Ga0075433_10199409
1255 Ga0075434_100004560
1256 Ga0075434_100031153
1257 Ga0075434_100035379
1258 Ga0075434_100043586
1259 Ga0075434_100052243
1260 Ga0075434_100053877
1261 Ga0075434_100083203
1262 Ga0075434_100132457
1263 Ga0075434_100188580
1264 Ga0075434_100383708
1265 Ga0075429_100058070
1266 Ga0068865_100001097
1267 Ga0068865_100078168
1268 Ga0068865_100411765
1269 Ga0075436_100008403
1270 Ga0075436_100334795
1271 Ga0097620_100125151
1272 Ga0097620_100337073
1273 Ga0097620_100582456
1274 Ga0097620_101000998
1275 Ga0075435_100014832
1276 Ga0075435_100054758
1277 Ga0075435_100134421
1278 Ga0075435_100251387
1279 Ga0075435_100518526
1280 Ga0099795_10021163
1281 Ga0105240_10067050
1282 Ga0105240_10135711
1283 Ga0111539_10011548
1284 Ga0111539_10026539
1285 Ga0111539_10050713
1286 Ga0111539_10196327
1287 Ga0111539_10203357
1288 Ga0105245_10004787
1289 Ga0105245_10197564
1290 Ga0105245_10319031
1291 Ga0105247_10003270
1292 Ga0105247_10018149
1293 Ga0105247_10024753
1294 Ga0105247_10141527
1295 Ga0105247_10378015
1296 Ga0114129_10001669
1297 Ga0114129_10006740
1298 Ga0114129_10024067
1299 Ga0114129_10035205
1300 Ga0114129_10166040
1301 Ga0114129_10309068
1302 Ga0114129_10510661
1303 Ga0114129_10542927
1304 Ga0105243_10002400
1305 Ga0105243_10004402
1306 Ga0105243_10088625
1307 Ga0105241_10008636
1308 Ga0105241_10012784
1309 Ga0105241_10470102
1310 Ga0105242_10007578
1311 Ga0105242_10023432
1312 Ga0105242_10156399
1313 Ga0105248_10010839
1314 Ga0105248_10014218
1315 Ga0105248_10049787
1316 Ga0105248_10237669
1317 Ga0105237_10158136
1318 Ga0105238_10015699
1319 Ga0105238_10063358
1320 Ga0105238_10083461
1321 Ga0105249_10336778
1322 Ga0099796_10002132
1323 Ga0105246_10025827
1324 Ga0105246_10041134
1325 Ga0157342_1003062
1326 Ga0157373_10099718
1327 Ga0157371_10158753
1328 Ga0157369_10307822
1329 Ga0157374_10001167
1330 Ga0157374_10095661
1331 Ga0157374_10344591
1332 Ga0157378_10008023
1333 Ga0157378_10020136
1334 Ga0157378_10034938
1335 Ga0157378_10088994
1336 Ga0163162_10010853
1337 Ga0163162_10194670
1338 Ga0157372_10070864
1339 Ga0157372_10216912
1340 Ga0157375_10031874
1341 Ga0163163_10007288
1342 Ga0163163_10011174
1343 Ga0163163_10041756
1344 Ga0163163_10450329
1345 Ga0157380_10001551
1346 Ga0157380_10059935
1347 Ga0157377_10070737
1348 Ga0157379_10008646
1349 Ga0157379_10202713
1350 Ga0157379_10591223
1351 Ga0157376_10062718
1352 Ga0157376_11108952
1353 Ga0157376_11109594
1354 Ga0213876_10104415
1355 Ga0228598_1031928
1356 Ga0207666_1000153
1357 Ga0209758_1000125
1358 Ga0209758_1019110
1359 Ga0207426_1000573
1360 Ga0207697_10001059
1361 Ga0207682_10002885
1362 Ga0207692_10000282
1363 Ga0207692_10020210
1364 Ga0207692_10076128
1365 Ga0207642_10000385
1366 Ga0207642_10024406
1367 Ga0207710_10000382
1368 Ga0207710_10065532
1369 Ga0207688_10001072
1370 Ga0207688_10004597
1371 Ga0207680_10046034
1372 Ga0207647_10033262
1373 Ga0207647_10048650
1374 Ga0207685_10002544
1375 Ga0207685_10006711
1376 Ga0207699_10012918
1377 Ga0207699_10032604
1378 Ga0207699_10053630
1379 Ga0207699_10185222
1380 Ga0207645_10002745
1381 Ga0207645_10110760
1382 Ga0207643_10000004
1383 Ga0207643_10000532
1384 Ga0207705_10252777
1385 Ga0207705_10260064
1386 Ga0207684_10009569
1387 Ga0207654_10008032
1388 Ga0207707_10014644
1389 Ga0207707_10095432
1390 Ga0207707_10149498
1391 Ga0207707_10257582
1392 Ga0207695_10535643
1393 Ga0207671_10382544
1394 Ga0207693_10001038
1395 Ga0207693_10002870
1396 Ga0207693_10021249
1397 Ga0207693_10051413
1398 Ga0207693_10111293
1399 Ga0207693_10113805
1400 Ga0207663_10001206
1401 Ga0207663_10020826
1402 Ga0207663_10182611
1403 Ga0207660_10084417
1404 Ga0207660_10108359
1405 Ga0207660_10171963
1406 Ga0207660_10504782
1407 Ga0207662_10000392
1408 Ga0207662_10009678
1409 Ga0207657_10002007
1410 Ga0207657_10007818
1411 Ga0207657_10019229
1412 Ga0207657_10124539
1413 Ga0207649_10005404
1414 Ga0207649_10176514
1415 Ga0207649_10237596
1416 Ga0207652_10040807
1417 Ga0207652_10057538
1418 Ga0207681_10203774
1419 Ga0207694_10036064
1420 Ga0207694_10052161
1421 Ga0207650_10017240
1422 Ga0207650_10180047
1423 Ga0207650_10226842
1424 Ga0207659_10000374
1425 Ga0207687_10001956
1426 Ga0207687_10003333
1427 Ga0207687_10416250
1428 Ga0207700_10029040
1429 Ga0207700_10054514
1430 Ga0207700_10063040
1431 Ga0207700_10132844
1432 Ga0207664_10012974
1433 Ga0207664_10294781
1434 Ga0207644_10004888
1435 Ga0207690_10022501
1436 Ga0207706_10017396
1437 Ga0207706_10093282
1438 Ga0207686_10028626
1439 Ga0207686_10108717
1440 Ga0207709_10008652
1441 Ga0207670_10121973
1442 Ga0207670_10303769
1443 Ga0207670_10478287
1444 Ga0207669_10000275
1445 Ga0207669_10011700
1446 Ga0207704_10016005
1447 Ga0207704_10022163
1448 Ga0207704_10087365
1449 Ga0207665_10000541
1450 Ga0207665_10011153
1451 Ga0207665_10013741
1452 Ga0207665_10403257
1453 Ga0207691_10004396
1454 Ga0207691_10030766
1455 Ga0207711_10007738
1456 Ga0207711_10021126
1457 Ga0207711_10047684
1458 Ga0207689_10002724
1459 Ga0207689_10009477
1460 Ga0207689_10576332
1461 Ga0207661_10055077
1462 Ga0207661_10148872
1463 Ga0207679_10001617
1464 Ga0207679_10039424
1465 Ga0207679_10156602
1466 Ga0207679_10211104
1467 Ga0207679_10235872
1468 Ga0207679_10333306
1469 Ga0207667_10234750
1470 Ga0207651_10127427
1471 Ga0207651_10292182
1472 Ga0207712_10045788
1473 Ga0207668_10118862
1474 Ga0207668_10144878
1475 Ga0207640_10005141
1476 Ga0207658_10038686
1477 Ga0207658_10076749
1478 Ga0207658_10163522
1479 Ga0207677_10044426
1480 Ga0207677_10172528
1481 Ga0207703_10001822
1482 Ga0207703_10019332
1483 Ga0207703_10511580
1484 Ga0207639_10491558
1485 Ga0207678_10002471
1486 Ga0207678_10020636
1487 Ga0207678_10020641
1488 Ga0207678_10258142
1489 Ga0207678_10267055
1490 Ga0207678_10338961
1491 Ga0207708_10001992
1492 Ga0207702_10134688
1493 Ga0207702_10266006
1494 Ga0207702_10310503
1495 Ga0207641_10013221
1496 Ga0207641_10113659
1497 Ga0207641_10132858
1498 Ga0207641_10222589
1499 Ga0207648_10004767
1500 Ga0207648_10169900
1501 Ga0207676_10002246
1502 Ga0207676_10014005
1503 Ga0207676_10541017
1504 Ga0207674_10007733
1505 Ga0207674_10077985
1506 Ga0207675_100007986
1507 Ga0207675_100131771
1508 Ga0207683_10002044
1509 Ga0207683_10063915
1510 Ga0207698_10150582
1511 Ga0207698_10483027
1512 Ga0207698_10671905
1513 Ga0207428_10000501
1514 Ga0265357_1000379
1515 Ga0268266_10003041
1516 Ga0268266_10217814
1517 Ga0268265_10016446
1518 Ga0268265_10027065
1519 Ga0268264_10339522
1520 Ga0268264_10849295
1521 Ga0265318_10024190
1522 Ga0265338_10028004
1523 Ga0265338_10140153
1524 Ga0265330_10004272
1525 Ga0265330_10076126
1526 Ga0265332_10000839
1527 Ga0265332_10011394
1528 Ga0265320_10006465
1529 Ga0265325_10000073
1530 Ga0265325_10001135
1531 Ga0265325_10014684
1532 Ga0265325_10044216
1533 Ga0265325_10045055
1534 Ga0265329_10012107
1535 Ga0265329_10025533
1536 Ga0265340_10000382
1537 Ga0265340_10009552
1538 Ga0265339_10001051
1539 Ga0265339_10002691
1540 Ga0265339_10062900
1541 Ga0265339_10101044
1542 Ga0265331_10019051
1543 Ga0265331_10065609
1544 Ga0265316_10110271
1545 Ga0265313_10000024
1546 Ga0265313_10000716
1547 Ga0265313_10016138
1548 Ga0265313_10022124
1549 Ga0265313_10054389
1550 Ga0265313_10085404
1551 Ga0265314_10002492
1552 Ga0265314_10038121
1553 Ga0265342_10000179
1554 Ga0265342_10000308
1555 Ga0265342_10069743
1556 Ga0265342_10088723
1557 Ga0265342_10094730
1558 Ga0265342_10104608
1559 Ga0307409_100728911
1560 Ga0373930_0001440
1561 Ga0373950_0002146
1562 Ga0373950_0013499
1563 Ga0373938_0018629
1564 Ga0373926_0027127
1565 Ga0373928_0005721
1566 Ga0373928_0025134
1567 Ga0373928_0034523
1568 Ga0373934_0079192
1569 Ga0373944_0021028
1570 Ga0373949_0001783
1571 Ga0373923_0009905
1572 Ga0373923_0160727
1573 Ga0373932_0088132
1574 Ga0373936_0153426
1575 Ga0373941_0003872
1576 Ga0373941_0007122
1577 Ga0373945_0018268
1578 Ga0373945_0061574
1579 Ga0373953_0002856
1580 Ga0373954_0009066
1581 Ga0373954_0010543
1582 Ga0373956_0001142
1583 Ga0373956_0050075
1584 Ga0373956_0072650
1585 Ga0373957_0003057
1586 Ga0373957_0014833
1587 Ga0373957_0028081
1588 Ga0373960_0067388
1589 Ga0373960_0095298
1590 Ga0373943_0007879
1591 Ga0373943_0040473
1592 Ga0373946_0001413
1593 Ga0373946_0003685
1594 Ga0373946_0133376
1595 Ga0373955_0000504
1596 Ga0373955_0004843
1597 Ga0373955_0006423
1598 Ga0373955_0118923
1599 Ga0373961_0019628
1600 Ga0373962_0010443
1601 Ga0373924_0000932
1602 Ga0373931_0045780
1603 Ga0373931_0093004
1604 Ga0373935_0000038
1605 Ga0373935_0036156
1606 Ga0373935_0117686
1607 Ga0373935_0201173
1608 Ga0373927_0008438
1609 Ga0373927_0129562
1610 Ga0373927_0307177
1611 Ga0373927_0434125
1612 Ga0373933_0007752
1613 Ga0373933_0011420
1614 Ga0373933_0020352
1615 Ga0373947_0000229
1616 Ga0373947_0009320
1617 Ga0373947_0027554
1618 Ga0373947_0097450
1619 Ga0373947_0140882
1620 Ga0373937_0000004
1621 Ga0373937_0000655
1622 Ga0373937_0009675
1623 Ga0373937_0053957
1624 Ga0373937_0074055
1625 Ga0373937_0261283
1626 Ga0373937_0497149
1627 Ga0373937_0672259
1628 Ga0373925_0000424
1629 Ga0373925_0017194
1630 Ga0373925_0030232
1631 Ga0373925_0032039
1632 Ga0373925_0155975
1633 Ga0373925_0254939
1634 Ga0395898_0326517
1635 Ga0436365_0076921
1636 Ga0436365_0432047
1637 Ga0436365_0960142
1638 Ga0436360_0780623
1639 Ga0436361_0685960
1640 Ga0439453_0000181
1641 Ga0451798_0958274
1642 Ga0451853_4041355
1643 Ga0439443_000550
1644 Ga0439446_0063269
1645 Ga0439435_0000899
1646 Ga0466966_0088104
1647 Ga0466963_0005670
1648 Ga0466963_0137821
1649 Ga0466963_0418771
1650 Ga0466964_0158830
1651 Ga0466957_0015548
1652 Ga0466957_0420031
1653 Ga0466958_0015838
1654 Ga0466967_0031688
1655 Ga0466967_0033052
1656 Ga0495627_039797
1657 Ga0495592_0000032
1658 Ga0495629_0001232
1659 Ga0495629_0001465
1660 Ga0495629_0107794
1661 Ga0495638_0058828
1662 Ga0495641_0010900
1663 Ga0495651_0000799
1664 Ga0495653_0000012
1665 Ga0495653_0448518
1666 Ga0495580_0377740
1667 Ga0495582_0000570
1668 Ga0495582_0031519
1669 Ga0495605_0055488
1670 Ga0495639_0027847
1671 Ga0495639_0084793
1672 Ga0495662_0032039
1673 Ga0495662_0191079
1674 Ga0495662_0191517
1675 Ga0495664_0000004
1676 Ga0495584_0040744
1677 Ga0495584_0041179
1678 Ga0495584_0124009
1679 Ga0495594_0083376
1680 Ga0495596_0108968
1681 Ga0495608_0000017
1682 Ga0495608_0009665
1683 Ga0495618_0000006
1684 Ga0495618_0019785
1685 Ga0495628_0000001
1686 Ga0495628_0004103
1687 Ga0495630_0005871
1688 Ga0495630_0017154
1689 Ga0495630_0093365
1690 Ga0495630_0131230
1691 Ga0495637_0053136
1692 Ga0495644_0041322
1693 Ga0495666_0040048
1694 Ga0495666_0159086
1695 Ga0495652_0000002
1696 Ga0495652_0027665
1697 Ga0495652_0297466
1698 Ga0495665_0032202
1699 Ga0495640_0000001
1700 Ga0495640_0008218
1701 Ga0495640_0017302
1702 Ga0495586_0082644
1703 Ga0495586_0199705
1704 Ga0495587_0000008
1705 Ga0495587_0009997
1706 Ga0495598_0001843
1707 Ga0495645_0000002
1708 Ga0495645_0044935
1709 Ga0495633_0053006
1710 Ga0495667_0000124
1711 Ga0495667_0003621
1712 Ga0495667_0020065
1713 Ga0495656_0004314
1714 Ga0495656_0007363
1715 Ga0495634_0000003
1716 Ga0495634_0057544
1717 Ga0495634_0214514
1718 Ga0495635_0000002
1719 Ga0495635_0011233
1720 Ga0495588_0055920
1721 Ga0495657_0000054
1722 Ga0495657_0005238
1723 Ga0495657_0148490
1724 Ga0495599_0000005
1725 Ga0495599_0010640
1726 Ga0495623_0000148
1727 Ga0495623_0010769
1728 Ga0495646_0000002
1729 Ga0495647_0004214
1730 Ga0495658_0000237
1731 Ga0495658_0002178
1732 Ga0495658_0006226
1733 Ga0495658_0070105
1734 Ga0495658_0218450
1735 Ga0495669_0033891
1736 Ga0495669_0109873
1737 Ga0495613_0103162
1738 Ga0495624_0026442
1739 Ga0495624_0063231
1740 Ga0495624_0066333
1741 Ga0495624_0336260
1742 Ga0495670_0011251
1743 Ga0495671_0025087
1744 Ga0495589_0046648
1745 Ga0495589_0069097
1746 Ga0495600_0000012
1747 Ga0495600_0057999
1748 Ga0495600_0060644
1749 Ga0495660_0170585
1750 Ga0495581_0019117
1751 Ga0495581_0300835
1752 Ga0495604_0000009
1753 Ga0495604_0174391
1754 Ga0495604_0211351
1755 Ga0495674_0000002
1756 Ga0495674_0047745
1757 Ga0495674_0086497
1758 Ga0495672_0175556
1759 Ga0495676_0119787
1760 Ga0495676_0158133
1761 Ga0495680_0001385
1762 Ga0495680_0012328
1763 Ga0495680_0018500
1764 Ga0495680_0097090
1765 Ga0495675_0000028
1766 Ga0495684_0000006
1767 Ga0495684_0047360
1768 Ga0495684_0196638
1769 Ga0495684_0339281
1770 Ga0495684_0343927
1771 Ga0495593_0000140
1772 Ga0495593_0057150
1773 Ga0495593_0179692
1774 Ga0495602_0000005
1775 Ga0495602_0013847
1776 Ga0495614_0051122
1777 Ga0495626_0130530
1778 Ga0496100_0003363
1779 Ga0496100_0015869
1780 Ga0496100_0041015
1781 Ga0496100_0098257
1782 Ga0496100_0169228
1783 Ga0496100_0445511
1784 Ga0496101_0001983
1785 Ga0496101_0023889
1786 Ga0496101_0095327
1787 Ga0496101_0362825
1788 Ga0496102_0002793
1789 Ga0496102_0016941
1790 Ga0496102_0028300
1791 Ga0496102_0039250
1792 Ga0496102_0090073
1793 Ga0496102_0573841
1794 Ga0496103_0002369
1795 Ga0496103_0020793
1796 Ga0496103_0021619
1797 Ga0496103_0120987
1798 Ga0496104_0000092
1799 Ga0496104_0018299
1800 Ga0496104_0053307
1801 Ga0496104_0099636
1802 Ga0496104_0122512
1803 Ga0496104_0225839
1804 Ga0496104_0563007
1805 Ga0496105_0002505
1806 Ga0496105_0004200
1807 Ga0496105_0007082
1808 Ga0496105_0501735
1809 Ga0496105_0501954
1810 Ga0496105_0547419
1811 Ga0496106_0007123
1812 Ga0496106_0010646
1813 Ga0496106_0020424
1814 Ga0496106_0086476
1815 Ga0496106_0113396
1816 Ga0496107_0005855
1817 Ga0496107_0019014
1818 Ga0496107_0057547
1819 Ga0496107_0084405
1820 Ga0496107_0113311
1821 Ga0496107_0175623
1822 Ga0496107_0295982
1823 Ga0496108_0000951
1824 Ga0496108_0009284
1825 Ga0496108_0017326
1826 Ga0496109_0004879
1827 Ga0496109_0010573
1828 Ga0496109_0017589
1829 Ga0496109_0109183
1830 Ga0496109_0120779
1831 Ga0496109_0132660
1832 Ga0496109_0255984
1833 Ga0496110_0010330
1834 Ga0496110_0025021
1835 Ga0496110_0047745
1836 Ga0496110_0064482
1837 Ga0496110_0106657
1838 Ga0496110_0178571
1839 Ga0496111_0002467
1840 Ga0496111_0015671
1841 Ga0496111_0037699
1842 Ga0496111_0077159
1843 Ga0496111_0093737
1844 Ga0496111_0206953
1845 Ga0496112_0007378
1846 Ga0496112_0023680
1847 Ga0496112_0027458
1848 Ga0496112_0060168
1849 Ga0496112_0179824
1850 Ga0496112_0297778
1851 Ga0496112_0517234
1852 Ga0496113_0000043
1853 Ga0496113_0004559
1854 Ga0496113_0022484
1855 Ga0496113_0048900
1856 Ga0496113_0113175
1857 Ga0496113_0390828
1858 Ga0496114_0036470
1859 Ga0496114_0064599
1860 Ga0496114_0087094
1861 Ga0496114_0144870
1862 Ga0496114_0765122
1863 Ga0496115_0002647
1864 Ga0496115_0003701
1865 Ga0496115_0008385
1866 Ga0496115_0037995
1867 Ga0496115_0076178
1868 Ga0496115_0211523
1869 Ga0496115_0342819
1870 Ga0496118_0020061
1871 Ga0496125_0071564
1872 Ga0496126_0158448
1873 Ga0501031_0045785
1874 Ga0501032_0142322
1875 Ga0501032_0153501
1876 Ga0501032_0197791
1877 Ga0501033_0059998
1878 Ga0501033_0100363
1879 Ga0501034_0022311
1880 Ga0501034_0025437
1881 Ga0501034_0057724
1882 Ga0501034_0081484
1883 Ga0501034_0479055
1884 Ga0501036_0000177
1885 Ga0501036_0004805
1886 Ga0501036_0035608
1887 Ga0501036_0037074
1888 Ga0501036_0049253
1889 Ga0501036_0191676
1890 Ga0501037_0001926
1891 Ga0501037_0007004
1892 Ga0501038_0013458
1893 Ga0501038_0176621
1894 Ga0501038_0221024
1895 Ga0501039_0073837
1896 Ga0501039_0117190
1897 Ga0501039_0183775
1898 Ga0501041_0026039
1899 Ga0501041_0552573
1900 Ga0501043_0008320
1901 Ga0501043_0022538
1902 Ga0501043_0024067
1903 Ga0501046_0008241
1904 Ga0501046_0013329
1905 Ga0501046_0037763
1906 Ga0501047_0000756
1907 Ga0501047_0056933
1908 Ga0501047_0086785
1909 Ga0501047_0090581
1910 Ga0501048_0000357
1911 Ga0501048_0009539
1912 Ga0501048_0277758
1913 Ga0501067_0065035
1914 Ga0501068_0002385
1915 Ga0501068_0022450
1916 Ga0501068_0067385
1917 Ga0501068_0167547
1918 Ga0501069_0000659
1919 Ga0501069_0030171
1920 Ga0501069_0140591
1921 Ga0501070_0000711
1922 Ga0501070_0021174
1923 Ga0501070_0059888
1924 Ga0501070_0123837
1925 Ga0501070_0168615
1926 Ga0501070_0228060
1927 Ga0501071_0037406
1928 Ga0501071_0049661
1929 Ga0501071_0100595
1930 Ga0501071_0125061
1931 Ga0501071_0287214
1932 Ga0501073_0022644
1933 Ga0501073_0027377
1934 Ga0501073_0043280
1935 Ga0501073_0053332
1936 Ga0501073_0213810
1937 Ga0501074_0003367
1938 Ga0501074_0025506
1939 Ga0501074_0091376
1940 Ga0501074_0179723
1941 Ga0501074_0285235
1942 Ga0501076_0004238
1943 Ga0501076_0146074
1944 Ga0501077_0046016
1945 Ga0501079_0066503
1946 Ga0501079_0184899
1947 Ga0501079_0513541
1948 Ga0501079_0563086
1949 Ga0501080_0003552
1950 Ga0501080_0012302
1951 Ga0501080_0335063
1952 Ga0501083_0007330
1953 Ga0501083_0009300
1954 Ga0501083_0045559
1955 Ga0501083_0049616
1956 Ga0501083_0089402
1957 Ga0501083_0238909
1958 Ga0501083_0246018
1959 Ga0501035_0000703
1960 Ga0501035_0014587
1961 Ga0501035_0383105
1962 Ga0501044_0009505
1963 Ga0501044_0012398
1964 Ga0501044_0028947
1965 Ga0501044_0063013
1966 Ga0501044_0246637
1967 nmdc:mga03683_12606_c1
1968 nmdc:mga03n38_134547_c1
1969 nmdc:mga00v17_123895_c1
1970 nmdc:mga00v17_43279_c1
1971 nmdc:mga0yw44_10242_c2
1972 nmdc:mga0yw44_1073_c2
1973 nmdc:mga0yw44_28448_c1
1974 nmdc:mga0yw44_339340_c1
1975 nmdc:mga0yw44_813_c1
1976 nmdc:mga0k408_102437_c1
1977 nmdc:mga0k408_60181_c1
1978 nmdc:mga07m45_133038_c1
1979 nmdc:mga05p37_23570_c1
1980 nmdc:mga05p37_6119_c1
1981 nmdc:mga05p37_656200_c1
1982 nmdc:mga05p37_66476_c1
1983 nmdc:mga06r32_142613_c1
1984 nmdc:mga06r32_215584_c1
1985 nmdc:mga06r32_457892_c1
1986 nmdc:mga06r32_473174_c1
1987 nmdc:mga06r32_673857_c1
1988 nmdc:mga08y16_100861_c1
1989 nmdc:mga08y16_218924_c1
1990 nmdc:mga08y16_281693_c1
1991 nmdc:mga08y16_53580_c1
1992 nmdc:mga08y16_68582_c1
1993 nmdc:mga08y16_7940_c1
1994 nmdc:mga0n895_128932_c1
1995 nmdc:mga0n895_138128_c1
1996 nmdc:mga0n895_212807_c1
1997 nmdc:mga0n895_346872_c1
1998 nmdc:mga0n895_70607_c1
1999 nmdc:mga0n895_80372_c1
2000 nmdc:mga0rr50_114313_c1
2001 nmdc:mga0rr50_183946_c1
2002 nmdc:mga0rr50_244589_c1
2003 nmdc:mga0rr50_36677_c1
2004 nmdc:mga0rr50_443475_c1
2005 nmdc:mga0rr50_73707_c1
2006 nmdc:mga08x19_140409_c1
2007 nmdc:mga08x19_272733_c1
2008 nmdc:mga08x19_4943_c1
2009 nmdc:mga0a205_19073_c1
2010 nmdc:mga0a205_30953_c1
2011 nmdc:mga0a205_329112_c1
2012 nmdc:mga0a205_439085_c1
2013 Ga0495601_0000002
2014 Ga0495601_0001735
2015 Ga0495601_0013626
2016 Ga0495601_0031821
2017 Ga0495612_0000010
2018 Ga0495612_0024655
2019 Ga0495612_0043876
2020 Ga0495612_0274639
2021 Ga0495595_0000026
2022 Ga0495595_0007500
2023 Ga0495595_0050761
2024 Ga0495595_0071510
2025 Ga0495595_0161542
2026 Ga0495619_0000019
2027 Ga0495619_0000484
2028 Ga0495619_0072501
2029 Ga0495619_0091849
2030 Ga0495619_0222827
2031 Ga0500643_000042
2032 Ga0500643_001251
2033 Ga0500644_0000533
2034 Ga0500646_0036379
2035 Ga0500647_0013260
2036 Ga0500651_0001643
2037 Ga0500557_000006
2038 Ga0500595_000002
2039 Ga0500595_007280
2040 Ga0500642_0000040
2041 Ga0500652_000005
2042 Ga0500604_0017874
2043 Ga0500616_0000002
2044 Ga0500636_0060032
2045 Ga0500636_0268572
2046 Ga0500645_000156
2047 Ga0501084_0013592
2048 Ga0501084_0067860
2049 Ga0501084_0129722
2050 Ga0501084_0211552
2051 Ga0501082_0000285
2052 Ga0501082_0038227
2053 Ga0501082_0509380
2054 Ga0501082_0747162
2055 Ga0466962_0083171
2056 Ga0530510_0392921

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

43

271

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wik-assembly1.cif.gz_A cryo-em structure of slc40/ferroportin with fab in the presence of hepcidin 0.4733 44 222
6rw3-assembly4.cif.gz_D the molecular basis for sugar import in malaria parasites. 0.4679 2 223
6rw3-assembly1.cif.gz_A the molecular basis for sugar import in malaria parasites. 0.463 1 223
6rw3-assembly2.cif.gz_B the molecular basis for sugar import in malaria parasites. 0.4626 1 223
4qiq-assembly1.cif.gz_A crystal structure of d-xylose-proton symporter 0.4456 44 217
ID Description Score Start End Superfamily
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5173 55 217 1.20.1250.20
af_Q54E82_206_395_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.504 48 216 1.20.1250.20
af_Q2G0K4_242_431_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.503 50 217 1.20.1250.20
af_Q9Y267_168_571_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5021 55 217 1.20.1250.20
af_Q23063_235_438_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4972 56 218 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7Z9K8V3-F1-model_v4 Probable membrane transporter protein 0.8532 3 222 GO:0005886
AF-C6WYA3-F1-model_v4 Probable membrane transporter protein 0.8434 14 222 GO:0005886
AF-A0A2A4NFJ0-F1-model_v4 Probable membrane transporter protein 0.8428 11 223 GO:0005886
AF-A0A537RZN4-F1-model_v4 Probable membrane transporter protein 0.841 3 222 GO:0005886
AF-A0A7Z9K8V3-F1-model_v4 Probable membrane transporter protein 0.8392 3 222 GO:0005886

Map