F488550
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1028 | 418 | 2056 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300006051|Ga0075364_10049712|Ga0075364_100497125 |
| Length | 278 |
| Sequence | VPNTGKPRKDGFKTAVAAITLDLMVESLFSGFADISLPELILIGAMALVASVVGGVAGYGTGALMPLVLVPIVGAEPVVPILSLSALFTNSSRTAAFLPLVDWRRAAIVLVAAVPTCALGAWGYTMLTGTGAALVIGTMLIASVPLRRLMRRRGLVLSHRGLAAAAFAWGPLAGGTVGAGIILLSLLMAAGLEGAAVVATDAVVSIGIGLTKLLTFGLAGAVTAKVIAVALLIGGIAFPGAFFAKAMINRLPVHVHTVILDAVVAGGGAMMIVNAFAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 8 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 12 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 142 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 221 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 226 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 229 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 230 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 232 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 247 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 250 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 253 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 266 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 268 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 269 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 270 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 275 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 350 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 351 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 352 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 357 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 358 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 403 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 405 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 406 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 407 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 408 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 409 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 410 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 411 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 412 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 415 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 418 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.57 |
| Nodule | 0 |
| Rhizoplane | 9.05 |
| Rhizosphere | 85.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075364_10049712 | 3300006051 | Bacteria | 2735 |
| 2 | JGI24752J21851_1009665 | 3300001976 | Bacteria | 1258 |
| 3 | JGI24746J21847_1000660 | 3300001977 | Bacteria | 5285 |
| 4 | JGI24739J22299_10005070 | 3300001989 | Bacteria | 5015 |
| 5 | JGI24737J22298_10001725 | 3300001990 | Bacteria | 7790 |
| 6 | JGI24738J21930_10014991 | 3300002075 | Bacteria | 1654 |
| 7 | JGI24035J26624_1000749 | 3300002126 | Bacteria | 3043 |
| 8 | JGI24742J22300_10000548 | 3300002244 | Bacteria | 5621 |
| 9 | JGI24742J22300_10020073 | 3300002244 | Bacteria | 1137 |
| 10 | JGI25406J46586_10006738 | 3300003203 | Bacteria | 5279 |
| 11 | JGI25153J46596_10011635 | 3300003215 | Bacteria | 3870 |
| 12 | JGI25404J52841_10005908 | 3300003659 | Bacteria | 2540 |
| 13 | JGI25405J52794_10002353 | 3300003911 | Bacteria | 3245 |
| 14 | Ga0065165_1001015 | 3300005262 | Bacteria | 34129 |
| 15 | Ga0070658_10073615 | 3300005327 | Bacteria | 2801 |
| 16 | Ga0070658_10181552 | 3300005327 | Bacteria | 1771 |
| 17 | Ga0070658_10442188 | 3300005327 | Bacteria | 1120 |
| 18 | Ga0070676_10004291 | 3300005328 | Bacteria | 7488 |
| 19 | Ga0070683_100004677 | 3300005329 | Bacteria | 11310 |
| 20 | Ga0070683_100149328 | 3300005329 | Bacteria | 2215 |
| 21 | Ga0070683_100164431 | 3300005329 | Bacteria | 2105 |
| 22 | Ga0070690_100008757 | 3300005330 | Bacteria | 5842 |
| 23 | Ga0070690_100092134 | 3300005330 | Bacteria | 1998 |
| 24 | Ga0070690_100103615 | 3300005330 | Bacteria | 1889 |
| 25 | Ga0070670_100004378 | 3300005331 | Bacteria | 11820 |
| 26 | Ga0070670_100016298 | 3300005331 | Bacteria | 6382 |
| 27 | Ga0070670_100048139 | 3300005331 | Bacteria | 3668 |
| 28 | Ga0068869_100000546 | 3300005334 | Bacteria | 21018 |
| 29 | Ga0068869_100063996 | 3300005334 | Bacteria | 2704 |
| 30 | Ga0070680_100035104 | 3300005336 | Bacteria | 4047 |
| 31 | Ga0070680_100043638 | 3300005336 | Bacteria | 3642 |
| 32 | Ga0070680_100070863 | 3300005336 | Bacteria | 2864 |
| 33 | Ga0070680_100099086 | 3300005336 | Bacteria | 2418 |
| 34 | Ga0070680_100442230 | 3300005336 | Bacteria | 1110 |
| 35 | Ga0070680_100541981 | 3300005336 | Bacteria | 997 |
| 36 | Ga0070682_100003445 | 3300005337 | Bacteria | 8766 |
| 37 | Ga0070682_100110716 | 3300005337 | Bacteria | 1829 |
| 38 | Ga0068868_100012769 | 3300005338 | Bacteria | 6144 |
| 39 | Ga0068868_100209747 | 3300005338 | Bacteria | 1627 |
| 40 | Ga0070660_100006773 | 3300005339 | Bacteria | 7953 |
| 41 | Ga0070660_100036099 | 3300005339 | Bacteria | 3743 |
| 42 | Ga0070660_100039013 | 3300005339 | Bacteria | 3609 |
| 43 | Ga0070660_100217924 | 3300005339 | Bacteria | 1551 |
| 44 | Ga0070689_100002392 | 3300005340 | Bacteria | 12238 |
| 45 | Ga0070689_100023289 | 3300005340 | Bacteria | 4634 |
| 46 | Ga0070689_100054606 | 3300005340 | Bacteria | 3093 |
| 47 | Ga0070691_10003723 | 3300005341 | Bacteria | 6886 |
| 48 | Ga0070691_10094042 | 3300005341 | Bacteria | 1481 |
| 49 | Ga0070687_100001017 | 3300005343 | Bacteria | 9561 |
| 50 | Ga0070661_100004096 | 3300005344 | Bacteria | 10046 |
| 51 | Ga0070661_100191351 | 3300005344 | Bacteria | 1560 |
| 52 | Ga0070692_10004423 | 3300005345 | Bacteria | 5871 |
| 53 | Ga0070668_100008178 | 3300005347 | Bacteria | 7768 |
| 54 | Ga0070668_100047207 | 3300005347 | Bacteria | 3310 |
| 55 | Ga0070668_100497346 | 3300005347 | Bacteria | 1055 |
| 56 | Ga0070669_100009976 | 3300005353 | Bacteria | 6754 |
| 57 | Ga0070675_100010473 | 3300005354 | Bacteria | 7243 |
| 58 | Ga0070671_100033814 | 3300005355 | Bacteria | 4230 |
| 59 | Ga0070671_100076769 | 3300005355 | Bacteria | 2791 |
| 60 | Ga0070674_100027012 | 3300005356 | Bacteria | 3757 |
| 61 | Ga0070674_100088015 | 3300005356 | Bacteria | 2234 |
| 62 | Ga0070673_100000050 | 3300005364 | Bacteria | 49499 |
| 63 | Ga0070673_100057192 | 3300005364 | Bacteria | 3081 |
| 64 | Ga0070688_100000781 | 3300005365 | Bacteria | 15764 |
| 65 | Ga0070688_100005154 | 3300005365 | Bacteria | 6855 |
| 66 | Ga0070659_100036287 | 3300005366 | Bacteria | 3842 |
| 67 | Ga0070659_100336097 | 3300005366 | Bacteria | 1265 |
| 68 | Ga0070667_100007711 | 3300005367 | Bacteria | 8923 |
| 69 | Ga0070667_100114407 | 3300005367 | Bacteria | 2342 |
| 70 | Ga0070667_100266149 | 3300005367 | Bacteria | 1536 |
| 71 | Ga0070703_10029323 | 3300005406 | Unclassified | 1651 |
| 72 | Ga0070709_10002579 | 3300005434 | Bacteria | 9800 |
| 73 | Ga0070709_10015376 | 3300005434 | Bacteria | 4353 |
| 74 | Ga0070709_10117887 | 3300005434 | Bacteria | 1795 |
| 75 | Ga0070714_100006031 | 3300005435 | Bacteria | 9304 |
| 76 | Ga0070714_100058980 | 3300005435 | Bacteria | 3290 |
| 77 | Ga0070714_100263447 | 3300005435 | Bacteria | 1597 |
| 78 | Ga0070713_100017576 | 3300005436 | Bacteria | 5412 |
| 79 | Ga0070713_100055547 | 3300005436 | Bacteria | 3291 |
| 80 | Ga0070713_100056884 | 3300005436 | Bacteria | 3254 |
| 81 | Ga0070713_100243471 | 3300005436 | Bacteria | 1638 |
| 82 | Ga0070710_10003313 | 3300005437 | Bacteria | 7639 |
| 83 | Ga0070710_10021794 | 3300005437 | Bacteria | 3344 |
| 84 | Ga0070710_10092281 | 3300005437 | Bacteria | 1788 |
| 85 | Ga0070710_10153247 | 3300005437 | Bacteria | 1423 |
| 86 | Ga0070701_10002148 | 3300005438 | Bacteria | 7507 |
| 87 | Ga0070701_10437087 | 3300005438 | Bacteria | 837 |
| 88 | Ga0070711_100022517 | 3300005439 | Bacteria | 4085 |
| 89 | Ga0070711_100024455 | 3300005439 | Bacteria | 3939 |
| 90 | Ga0070711_100027086 | 3300005439 | Bacteria | 3761 |
| 91 | Ga0070705_100003118 | 3300005440 | Bacteria | 8153 |
| 92 | Ga0070700_100002692 | 3300005441 | Bacteria | 9079 |
| 93 | Ga0070694_100005972 | 3300005444 | Bacteria | 7383 |
| 94 | Ga0070708_100269960 | 3300005445 | Bacteria | 1600 |
| 95 | Ga0070663_100019695 | 3300005455 | Bacteria | 4455 |
| 96 | Ga0070663_100044767 | 3300005455 | Bacteria | 3123 |
| 97 | Ga0070663_100087995 | 3300005455 | Bacteria | 2296 |
| 98 | Ga0070663_100272077 | 3300005455 | Unclassified | 1347 |
| 99 | Ga0070663_100486178 | 3300005455 | Unclassified | 1023 |
| 100 | Ga0070678_100000518 | 3300005456 | Bacteria | 18676 |
| 101 | Ga0070678_100022233 | 3300005456 | Bacteria | 4197 |
| 102 | Ga0070678_100055812 | 3300005456 | Bacteria | 2886 |
| 103 | Ga0070678_100261512 | 3300005456 | Bacteria | 1456 |
| 104 | Ga0070678_100429698 | 3300005456 | Bacteria | 1153 |
| 105 | Ga0070662_100207506 | 3300005457 | Bacteria | 1557 |
| 106 | Ga0070681_10011624 | 3300005458 | Bacteria | 8716 |
| 107 | Ga0070681_10027987 | 3300005458 | Bacteria | 5666 |
| 108 | Ga0070681_10196314 | 3300005458 | Bacteria | 1937 |
| 109 | Ga0070681_10552107 | 3300005458 | Bacteria | 1066 |
| 110 | Ga0068867_100084087 | 3300005459 | Bacteria | 2403 |
| 111 | Ga0070685_10003674 | 3300005466 | Bacteria | 7777 |
| 112 | Ga0070685_10014330 | 3300005466 | Bacteria | 4198 |
| 113 | Ga0070707_100135839 | 3300005468 | Bacteria | 2392 |
| 114 | Ga0070699_100010972 | 3300005518 | Bacteria | 7834 |
| 115 | Ga0070679_100004048 | 3300005530 | Bacteria | 13502 |
| 116 | Ga0070679_100007667 | 3300005530 | Bacteria | 10102 |
| 117 | Ga0070679_100038301 | 3300005530 | Bacteria | 4766 |
| 118 | Ga0070679_100103442 | 3300005530 | Bacteria | 2834 |
| 119 | Ga0070679_100157769 | 3300005530 | Bacteria | 2243 |
| 120 | Ga0070684_100004205 | 3300005535 | Bacteria | 10907 |
| 121 | Ga0070697_100245505 | 3300005536 | Bacteria | 1530 |
| 122 | Ga0070697_100652942 | 3300005536 | Bacteria | 926 |
| 123 | Ga0068853_100042900 | 3300005539 | Bacteria | 3869 |
| 124 | Ga0068853_100718527 | 3300005539 | Bacteria | 954 |
| 125 | Ga0070672_100000643 | 3300005543 | Bacteria | 20456 |
| 126 | Ga0070686_100081135 | 3300005544 | Bacteria | 2147 |
| 127 | Ga0070695_100127165 | 3300005545 | Bacteria | 1751 |
| 128 | Ga0070696_100147295 | 3300005546 | Bacteria | 1725 |
| 129 | Ga0070693_100010080 | 3300005547 | Bacteria | 4718 |
| 130 | Ga0070693_100015464 | 3300005547 | Bacteria | 3930 |
| 131 | Ga0070665_100004366 | 3300005548 | Bacteria | 14875 |
| 132 | Ga0070665_100098694 | 3300005548 | Bacteria | 2925 |
| 133 | Ga0070665_100107354 | 3300005548 | Bacteria | 2794 |
| 134 | Ga0070665_100205970 | 3300005548 | Bacteria | 1968 |
| 135 | Ga0070704_100007534 | 3300005549 | Bacteria | 6481 |
| 136 | Ga0068855_100035984 | 3300005563 | Bacteria | 5895 |
| 137 | Ga0068855_100263615 | 3300005563 | Bacteria | 1919 |
| 138 | Ga0070664_100045869 | 3300005564 | Bacteria | 3691 |
| 139 | Ga0070664_100061029 | 3300005564 | Bacteria | 3212 |
| 140 | Ga0070664_100273849 | 3300005564 | Bacteria | 1521 |
| 141 | Ga0068857_100001038 | 3300005577 | Bacteria | 21487 |
| 142 | Ga0068857_100193234 | 3300005577 | Bacteria | 1854 |
| 143 | Ga0068854_100154785 | 3300005578 | Bacteria | 1770 |
| 144 | Ga0068856_100009104 | 3300005614 | Bacteria | 9654 |
| 145 | Ga0068856_100216401 | 3300005614 | Bacteria | 1931 |
| 146 | Ga0068856_100705853 | 3300005614 | Bacteria | 1029 |
| 147 | Ga0070702_100003907 | 3300005615 | Bacteria | 6754 |
| 148 | Ga0070702_100045550 | 3300005615 | Bacteria | 2482 |
| 149 | Ga0070702_100280699 | 3300005615 | Bacteria | 1143 |
| 150 | Ga0068852_100024049 | 3300005616 | Bacteria | 4916 |
| 151 | Ga0068852_100342276 | 3300005616 | Bacteria | 1458 |
| 152 | Ga0068859_100125159 | 3300005617 | Bacteria | 2639 |
| 153 | Ga0068859_100337060 | 3300005617 | Bacteria | 1602 |
| 154 | Ga0068859_100582430 | 3300005617 | Bacteria | 1212 |
| 155 | Ga0068859_101001040 | 3300005617 | Bacteria | 918 |
| 156 | Ga0068864_100001882 | 3300005618 | Bacteria | 17235 |
| 157 | Ga0068864_100227008 | 3300005618 | Bacteria | 1725 |
| 158 | Ga0068864_100237471 | 3300005618 | Bacteria | 1688 |
| 159 | Ga0068866_10000791 | 3300005718 | Bacteria | 14174 |
| 160 | Ga0068866_10028400 | 3300005718 | Bacteria | 2665 |
| 161 | Ga0068861_100002491 | 3300005719 | Bacteria | 12008 |
| 162 | Ga0068870_10001431 | 3300005840 | Bacteria | 9645 |
| 163 | Ga0068870_10026649 | 3300005840 | Bacteria | 2883 |
| 164 | Ga0068863_100031598 | 3300005841 | Bacteria | 5051 |
| 165 | Ga0068863_100097902 | 3300005841 | Bacteria | 2786 |
| 166 | Ga0068863_100155588 | 3300005841 | Bacteria | 2189 |
| 167 | Ga0068858_100028785 | 3300005842 | Bacteria | 5159 |
| 168 | Ga0068858_100050653 | 3300005842 | Bacteria | 3843 |
| 169 | Ga0068858_100131690 | 3300005842 | Bacteria | 2345 |
| 170 | Ga0068860_100002530 | 3300005843 | Bacteria | 19153 |
| 171 | Ga0068860_100213517 | 3300005843 | Bacteria | 1872 |
| 172 | Ga0068860_100380951 | 3300005843 | Bacteria | 1392 |
| 173 | Ga0068862_100011700 | 3300005844 | Bacteria | 7241 |
| 174 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 175 | Ga0081455_10016554 | 3300005937 | Bacteria | 7113 |
| 176 | Ga0081455_10034433 | 3300005937 | Bacteria | 4537 |
| 177 | Ga0081455_10049916 | 3300005937 | Bacteria | 3603 |
| 178 | Ga0081455_10082000 | 3300005937 | Bacteria | 2639 |
| 179 | Ga0081455_10138580 | 3300005937 | Bacteria | 1892 |
| 180 | Ga0081538_10108327 | 3300005981 | Bacteria | 1372 |
| 181 | Ga0081540_1000027 | 3300005983 | Bacteria | 151880 |
| 182 | Ga0081540_1003265 | 3300005983 | Bacteria | 12889 |
| 183 | Ga0081540_1025762 | 3300005983 | Bacteria | 3375 |
| 184 | Ga0081539_10001260 | 3300005985 | Bacteria | 44845 |
| 185 | Ga0081539_10029936 | 3300005985 | Bacteria | 3390 |
| 186 | Ga0070717_10000485 | 3300006028 | Bacteria | 25249 |
| 187 | Ga0070717_10000980 | 3300006028 | Bacteria | 19102 |
| 188 | Ga0070717_10494912 | 3300006028 | Bacteria | 1104 |
| 189 | Ga0075365_10001829 | 3300006038 | Bacteria | 9956 |
| 190 | Ga0075365_10001918 | 3300006038 | Bacteria | 9807 |
| 191 | Ga0075365_10018393 | 3300006038 | Bacteria | 4295 |
| 192 | Ga0075365_10238853 | 3300006038 | Bacteria | 1276 |
| 193 | Ga0075368_10023549 | 3300006042 | Bacteria | 2353 |
| 194 | Ga0075363_100067153 | 3300006048 | Bacteria | 1942 |
| 195 | Ga0075364_10010606 | 3300006051 | Bacteria | 5573 |
| 196 | Ga0070715_10000289 | 3300006163 | Bacteria | 12366 |
| 197 | Ga0070715_10001137 | 3300006163 | Bacteria | 7597 |
| 198 | Ga0070716_100004371 | 3300006173 | Bacteria | 6749 |
| 199 | Ga0070716_100085838 | 3300006173 | Bacteria | 1892 |
| 200 | Ga0070712_100000210 | 3300006175 | Bacteria | 32927 |
| 201 | Ga0070712_100000381 | 3300006175 | Bacteria | 25274 |
| 202 | Ga0070712_100003511 | 3300006175 | Bacteria | 9649 |
| 203 | Ga0075362_10004834 | 3300006177 | Bacteria | 4866 |
| 204 | Ga0075367_10049089 | 3300006178 | Bacteria | 2487 |
| 205 | Ga0075367_10087502 | 3300006178 | Bacteria | 1892 |
| 206 | Ga0075366_10075432 | 3300006195 | Bacteria | 2012 |
| 207 | Ga0075366_10316823 | 3300006195 | Unclassified | 955 |
| 208 | Ga0097621_100001425 | 3300006237 | Bacteria | 16408 |
| 209 | Ga0097621_100002618 | 3300006237 | Bacteria | 12322 |
| 210 | Ga0097621_100070217 | 3300006237 | Bacteria | 2892 |
| 211 | Ga0075370_10076893 | 3300006353 | Bacteria | 1915 |
| 212 | Ga0068871_100006790 | 3300006358 | Bacteria | 8135 |
| 213 | Ga0068871_100016863 | 3300006358 | Bacteria | 5513 |
| 214 | Ga0068871_100124129 | 3300006358 | Bacteria | 2184 |
| 215 | Ga0068871_100731276 | 3300006358 | Bacteria | 908 |
| 216 | Ga0075428_100015591 | 3300006844 | Bacteria | 8426 |
| 217 | Ga0075428_100500760 | 3300006844 | Bacteria | 1300 |
| 218 | Ga0075428_100557035 | 3300006844 | Bacteria | 1225 |
| 219 | Ga0075428_100863425 | 3300006844 | Bacteria | 961 |
| 220 | Ga0075430_100099742 | 3300006846 | Bacteria | 2425 |
| 221 | Ga0075430_100196520 | 3300006846 | Bacteria | 1676 |
| 222 | Ga0075431_100067535 | 3300006847 | Bacteria | 3691 |
| 223 | Ga0075431_100079885 | 3300006847 | Bacteria | 3376 |
| 224 | Ga0075431_100441514 | 3300006847 | Bacteria | 1298 |
| 225 | Ga0075433_10109293 | 3300006852 | Bacteria | 2453 |
| 226 | Ga0075433_10199409 | 3300006852 | Bacteria | 1780 |
| 227 | Ga0075434_100004560 | 3300006871 | Bacteria | 12511 |
| 228 | Ga0075434_100031153 | 3300006871 | Bacteria | 5256 |
| 229 | Ga0075434_100035379 | 3300006871 | Bacteria | 4938 |
| 230 | Ga0075434_100043586 | 3300006871 | Bacteria | 4450 |
| 231 | Ga0075434_100052243 | 3300006871 | Bacteria | 4060 |
| 232 | Ga0075434_100053877 | 3300006871 | Bacteria | 3996 |
| 233 | Ga0075434_100083203 | 3300006871 | Bacteria | 3198 |
| 234 | Ga0075434_100132457 | 3300006871 | Bacteria | 2512 |
| 235 | Ga0075434_100188580 | 3300006871 | Bacteria | 2082 |
| 236 | Ga0075434_100383708 | 3300006871 | Bacteria | 1426 |
| 237 | Ga0075429_100058070 | 3300006880 | Bacteria | 3370 |
| 238 | Ga0068865_100001097 | 3300006881 | Bacteria | 15622 |
| 239 | Ga0068865_100078168 | 3300006881 | Bacteria | 2366 |
| 240 | Ga0068865_100411765 | 3300006881 | Bacteria | 1109 |
| 241 | Ga0075436_100008403 | 3300006914 | Bacteria | 7059 |
| 242 | Ga0075436_100334795 | 3300006914 | Bacteria | 1089 |
| 243 | Ga0097620_100125151 | 3300006931 | Bacteria | 2639 |
| 244 | Ga0097620_100337073 | 3300006931 | Bacteria | 1602 |
| 245 | Ga0097620_100582456 | 3300006931 | Bacteria | 1212 |
| 246 | Ga0097620_101000998 | 3300006931 | Bacteria | 918 |
| 247 | Ga0075435_100014832 | 3300007076 | Bacteria | 5841 |
| 248 | Ga0075435_100054758 | 3300007076 | Bacteria | 3220 |
| 249 | Ga0075435_100134421 | 3300007076 | Bacteria | 2071 |
| 250 | Ga0075435_100251387 | 3300007076 | Bacteria | 1505 |
| 251 | Ga0075435_100518526 | 3300007076 | Bacteria | 1031 |
| 252 | Ga0099795_10021163 | 3300007788 | Bacteria | 2129 |
| 253 | Ga0105240_10067050 | 3300009093 | Bacteria | 4450 |
| 254 | Ga0105240_10135711 | 3300009093 | Bacteria | 2947 |
| 255 | Ga0111539_10011548 | 3300009094 | Bacteria | 11084 |
| 256 | Ga0111539_10026539 | 3300009094 | Bacteria | 7080 |
| 257 | Ga0111539_10050713 | 3300009094 | Bacteria | 4944 |
| 258 | Ga0111539_10196327 | 3300009094 | Bacteria | 2354 |
| 259 | Ga0111539_10203357 | 3300009094 | Bacteria | 2309 |
| 260 | Ga0105245_10004787 | 3300009098 | Bacteria | 11946 |
| 261 | Ga0105245_10197564 | 3300009098 | Bacteria | 1930 |
| 262 | Ga0105245_10319031 | 3300009098 | Bacteria | 1530 |
| 263 | Ga0105247_10003270 | 3300009101 | Bacteria | 10626 |
| 264 | Ga0105247_10018149 | 3300009101 | Bacteria | 4219 |
| 265 | Ga0105247_10024753 | 3300009101 | Bacteria | 3619 |
| 266 | Ga0105247_10141527 | 3300009101 | Unclassified | 1577 |
| 267 | Ga0105247_10378015 | 3300009101 | Bacteria | 1003 |
| 268 | Ga0114129_10001669 | 3300009147 | Bacteria | 30222 |
| 269 | Ga0114129_10006740 | 3300009147 | Bacteria | 16309 |
| 270 | Ga0114129_10024067 | 3300009147 | Bacteria | 8629 |
| 271 | Ga0114129_10035205 | 3300009147 | Bacteria | 7074 |
| 272 | Ga0114129_10166040 | 3300009147 | Bacteria | 3012 |
| 273 | Ga0114129_10309068 | 3300009147 | Bacteria | 2105 |
| 274 | Ga0114129_10510661 | 3300009147 | Bacteria | 1568 |
| 275 | Ga0114129_10542927 | 3300009147 | Bacteria | 1513 |
| 276 | Ga0105243_10002400 | 3300009148 | Bacteria | 15707 |
| 277 | Ga0105243_10004402 | 3300009148 | Bacteria | 11139 |
| 278 | Ga0105243_10088625 | 3300009148 | Bacteria | 2542 |
| 279 | Ga0105241_10008636 | 3300009174 | Bacteria | 7488 |
| 280 | Ga0105241_10012784 | 3300009174 | Bacteria | 6160 |
| 281 | Ga0105241_10470102 | 3300009174 | Bacteria | 1116 |
| 282 | Ga0105242_10007578 | 3300009176 | Bacteria | 8356 |
| 283 | Ga0105242_10023432 | 3300009176 | Bacteria | 4864 |
| 284 | Ga0105242_10156399 | 3300009176 | Bacteria | 1992 |
| 285 | Ga0105248_10010839 | 3300009177 | Bacteria | 10064 |
| 286 | Ga0105248_10014218 | 3300009177 | Bacteria | 8762 |
| 287 | Ga0105248_10049787 | 3300009177 | Bacteria | 4698 |
| 288 | Ga0105248_10237669 | 3300009177 | Bacteria | 2051 |
| 289 | Ga0105237_10158136 | 3300009545 | Bacteria | 2263 |
| 290 | Ga0105238_10015699 | 3300009551 | Bacteria | 7667 |
| 291 | Ga0105238_10063358 | 3300009551 | Bacteria | 3697 |
| 292 | Ga0105238_10083461 | 3300009551 | Bacteria | 3184 |
| 293 | Ga0105249_10336778 | 3300009553 | Bacteria | 1524 |
| 294 | Ga0099796_10002132 | 3300010159 | Bacteria | 4257 |
| 295 | Ga0105246_10025827 | 3300011119 | Bacteria | 3830 |
| 296 | Ga0105246_10041134 | 3300011119 | Bacteria | 3122 |
| 297 | Ga0157342_1003062 | 3300012507 | Bacteria | 1409 |
| 298 | Ga0157373_10099718 | 3300013100 | Bacteria | 2044 |
| 299 | Ga0157371_10158753 | 3300013102 | Bacteria | 1615 |
| 300 | Ga0157369_10307822 | 3300013105 | Bacteria | 1648 |
| 301 | Ga0157374_10001167 | 3300013296 | Bacteria | 22404 |
| 302 | Ga0157374_10095661 | 3300013296 | Bacteria | 2840 |
| 303 | Ga0157374_10344591 | 3300013296 | Bacteria | 1480 |
| 304 | Ga0157378_10008023 | 3300013297 | Bacteria | 9217 |
| 305 | Ga0157378_10020136 | 3300013297 | Bacteria | 5867 |
| 306 | Ga0157378_10034938 | 3300013297 | Bacteria | 4444 |
| 307 | Ga0157378_10088994 | 3300013297 | Bacteria | 2803 |
| 308 | Ga0163162_10010853 | 3300013306 | Bacteria | 8866 |
| 309 | Ga0163162_10194670 | 3300013306 | Bacteria | 2156 |
| 310 | Ga0157372_10070864 | 3300013307 | Bacteria | 3923 |
| 311 | Ga0157372_10216912 | 3300013307 | Bacteria | 2218 |
| 312 | Ga0157375_10031874 | 3300013308 | Bacteria | 4992 |
| 313 | Ga0163163_10007288 | 3300014325 | Bacteria | 9756 |
| 314 | Ga0163163_10011174 | 3300014325 | Bacteria | 8131 |
| 315 | Ga0163163_10041756 | 3300014325 | Bacteria | 4487 |
| 316 | Ga0163163_10450329 | 3300014325 | Bacteria | 1347 |
| 317 | Ga0157380_10001551 | 3300014326 | Bacteria | 15111 |
| 318 | Ga0157380_10059935 | 3300014326 | Bacteria | 3039 |
| 319 | Ga0157377_10070737 | 3300014745 | Bacteria | 2016 |
| 320 | Ga0157379_10008646 | 3300014968 | Bacteria | 8866 |
| 321 | Ga0157379_10202713 | 3300014968 | Unclassified | 1794 |
| 322 | Ga0157379_10591223 | 3300014968 | Bacteria | 1035 |
| 323 | Ga0157376_10062718 | 3300014969 | Bacteria | 3128 |
| 324 | Ga0157376_11108952 | 3300014969 | Bacteria | 817 |
| 325 | Ga0157376_11109594 | 3300014969 | Bacteria | 817 |
| 326 | Ga0213876_10104415 | 3300021384 | Bacteria | 1503 |
| 327 | Ga0228598_1031928 | 3300024227 | Bacteria | 1037 |
| 328 | Ga0207666_1000153 | 3300025271 | Bacteria | 10663 |
| 329 | Ga0209758_1000125 | 3300025297 | Bacteria | 189869 |
| 330 | Ga0209758_1019110 | 3300025297 | Bacteria | 3324 |
| 331 | Ga0207426_1000573 | 3300025302 | Bacteria | 49440 |
| 332 | Ga0207697_10001059 | 3300025315 | Bacteria | 15198 |
| 333 | Ga0207682_10002885 | 3300025893 | Bacteria | 7586 |
| 334 | Ga0207692_10000282 | 3300025898 | Bacteria | 17493 |
| 335 | Ga0207692_10020210 | 3300025898 | Bacteria | 3024 |
| 336 | Ga0207692_10076128 | 3300025898 | Bacteria | 1782 |
| 337 | Ga0207642_10000385 | 3300025899 | Bacteria | 13210 |
| 338 | Ga0207642_10024406 | 3300025899 | Bacteria | 2430 |
| 339 | Ga0207710_10000382 | 3300025900 | Bacteria | 30360 |
| 340 | Ga0207710_10065532 | 3300025900 | Bacteria | 1656 |
| 341 | Ga0207688_10001072 | 3300025901 | Bacteria | 13993 |
| 342 | Ga0207688_10004597 | 3300025901 | Bacteria | 7515 |
| 343 | Ga0207680_10046034 | 3300025903 | Bacteria | 2577 |
| 344 | Ga0207647_10033262 | 3300025904 | Bacteria | 3302 |
| 345 | Ga0207647_10048650 | 3300025904 | Bacteria | 2632 |
| 346 | Ga0207685_10002544 | 3300025905 | Bacteria | 4206 |
| 347 | Ga0207685_10006711 | 3300025905 | Bacteria | 3157 |
| 348 | Ga0207699_10012918 | 3300025906 | Bacteria | 4257 |
| 349 | Ga0207699_10032604 | 3300025906 | Bacteria | 2936 |
| 350 | Ga0207699_10053630 | 3300025906 | Bacteria | 2391 |
| 351 | Ga0207699_10185222 | 3300025906 | Bacteria | 1402 |
| 352 | Ga0207645_10002745 | 3300025907 | Bacteria | 13711 |
| 353 | Ga0207645_10110760 | 3300025907 | Bacteria | 1777 |
| 354 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 355 | Ga0207643_10000532 | 3300025908 | Bacteria | 24445 |
| 356 | Ga0207705_10252777 | 3300025909 | Bacteria | 1344 |
| 357 | Ga0207705_10260064 | 3300025909 | Bacteria | 1325 |
| 358 | Ga0207684_10009569 | 3300025910 | Bacteria | 8549 |
| 359 | Ga0207654_10008032 | 3300025911 | Bacteria | 5318 |
| 360 | Ga0207707_10014644 | 3300025912 | Bacteria | 6833 |
| 361 | Ga0207707_10095432 | 3300025912 | Bacteria | 2599 |
| 362 | Ga0207707_10149498 | 3300025912 | Bacteria | 2042 |
| 363 | Ga0207707_10257582 | 3300025912 | Bacteria | 1514 |
| 364 | Ga0207695_10535643 | 3300025913 | Bacteria | 1052 |
| 365 | Ga0207671_10382544 | 3300025914 | Bacteria | 1118 |
| 366 | Ga0207693_10001038 | 3300025915 | Bacteria | 24865 |
| 367 | Ga0207693_10002870 | 3300025915 | Bacteria | 14928 |
| 368 | Ga0207693_10021249 | 3300025915 | Bacteria | 5158 |
| 369 | Ga0207693_10051413 | 3300025915 | Bacteria | 3233 |
| 370 | Ga0207693_10111293 | 3300025915 | Bacteria | 2148 |
| 371 | Ga0207693_10113805 | 3300025915 | Bacteria | 2123 |
| 372 | Ga0207663_10001206 | 3300025916 | Bacteria | 11940 |
| 373 | Ga0207663_10020826 | 3300025916 | Bacteria | 3722 |
| 374 | Ga0207663_10182611 | 3300025916 | Bacteria | 1499 |
| 375 | Ga0207660_10084417 | 3300025917 | Bacteria | 2341 |
| 376 | Ga0207660_10108359 | 3300025917 | Bacteria | 2086 |
| 377 | Ga0207660_10171963 | 3300025917 | Bacteria | 1677 |
| 378 | Ga0207660_10504782 | 3300025917 | Bacteria | 981 |
| 379 | Ga0207662_10000392 | 3300025918 | Bacteria | 19588 |
| 380 | Ga0207662_10009678 | 3300025918 | Bacteria | 5313 |
| 381 | Ga0207657_10002007 | 3300025919 | Bacteria | 22003 |
| 382 | Ga0207657_10007818 | 3300025919 | Bacteria | 10913 |
| 383 | Ga0207657_10019229 | 3300025919 | Bacteria | 6492 |
| 384 | Ga0207657_10124539 | 3300025919 | Bacteria | 2118 |
| 385 | Ga0207649_10005404 | 3300025920 | Bacteria | 6918 |
| 386 | Ga0207649_10176514 | 3300025920 | Bacteria | 1492 |
| 387 | Ga0207649_10237596 | 3300025920 | Bacteria | 1306 |
| 388 | Ga0207652_10040807 | 3300025921 | Bacteria | 3942 |
| 389 | Ga0207652_10057538 | 3300025921 | Bacteria | 3349 |
| 390 | Ga0207681_10203774 | 3300025923 | Bacteria | 1520 |
| 391 | Ga0207694_10036064 | 3300025924 | Bacteria | 3794 |
| 392 | Ga0207694_10052161 | 3300025924 | Bacteria | 3171 |
| 393 | Ga0207650_10017240 | 3300025925 | Bacteria | 5055 |
| 394 | Ga0207650_10180047 | 3300025925 | Bacteria | 1684 |
| 395 | Ga0207650_10226842 | 3300025925 | Bacteria | 1505 |
| 396 | Ga0207659_10000374 | 3300025926 | Bacteria | 26976 |
| 397 | Ga0207687_10001956 | 3300025927 | Bacteria | 14176 |
| 398 | Ga0207687_10003333 | 3300025927 | Bacteria | 10848 |
| 399 | Ga0207687_10416250 | 3300025927 | Bacteria | 1108 |
| 400 | Ga0207700_10029040 | 3300025928 | Bacteria | 3898 |
| 401 | Ga0207700_10054514 | 3300025928 | Bacteria | 3002 |
| 402 | Ga0207700_10063040 | 3300025928 | Bacteria | 2818 |
| 403 | Ga0207700_10132844 | 3300025928 | Bacteria | 2035 |
| 404 | Ga0207664_10012974 | 3300025929 | Bacteria | 5970 |
| 405 | Ga0207664_10294781 | 3300025929 | Bacteria | 1426 |
| 406 | Ga0207644_10004888 | 3300025931 | Bacteria | 8732 |
| 407 | Ga0207690_10022501 | 3300025932 | Bacteria | 3923 |
| 408 | Ga0207706_10017396 | 3300025933 | Bacteria | 6476 |
| 409 | Ga0207706_10093282 | 3300025933 | Bacteria | 2648 |
| 410 | Ga0207686_10028626 | 3300025934 | Bacteria | 3277 |
| 411 | Ga0207686_10108717 | 3300025934 | Bacteria | 1866 |
| 412 | Ga0207709_10008652 | 3300025935 | Bacteria | 5620 |
| 413 | Ga0207670_10121973 | 3300025936 | Unclassified | 1896 |
| 414 | Ga0207670_10303769 | 3300025936 | Bacteria | 1250 |
| 415 | Ga0207670_10478287 | 3300025936 | Bacteria | 1008 |
| 416 | Ga0207669_10000275 | 3300025937 | Bacteria | 23591 |
| 417 | Ga0207669_10011700 | 3300025937 | Bacteria | 4283 |
| 418 | Ga0207704_10016005 | 3300025938 | Bacteria | 3842 |
| 419 | Ga0207704_10022163 | 3300025938 | Bacteria | 3397 |
| 420 | Ga0207704_10087365 | 3300025938 | Bacteria | 2036 |
| 421 | Ga0207665_10000541 | 3300025939 | Bacteria | 25458 |
| 422 | Ga0207665_10011153 | 3300025939 | Bacteria | 5896 |
| 423 | Ga0207665_10013741 | 3300025939 | Bacteria | 5325 |
| 424 | Ga0207665_10403257 | 3300025939 | Bacteria | 1042 |
| 425 | Ga0207691_10004396 | 3300025940 | Bacteria | 13666 |
| 426 | Ga0207691_10030766 | 3300025940 | Bacteria | 5014 |
| 427 | Ga0207711_10007738 | 3300025941 | Bacteria | 8978 |
| 428 | Ga0207711_10021126 | 3300025941 | Bacteria | 5438 |
| 429 | Ga0207711_10047684 | 3300025941 | Bacteria | 3664 |
| 430 | Ga0207689_10002724 | 3300025942 | Bacteria | 16345 |
| 431 | Ga0207689_10009477 | 3300025942 | Bacteria | 8407 |
| 432 | Ga0207689_10576332 | 3300025942 | Bacteria | 946 |
| 433 | Ga0207661_10055077 | 3300025944 | Bacteria | 3188 |
| 434 | Ga0207661_10148872 | 3300025944 | Bacteria | 2022 |
| 435 | Ga0207679_10001617 | 3300025945 | Bacteria | 14034 |
| 436 | Ga0207679_10039424 | 3300025945 | Bacteria | 3373 |
| 437 | Ga0207679_10156602 | 3300025945 | Bacteria | 1861 |
| 438 | Ga0207679_10211104 | 3300025945 | Bacteria | 1628 |
| 439 | Ga0207679_10235872 | 3300025945 | Bacteria | 1547 |
| 440 | Ga0207679_10333306 | 3300025945 | Bacteria | 1317 |
| 441 | Ga0207667_10234750 | 3300025949 | Bacteria | 1877 |
| 442 | Ga0207651_10127427 | 3300025960 | Bacteria | 1942 |
| 443 | Ga0207651_10292182 | 3300025960 | Bacteria | 1352 |
| 444 | Ga0207712_10045788 | 3300025961 | Bacteria | 3031 |
| 445 | Ga0207668_10118862 | 3300025972 | Bacteria | 1997 |
| 446 | Ga0207668_10144878 | 3300025972 | Unclassified | 1831 |
| 447 | Ga0207640_10005141 | 3300025981 | Bacteria | 7114 |
| 448 | Ga0207658_10038686 | 3300025986 | Bacteria | 3438 |
| 449 | Ga0207658_10076749 | 3300025986 | Bacteria | 2547 |
| 450 | Ga0207658_10163522 | 3300025986 | Bacteria | 1826 |
| 451 | Ga0207677_10044426 | 3300026023 | Bacteria | 2960 |
| 452 | Ga0207677_10172528 | 3300026023 | Bacteria | 1693 |
| 453 | Ga0207703_10001822 | 3300026035 | Bacteria | 19007 |
| 454 | Ga0207703_10019332 | 3300026035 | Bacteria | 5322 |
| 455 | Ga0207703_10511580 | 3300026035 | Bacteria | 1128 |
| 456 | Ga0207639_10491558 | 3300026041 | Bacteria | 1120 |
| 457 | Ga0207678_10002471 | 3300026067 | Bacteria | 16791 |
| 458 | Ga0207678_10020636 | 3300026067 | Bacteria | 5775 |
| 459 | Ga0207678_10020641 | 3300026067 | Bacteria | 5775 |
| 460 | Ga0207678_10258142 | 3300026067 | Unclassified | 1493 |
| 461 | Ga0207678_10267055 | 3300026067 | Bacteria | 1467 |
| 462 | Ga0207678_10338961 | 3300026067 | Bacteria | 1295 |
| 463 | Ga0207708_10001992 | 3300026075 | Bacteria | 15035 |
| 464 | Ga0207702_10134688 | 3300026078 | Bacteria | 2227 |
| 465 | Ga0207702_10266006 | 3300026078 | Bacteria | 1616 |
| 466 | Ga0207702_10310503 | 3300026078 | Bacteria | 1499 |
| 467 | Ga0207641_10013221 | 3300026088 | Bacteria | 6768 |
| 468 | Ga0207641_10113659 | 3300026088 | Bacteria | 2405 |
| 469 | Ga0207641_10132858 | 3300026088 | Bacteria | 2237 |
| 470 | Ga0207641_10222589 | 3300026088 | Bacteria | 1750 |
| 471 | Ga0207648_10004767 | 3300026089 | Bacteria | 13850 |
| 472 | Ga0207648_10169900 | 3300026089 | Bacteria | 1927 |
| 473 | Ga0207676_10002246 | 3300026095 | Bacteria | 13878 |
| 474 | Ga0207676_10014005 | 3300026095 | Bacteria | 5758 |
| 475 | Ga0207676_10541017 | 3300026095 | Bacteria | 1111 |
| 476 | Ga0207674_10007733 | 3300026116 | Bacteria | 12510 |
| 477 | Ga0207674_10077985 | 3300026116 | Bacteria | 3318 |
| 478 | Ga0207675_100007986 | 3300026118 | Bacteria | 9973 |
| 479 | Ga0207675_100131771 | 3300026118 | Bacteria | 2371 |
| 480 | Ga0207683_10002044 | 3300026121 | Bacteria | 17862 |
| 481 | Ga0207683_10063915 | 3300026121 | Bacteria | 3242 |
| 482 | Ga0207698_10150582 | 3300026142 | Unclassified | 2018 |
| 483 | Ga0207698_10483027 | 3300026142 | Bacteria | 1202 |
| 484 | Ga0207698_10671905 | 3300026142 | Bacteria | 1028 |
| 485 | Ga0207428_10000501 | 3300027907 | Bacteria | 46798 |
| 486 | Ga0265357_1000379 | 3300028023 | Bacteria | 2483 |
| 487 | Ga0268266_10003041 | 3300028379 | Bacteria | 17192 |
| 488 | Ga0268266_10217814 | 3300028379 | Bacteria | 1753 |
| 489 | Ga0268265_10016446 | 3300028380 | Bacteria | 5082 |
| 490 | Ga0268265_10027065 | 3300028380 | Bacteria | 4088 |
| 491 | Ga0268264_10339522 | 3300028381 | Bacteria | 1426 |
| 492 | Ga0268264_10849295 | 3300028381 | Bacteria | 914 |
| 493 | Ga0265318_10024190 | 3300028577 | Bacteria | 2412 |
| 494 | Ga0265338_10028004 | 3300028800 | Bacteria | 5634 |
| 495 | Ga0265338_10140153 | 3300028800 | Bacteria | 1895 |
| 496 | Ga0265330_10004272 | 3300031235 | Bacteria | 7274 |
| 497 | Ga0265330_10076126 | 3300031235 | Bacteria | 1448 |
| 498 | Ga0265332_10000839 | 3300031238 | Bacteria | 18678 |
| 499 | Ga0265332_10011394 | 3300031238 | Bacteria | 3953 |
| 500 | Ga0265320_10006465 | 3300031240 | Bacteria | 7386 |
| 501 | Ga0265325_10000073 | 3300031241 | Bacteria | 70109 |
| 502 | Ga0265325_10001135 | 3300031241 | Bacteria | 19104 |
| 503 | Ga0265325_10014684 | 3300031241 | Bacteria | 4419 |
| 504 | Ga0265325_10044216 | 3300031241 | Bacteria | 2320 |
| 505 | Ga0265325_10045055 | 3300031241 | Bacteria | 2294 |
| 506 | Ga0265329_10012107 | 3300031242 | Bacteria | 3113 |
| 507 | Ga0265329_10025533 | 3300031242 | Bacteria | 1954 |
| 508 | Ga0265340_10000382 | 3300031247 | Bacteria | 23632 |
| 509 | Ga0265340_10009552 | 3300031247 | Bacteria | 5201 |
| 510 | Ga0265339_10001051 | 3300031249 | Bacteria | 20994 |
| 511 | Ga0265339_10002691 | 3300031249 | Bacteria | 12639 |
| 512 | Ga0265339_10062900 | 3300031249 | Bacteria | 1994 |
| 513 | Ga0265339_10101044 | 3300031249 | Bacteria | 1501 |
| 514 | Ga0265331_10019051 | 3300031250 | Bacteria | 3548 |
| 515 | Ga0265331_10065609 | 3300031250 | Bacteria | 1706 |
| 516 | Ga0265316_10110271 | 3300031344 | Bacteria | 2084 |
| 517 | Ga0265313_10000024 | 3300031595 | Bacteria | 138587 |
| 518 | Ga0265313_10000716 | 3300031595 | Bacteria | 34149 |
| 519 | Ga0265313_10016138 | 3300031595 | Bacteria | 4310 |
| 520 | Ga0265313_10022124 | 3300031595 | Bacteria | 3457 |
| 521 | Ga0265313_10054389 | 3300031595 | Bacteria | 1901 |
| 522 | Ga0265313_10085404 | 3300031595 | Bacteria | 1426 |
| 523 | Ga0265314_10002492 | 3300031711 | Bacteria | 18802 |
| 524 | Ga0265314_10038121 | 3300031711 | Bacteria | 3476 |
| 525 | Ga0265342_10000179 | 3300031712 | Bacteria | 70615 |
| 526 | Ga0265342_10000308 | 3300031712 | Bacteria | 55378 |
| 527 | Ga0265342_10069743 | 3300031712 | Bacteria | 2052 |
| 528 | Ga0265342_10088723 | 3300031712 | Bacteria | 1775 |
| 529 | Ga0265342_10094730 | 3300031712 | Bacteria | 1708 |
| 530 | Ga0265342_10104608 | 3300031712 | Bacteria | 1608 |
| 531 | Ga0307409_100728911 | 3300031995 | Bacteria | 993 |
| 532 | Ga0373930_0001440 | 3300034816 | Bacteria | 3539 |
| 533 | Ga0373950_0002146 | 3300034818 | Bacteria | 2683 |
| 534 | Ga0373950_0013499 | 3300034818 | Bacteria | 1364 |
| 535 | Ga0373938_0018629 | 3300034957 | Bacteria | 1380 |
| 536 | Ga0373926_0027127 | 3300035083 | Bacteria | 2005 |
| 537 | Ga0373928_0005721 | 3300035084 | Bacteria | 2377 |
| 538 | Ga0373928_0025134 | 3300035084 | Bacteria | 1282 |
| 539 | Ga0373928_0034523 | 3300035084 | Bacteria | 1136 |
| 540 | Ga0373934_0079192 | 3300035086 | Bacteria | 1319 |
| 541 | Ga0373944_0021028 | 3300035089 | Bacteria | 1885 |
| 542 | Ga0373949_0001783 | 3300035090 | Bacteria | 5906 |
| 543 | Ga0373923_0009905 | 3300035111 | Bacteria | 3452 |
| 544 | Ga0373923_0160727 | 3300035111 | Bacteria | 1025 |
| 545 | Ga0373932_0088132 | 3300035112 | Bacteria | 991 |
| 546 | Ga0373936_0153426 | 3300035113 | Bacteria | 999 |
| 547 | Ga0373941_0003872 | 3300035115 | Bacteria | 3427 |
| 548 | Ga0373941_0007122 | 3300035115 | Bacteria | 2724 |
| 549 | Ga0373945_0018268 | 3300035116 | Bacteria | 2384 |
| 550 | Ga0373945_0061574 | 3300035116 | Bacteria | 1402 |
| 551 | Ga0373953_0002856 | 3300035117 | Bacteria | 5267 |
| 552 | Ga0373954_0009066 | 3300035118 | Bacteria | 4375 |
| 553 | Ga0373954_0010543 | 3300035118 | Bacteria | 4080 |
| 554 | Ga0373956_0001142 | 3300035119 | Bacteria | 10971 |
| 555 | Ga0373956_0050075 | 3300035119 | Bacteria | 1874 |
| 556 | Ga0373956_0072650 | 3300035119 | Bacteria | 1571 |
| 557 | Ga0373957_0003057 | 3300035120 | Bacteria | 4875 |
| 558 | Ga0373957_0014833 | 3300035120 | Bacteria | 2670 |
| 559 | Ga0373957_0028081 | 3300035120 | Bacteria | 2048 |
| 560 | Ga0373960_0067388 | 3300035121 | Bacteria | 1099 |
| 561 | Ga0373960_0095298 | 3300035121 | Unclassified | 957 |
| 562 | Ga0373943_0007879 | 3300035170 | Bacteria | 4781 |
| 563 | Ga0373943_0040473 | 3300035170 | Bacteria | 2250 |
| 564 | Ga0373946_0001413 | 3300035171 | Bacteria | 8330 |
| 565 | Ga0373946_0003685 | 3300035171 | Bacteria | 5427 |
| 566 | Ga0373946_0133376 | 3300035171 | Unclassified | 1145 |
| 567 | Ga0373955_0000504 | 3300035172 | Bacteria | 16576 |
| 568 | Ga0373955_0004843 | 3300035172 | Bacteria | 6000 |
| 569 | Ga0373955_0006423 | 3300035172 | Bacteria | 5356 |
| 570 | Ga0373955_0118923 | 3300035172 | Bacteria | 1534 |
| 571 | Ga0373961_0019628 | 3300035241 | Bacteria | 1778 |
| 572 | Ga0373962_0010443 | 3300035242 | Bacteria | 2315 |
| 573 | Ga0373924_0000932 | 3300035410 | Bacteria | 9223 |
| 574 | Ga0373931_0045780 | 3300035691 | Bacteria | 2311 |
| 575 | Ga0373931_0093004 | 3300035691 | Bacteria | 1683 |
| 576 | Ga0373935_0000038 | 3300035692 | Bacteria | 51446 |
| 577 | Ga0373935_0036156 | 3300035692 | Bacteria | 3086 |
| 578 | Ga0373935_0117686 | 3300035692 | Bacteria | 1771 |
| 579 | Ga0373935_0201173 | 3300035692 | Bacteria | 1376 |
| 580 | Ga0373927_0008438 | 3300035695 | Bacteria | 6928 |
| 581 | Ga0373927_0129562 | 3300035695 | Bacteria | 1647 |
| 582 | Ga0373927_0307177 | 3300035695 | Bacteria | 1044 |
| 583 | Ga0373927_0434125 | 3300035695 | Bacteria | 867 |
| 584 | Ga0373933_0007752 | 3300035724 | Bacteria | 5864 |
| 585 | Ga0373933_0011420 | 3300035724 | Bacteria | 4894 |
| 586 | Ga0373933_0020352 | 3300035724 | Bacteria | 3761 |
| 587 | Ga0373947_0000229 | 3300035725 | Bacteria | 31423 |
| 588 | Ga0373947_0009320 | 3300035725 | Bacteria | 5640 |
| 589 | Ga0373947_0027554 | 3300035725 | Bacteria | 3326 |
| 590 | Ga0373947_0097450 | 3300035725 | Bacteria | 1843 |
| 591 | Ga0373947_0140882 | 3300035725 | Bacteria | 1546 |
| 592 | Ga0373937_0000004 | 3300036401 | Bacteria | 212269 |
| 593 | Ga0373937_0000655 | 3300036401 | Bacteria | 30381 |
| 594 | Ga0373937_0009675 | 3300036401 | Bacteria | 8398 |
| 595 | Ga0373937_0053957 | 3300036401 | Bacteria | 3687 |
| 596 | Ga0373937_0074055 | 3300036401 | Bacteria | 3142 |
| 597 | Ga0373937_0261283 | 3300036401 | Bacteria | 1633 |
| 598 | Ga0373937_0497149 | 3300036401 | Bacteria | 1159 |
| 599 | Ga0373937_0672259 | 3300036401 | Bacteria | 981 |
| 600 | Ga0373925_0000424 | 3300037068 | Bacteria | 42803 |
| 601 | Ga0373925_0017194 | 3300037068 | Bacteria | 5238 |
| 602 | Ga0373925_0030232 | 3300037068 | Bacteria | 3976 |
| 603 | Ga0373925_0032039 | 3300037068 | Bacteria | 3867 |
| 604 | Ga0373925_0155975 | 3300037068 | Bacteria | 1795 |
| 605 | Ga0373925_0254939 | 3300037068 | Bacteria | 1408 |
| 606 | Ga0395898_0326517 | 3300037466 | Bacteria | 1463 |
| 607 | Ga0436365_0076921 | 3300039437 | Bacteria | 40502 |
| 608 | Ga0436365_0432047 | 3300039437 | Bacteria | 2497 |
| 609 | Ga0436365_0960142 | 3300039437 | Bacteria | 882 |
| 610 | Ga0436360_0780623 | 3300039438 | Bacteria | 1035 |
| 611 | Ga0436361_0685960 | 3300039447 | Bacteria | 1426 |
| 612 | Ga0439453_0000181 | 3300041408 | Bacteria | 5943 |
| 613 | Ga0451798_0958274 | 3300041458 | Bacteria | 826 |
| 614 | Ga0451853_4041355 | 3300041512 | Bacteria | 2370 |
| 615 | Ga0439443_000550 | 3300042003 | Bacteria | 3424 |
| 616 | Ga0439446_0063269 | 3300042156 | Bacteria | 1121 |
| 617 | Ga0439435_0000899 | 3300042436 | Bacteria | 5123 |
| 618 | Ga0466966_0088104 | 3300044684 | Bacteria | 1929 |
| 619 | Ga0466963_0005670 | 3300044694 | Bacteria | 7334 |
| 620 | Ga0466963_0137821 | 3300044694 | Bacteria | 1689 |
| 621 | Ga0466963_0418771 | 3300044694 | Bacteria | 945 |
| 622 | Ga0466964_0158830 | 3300044706 | Bacteria | 1055 |
| 623 | Ga0466957_0015548 | 3300044842 | Bacteria | 4445 |
| 624 | Ga0466957_0420031 | 3300044842 | Bacteria | 917 |
| 625 | Ga0466958_0015838 | 3300045836 | Bacteria | 4331 |
| 626 | Ga0466967_0031688 | 3300045976 | Bacteria | 4454 |
| 627 | Ga0466967_0033052 | 3300045976 | Bacteria | 4376 |
| 628 | Ga0495627_039797 | 3300046453 | Bacteria | 1449 |
| 629 | Ga0495592_0000032 | 3300046454 | Bacteria | 128274 |
| 630 | Ga0495629_0001232 | 3300046459 | Bacteria | 20103 |
| 631 | Ga0495629_0001465 | 3300046459 | Bacteria | 18592 |
| 632 | Ga0495629_0107794 | 3300046459 | Bacteria | 1943 |
| 633 | Ga0495638_0058828 | 3300046460 | Bacteria | 2381 |
| 634 | Ga0495641_0010900 | 3300046461 | Bacteria | 5225 |
| 635 | Ga0495651_0000799 | 3300046462 | Bacteria | 24378 |
| 636 | Ga0495653_0000012 | 3300046463 | Bacteria | 266880 |
| 637 | Ga0495653_0448518 | 3300046463 | Bacteria | 812 |
| 638 | Ga0495580_0377740 | 3300046472 | Bacteria | 957 |
| 639 | Ga0495582_0000570 | 3300046473 | Bacteria | 20403 |
| 640 | Ga0495582_0031519 | 3300046473 | Bacteria | 2914 |
| 641 | Ga0495605_0055488 | 3300046474 | Bacteria | 1914 |
| 642 | Ga0495639_0027847 | 3300046475 | Bacteria | 2502 |
| 643 | Ga0495639_0084793 | 3300046475 | Bacteria | 1480 |
| 644 | Ga0495662_0032039 | 3300046476 | Bacteria | 2539 |
| 645 | Ga0495662_0191079 | 3300046476 | Bacteria | 1010 |
| 646 | Ga0495662_0191517 | 3300046476 | Bacteria | 1008 |
| 647 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 648 | Ga0495584_0040744 | 3300046491 | Bacteria | 2345 |
| 649 | Ga0495584_0041179 | 3300046491 | Bacteria | 2332 |
| 650 | Ga0495584_0124009 | 3300046491 | Bacteria | 1309 |
| 651 | Ga0495594_0083376 | 3300046499 | Bacteria | 1787 |
| 652 | Ga0495596_0108968 | 3300046500 | Bacteria | 1075 |
| 653 | Ga0495608_0000017 | 3300046511 | Bacteria | 192929 |
| 654 | Ga0495608_0009665 | 3300046511 | Bacteria | 6728 |
| 655 | Ga0495618_0000006 | 3300046514 | Bacteria | 229906 |
| 656 | Ga0495618_0019785 | 3300046514 | Bacteria | 4143 |
| 657 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 658 | Ga0495628_0004103 | 3300046516 | Bacteria | 12959 |
| 659 | Ga0495630_0005871 | 3300046517 | Bacteria | 8684 |
| 660 | Ga0495630_0017154 | 3300046517 | Bacteria | 5301 |
| 661 | Ga0495630_0093365 | 3300046517 | Bacteria | 2274 |
| 662 | Ga0495630_0131230 | 3300046517 | Bacteria | 1903 |
| 663 | Ga0495637_0053136 | 3300046520 | Bacteria | 1688 |
| 664 | Ga0495644_0041322 | 3300046523 | Bacteria | 1737 |
| 665 | Ga0495666_0040048 | 3300046526 | Bacteria | 2273 |
| 666 | Ga0495666_0159086 | 3300046526 | Bacteria | 1048 |
| 667 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 668 | Ga0495652_0027665 | 3300046529 | Bacteria | 4994 |
| 669 | Ga0495652_0297466 | 3300046529 | Bacteria | 1175 |
| 670 | Ga0495665_0032202 | 3300046531 | Bacteria | 2804 |
| 671 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 672 | Ga0495640_0008218 | 3300046533 | Bacteria | 8189 |
| 673 | Ga0495640_0017302 | 3300046533 | Bacteria | 5375 |
| 674 | Ga0495586_0082644 | 3300046535 | Bacteria | 1766 |
| 675 | Ga0495586_0199705 | 3300046535 | Bacteria | 1133 |
| 676 | Ga0495587_0000008 | 3300046536 | Bacteria | 271097 |
| 677 | Ga0495587_0009997 | 3300046536 | Bacteria | 6057 |
| 678 | Ga0495598_0001843 | 3300046537 | Bacteria | 4269 |
| 679 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 680 | Ga0495645_0044935 | 3300046543 | Bacteria | 3221 |
| 681 | Ga0495633_0053006 | 3300046558 | Bacteria | 1910 |
| 682 | Ga0495667_0000124 | 3300046559 | Bacteria | 55660 |
| 683 | Ga0495667_0003621 | 3300046559 | Bacteria | 10387 |
| 684 | Ga0495667_0020065 | 3300046559 | Bacteria | 4509 |
| 685 | Ga0495656_0004314 | 3300046615 | Bacteria | 4861 |
| 686 | Ga0495656_0007363 | 3300046615 | Bacteria | 3886 |
| 687 | Ga0495634_0000003 | 3300046642 | Bacteria | 206222 |
| 688 | Ga0495634_0057544 | 3300046642 | Bacteria | 2594 |
| 689 | Ga0495634_0214514 | 3300046642 | Bacteria | 1190 |
| 690 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 691 | Ga0495635_0011233 | 3300046663 | Bacteria | 6278 |
| 692 | Ga0495588_0055920 | 3300046674 | Bacteria | 2037 |
| 693 | Ga0495657_0000054 | 3300046675 | Bacteria | 99620 |
| 694 | Ga0495657_0005238 | 3300046675 | Bacteria | 10267 |
| 695 | Ga0495657_0148490 | 3300046675 | Bacteria | 1457 |
| 696 | Ga0495599_0000005 | 3300046678 | Bacteria | 300169 |
| 697 | Ga0495599_0010640 | 3300046678 | Bacteria | 5630 |
| 698 | Ga0495623_0000148 | 3300046679 | Bacteria | 43192 |
| 699 | Ga0495623_0010769 | 3300046679 | Bacteria | 5921 |
| 700 | Ga0495646_0000002 | 3300046680 | Bacteria | 310568 |
| 701 | Ga0495647_0004214 | 3300046681 | Bacteria | 4657 |
| 702 | Ga0495658_0000237 | 3300046683 | Bacteria | 31696 |
| 703 | Ga0495658_0002178 | 3300046683 | Bacteria | 9911 |
| 704 | Ga0495658_0006226 | 3300046683 | Bacteria | 5863 |
| 705 | Ga0495658_0070105 | 3300046683 | Bacteria | 2033 |
| 706 | Ga0495658_0218450 | 3300046683 | Bacteria | 1193 |
| 707 | Ga0495669_0033891 | 3300046684 | Bacteria | 2250 |
| 708 | Ga0495669_0109873 | 3300046684 | Bacteria | 1287 |
| 709 | Ga0495613_0103162 | 3300046689 | Bacteria | 2059 |
| 710 | Ga0495624_0026442 | 3300046690 | Bacteria | 3803 |
| 711 | Ga0495624_0063231 | 3300046690 | Bacteria | 2313 |
| 712 | Ga0495624_0066333 | 3300046690 | Bacteria | 2253 |
| 713 | Ga0495624_0336260 | 3300046690 | Bacteria | 909 |
| 714 | Ga0495670_0011251 | 3300046691 | Bacteria | 4398 |
| 715 | Ga0495671_0025087 | 3300046692 | Bacteria | 3101 |
| 716 | Ga0495589_0046648 | 3300046794 | Bacteria | 2150 |
| 717 | Ga0495589_0069097 | 3300046794 | Bacteria | 1728 |
| 718 | Ga0495600_0000012 | 3300046809 | Bacteria | 119798 |
| 719 | Ga0495600_0057999 | 3300046809 | Bacteria | 2529 |
| 720 | Ga0495600_0060644 | 3300046809 | Bacteria | 2470 |
| 721 | Ga0495660_0170585 | 3300046810 | Bacteria | 1060 |
| 722 | Ga0495581_0019117 | 3300047315 | Bacteria | 3977 |
| 723 | Ga0495581_0300835 | 3300047315 | Bacteria | 937 |
| 724 | Ga0495604_0000009 | 3300047317 | Bacteria | 326341 |
| 725 | Ga0495604_0174391 | 3300047317 | Bacteria | 1509 |
| 726 | Ga0495604_0211351 | 3300047317 | Bacteria | 1340 |
| 727 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 728 | Ga0495674_0047745 | 3300047319 | Bacteria | 3793 |
| 729 | Ga0495674_0086497 | 3300047319 | Bacteria | 2684 |
| 730 | Ga0495672_0175556 | 3300047320 | Bacteria | 1089 |
| 731 | Ga0495676_0119787 | 3300047321 | Bacteria | 1916 |
| 732 | Ga0495676_0158133 | 3300047321 | Bacteria | 1606 |
| 733 | Ga0495680_0001385 | 3300047322 | Bacteria | 26203 |
| 734 | Ga0495680_0012328 | 3300047322 | Bacteria | 7529 |
| 735 | Ga0495680_0018500 | 3300047322 | Bacteria | 5910 |
| 736 | Ga0495680_0097090 | 3300047322 | Bacteria | 2200 |
| 737 | Ga0495675_0000028 | 3300047444 | Bacteria | 105848 |
| 738 | Ga0495684_0000006 | 3300047471 | Bacteria | 247568 |
| 739 | Ga0495684_0047360 | 3300047471 | Bacteria | 3288 |
| 740 | Ga0495684_0196638 | 3300047471 | Bacteria | 1488 |
| 741 | Ga0495684_0339281 | 3300047471 | Unclassified | 1070 |
| 742 | Ga0495684_0343927 | 3300047471 | Bacteria | 1061 |
| 743 | Ga0495593_0000140 | 3300047673 | Bacteria | 35205 |
| 744 | Ga0495593_0057150 | 3300047673 | Bacteria | 2049 |
| 745 | Ga0495593_0179692 | 3300047673 | Bacteria | 1066 |
| 746 | Ga0495602_0000005 | 3300048088 | Bacteria | 325957 |
| 747 | Ga0495602_0013847 | 3300048088 | Bacteria | 8223 |
| 748 | Ga0495614_0051122 | 3300048089 | Bacteria | 1771 |
| 749 | Ga0495626_0130530 | 3300048091 | Bacteria | 1073 |
| 750 | Ga0496100_0003363 | 3300048903 | Bacteria | 8326 |
| 751 | Ga0496100_0015869 | 3300048903 | Bacteria | 4409 |
| 752 | Ga0496100_0041015 | 3300048903 | Bacteria | 2948 |
| 753 | Ga0496100_0098257 | 3300048903 | Bacteria | 2012 |
| 754 | Ga0496100_0169228 | 3300048903 | Bacteria | 1572 |
| 755 | Ga0496100_0445511 | 3300048903 | Unclassified | 992 |
| 756 | Ga0496101_0001983 | 3300048904 | Bacteria | 12419 |
| 757 | Ga0496101_0023889 | 3300048904 | Bacteria | 4226 |
| 758 | Ga0496101_0095327 | 3300048904 | Bacteria | 2219 |
| 759 | Ga0496101_0362825 | 3300048904 | Bacteria | 1139 |
| 760 | Ga0496102_0002793 | 3300048905 | Bacteria | 14888 |
| 761 | Ga0496102_0016941 | 3300048905 | Bacteria | 6377 |
| 762 | Ga0496102_0028300 | 3300048905 | Bacteria | 5005 |
| 763 | Ga0496102_0039250 | 3300048905 | Bacteria | 4277 |
| 764 | Ga0496102_0090073 | 3300048905 | Bacteria | 2838 |
| 765 | Ga0496102_0573841 | 3300048905 | Bacteria | 1051 |
| 766 | Ga0496103_0002369 | 3300048906 | Bacteria | 11883 |
| 767 | Ga0496103_0020793 | 3300048906 | Bacteria | 3945 |
| 768 | Ga0496103_0021619 | 3300048906 | Bacteria | 3871 |
| 769 | Ga0496103_0120987 | 3300048906 | Bacteria | 1667 |
| 770 | Ga0496104_0000092 | 3300048907 | Bacteria | 87232 |
| 771 | Ga0496104_0018299 | 3300048907 | Bacteria | 6392 |
| 772 | Ga0496104_0053307 | 3300048907 | Bacteria | 3820 |
| 773 | Ga0496104_0099636 | 3300048907 | Bacteria | 2781 |
| 774 | Ga0496104_0122512 | 3300048907 | Bacteria | 2496 |
| 775 | Ga0496104_0225839 | 3300048907 | Bacteria | 1784 |
| 776 | Ga0496104_0563007 | 3300048907 | Bacteria | 1050 |
| 777 | Ga0496105_0002505 | 3300048908 | Bacteria | 13315 |
| 778 | Ga0496105_0004200 | 3300048908 | Bacteria | 10816 |
| 779 | Ga0496105_0007082 | 3300048908 | Bacteria | 8644 |
| 780 | Ga0496105_0501735 | 3300048908 | Bacteria | 952 |
| 781 | Ga0496105_0501954 | 3300048908 | Unclassified | 952 |
| 782 | Ga0496105_0547419 | 3300048908 | Bacteria | 903 |
| 783 | Ga0496106_0007123 | 3300048909 | Bacteria | 8258 |
| 784 | Ga0496106_0010646 | 3300048909 | Bacteria | 6795 |
| 785 | Ga0496106_0020424 | 3300048909 | Bacteria | 4915 |
| 786 | Ga0496106_0086476 | 3300048909 | Bacteria | 2414 |
| 787 | Ga0496106_0113396 | 3300048909 | Bacteria | 2113 |
| 788 | Ga0496107_0005855 | 3300048910 | Bacteria | 8416 |
| 789 | Ga0496107_0019014 | 3300048910 | Bacteria | 4844 |
| 790 | Ga0496107_0057547 | 3300048910 | Bacteria | 2810 |
| 791 | Ga0496107_0084405 | 3300048910 | Bacteria | 2317 |
| 792 | Ga0496107_0113311 | 3300048910 | Bacteria | 1994 |
| 793 | Ga0496107_0175623 | 3300048910 | Unclassified | 1590 |
| 794 | Ga0496107_0295982 | 3300048910 | Bacteria | 1204 |
| 795 | Ga0496108_0000951 | 3300048911 | Bacteria | 22499 |
| 796 | Ga0496108_0009284 | 3300048911 | Bacteria | 7960 |
| 797 | Ga0496108_0017326 | 3300048911 | Bacteria | 5892 |
| 798 | Ga0496109_0004879 | 3300048912 | Bacteria | 11202 |
| 799 | Ga0496109_0010573 | 3300048912 | Bacteria | 7892 |
| 800 | Ga0496109_0017589 | 3300048912 | Bacteria | 6269 |
| 801 | Ga0496109_0109183 | 3300048912 | Bacteria | 2571 |
| 802 | Ga0496109_0120779 | 3300048912 | Bacteria | 2441 |
| 803 | Ga0496109_0132660 | 3300048912 | Bacteria | 2326 |
| 804 | Ga0496109_0255984 | 3300048912 | Bacteria | 1649 |
| 805 | Ga0496110_0010330 | 3300048913 | Bacteria | 7588 |
| 806 | Ga0496110_0025021 | 3300048913 | Bacteria | 5096 |
| 807 | Ga0496110_0047745 | 3300048913 | Bacteria | 3750 |
| 808 | Ga0496110_0064482 | 3300048913 | Bacteria | 3238 |
| 809 | Ga0496110_0106657 | 3300048913 | Bacteria | 2514 |
| 810 | Ga0496110_0178571 | 3300048913 | Bacteria | 1927 |
| 811 | Ga0496111_0002467 | 3300048914 | Bacteria | 11163 |
| 812 | Ga0496111_0015671 | 3300048914 | Bacteria | 5209 |
| 813 | Ga0496111_0037699 | 3300048914 | Bacteria | 3460 |
| 814 | Ga0496111_0077159 | 3300048914 | Bacteria | 2429 |
| 815 | Ga0496111_0093737 | 3300048914 | Bacteria | 2202 |
| 816 | Ga0496111_0206953 | 3300048914 | Bacteria | 1458 |
| 817 | Ga0496112_0007378 | 3300048915 | Bacteria | 9759 |
| 818 | Ga0496112_0023680 | 3300048915 | Bacteria | 5872 |
| 819 | Ga0496112_0027458 | 3300048915 | Bacteria | 5487 |
| 820 | Ga0496112_0060168 | 3300048915 | Bacteria | 3742 |
| 821 | Ga0496112_0179824 | 3300048915 | Bacteria | 2079 |
| 822 | Ga0496112_0297778 | 3300048915 | Bacteria | 1559 |
| 823 | Ga0496112_0517234 | 3300048915 | Bacteria | 1128 |
| 824 | Ga0496113_0000043 | 3300048916 | Bacteria | 52544 |
| 825 | Ga0496113_0004559 | 3300048916 | Bacteria | 8532 |
| 826 | Ga0496113_0022484 | 3300048916 | Bacteria | 4461 |
| 827 | Ga0496113_0048900 | 3300048916 | Bacteria | 3147 |
| 828 | Ga0496113_0113175 | 3300048916 | Bacteria | 2115 |
| 829 | Ga0496113_0390828 | 3300048916 | Bacteria | 1116 |
| 830 | Ga0496114_0036470 | 3300048917 | Bacteria | 4065 |
| 831 | Ga0496114_0064599 | 3300048917 | Bacteria | 3065 |
| 832 | Ga0496114_0087094 | 3300048917 | Bacteria | 2647 |
| 833 | Ga0496114_0144870 | 3300048917 | Bacteria | 2059 |
| 834 | Ga0496114_0765122 | 3300048917 | Bacteria | 843 |
| 835 | Ga0496115_0002647 | 3300048918 | Bacteria | 12855 |
| 836 | Ga0496115_0003701 | 3300048918 | Bacteria | 11002 |
| 837 | Ga0496115_0008385 | 3300048918 | Bacteria | 7647 |
| 838 | Ga0496115_0037995 | 3300048918 | Bacteria | 3819 |
| 839 | Ga0496115_0076178 | 3300048918 | Bacteria | 2726 |
| 840 | Ga0496115_0211523 | 3300048918 | Bacteria | 1601 |
| 841 | Ga0496115_0342819 | 3300048918 | Unclassified | 1219 |
| 842 | Ga0496118_0020061 | 3300048921 | Bacteria | 5944 |
| 843 | Ga0496125_0071564 | 3300048928 | Bacteria | 2708 |
| 844 | Ga0496126_0158448 | 3300048929 | Bacteria | 1936 |
| 845 | Ga0501031_0045785 | 3300049568 | Bacteria | 2854 |
| 846 | Ga0501032_0142322 | 3300049569 | Bacteria | 1579 |
| 847 | Ga0501032_0153501 | 3300049569 | Bacteria | 1513 |
| 848 | Ga0501032_0197791 | 3300049569 | Bacteria | 1312 |
| 849 | Ga0501033_0059998 | 3300049570 | Bacteria | 2807 |
| 850 | Ga0501033_0100363 | 3300049570 | Bacteria | 2112 |
| 851 | Ga0501034_0022311 | 3300049571 | Bacteria | 6453 |
| 852 | Ga0501034_0025437 | 3300049571 | Bacteria | 6026 |
| 853 | Ga0501034_0057724 | 3300049571 | Bacteria | 3901 |
| 854 | Ga0501034_0081484 | 3300049571 | Bacteria | 3238 |
| 855 | Ga0501034_0479055 | 3300049571 | Bacteria | 1160 |
| 856 | Ga0501036_0000177 | 3300049572 | Bacteria | 41942 |
| 857 | Ga0501036_0004805 | 3300049572 | Bacteria | 10920 |
| 858 | Ga0501036_0035608 | 3300049572 | Bacteria | 4211 |
| 859 | Ga0501036_0037074 | 3300049572 | Bacteria | 4124 |
| 860 | Ga0501036_0049253 | 3300049572 | Bacteria | 3567 |
| 861 | Ga0501036_0191676 | 3300049572 | Bacteria | 1720 |
| 862 | Ga0501037_0001926 | 3300049573 | Bacteria | 15044 |
| 863 | Ga0501037_0007004 | 3300049573 | Bacteria | 8232 |
| 864 | Ga0501038_0013458 | 3300049574 | Bacteria | 7457 |
| 865 | Ga0501038_0176621 | 3300049574 | Bacteria | 1725 |
| 866 | Ga0501038_0221024 | 3300049574 | Bacteria | 1511 |
| 867 | Ga0501039_0073837 | 3300049575 | Bacteria | 2650 |
| 868 | Ga0501039_0117190 | 3300049575 | Bacteria | 2085 |
| 869 | Ga0501039_0183775 | 3300049575 | Bacteria | 1644 |
| 870 | Ga0501041_0026039 | 3300049577 | Bacteria | 3516 |
| 871 | Ga0501041_0552573 | 3300049577 | Bacteria | 734 |
| 872 | Ga0501043_0008320 | 3300049579 | Bacteria | 8168 |
| 873 | Ga0501043_0022538 | 3300049579 | Bacteria | 4938 |
| 874 | Ga0501043_0024067 | 3300049579 | Bacteria | 4778 |
| 875 | Ga0501046_0008241 | 3300049580 | Bacteria | 9099 |
| 876 | Ga0501046_0013329 | 3300049580 | Bacteria | 6965 |
| 877 | Ga0501046_0037763 | 3300049580 | Bacteria | 3880 |
| 878 | Ga0501047_0000756 | 3300049581 | Bacteria | 33738 |
| 879 | Ga0501047_0056933 | 3300049581 | Bacteria | 3781 |
| 880 | Ga0501047_0086785 | 3300049581 | Bacteria | 3007 |
| 881 | Ga0501047_0090581 | 3300049581 | Bacteria | 2935 |
| 882 | Ga0501048_0000357 | 3300049582 | Bacteria | 31694 |
| 883 | Ga0501048_0009539 | 3300049582 | Bacteria | 7285 |
| 884 | Ga0501048_0277758 | 3300049582 | Bacteria | 1191 |
| 885 | Ga0501067_0065035 | 3300049583 | Bacteria | 2019 |
| 886 | Ga0501068_0002385 | 3300049584 | Bacteria | 9988 |
| 887 | Ga0501068_0022450 | 3300049584 | Bacteria | 3690 |
| 888 | Ga0501068_0067385 | 3300049584 | Bacteria | 2181 |
| 889 | Ga0501068_0167547 | 3300049584 | Bacteria | 1386 |
| 890 | Ga0501069_0000659 | 3300049585 | Bacteria | 16060 |
| 891 | Ga0501069_0030171 | 3300049585 | Bacteria | 2977 |
| 892 | Ga0501069_0140591 | 3300049585 | Bacteria | 1385 |
| 893 | Ga0501070_0000711 | 3300049586 | Bacteria | 30493 |
| 894 | Ga0501070_0021174 | 3300049586 | Bacteria | 5457 |
| 895 | Ga0501070_0059888 | 3300049586 | Bacteria | 3156 |
| 896 | Ga0501070_0123837 | 3300049586 | Bacteria | 2136 |
| 897 | Ga0501070_0168615 | 3300049586 | Bacteria | 1804 |
| 898 | Ga0501070_0228060 | 3300049586 | Bacteria | 1526 |
| 899 | Ga0501071_0037406 | 3300049587 | Bacteria | 3466 |
| 900 | Ga0501071_0049661 | 3300049587 | Bacteria | 3020 |
| 901 | Ga0501071_0100595 | 3300049587 | Bacteria | 2131 |
| 902 | Ga0501071_0125061 | 3300049587 | Bacteria | 1908 |
| 903 | Ga0501071_0287214 | 3300049587 | Bacteria | 1245 |
| 904 | Ga0501073_0022644 | 3300049589 | Bacteria | 4521 |
| 905 | Ga0501073_0027377 | 3300049589 | Bacteria | 4076 |
| 906 | Ga0501073_0043280 | 3300049589 | Bacteria | 3175 |
| 907 | Ga0501073_0053332 | 3300049589 | Bacteria | 2831 |
| 908 | Ga0501073_0213810 | 3300049589 | Bacteria | 1332 |
| 909 | Ga0501074_0003367 | 3300049590 | Bacteria | 11324 |
| 910 | Ga0501074_0025506 | 3300049590 | Bacteria | 4292 |
| 911 | Ga0501074_0091376 | 3300049590 | Bacteria | 2180 |
| 912 | Ga0501074_0179723 | 3300049590 | Bacteria | 1509 |
| 913 | Ga0501074_0285235 | 3300049590 | Bacteria | 1173 |
| 914 | Ga0501076_0004238 | 3300049592 | Bacteria | 10148 |
| 915 | Ga0501076_0146074 | 3300049592 | Unclassified | 1923 |
| 916 | Ga0501077_0046016 | 3300049593 | Bacteria | 2772 |
| 917 | Ga0501079_0066503 | 3300049741 | Bacteria | 2781 |
| 918 | Ga0501079_0184899 | 3300049741 | Bacteria | 1627 |
| 919 | Ga0501079_0513541 | 3300049741 | Bacteria | 942 |
| 920 | Ga0501079_0563086 | 3300049741 | Bacteria | 896 |
| 921 | Ga0501080_0003552 | 3300049742 | Bacteria | 13734 |
| 922 | Ga0501080_0012302 | 3300049742 | Bacteria | 7840 |
| 923 | Ga0501080_0335063 | 3300049742 | Bacteria | 1368 |
| 924 | Ga0501083_0007330 | 3300049744 | Bacteria | 7822 |
| 925 | Ga0501083_0009300 | 3300049744 | Bacteria | 6937 |
| 926 | Ga0501083_0045559 | 3300049744 | Bacteria | 2967 |
| 927 | Ga0501083_0049616 | 3300049744 | Bacteria | 2828 |
| 928 | Ga0501083_0089402 | 3300049744 | Bacteria | 2035 |
| 929 | Ga0501083_0238909 | 3300049744 | Bacteria | 1183 |
| 930 | Ga0501083_0246018 | 3300049744 | Bacteria | 1164 |
| 931 | Ga0501035_0000703 | 3300049822 | Bacteria | 36519 |
| 932 | Ga0501035_0014587 | 3300049822 | Bacteria | 7252 |
| 933 | Ga0501035_0383105 | 3300049822 | Bacteria | 1172 |
| 934 | Ga0501044_0009505 | 3300049823 | Bacteria | 10587 |
| 935 | Ga0501044_0012398 | 3300049823 | Bacteria | 9228 |
| 936 | Ga0501044_0028947 | 3300049823 | Bacteria | 5843 |
| 937 | Ga0501044_0063013 | 3300049823 | Bacteria | 3789 |
| 938 | Ga0501044_0246637 | 3300049823 | Bacteria | 1728 |
| 939 | nmdc:mga03683_12606_c1 | 3300050489 | Bacteria | 3093 |
| 940 | nmdc:mga03n38_134547_c1 | 3300050490 | Bacteria | 1229 |
| 941 | nmdc:mga00v17_123895_c1 | 3300050491 | Bacteria | 1648 |
| 942 | nmdc:mga00v17_43279_c1 | 3300050491 | Bacteria | 2711 |
| 943 | nmdc:mga0yw44_10242_c2 | 3300050492 | Bacteria | 4376 |
| 944 | nmdc:mga0yw44_1073_c2 | 3300050492 | Bacteria | 3816 |
| 945 | nmdc:mga0yw44_28448_c1 | 3300050492 | Bacteria | 3215 |
| 946 | nmdc:mga0yw44_339340_c1 | 3300050492 | Bacteria | 1010 |
| 947 | nmdc:mga0yw44_813_c1 | 3300050492 | Bacteria | 11629 |
| 948 | nmdc:mga0k408_102437_c1 | 3300050493 | Bacteria | 1688 |
| 949 | nmdc:mga0k408_60181_c1 | 3300050493 | Bacteria | 2207 |
| 950 | nmdc:mga07m45_133038_c1 | 3300050496 | Bacteria | 1439 |
| 951 | nmdc:mga05p37_23570_c1 | 3300050507 | Bacteria | 7469 |
| 952 | nmdc:mga05p37_6119_c1 | 3300050507 | Bacteria | 14175 |
| 953 | nmdc:mga05p37_656200_c1 | 3300050507 | Bacteria | 1174 |
| 954 | nmdc:mga05p37_66476_c1 | 3300050507 | Bacteria | 4435 |
| 955 | nmdc:mga06r32_142613_c1 | 3300050510 | Bacteria | 2373 |
| 956 | nmdc:mga06r32_215584_c1 | 3300050510 | Bacteria | 1333 |
| 957 | nmdc:mga06r32_457892_c1 | 3300050510 | Bacteria | 1255 |
| 958 | nmdc:mga06r32_473174_c1 | 3300050510 | Bacteria | 1231 |
| 959 | nmdc:mga06r32_673857_c1 | 3300050510 | Bacteria | 1001 |
| 960 | nmdc:mga08y16_100861_c1 | 3300050511 | Bacteria | 3005 |
| 961 | nmdc:mga08y16_218924_c1 | 3300050511 | Bacteria | 1971 |
| 962 | nmdc:mga08y16_281693_c1 | 3300050511 | Bacteria | 1715 |
| 963 | nmdc:mga08y16_53580_c1 | 3300050511 | Bacteria | 4218 |
| 964 | nmdc:mga08y16_68582_c1 | 3300050511 | Bacteria | 3697 |
| 965 | nmdc:mga08y16_7940_c1 | 3300050511 | Bacteria | 11107 |
| 966 | nmdc:mga0n895_128932_c1 | 3300050512 | Bacteria | 2554 |
| 967 | nmdc:mga0n895_138128_c1 | 3300050512 | Bacteria | 2464 |
| 968 | nmdc:mga0n895_212807_c1 | 3300050512 | Bacteria | 1963 |
| 969 | nmdc:mga0n895_346872_c1 | 3300050512 | Unclassified | 1504 |
| 970 | nmdc:mga0n895_70607_c1 | 3300050512 | Bacteria | 3461 |
| 971 | nmdc:mga0n895_80372_c1 | 3300050512 | Bacteria | 3248 |
| 972 | nmdc:mga0rr50_114313_c1 | 3300050513 | Bacteria | 2140 |
| 973 | nmdc:mga0rr50_183946_c1 | 3300050513 | Bacteria | 1709 |
| 974 | nmdc:mga0rr50_244589_c1 | 3300050513 | Bacteria | 1488 |
| 975 | nmdc:mga0rr50_36677_c1 | 3300050513 | Bacteria | 3533 |
| 976 | nmdc:mga0rr50_443475_c1 | 3300050513 | Bacteria | 1100 |
| 977 | nmdc:mga0rr50_73707_c1 | 3300050513 | Bacteria | 2611 |
| 978 | nmdc:mga08x19_140409_c1 | 3300050514 | Bacteria | 1631 |
| 979 | nmdc:mga08x19_272733_c1 | 3300050514 | Bacteria | 1171 |
| 980 | nmdc:mga08x19_4943_c1 | 3300050514 | Bacteria | 7874 |
| 981 | nmdc:mga0a205_19073_c1 | 3300050515 | Bacteria | 6463 |
| 982 | nmdc:mga0a205_30953_c1 | 3300050515 | Bacteria | 5126 |
| 983 | nmdc:mga0a205_329112_c1 | 3300050515 | Bacteria | 1398 |
| 984 | nmdc:mga0a205_439085_c1 | 3300050515 | Bacteria | 1166 |
| 985 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 986 | Ga0495601_0001735 | 3300053077 | Bacteria | 12053 |
| 987 | Ga0495601_0013626 | 3300053077 | Bacteria | 4891 |
| 988 | Ga0495601_0031821 | 3300053077 | Bacteria | 3280 |
| 989 | Ga0495612_0000010 | 3300053078 | Bacteria | 227618 |
| 990 | Ga0495612_0024655 | 3300053078 | Bacteria | 2414 |
| 991 | Ga0495612_0043876 | 3300053078 | Bacteria | 1828 |
| 992 | Ga0495612_0274639 | 3300053078 | Bacteria | 752 |
| 993 | Ga0495595_0000026 | 3300053084 | Bacteria | 99949 |
| 994 | Ga0495595_0007500 | 3300053084 | Bacteria | 4468 |
| 995 | Ga0495595_0050761 | 3300053084 | Bacteria | 1922 |
| 996 | Ga0495595_0071510 | 3300053084 | Bacteria | 1640 |
| 997 | Ga0495595_0161542 | 3300053084 | Bacteria | 1105 |
| 998 | Ga0495619_0000019 | 3300053085 | Bacteria | 209518 |
| 999 | Ga0495619_0000484 | 3300053085 | Bacteria | 26647 |
| 1000 | Ga0495619_0072501 | 3300053085 | Bacteria | 2306 |
| 1001 | Ga0495619_0091849 | 3300053085 | Bacteria | 2055 |
| 1002 | Ga0495619_0222827 | 3300053085 | Bacteria | 1306 |
| 1003 | Ga0500643_000042 | 3300053087 | Bacteria | 158933 |
| 1004 | Ga0500643_001251 | 3300053087 | Bacteria | 15060 |
| 1005 | Ga0500644_0000533 | 3300053088 | Bacteria | 15780 |
| 1006 | Ga0500646_0036379 | 3300053090 | Bacteria | 1371 |
| 1007 | Ga0500647_0013260 | 3300053091 | Bacteria | 3725 |
| 1008 | Ga0500651_0001643 | 3300053093 | Bacteria | 11381 |
| 1009 | Ga0500557_000006 | 3300053105 | Bacteria | 141252 |
| 1010 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1011 | Ga0500595_007280 | 3300053119 | Bacteria | 4596 |
| 1012 | Ga0500642_0000040 | 3300053130 | Bacteria | 96160 |
| 1013 | Ga0500652_000005 | 3300053131 | Bacteria | 171538 |
| 1014 | Ga0500604_0017874 | 3300053151 | Bacteria | 1969 |
| 1015 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1016 | Ga0500636_0060032 | 3300053177 | Bacteria | 2221 |
| 1017 | Ga0500636_0268572 | 3300053177 | Bacteria | 859 |
| 1018 | Ga0500645_000156 | 3300053730 | Bacteria | 53110 |
| 1019 | Ga0501084_0013592 | 3300054114 | Bacteria | 6737 |
| 1020 | Ga0501084_0067860 | 3300054114 | Bacteria | 2985 |
| 1021 | Ga0501084_0129722 | 3300054114 | Bacteria | 2122 |
| 1022 | Ga0501084_0211552 | 3300054114 | Bacteria | 1636 |
| 1023 | Ga0501082_0000285 | 3300060353 | Bacteria | 44550 |
| 1024 | Ga0501082_0038227 | 3300060353 | Bacteria | 4141 |
| 1025 | Ga0501082_0509380 | 3300060353 | Bacteria | 1052 |
| 1026 | Ga0501082_0747162 | 3300060353 | Bacteria | 856 |
| 1027 | Ga0466962_0083171 | 3300061719 | Bacteria | 1531 |
| 1028 | Ga0530510_0392921 | 3300061734 | Bacteria | 1045 |
| 1029 | Ga0075364_10049712 | |||
| 1030 | JGI24752J21851_1009665 | |||
| 1031 | JGI24746J21847_1000660 | |||
| 1032 | JGI24739J22299_10005070 | |||
| 1033 | JGI24737J22298_10001725 | |||
| 1034 | JGI24738J21930_10014991 | |||
| 1035 | JGI24035J26624_1000749 | |||
| 1036 | JGI24742J22300_10000548 | |||
| 1037 | JGI24742J22300_10020073 | |||
| 1038 | JGI25406J46586_10006738 | |||
| 1039 | JGI25153J46596_10011635 | |||
| 1040 | JGI25404J52841_10005908 | |||
| 1041 | JGI25405J52794_10002353 | |||
| 1042 | Ga0065165_1001015 | |||
| 1043 | Ga0070658_10073615 | |||
| 1044 | Ga0070658_10181552 | |||
| 1045 | Ga0070658_10442188 | |||
| 1046 | Ga0070676_10004291 | |||
| 1047 | Ga0070683_100004677 | |||
| 1048 | Ga0070683_100149328 | |||
| 1049 | Ga0070683_100164431 | |||
| 1050 | Ga0070690_100008757 | |||
| 1051 | Ga0070690_100092134 | |||
| 1052 | Ga0070690_100103615 | |||
| 1053 | Ga0070670_100004378 | |||
| 1054 | Ga0070670_100016298 | |||
| 1055 | Ga0070670_100048139 | |||
| 1056 | Ga0068869_100000546 | |||
| 1057 | Ga0068869_100063996 | |||
| 1058 | Ga0070680_100035104 | |||
| 1059 | Ga0070680_100043638 | |||
| 1060 | Ga0070680_100070863 | |||
| 1061 | Ga0070680_100099086 | |||
| 1062 | Ga0070680_100442230 | |||
| 1063 | Ga0070680_100541981 | |||
| 1064 | Ga0070682_100003445 | |||
| 1065 | Ga0070682_100110716 | |||
| 1066 | Ga0068868_100012769 | |||
| 1067 | Ga0068868_100209747 | |||
| 1068 | Ga0070660_100006773 | |||
| 1069 | Ga0070660_100036099 | |||
| 1070 | Ga0070660_100039013 | |||
| 1071 | Ga0070660_100217924 | |||
| 1072 | Ga0070689_100002392 | |||
| 1073 | Ga0070689_100023289 | |||
| 1074 | Ga0070689_100054606 | |||
| 1075 | Ga0070691_10003723 | |||
| 1076 | Ga0070691_10094042 | |||
| 1077 | Ga0070687_100001017 | |||
| 1078 | Ga0070661_100004096 | |||
| 1079 | Ga0070661_100191351 | |||
| 1080 | Ga0070692_10004423 | |||
| 1081 | Ga0070668_100008178 | |||
| 1082 | Ga0070668_100047207 | |||
| 1083 | Ga0070668_100497346 | |||
| 1084 | Ga0070669_100009976 | |||
| 1085 | Ga0070675_100010473 | |||
| 1086 | Ga0070671_100033814 | |||
| 1087 | Ga0070671_100076769 | |||
| 1088 | Ga0070674_100027012 | |||
| 1089 | Ga0070674_100088015 | |||
| 1090 | Ga0070673_100000050 | |||
| 1091 | Ga0070673_100057192 | |||
| 1092 | Ga0070688_100000781 | |||
| 1093 | Ga0070688_100005154 | |||
| 1094 | Ga0070659_100036287 | |||
| 1095 | Ga0070659_100336097 | |||
| 1096 | Ga0070667_100007711 | |||
| 1097 | Ga0070667_100114407 | |||
| 1098 | Ga0070667_100266149 | |||
| 1099 | Ga0070703_10029323 | |||
| 1100 | Ga0070709_10002579 | |||
| 1101 | Ga0070709_10015376 | |||
| 1102 | Ga0070709_10117887 | |||
| 1103 | Ga0070714_100006031 | |||
| 1104 | Ga0070714_100058980 | |||
| 1105 | Ga0070714_100263447 | |||
| 1106 | Ga0070713_100017576 | |||
| 1107 | Ga0070713_100055547 | |||
| 1108 | Ga0070713_100056884 | |||
| 1109 | Ga0070713_100243471 | |||
| 1110 | Ga0070710_10003313 | |||
| 1111 | Ga0070710_10021794 | |||
| 1112 | Ga0070710_10092281 | |||
| 1113 | Ga0070710_10153247 | |||
| 1114 | Ga0070701_10002148 | |||
| 1115 | Ga0070701_10437087 | |||
| 1116 | Ga0070711_100022517 | |||
| 1117 | Ga0070711_100024455 | |||
| 1118 | Ga0070711_100027086 | |||
| 1119 | Ga0070705_100003118 | |||
| 1120 | Ga0070700_100002692 | |||
| 1121 | Ga0070694_100005972 | |||
| 1122 | Ga0070708_100269960 | |||
| 1123 | Ga0070663_100019695 | |||
| 1124 | Ga0070663_100044767 | |||
| 1125 | Ga0070663_100087995 | |||
| 1126 | Ga0070663_100272077 | |||
| 1127 | Ga0070663_100486178 | |||
| 1128 | Ga0070678_100000518 | |||
| 1129 | Ga0070678_100022233 | |||
| 1130 | Ga0070678_100055812 | |||
| 1131 | Ga0070678_100261512 | |||
| 1132 | Ga0070678_100429698 | |||
| 1133 | Ga0070662_100207506 | |||
| 1134 | Ga0070681_10011624 | |||
| 1135 | Ga0070681_10027987 | |||
| 1136 | Ga0070681_10196314 | |||
| 1137 | Ga0070681_10552107 | |||
| 1138 | Ga0068867_100084087 | |||
| 1139 | Ga0070685_10003674 | |||
| 1140 | Ga0070685_10014330 | |||
| 1141 | Ga0070707_100135839 | |||
| 1142 | Ga0070699_100010972 | |||
| 1143 | Ga0070679_100004048 | |||
| 1144 | Ga0070679_100007667 | |||
| 1145 | Ga0070679_100038301 | |||
| 1146 | Ga0070679_100103442 | |||
| 1147 | Ga0070679_100157769 | |||
| 1148 | Ga0070684_100004205 | |||
| 1149 | Ga0070697_100245505 | |||
| 1150 | Ga0070697_100652942 | |||
| 1151 | Ga0068853_100042900 | |||
| 1152 | Ga0068853_100718527 | |||
| 1153 | Ga0070672_100000643 | |||
| 1154 | Ga0070686_100081135 | |||
| 1155 | Ga0070695_100127165 | |||
| 1156 | Ga0070696_100147295 | |||
| 1157 | Ga0070693_100010080 | |||
| 1158 | Ga0070693_100015464 | |||
| 1159 | Ga0070665_100004366 | |||
| 1160 | Ga0070665_100098694 | |||
| 1161 | Ga0070665_100107354 | |||
| 1162 | Ga0070665_100205970 | |||
| 1163 | Ga0070704_100007534 | |||
| 1164 | Ga0068855_100035984 | |||
| 1165 | Ga0068855_100263615 | |||
| 1166 | Ga0070664_100045869 | |||
| 1167 | Ga0070664_100061029 | |||
| 1168 | Ga0070664_100273849 | |||
| 1169 | Ga0068857_100001038 | |||
| 1170 | Ga0068857_100193234 | |||
| 1171 | Ga0068854_100154785 | |||
| 1172 | Ga0068856_100009104 | |||
| 1173 | Ga0068856_100216401 | |||
| 1174 | Ga0068856_100705853 | |||
| 1175 | Ga0070702_100003907 | |||
| 1176 | Ga0070702_100045550 | |||
| 1177 | Ga0070702_100280699 | |||
| 1178 | Ga0068852_100024049 | |||
| 1179 | Ga0068852_100342276 | |||
| 1180 | Ga0068859_100125159 | |||
| 1181 | Ga0068859_100337060 | |||
| 1182 | Ga0068859_100582430 | |||
| 1183 | Ga0068859_101001040 | |||
| 1184 | Ga0068864_100001882 | |||
| 1185 | Ga0068864_100227008 | |||
| 1186 | Ga0068864_100237471 | |||
| 1187 | Ga0068866_10000791 | |||
| 1188 | Ga0068866_10028400 | |||
| 1189 | Ga0068861_100002491 | |||
| 1190 | Ga0068870_10001431 | |||
| 1191 | Ga0068870_10026649 | |||
| 1192 | Ga0068863_100031598 | |||
| 1193 | Ga0068863_100097902 | |||
| 1194 | Ga0068863_100155588 | |||
| 1195 | Ga0068858_100028785 | |||
| 1196 | Ga0068858_100050653 | |||
| 1197 | Ga0068858_100131690 | |||
| 1198 | Ga0068860_100002530 | |||
| 1199 | Ga0068860_100213517 | |||
| 1200 | Ga0068860_100380951 | |||
| 1201 | Ga0068862_100011700 | |||
| 1202 | Ga0081455_10000081 | |||
| 1203 | Ga0081455_10016554 | |||
| 1204 | Ga0081455_10034433 | |||
| 1205 | Ga0081455_10049916 | |||
| 1206 | Ga0081455_10082000 | |||
| 1207 | Ga0081455_10138580 | |||
| 1208 | Ga0081538_10108327 | |||
| 1209 | Ga0081540_1000027 | |||
| 1210 | Ga0081540_1003265 | |||
| 1211 | Ga0081540_1025762 | |||
| 1212 | Ga0081539_10001260 | |||
| 1213 | Ga0081539_10029936 | |||
| 1214 | Ga0070717_10000485 | |||
| 1215 | Ga0070717_10000980 | |||
| 1216 | Ga0070717_10494912 | |||
| 1217 | Ga0075365_10001829 | |||
| 1218 | Ga0075365_10001918 | |||
| 1219 | Ga0075365_10018393 | |||
| 1220 | Ga0075365_10238853 | |||
| 1221 | Ga0075368_10023549 | |||
| 1222 | Ga0075363_100067153 | |||
| 1223 | Ga0075364_10010606 | |||
| 1224 | Ga0070715_10000289 | |||
| 1225 | Ga0070715_10001137 | |||
| 1226 | Ga0070716_100004371 | |||
| 1227 | Ga0070716_100085838 | |||
| 1228 | Ga0070712_100000210 | |||
| 1229 | Ga0070712_100000381 | |||
| 1230 | Ga0070712_100003511 | |||
| 1231 | Ga0075362_10004834 | |||
| 1232 | Ga0075367_10049089 | |||
| 1233 | Ga0075367_10087502 | |||
| 1234 | Ga0075366_10075432 | |||
| 1235 | Ga0075366_10316823 | |||
| 1236 | Ga0097621_100001425 | |||
| 1237 | Ga0097621_100002618 | |||
| 1238 | Ga0097621_100070217 | |||
| 1239 | Ga0075370_10076893 | |||
| 1240 | Ga0068871_100006790 | |||
| 1241 | Ga0068871_100016863 | |||
| 1242 | Ga0068871_100124129 | |||
| 1243 | Ga0068871_100731276 | |||
| 1244 | Ga0075428_100015591 | |||
| 1245 | Ga0075428_100500760 | |||
| 1246 | Ga0075428_100557035 | |||
| 1247 | Ga0075428_100863425 | |||
| 1248 | Ga0075430_100099742 | |||
| 1249 | Ga0075430_100196520 | |||
| 1250 | Ga0075431_100067535 | |||
| 1251 | Ga0075431_100079885 | |||
| 1252 | Ga0075431_100441514 | |||
| 1253 | Ga0075433_10109293 | |||
| 1254 | Ga0075433_10199409 | |||
| 1255 | Ga0075434_100004560 | |||
| 1256 | Ga0075434_100031153 | |||
| 1257 | Ga0075434_100035379 | |||
| 1258 | Ga0075434_100043586 | |||
| 1259 | Ga0075434_100052243 | |||
| 1260 | Ga0075434_100053877 | |||
| 1261 | Ga0075434_100083203 | |||
| 1262 | Ga0075434_100132457 | |||
| 1263 | Ga0075434_100188580 | |||
| 1264 | Ga0075434_100383708 | |||
| 1265 | Ga0075429_100058070 | |||
| 1266 | Ga0068865_100001097 | |||
| 1267 | Ga0068865_100078168 | |||
| 1268 | Ga0068865_100411765 | |||
| 1269 | Ga0075436_100008403 | |||
| 1270 | Ga0075436_100334795 | |||
| 1271 | Ga0097620_100125151 | |||
| 1272 | Ga0097620_100337073 | |||
| 1273 | Ga0097620_100582456 | |||
| 1274 | Ga0097620_101000998 | |||
| 1275 | Ga0075435_100014832 | |||
| 1276 | Ga0075435_100054758 | |||
| 1277 | Ga0075435_100134421 | |||
| 1278 | Ga0075435_100251387 | |||
| 1279 | Ga0075435_100518526 | |||
| 1280 | Ga0099795_10021163 | |||
| 1281 | Ga0105240_10067050 | |||
| 1282 | Ga0105240_10135711 | |||
| 1283 | Ga0111539_10011548 | |||
| 1284 | Ga0111539_10026539 | |||
| 1285 | Ga0111539_10050713 | |||
| 1286 | Ga0111539_10196327 | |||
| 1287 | Ga0111539_10203357 | |||
| 1288 | Ga0105245_10004787 | |||
| 1289 | Ga0105245_10197564 | |||
| 1290 | Ga0105245_10319031 | |||
| 1291 | Ga0105247_10003270 | |||
| 1292 | Ga0105247_10018149 | |||
| 1293 | Ga0105247_10024753 | |||
| 1294 | Ga0105247_10141527 | |||
| 1295 | Ga0105247_10378015 | |||
| 1296 | Ga0114129_10001669 | |||
| 1297 | Ga0114129_10006740 | |||
| 1298 | Ga0114129_10024067 | |||
| 1299 | Ga0114129_10035205 | |||
| 1300 | Ga0114129_10166040 | |||
| 1301 | Ga0114129_10309068 | |||
| 1302 | Ga0114129_10510661 | |||
| 1303 | Ga0114129_10542927 | |||
| 1304 | Ga0105243_10002400 | |||
| 1305 | Ga0105243_10004402 | |||
| 1306 | Ga0105243_10088625 | |||
| 1307 | Ga0105241_10008636 | |||
| 1308 | Ga0105241_10012784 | |||
| 1309 | Ga0105241_10470102 | |||
| 1310 | Ga0105242_10007578 | |||
| 1311 | Ga0105242_10023432 | |||
| 1312 | Ga0105242_10156399 | |||
| 1313 | Ga0105248_10010839 | |||
| 1314 | Ga0105248_10014218 | |||
| 1315 | Ga0105248_10049787 | |||
| 1316 | Ga0105248_10237669 | |||
| 1317 | Ga0105237_10158136 | |||
| 1318 | Ga0105238_10015699 | |||
| 1319 | Ga0105238_10063358 | |||
| 1320 | Ga0105238_10083461 | |||
| 1321 | Ga0105249_10336778 | |||
| 1322 | Ga0099796_10002132 | |||
| 1323 | Ga0105246_10025827 | |||
| 1324 | Ga0105246_10041134 | |||
| 1325 | Ga0157342_1003062 | |||
| 1326 | Ga0157373_10099718 | |||
| 1327 | Ga0157371_10158753 | |||
| 1328 | Ga0157369_10307822 | |||
| 1329 | Ga0157374_10001167 | |||
| 1330 | Ga0157374_10095661 | |||
| 1331 | Ga0157374_10344591 | |||
| 1332 | Ga0157378_10008023 | |||
| 1333 | Ga0157378_10020136 | |||
| 1334 | Ga0157378_10034938 | |||
| 1335 | Ga0157378_10088994 | |||
| 1336 | Ga0163162_10010853 | |||
| 1337 | Ga0163162_10194670 | |||
| 1338 | Ga0157372_10070864 | |||
| 1339 | Ga0157372_10216912 | |||
| 1340 | Ga0157375_10031874 | |||
| 1341 | Ga0163163_10007288 | |||
| 1342 | Ga0163163_10011174 | |||
| 1343 | Ga0163163_10041756 | |||
| 1344 | Ga0163163_10450329 | |||
| 1345 | Ga0157380_10001551 | |||
| 1346 | Ga0157380_10059935 | |||
| 1347 | Ga0157377_10070737 | |||
| 1348 | Ga0157379_10008646 | |||
| 1349 | Ga0157379_10202713 | |||
| 1350 | Ga0157379_10591223 | |||
| 1351 | Ga0157376_10062718 | |||
| 1352 | Ga0157376_11108952 | |||
| 1353 | Ga0157376_11109594 | |||
| 1354 | Ga0213876_10104415 | |||
| 1355 | Ga0228598_1031928 | |||
| 1356 | Ga0207666_1000153 | |||
| 1357 | Ga0209758_1000125 | |||
| 1358 | Ga0209758_1019110 | |||
| 1359 | Ga0207426_1000573 | |||
| 1360 | Ga0207697_10001059 | |||
| 1361 | Ga0207682_10002885 | |||
| 1362 | Ga0207692_10000282 | |||
| 1363 | Ga0207692_10020210 | |||
| 1364 | Ga0207692_10076128 | |||
| 1365 | Ga0207642_10000385 | |||
| 1366 | Ga0207642_10024406 | |||
| 1367 | Ga0207710_10000382 | |||
| 1368 | Ga0207710_10065532 | |||
| 1369 | Ga0207688_10001072 | |||
| 1370 | Ga0207688_10004597 | |||
| 1371 | Ga0207680_10046034 | |||
| 1372 | Ga0207647_10033262 | |||
| 1373 | Ga0207647_10048650 | |||
| 1374 | Ga0207685_10002544 | |||
| 1375 | Ga0207685_10006711 | |||
| 1376 | Ga0207699_10012918 | |||
| 1377 | Ga0207699_10032604 | |||
| 1378 | Ga0207699_10053630 | |||
| 1379 | Ga0207699_10185222 | |||
| 1380 | Ga0207645_10002745 | |||
| 1381 | Ga0207645_10110760 | |||
| 1382 | Ga0207643_10000004 | |||
| 1383 | Ga0207643_10000532 | |||
| 1384 | Ga0207705_10252777 | |||
| 1385 | Ga0207705_10260064 | |||
| 1386 | Ga0207684_10009569 | |||
| 1387 | Ga0207654_10008032 | |||
| 1388 | Ga0207707_10014644 | |||
| 1389 | Ga0207707_10095432 | |||
| 1390 | Ga0207707_10149498 | |||
| 1391 | Ga0207707_10257582 | |||
| 1392 | Ga0207695_10535643 | |||
| 1393 | Ga0207671_10382544 | |||
| 1394 | Ga0207693_10001038 | |||
| 1395 | Ga0207693_10002870 | |||
| 1396 | Ga0207693_10021249 | |||
| 1397 | Ga0207693_10051413 | |||
| 1398 | Ga0207693_10111293 | |||
| 1399 | Ga0207693_10113805 | |||
| 1400 | Ga0207663_10001206 | |||
| 1401 | Ga0207663_10020826 | |||
| 1402 | Ga0207663_10182611 | |||
| 1403 | Ga0207660_10084417 | |||
| 1404 | Ga0207660_10108359 | |||
| 1405 | Ga0207660_10171963 | |||
| 1406 | Ga0207660_10504782 | |||
| 1407 | Ga0207662_10000392 | |||
| 1408 | Ga0207662_10009678 | |||
| 1409 | Ga0207657_10002007 | |||
| 1410 | Ga0207657_10007818 | |||
| 1411 | Ga0207657_10019229 | |||
| 1412 | Ga0207657_10124539 | |||
| 1413 | Ga0207649_10005404 | |||
| 1414 | Ga0207649_10176514 | |||
| 1415 | Ga0207649_10237596 | |||
| 1416 | Ga0207652_10040807 | |||
| 1417 | Ga0207652_10057538 | |||
| 1418 | Ga0207681_10203774 | |||
| 1419 | Ga0207694_10036064 | |||
| 1420 | Ga0207694_10052161 | |||
| 1421 | Ga0207650_10017240 | |||
| 1422 | Ga0207650_10180047 | |||
| 1423 | Ga0207650_10226842 | |||
| 1424 | Ga0207659_10000374 | |||
| 1425 | Ga0207687_10001956 | |||
| 1426 | Ga0207687_10003333 | |||
| 1427 | Ga0207687_10416250 | |||
| 1428 | Ga0207700_10029040 | |||
| 1429 | Ga0207700_10054514 | |||
| 1430 | Ga0207700_10063040 | |||
| 1431 | Ga0207700_10132844 | |||
| 1432 | Ga0207664_10012974 | |||
| 1433 | Ga0207664_10294781 | |||
| 1434 | Ga0207644_10004888 | |||
| 1435 | Ga0207690_10022501 | |||
| 1436 | Ga0207706_10017396 | |||
| 1437 | Ga0207706_10093282 | |||
| 1438 | Ga0207686_10028626 | |||
| 1439 | Ga0207686_10108717 | |||
| 1440 | Ga0207709_10008652 | |||
| 1441 | Ga0207670_10121973 | |||
| 1442 | Ga0207670_10303769 | |||
| 1443 | Ga0207670_10478287 | |||
| 1444 | Ga0207669_10000275 | |||
| 1445 | Ga0207669_10011700 | |||
| 1446 | Ga0207704_10016005 | |||
| 1447 | Ga0207704_10022163 | |||
| 1448 | Ga0207704_10087365 | |||
| 1449 | Ga0207665_10000541 | |||
| 1450 | Ga0207665_10011153 | |||
| 1451 | Ga0207665_10013741 | |||
| 1452 | Ga0207665_10403257 | |||
| 1453 | Ga0207691_10004396 | |||
| 1454 | Ga0207691_10030766 | |||
| 1455 | Ga0207711_10007738 | |||
| 1456 | Ga0207711_10021126 | |||
| 1457 | Ga0207711_10047684 | |||
| 1458 | Ga0207689_10002724 | |||
| 1459 | Ga0207689_10009477 | |||
| 1460 | Ga0207689_10576332 | |||
| 1461 | Ga0207661_10055077 | |||
| 1462 | Ga0207661_10148872 | |||
| 1463 | Ga0207679_10001617 | |||
| 1464 | Ga0207679_10039424 | |||
| 1465 | Ga0207679_10156602 | |||
| 1466 | Ga0207679_10211104 | |||
| 1467 | Ga0207679_10235872 | |||
| 1468 | Ga0207679_10333306 | |||
| 1469 | Ga0207667_10234750 | |||
| 1470 | Ga0207651_10127427 | |||
| 1471 | Ga0207651_10292182 | |||
| 1472 | Ga0207712_10045788 | |||
| 1473 | Ga0207668_10118862 | |||
| 1474 | Ga0207668_10144878 | |||
| 1475 | Ga0207640_10005141 | |||
| 1476 | Ga0207658_10038686 | |||
| 1477 | Ga0207658_10076749 | |||
| 1478 | Ga0207658_10163522 | |||
| 1479 | Ga0207677_10044426 | |||
| 1480 | Ga0207677_10172528 | |||
| 1481 | Ga0207703_10001822 | |||
| 1482 | Ga0207703_10019332 | |||
| 1483 | Ga0207703_10511580 | |||
| 1484 | Ga0207639_10491558 | |||
| 1485 | Ga0207678_10002471 | |||
| 1486 | Ga0207678_10020636 | |||
| 1487 | Ga0207678_10020641 | |||
| 1488 | Ga0207678_10258142 | |||
| 1489 | Ga0207678_10267055 | |||
| 1490 | Ga0207678_10338961 | |||
| 1491 | Ga0207708_10001992 | |||
| 1492 | Ga0207702_10134688 | |||
| 1493 | Ga0207702_10266006 | |||
| 1494 | Ga0207702_10310503 | |||
| 1495 | Ga0207641_10013221 | |||
| 1496 | Ga0207641_10113659 | |||
| 1497 | Ga0207641_10132858 | |||
| 1498 | Ga0207641_10222589 | |||
| 1499 | Ga0207648_10004767 | |||
| 1500 | Ga0207648_10169900 | |||
| 1501 | Ga0207676_10002246 | |||
| 1502 | Ga0207676_10014005 | |||
| 1503 | Ga0207676_10541017 | |||
| 1504 | Ga0207674_10007733 | |||
| 1505 | Ga0207674_10077985 | |||
| 1506 | Ga0207675_100007986 | |||
| 1507 | Ga0207675_100131771 | |||
| 1508 | Ga0207683_10002044 | |||
| 1509 | Ga0207683_10063915 | |||
| 1510 | Ga0207698_10150582 | |||
| 1511 | Ga0207698_10483027 | |||
| 1512 | Ga0207698_10671905 | |||
| 1513 | Ga0207428_10000501 | |||
| 1514 | Ga0265357_1000379 | |||
| 1515 | Ga0268266_10003041 | |||
| 1516 | Ga0268266_10217814 | |||
| 1517 | Ga0268265_10016446 | |||
| 1518 | Ga0268265_10027065 | |||
| 1519 | Ga0268264_10339522 | |||
| 1520 | Ga0268264_10849295 | |||
| 1521 | Ga0265318_10024190 | |||
| 1522 | Ga0265338_10028004 | |||
| 1523 | Ga0265338_10140153 | |||
| 1524 | Ga0265330_10004272 | |||
| 1525 | Ga0265330_10076126 | |||
| 1526 | Ga0265332_10000839 | |||
| 1527 | Ga0265332_10011394 | |||
| 1528 | Ga0265320_10006465 | |||
| 1529 | Ga0265325_10000073 | |||
| 1530 | Ga0265325_10001135 | |||
| 1531 | Ga0265325_10014684 | |||
| 1532 | Ga0265325_10044216 | |||
| 1533 | Ga0265325_10045055 | |||
| 1534 | Ga0265329_10012107 | |||
| 1535 | Ga0265329_10025533 | |||
| 1536 | Ga0265340_10000382 | |||
| 1537 | Ga0265340_10009552 | |||
| 1538 | Ga0265339_10001051 | |||
| 1539 | Ga0265339_10002691 | |||
| 1540 | Ga0265339_10062900 | |||
| 1541 | Ga0265339_10101044 | |||
| 1542 | Ga0265331_10019051 | |||
| 1543 | Ga0265331_10065609 | |||
| 1544 | Ga0265316_10110271 | |||
| 1545 | Ga0265313_10000024 | |||
| 1546 | Ga0265313_10000716 | |||
| 1547 | Ga0265313_10016138 | |||
| 1548 | Ga0265313_10022124 | |||
| 1549 | Ga0265313_10054389 | |||
| 1550 | Ga0265313_10085404 | |||
| 1551 | Ga0265314_10002492 | |||
| 1552 | Ga0265314_10038121 | |||
| 1553 | Ga0265342_10000179 | |||
| 1554 | Ga0265342_10000308 | |||
| 1555 | Ga0265342_10069743 | |||
| 1556 | Ga0265342_10088723 | |||
| 1557 | Ga0265342_10094730 | |||
| 1558 | Ga0265342_10104608 | |||
| 1559 | Ga0307409_100728911 | |||
| 1560 | Ga0373930_0001440 | |||
| 1561 | Ga0373950_0002146 | |||
| 1562 | Ga0373950_0013499 | |||
| 1563 | Ga0373938_0018629 | |||
| 1564 | Ga0373926_0027127 | |||
| 1565 | Ga0373928_0005721 | |||
| 1566 | Ga0373928_0025134 | |||
| 1567 | Ga0373928_0034523 | |||
| 1568 | Ga0373934_0079192 | |||
| 1569 | Ga0373944_0021028 | |||
| 1570 | Ga0373949_0001783 | |||
| 1571 | Ga0373923_0009905 | |||
| 1572 | Ga0373923_0160727 | |||
| 1573 | Ga0373932_0088132 | |||
| 1574 | Ga0373936_0153426 | |||
| 1575 | Ga0373941_0003872 | |||
| 1576 | Ga0373941_0007122 | |||
| 1577 | Ga0373945_0018268 | |||
| 1578 | Ga0373945_0061574 | |||
| 1579 | Ga0373953_0002856 | |||
| 1580 | Ga0373954_0009066 | |||
| 1581 | Ga0373954_0010543 | |||
| 1582 | Ga0373956_0001142 | |||
| 1583 | Ga0373956_0050075 | |||
| 1584 | Ga0373956_0072650 | |||
| 1585 | Ga0373957_0003057 | |||
| 1586 | Ga0373957_0014833 | |||
| 1587 | Ga0373957_0028081 | |||
| 1588 | Ga0373960_0067388 | |||
| 1589 | Ga0373960_0095298 | |||
| 1590 | Ga0373943_0007879 | |||
| 1591 | Ga0373943_0040473 | |||
| 1592 | Ga0373946_0001413 | |||
| 1593 | Ga0373946_0003685 | |||
| 1594 | Ga0373946_0133376 | |||
| 1595 | Ga0373955_0000504 | |||
| 1596 | Ga0373955_0004843 | |||
| 1597 | Ga0373955_0006423 | |||
| 1598 | Ga0373955_0118923 | |||
| 1599 | Ga0373961_0019628 | |||
| 1600 | Ga0373962_0010443 | |||
| 1601 | Ga0373924_0000932 | |||
| 1602 | Ga0373931_0045780 | |||
| 1603 | Ga0373931_0093004 | |||
| 1604 | Ga0373935_0000038 | |||
| 1605 | Ga0373935_0036156 | |||
| 1606 | Ga0373935_0117686 | |||
| 1607 | Ga0373935_0201173 | |||
| 1608 | Ga0373927_0008438 | |||
| 1609 | Ga0373927_0129562 | |||
| 1610 | Ga0373927_0307177 | |||
| 1611 | Ga0373927_0434125 | |||
| 1612 | Ga0373933_0007752 | |||
| 1613 | Ga0373933_0011420 | |||
| 1614 | Ga0373933_0020352 | |||
| 1615 | Ga0373947_0000229 | |||
| 1616 | Ga0373947_0009320 | |||
| 1617 | Ga0373947_0027554 | |||
| 1618 | Ga0373947_0097450 | |||
| 1619 | Ga0373947_0140882 | |||
| 1620 | Ga0373937_0000004 | |||
| 1621 | Ga0373937_0000655 | |||
| 1622 | Ga0373937_0009675 | |||
| 1623 | Ga0373937_0053957 | |||
| 1624 | Ga0373937_0074055 | |||
| 1625 | Ga0373937_0261283 | |||
| 1626 | Ga0373937_0497149 | |||
| 1627 | Ga0373937_0672259 | |||
| 1628 | Ga0373925_0000424 | |||
| 1629 | Ga0373925_0017194 | |||
| 1630 | Ga0373925_0030232 | |||
| 1631 | Ga0373925_0032039 | |||
| 1632 | Ga0373925_0155975 | |||
| 1633 | Ga0373925_0254939 | |||
| 1634 | Ga0395898_0326517 | |||
| 1635 | Ga0436365_0076921 | |||
| 1636 | Ga0436365_0432047 | |||
| 1637 | Ga0436365_0960142 | |||
| 1638 | Ga0436360_0780623 | |||
| 1639 | Ga0436361_0685960 | |||
| 1640 | Ga0439453_0000181 | |||
| 1641 | Ga0451798_0958274 | |||
| 1642 | Ga0451853_4041355 | |||
| 1643 | Ga0439443_000550 | |||
| 1644 | Ga0439446_0063269 | |||
| 1645 | Ga0439435_0000899 | |||
| 1646 | Ga0466966_0088104 | |||
| 1647 | Ga0466963_0005670 | |||
| 1648 | Ga0466963_0137821 | |||
| 1649 | Ga0466963_0418771 | |||
| 1650 | Ga0466964_0158830 | |||
| 1651 | Ga0466957_0015548 | |||
| 1652 | Ga0466957_0420031 | |||
| 1653 | Ga0466958_0015838 | |||
| 1654 | Ga0466967_0031688 | |||
| 1655 | Ga0466967_0033052 | |||
| 1656 | Ga0495627_039797 | |||
| 1657 | Ga0495592_0000032 | |||
| 1658 | Ga0495629_0001232 | |||
| 1659 | Ga0495629_0001465 | |||
| 1660 | Ga0495629_0107794 | |||
| 1661 | Ga0495638_0058828 | |||
| 1662 | Ga0495641_0010900 | |||
| 1663 | Ga0495651_0000799 | |||
| 1664 | Ga0495653_0000012 | |||
| 1665 | Ga0495653_0448518 | |||
| 1666 | Ga0495580_0377740 | |||
| 1667 | Ga0495582_0000570 | |||
| 1668 | Ga0495582_0031519 | |||
| 1669 | Ga0495605_0055488 | |||
| 1670 | Ga0495639_0027847 | |||
| 1671 | Ga0495639_0084793 | |||
| 1672 | Ga0495662_0032039 | |||
| 1673 | Ga0495662_0191079 | |||
| 1674 | Ga0495662_0191517 | |||
| 1675 | Ga0495664_0000004 | |||
| 1676 | Ga0495584_0040744 | |||
| 1677 | Ga0495584_0041179 | |||
| 1678 | Ga0495584_0124009 | |||
| 1679 | Ga0495594_0083376 | |||
| 1680 | Ga0495596_0108968 | |||
| 1681 | Ga0495608_0000017 | |||
| 1682 | Ga0495608_0009665 | |||
| 1683 | Ga0495618_0000006 | |||
| 1684 | Ga0495618_0019785 | |||
| 1685 | Ga0495628_0000001 | |||
| 1686 | Ga0495628_0004103 | |||
| 1687 | Ga0495630_0005871 | |||
| 1688 | Ga0495630_0017154 | |||
| 1689 | Ga0495630_0093365 | |||
| 1690 | Ga0495630_0131230 | |||
| 1691 | Ga0495637_0053136 | |||
| 1692 | Ga0495644_0041322 | |||
| 1693 | Ga0495666_0040048 | |||
| 1694 | Ga0495666_0159086 | |||
| 1695 | Ga0495652_0000002 | |||
| 1696 | Ga0495652_0027665 | |||
| 1697 | Ga0495652_0297466 | |||
| 1698 | Ga0495665_0032202 | |||
| 1699 | Ga0495640_0000001 | |||
| 1700 | Ga0495640_0008218 | |||
| 1701 | Ga0495640_0017302 | |||
| 1702 | Ga0495586_0082644 | |||
| 1703 | Ga0495586_0199705 | |||
| 1704 | Ga0495587_0000008 | |||
| 1705 | Ga0495587_0009997 | |||
| 1706 | Ga0495598_0001843 | |||
| 1707 | Ga0495645_0000002 | |||
| 1708 | Ga0495645_0044935 | |||
| 1709 | Ga0495633_0053006 | |||
| 1710 | Ga0495667_0000124 | |||
| 1711 | Ga0495667_0003621 | |||
| 1712 | Ga0495667_0020065 | |||
| 1713 | Ga0495656_0004314 | |||
| 1714 | Ga0495656_0007363 | |||
| 1715 | Ga0495634_0000003 | |||
| 1716 | Ga0495634_0057544 | |||
| 1717 | Ga0495634_0214514 | |||
| 1718 | Ga0495635_0000002 | |||
| 1719 | Ga0495635_0011233 | |||
| 1720 | Ga0495588_0055920 | |||
| 1721 | Ga0495657_0000054 | |||
| 1722 | Ga0495657_0005238 | |||
| 1723 | Ga0495657_0148490 | |||
| 1724 | Ga0495599_0000005 | |||
| 1725 | Ga0495599_0010640 | |||
| 1726 | Ga0495623_0000148 | |||
| 1727 | Ga0495623_0010769 | |||
| 1728 | Ga0495646_0000002 | |||
| 1729 | Ga0495647_0004214 | |||
| 1730 | Ga0495658_0000237 | |||
| 1731 | Ga0495658_0002178 | |||
| 1732 | Ga0495658_0006226 | |||
| 1733 | Ga0495658_0070105 | |||
| 1734 | Ga0495658_0218450 | |||
| 1735 | Ga0495669_0033891 | |||
| 1736 | Ga0495669_0109873 | |||
| 1737 | Ga0495613_0103162 | |||
| 1738 | Ga0495624_0026442 | |||
| 1739 | Ga0495624_0063231 | |||
| 1740 | Ga0495624_0066333 | |||
| 1741 | Ga0495624_0336260 | |||
| 1742 | Ga0495670_0011251 | |||
| 1743 | Ga0495671_0025087 | |||
| 1744 | Ga0495589_0046648 | |||
| 1745 | Ga0495589_0069097 | |||
| 1746 | Ga0495600_0000012 | |||
| 1747 | Ga0495600_0057999 | |||
| 1748 | Ga0495600_0060644 | |||
| 1749 | Ga0495660_0170585 | |||
| 1750 | Ga0495581_0019117 | |||
| 1751 | Ga0495581_0300835 | |||
| 1752 | Ga0495604_0000009 | |||
| 1753 | Ga0495604_0174391 | |||
| 1754 | Ga0495604_0211351 | |||
| 1755 | Ga0495674_0000002 | |||
| 1756 | Ga0495674_0047745 | |||
| 1757 | Ga0495674_0086497 | |||
| 1758 | Ga0495672_0175556 | |||
| 1759 | Ga0495676_0119787 | |||
| 1760 | Ga0495676_0158133 | |||
| 1761 | Ga0495680_0001385 | |||
| 1762 | Ga0495680_0012328 | |||
| 1763 | Ga0495680_0018500 | |||
| 1764 | Ga0495680_0097090 | |||
| 1765 | Ga0495675_0000028 | |||
| 1766 | Ga0495684_0000006 | |||
| 1767 | Ga0495684_0047360 | |||
| 1768 | Ga0495684_0196638 | |||
| 1769 | Ga0495684_0339281 | |||
| 1770 | Ga0495684_0343927 | |||
| 1771 | Ga0495593_0000140 | |||
| 1772 | Ga0495593_0057150 | |||
| 1773 | Ga0495593_0179692 | |||
| 1774 | Ga0495602_0000005 | |||
| 1775 | Ga0495602_0013847 | |||
| 1776 | Ga0495614_0051122 | |||
| 1777 | Ga0495626_0130530 | |||
| 1778 | Ga0496100_0003363 | |||
| 1779 | Ga0496100_0015869 | |||
| 1780 | Ga0496100_0041015 | |||
| 1781 | Ga0496100_0098257 | |||
| 1782 | Ga0496100_0169228 | |||
| 1783 | Ga0496100_0445511 | |||
| 1784 | Ga0496101_0001983 | |||
| 1785 | Ga0496101_0023889 | |||
| 1786 | Ga0496101_0095327 | |||
| 1787 | Ga0496101_0362825 | |||
| 1788 | Ga0496102_0002793 | |||
| 1789 | Ga0496102_0016941 | |||
| 1790 | Ga0496102_0028300 | |||
| 1791 | Ga0496102_0039250 | |||
| 1792 | Ga0496102_0090073 | |||
| 1793 | Ga0496102_0573841 | |||
| 1794 | Ga0496103_0002369 | |||
| 1795 | Ga0496103_0020793 | |||
| 1796 | Ga0496103_0021619 | |||
| 1797 | Ga0496103_0120987 | |||
| 1798 | Ga0496104_0000092 | |||
| 1799 | Ga0496104_0018299 | |||
| 1800 | Ga0496104_0053307 | |||
| 1801 | Ga0496104_0099636 | |||
| 1802 | Ga0496104_0122512 | |||
| 1803 | Ga0496104_0225839 | |||
| 1804 | Ga0496104_0563007 | |||
| 1805 | Ga0496105_0002505 | |||
| 1806 | Ga0496105_0004200 | |||
| 1807 | Ga0496105_0007082 | |||
| 1808 | Ga0496105_0501735 | |||
| 1809 | Ga0496105_0501954 | |||
| 1810 | Ga0496105_0547419 | |||
| 1811 | Ga0496106_0007123 | |||
| 1812 | Ga0496106_0010646 | |||
| 1813 | Ga0496106_0020424 | |||
| 1814 | Ga0496106_0086476 | |||
| 1815 | Ga0496106_0113396 | |||
| 1816 | Ga0496107_0005855 | |||
| 1817 | Ga0496107_0019014 | |||
| 1818 | Ga0496107_0057547 | |||
| 1819 | Ga0496107_0084405 | |||
| 1820 | Ga0496107_0113311 | |||
| 1821 | Ga0496107_0175623 | |||
| 1822 | Ga0496107_0295982 | |||
| 1823 | Ga0496108_0000951 | |||
| 1824 | Ga0496108_0009284 | |||
| 1825 | Ga0496108_0017326 | |||
| 1826 | Ga0496109_0004879 | |||
| 1827 | Ga0496109_0010573 | |||
| 1828 | Ga0496109_0017589 | |||
| 1829 | Ga0496109_0109183 | |||
| 1830 | Ga0496109_0120779 | |||
| 1831 | Ga0496109_0132660 | |||
| 1832 | Ga0496109_0255984 | |||
| 1833 | Ga0496110_0010330 | |||
| 1834 | Ga0496110_0025021 | |||
| 1835 | Ga0496110_0047745 | |||
| 1836 | Ga0496110_0064482 | |||
| 1837 | Ga0496110_0106657 | |||
| 1838 | Ga0496110_0178571 | |||
| 1839 | Ga0496111_0002467 | |||
| 1840 | Ga0496111_0015671 | |||
| 1841 | Ga0496111_0037699 | |||
| 1842 | Ga0496111_0077159 | |||
| 1843 | Ga0496111_0093737 | |||
| 1844 | Ga0496111_0206953 | |||
| 1845 | Ga0496112_0007378 | |||
| 1846 | Ga0496112_0023680 | |||
| 1847 | Ga0496112_0027458 | |||
| 1848 | Ga0496112_0060168 | |||
| 1849 | Ga0496112_0179824 | |||
| 1850 | Ga0496112_0297778 | |||
| 1851 | Ga0496112_0517234 | |||
| 1852 | Ga0496113_0000043 | |||
| 1853 | Ga0496113_0004559 | |||
| 1854 | Ga0496113_0022484 | |||
| 1855 | Ga0496113_0048900 | |||
| 1856 | Ga0496113_0113175 | |||
| 1857 | Ga0496113_0390828 | |||
| 1858 | Ga0496114_0036470 | |||
| 1859 | Ga0496114_0064599 | |||
| 1860 | Ga0496114_0087094 | |||
| 1861 | Ga0496114_0144870 | |||
| 1862 | Ga0496114_0765122 | |||
| 1863 | Ga0496115_0002647 | |||
| 1864 | Ga0496115_0003701 | |||
| 1865 | Ga0496115_0008385 | |||
| 1866 | Ga0496115_0037995 | |||
| 1867 | Ga0496115_0076178 | |||
| 1868 | Ga0496115_0211523 | |||
| 1869 | Ga0496115_0342819 | |||
| 1870 | Ga0496118_0020061 | |||
| 1871 | Ga0496125_0071564 | |||
| 1872 | Ga0496126_0158448 | |||
| 1873 | Ga0501031_0045785 | |||
| 1874 | Ga0501032_0142322 | |||
| 1875 | Ga0501032_0153501 | |||
| 1876 | Ga0501032_0197791 | |||
| 1877 | Ga0501033_0059998 | |||
| 1878 | Ga0501033_0100363 | |||
| 1879 | Ga0501034_0022311 | |||
| 1880 | Ga0501034_0025437 | |||
| 1881 | Ga0501034_0057724 | |||
| 1882 | Ga0501034_0081484 | |||
| 1883 | Ga0501034_0479055 | |||
| 1884 | Ga0501036_0000177 | |||
| 1885 | Ga0501036_0004805 | |||
| 1886 | Ga0501036_0035608 | |||
| 1887 | Ga0501036_0037074 | |||
| 1888 | Ga0501036_0049253 | |||
| 1889 | Ga0501036_0191676 | |||
| 1890 | Ga0501037_0001926 | |||
| 1891 | Ga0501037_0007004 | |||
| 1892 | Ga0501038_0013458 | |||
| 1893 | Ga0501038_0176621 | |||
| 1894 | Ga0501038_0221024 | |||
| 1895 | Ga0501039_0073837 | |||
| 1896 | Ga0501039_0117190 | |||
| 1897 | Ga0501039_0183775 | |||
| 1898 | Ga0501041_0026039 | |||
| 1899 | Ga0501041_0552573 | |||
| 1900 | Ga0501043_0008320 | |||
| 1901 | Ga0501043_0022538 | |||
| 1902 | Ga0501043_0024067 | |||
| 1903 | Ga0501046_0008241 | |||
| 1904 | Ga0501046_0013329 | |||
| 1905 | Ga0501046_0037763 | |||
| 1906 | Ga0501047_0000756 | |||
| 1907 | Ga0501047_0056933 | |||
| 1908 | Ga0501047_0086785 | |||
| 1909 | Ga0501047_0090581 | |||
| 1910 | Ga0501048_0000357 | |||
| 1911 | Ga0501048_0009539 | |||
| 1912 | Ga0501048_0277758 | |||
| 1913 | Ga0501067_0065035 | |||
| 1914 | Ga0501068_0002385 | |||
| 1915 | Ga0501068_0022450 | |||
| 1916 | Ga0501068_0067385 | |||
| 1917 | Ga0501068_0167547 | |||
| 1918 | Ga0501069_0000659 | |||
| 1919 | Ga0501069_0030171 | |||
| 1920 | Ga0501069_0140591 | |||
| 1921 | Ga0501070_0000711 | |||
| 1922 | Ga0501070_0021174 | |||
| 1923 | Ga0501070_0059888 | |||
| 1924 | Ga0501070_0123837 | |||
| 1925 | Ga0501070_0168615 | |||
| 1926 | Ga0501070_0228060 | |||
| 1927 | Ga0501071_0037406 | |||
| 1928 | Ga0501071_0049661 | |||
| 1929 | Ga0501071_0100595 | |||
| 1930 | Ga0501071_0125061 | |||
| 1931 | Ga0501071_0287214 | |||
| 1932 | Ga0501073_0022644 | |||
| 1933 | Ga0501073_0027377 | |||
| 1934 | Ga0501073_0043280 | |||
| 1935 | Ga0501073_0053332 | |||
| 1936 | Ga0501073_0213810 | |||
| 1937 | Ga0501074_0003367 | |||
| 1938 | Ga0501074_0025506 | |||
| 1939 | Ga0501074_0091376 | |||
| 1940 | Ga0501074_0179723 | |||
| 1941 | Ga0501074_0285235 | |||
| 1942 | Ga0501076_0004238 | |||
| 1943 | Ga0501076_0146074 | |||
| 1944 | Ga0501077_0046016 | |||
| 1945 | Ga0501079_0066503 | |||
| 1946 | Ga0501079_0184899 | |||
| 1947 | Ga0501079_0513541 | |||
| 1948 | Ga0501079_0563086 | |||
| 1949 | Ga0501080_0003552 | |||
| 1950 | Ga0501080_0012302 | |||
| 1951 | Ga0501080_0335063 | |||
| 1952 | Ga0501083_0007330 | |||
| 1953 | Ga0501083_0009300 | |||
| 1954 | Ga0501083_0045559 | |||
| 1955 | Ga0501083_0049616 | |||
| 1956 | Ga0501083_0089402 | |||
| 1957 | Ga0501083_0238909 | |||
| 1958 | Ga0501083_0246018 | |||
| 1959 | Ga0501035_0000703 | |||
| 1960 | Ga0501035_0014587 | |||
| 1961 | Ga0501035_0383105 | |||
| 1962 | Ga0501044_0009505 | |||
| 1963 | Ga0501044_0012398 | |||
| 1964 | Ga0501044_0028947 | |||
| 1965 | Ga0501044_0063013 | |||
| 1966 | Ga0501044_0246637 | |||
| 1967 | nmdc:mga03683_12606_c1 | |||
| 1968 | nmdc:mga03n38_134547_c1 | |||
| 1969 | nmdc:mga00v17_123895_c1 | |||
| 1970 | nmdc:mga00v17_43279_c1 | |||
| 1971 | nmdc:mga0yw44_10242_c2 | |||
| 1972 | nmdc:mga0yw44_1073_c2 | |||
| 1973 | nmdc:mga0yw44_28448_c1 | |||
| 1974 | nmdc:mga0yw44_339340_c1 | |||
| 1975 | nmdc:mga0yw44_813_c1 | |||
| 1976 | nmdc:mga0k408_102437_c1 | |||
| 1977 | nmdc:mga0k408_60181_c1 | |||
| 1978 | nmdc:mga07m45_133038_c1 | |||
| 1979 | nmdc:mga05p37_23570_c1 | |||
| 1980 | nmdc:mga05p37_6119_c1 | |||
| 1981 | nmdc:mga05p37_656200_c1 | |||
| 1982 | nmdc:mga05p37_66476_c1 | |||
| 1983 | nmdc:mga06r32_142613_c1 | |||
| 1984 | nmdc:mga06r32_215584_c1 | |||
| 1985 | nmdc:mga06r32_457892_c1 | |||
| 1986 | nmdc:mga06r32_473174_c1 | |||
| 1987 | nmdc:mga06r32_673857_c1 | |||
| 1988 | nmdc:mga08y16_100861_c1 | |||
| 1989 | nmdc:mga08y16_218924_c1 | |||
| 1990 | nmdc:mga08y16_281693_c1 | |||
| 1991 | nmdc:mga08y16_53580_c1 | |||
| 1992 | nmdc:mga08y16_68582_c1 | |||
| 1993 | nmdc:mga08y16_7940_c1 | |||
| 1994 | nmdc:mga0n895_128932_c1 | |||
| 1995 | nmdc:mga0n895_138128_c1 | |||
| 1996 | nmdc:mga0n895_212807_c1 | |||
| 1997 | nmdc:mga0n895_346872_c1 | |||
| 1998 | nmdc:mga0n895_70607_c1 | |||
| 1999 | nmdc:mga0n895_80372_c1 | |||
| 2000 | nmdc:mga0rr50_114313_c1 | |||
| 2001 | nmdc:mga0rr50_183946_c1 | |||
| 2002 | nmdc:mga0rr50_244589_c1 | |||
| 2003 | nmdc:mga0rr50_36677_c1 | |||
| 2004 | nmdc:mga0rr50_443475_c1 | |||
| 2005 | nmdc:mga0rr50_73707_c1 | |||
| 2006 | nmdc:mga08x19_140409_c1 | |||
| 2007 | nmdc:mga08x19_272733_c1 | |||
| 2008 | nmdc:mga08x19_4943_c1 | |||
| 2009 | nmdc:mga0a205_19073_c1 | |||
| 2010 | nmdc:mga0a205_30953_c1 | |||
| 2011 | nmdc:mga0a205_329112_c1 | |||
| 2012 | nmdc:mga0a205_439085_c1 | |||
| 2013 | Ga0495601_0000002 | |||
| 2014 | Ga0495601_0001735 | |||
| 2015 | Ga0495601_0013626 | |||
| 2016 | Ga0495601_0031821 | |||
| 2017 | Ga0495612_0000010 | |||
| 2018 | Ga0495612_0024655 | |||
| 2019 | Ga0495612_0043876 | |||
| 2020 | Ga0495612_0274639 | |||
| 2021 | Ga0495595_0000026 | |||
| 2022 | Ga0495595_0007500 | |||
| 2023 | Ga0495595_0050761 | |||
| 2024 | Ga0495595_0071510 | |||
| 2025 | Ga0495595_0161542 | |||
| 2026 | Ga0495619_0000019 | |||
| 2027 | Ga0495619_0000484 | |||
| 2028 | Ga0495619_0072501 | |||
| 2029 | Ga0495619_0091849 | |||
| 2030 | Ga0495619_0222827 | |||
| 2031 | Ga0500643_000042 | |||
| 2032 | Ga0500643_001251 | |||
| 2033 | Ga0500644_0000533 | |||
| 2034 | Ga0500646_0036379 | |||
| 2035 | Ga0500647_0013260 | |||
| 2036 | Ga0500651_0001643 | |||
| 2037 | Ga0500557_000006 | |||
| 2038 | Ga0500595_000002 | |||
| 2039 | Ga0500595_007280 | |||
| 2040 | Ga0500642_0000040 | |||
| 2041 | Ga0500652_000005 | |||
| 2042 | Ga0500604_0017874 | |||
| 2043 | Ga0500616_0000002 | |||
| 2044 | Ga0500636_0060032 | |||
| 2045 | Ga0500636_0268572 | |||
| 2046 | Ga0500645_000156 | |||
| 2047 | Ga0501084_0013592 | |||
| 2048 | Ga0501084_0067860 | |||
| 2049 | Ga0501084_0129722 | |||
| 2050 | Ga0501084_0211552 | |||
| 2051 | Ga0501082_0000285 | |||
| 2052 | Ga0501082_0038227 | |||
| 2053 | Ga0501082_0509380 | |||
| 2054 | Ga0501082_0747162 | |||
| 2055 | Ga0466962_0083171 | |||
| 2056 | Ga0530510_0392921 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wik-assembly1.cif.gz_A | cryo-em structure of slc40/ferroportin with fab in the presence of hepcidin | 0.4733 | 44 | 222 |
| 6rw3-assembly4.cif.gz_D | the molecular basis for sugar import in malaria parasites. | 0.4679 | 2 | 223 |
| 6rw3-assembly1.cif.gz_A | the molecular basis for sugar import in malaria parasites. | 0.463 | 1 | 223 |
| 6rw3-assembly2.cif.gz_B | the molecular basis for sugar import in malaria parasites. | 0.4626 | 1 | 223 |
| 4qiq-assembly1.cif.gz_A | crystal structure of d-xylose-proton symporter | 0.4456 | 44 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FW85_14_250_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5173 | 55 | 217 | 1.20.1250.20 |
| af_Q54E82_206_395_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.504 | 48 | 216 | 1.20.1250.20 |
| af_Q2G0K4_242_431_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.503 | 50 | 217 | 1.20.1250.20 |
| af_Q9Y267_168_571_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5021 | 55 | 217 | 1.20.1250.20 |
| af_Q23063_235_438_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4972 | 56 | 218 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z9K8V3-F1-model_v4 | Probable membrane transporter protein | 0.8532 | 3 | 222 |
GO:0005886
|
| AF-C6WYA3-F1-model_v4 | Probable membrane transporter protein | 0.8434 | 14 | 222 |
GO:0005886
|
| AF-A0A2A4NFJ0-F1-model_v4 | Probable membrane transporter protein | 0.8428 | 11 | 223 |
GO:0005886
|
| AF-A0A537RZN4-F1-model_v4 | Probable membrane transporter protein | 0.841 | 3 | 222 |
GO:0005886
|
| AF-A0A7Z9K8V3-F1-model_v4 | Probable membrane transporter protein | 0.8392 | 3 | 222 |
GO:0005886
|