F488564

General Info

Members Datasets Scaffolds Average Seq Length
1029 282 2058 101

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10085431|Ga0070677_100854313
Length 124
Sequence MKISRGLAALPMMLASPAFAAGQVDPQGSGPIVAALMWLQGTLLGNVATAVAVIAVAMVGFMMLTGRMNWRFGATVIIGCFILFGSAAIVSGIQSAAAAGKPKPWLFRGRPYFARLPGRRCSRA

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
192 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
193 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
194 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
195 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
198 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
201 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
202 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
203 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
204 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
205 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
206 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
225 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
226 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
230 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
251 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
252 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
279 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
282 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.68
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 2.92
Rhizosphere 93.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10085431 3300005333 Bacteria 1361
2 JGI24741J21665_1009587 3300001915 Bacteria 1772
3 JGI24741J21665_1015597 3300001915 Bacteria 1252
4 JGI24741J21665_1063032 3300001915 Bacteria 548
5 JGI24740J21852_10004319 3300001979 Bacteria 6123
6 JGI24740J21852_10017233 3300001979 Bacteria 2588
7 JGI24737J22298_10014181 3300001990 Bacteria 2588
8 JGI24735J21928_10002858 3300002067 Bacteria 5953
9 JGI24735J21928_10010404 3300002067 Bacteria 2967
10 JGI24738J21930_10042157 3300002075 Bacteria 927
11 rootH1_10057308 3300003323 Bacteria 2367
12 rootH1_10214045 3300003323 Bacteria 1973
13 Ga0065715_10363199 3300005293 Bacteria 925
14 Ga0065707_10104014 3300005295 Bacteria 2718
15 Ga0070658_10001812 3300005327 Bacteria 17969
16 Ga0070658_10004882 3300005327 Bacteria 10923
17 Ga0070658_10005900 3300005327 Bacteria 9936
18 Ga0070658_10021687 3300005327 Bacteria 5148
19 Ga0070658_10083721 3300005327 Bacteria 2622
20 Ga0070658_10120769 3300005327 Bacteria 2177
21 Ga0070658_10214504 3300005327 Bacteria 1626
22 Ga0070658_10594883 3300005327 Bacteria 958
23 Ga0070658_10701198 3300005327 Bacteria 879
24 Ga0070658_10788485 3300005327 Bacteria 825
25 Ga0070658_11653841 3300005327 Bacteria 554
26 Ga0070676_10074124 3300005328 Bacteria 2049
27 Ga0070683_100038356 3300005329 Bacteria 4392
28 Ga0070683_100042663 3300005329 Bacteria 4177
29 Ga0070683_100051973 3300005329 Bacteria 3795
30 Ga0070683_100164256 3300005329 Bacteria 2106
31 Ga0070683_100313365 3300005329 Bacteria 1493
32 Ga0070683_100407587 3300005329 Bacteria 1297
33 Ga0070683_100833830 3300005329 Bacteria 884
34 Ga0070670_100002202 3300005331 Bacteria 16017
35 Ga0070670_100052381 3300005331 Bacteria 3506
36 Ga0070670_100098676 3300005331 Bacteria 2513
37 Ga0070670_100101102 3300005331 Bacteria 2482
38 Ga0070670_100664008 3300005331 Bacteria 936
39 Ga0070670_101571501 3300005331 Bacteria 604
40 Ga0070677_10004794 3300005333 Bacteria 4434
41 Ga0070677_10392010 3300005333 Bacteria 730
42 Ga0070666_10012847 3300005335 Bacteria 5295
43 Ga0070666_10063696 3300005335 Bacteria 2499
44 Ga0070680_100001450 3300005336 Bacteria 17185
45 Ga0070680_100017931 3300005336 Bacteria 5588
46 Ga0070680_100089669 3300005336 Bacteria 2544
47 Ga0070680_100125083 3300005336 Bacteria 2148
48 Ga0070680_100506025 3300005336 Bacteria 1034
49 Ga0070680_101243851 3300005336 Bacteria 644
50 Ga0070680_101356344 3300005336 Bacteria 616
51 Ga0070682_100047471 3300005337 Bacteria 2669
52 Ga0070682_100639366 3300005337 Bacteria 845
53 Ga0070682_101690106 3300005337 Bacteria 550
54 Ga0068868_101418681 3300005338 Bacteria 648
55 Ga0070660_100003962 3300005339 Bacteria 10231
56 Ga0070660_100012252 3300005339 Bacteria 6119
57 Ga0070660_100046638 3300005339 Bacteria 3322
58 Ga0070660_100059507 3300005339 Bacteria 2962
59 Ga0070660_100140197 3300005339 Bacteria 1939
60 Ga0070660_100190667 3300005339 Bacteria 1660
61 Ga0070660_100335812 3300005339 Bacteria 1243
62 Ga0070660_100346684 3300005339 Bacteria 1222
63 Ga0070660_100908596 3300005339 Bacteria 742
64 Ga0070660_101635403 3300005339 Bacteria 548
65 Ga0070691_10006086 3300005341 Bacteria 5508
66 Ga0070691_10067251 3300005341 Bacteria 1733
67 Ga0070661_100034434 3300005344 Bacteria 3672
68 Ga0070661_100043207 3300005344 Bacteria 3292
69 Ga0070661_100049090 3300005344 Bacteria 3090
70 Ga0070661_100054191 3300005344 Bacteria 2937
71 Ga0070661_100060032 3300005344 Bacteria 2790
72 Ga0070661_100066088 3300005344 Bacteria 2657
73 Ga0070661_100094270 3300005344 Bacteria 2218
74 Ga0070661_100108693 3300005344 Bacteria 2069
75 Ga0070661_100117559 3300005344 Bacteria 1989
76 Ga0070661_100163341 3300005344 Bacteria 1687
77 Ga0070661_100221835 3300005344 Bacteria 1450
78 Ga0070661_100683825 3300005344 Bacteria 835
79 Ga0070692_10101958 3300005345 Bacteria 1575
80 Ga0070668_101019219 3300005347 Bacteria 745
81 Ga0070668_101422467 3300005347 Bacteria 633
82 Ga0070669_100097309 3300005353 Bacteria 2215
83 Ga0070669_100687803 3300005353 Bacteria 863
84 Ga0070669_101124958 3300005353 Bacteria 677
85 Ga0070675_100073494 3300005354 Bacteria 2839
86 Ga0070675_100407209 3300005354 Bacteria 1214
87 Ga0070675_102093588 3300005354 Bacteria 522
88 Ga0070671_100020373 3300005355 Bacteria 5407
89 Ga0070671_100056156 3300005355 Bacteria 3276
90 Ga0070671_100058503 3300005355 Bacteria 3208
91 Ga0070671_100454155 3300005355 Bacteria 1099
92 Ga0070671_100697482 3300005355 Bacteria 880
93 Ga0070671_101181799 3300005355 Bacteria 673
94 Ga0070671_101603293 3300005355 Bacteria 577
95 Ga0070674_100032808 3300005356 Bacteria 3451
96 Ga0070674_100099347 3300005356 Bacteria 2117
97 Ga0070674_100211949 3300005356 Bacteria 1502
98 Ga0070674_101681305 3300005356 Bacteria 574
99 Ga0070673_100052580 3300005364 Bacteria 3197
100 Ga0070673_100157734 3300005364 Bacteria 1927
101 Ga0070673_100204483 3300005364 Bacteria 1702
102 Ga0070673_100467878 3300005364 Bacteria 1136
103 Ga0070673_101131393 3300005364 Bacteria 732
104 Ga0070673_101760955 3300005364 Bacteria 587
105 Ga0070659_100002216 3300005366 Bacteria 13808
106 Ga0070659_100005262 3300005366 Bacteria 9284
107 Ga0070659_100026983 3300005366 Bacteria 4422
108 Ga0070659_100030144 3300005366 Bacteria 4197
109 Ga0070659_100096137 3300005366 Bacteria 2379
110 Ga0070659_100115850 3300005366 Bacteria 2166
111 Ga0070659_100425267 3300005366 Bacteria 1124
112 Ga0070659_100438499 3300005366 Bacteria 1106
113 Ga0070659_100499015 3300005366 Bacteria 1037
114 Ga0070659_100657927 3300005366 Bacteria 904
115 Ga0070659_101175541 3300005366 Bacteria 678
116 Ga0070659_101623569 3300005366 Bacteria 577
117 Ga0070659_101837899 3300005366 Bacteria 543
118 Ga0070667_101238438 3300005367 Bacteria 699
119 Ga0070667_101298063 3300005367 Bacteria 682
120 Ga0070709_10108935 3300005434 Bacteria 1859
121 Ga0070714_100084447 3300005435 Bacteria 2770
122 Ga0070714_100189986 3300005435 Bacteria 1873
123 Ga0070714_100500356 3300005435 Bacteria 1159
124 Ga0070714_100530349 3300005435 Bacteria 1125
125 Ga0070714_100537828 3300005435 Bacteria 1117
126 Ga0070713_100032231 3300005436 Bacteria 4183
127 Ga0070713_100096380 3300005436 Bacteria 2554
128 Ga0070713_100413521 3300005436 Bacteria 1261
129 Ga0070711_101038932 3300005439 Bacteria 704
130 Ga0070700_100249000 3300005441 Bacteria 1273
131 Ga0070663_100012832 3300005455 Bacteria 5316
132 Ga0070663_100019960 3300005455 Bacteria 4426
133 Ga0070663_100143232 3300005455 Bacteria 1827
134 Ga0070663_100645420 3300005455 Bacteria 895
135 Ga0070678_100011307 3300005456 Bacteria 5499
136 Ga0070678_100020999 3300005456 Bacteria 4296
137 Ga0070678_100023289 3300005456 Bacteria 4125
138 Ga0070662_100001539 3300005457 Bacteria 14228
139 Ga0070662_100004204 3300005457 Bacteria 9069
140 Ga0070662_100004720 3300005457 Bacteria 8636
141 Ga0070662_100004991 3300005457 Bacteria 8436
142 Ga0070662_100011626 3300005457 Bacteria 5810
143 Ga0070662_100012652 3300005457 Bacteria 5601
144 Ga0070662_100031255 3300005457 Bacteria 3735
145 Ga0070662_100045042 3300005457 Bacteria 3163
146 Ga0070662_100118981 3300005457 Bacteria 2022
147 Ga0070662_100126867 3300005457 Bacteria 1962
148 Ga0070662_100210023 3300005457 Bacteria 1549
149 Ga0070662_100435041 3300005457 Bacteria 1087
150 Ga0070662_100535808 3300005457 Bacteria 980
151 Ga0070662_100757746 3300005457 Bacteria 824
152 Ga0070681_10001339 3300005458 Bacteria 21543
153 Ga0070681_10014993 3300005458 Bacteria 7706
154 Ga0070681_10066166 3300005458 Bacteria 3582
155 Ga0070681_10349728 3300005458 Bacteria 1388
156 Ga0070681_10634359 3300005458 Bacteria 983
157 Ga0070679_100003454 3300005530 Bacteria 14471
158 Ga0070679_100027930 3300005530 Bacteria 5559
159 Ga0070679_100082376 3300005530 Bacteria 3207
160 Ga0070679_100141140 3300005530 Bacteria 2388
161 Ga0070679_100191409 3300005530 Bacteria 2014
162 Ga0070679_100274145 3300005530 Bacteria 1640
163 Ga0070679_100394128 3300005530 Bacteria 1331
164 Ga0070679_100611104 3300005530 Bacteria 1033
165 Ga0070679_100744898 3300005530 Bacteria 923
166 Ga0070679_100759368 3300005530 Bacteria 913
167 Ga0070684_100011579 3300005535 Bacteria 7028
168 Ga0070684_100128515 3300005535 Bacteria 2284
169 Ga0070684_100132298 3300005535 Bacteria 2250
170 Ga0070684_100149849 3300005535 Bacteria 2113
171 Ga0068853_100001957 3300005539 Bacteria 15180
172 Ga0068853_100077698 3300005539 Bacteria 2900
173 Ga0068853_100384335 3300005539 Bacteria 1311
174 Ga0068853_100385435 3300005539 Bacteria 1309
175 Ga0068853_100418774 3300005539 Bacteria 1256
176 Ga0070672_100051075 3300005543 Bacteria 3223
177 Ga0070672_100256561 3300005543 Bacteria 1474
178 Ga0070693_100057759 3300005547 Bacteria 2244
179 Ga0070665_100006804 3300005548 Bacteria 11625
180 Ga0070665_100026298 3300005548 Bacteria 5860
181 Ga0070665_100211587 3300005548 Bacteria 1940
182 Ga0068855_100004751 3300005563 Bacteria 16586
183 Ga0068855_100052431 3300005563 Bacteria 4802
184 Ga0068855_100072304 3300005563 Bacteria 4009
185 Ga0068855_100132730 3300005563 Bacteria 2843
186 Ga0068855_100172964 3300005563 Bacteria 2445
187 Ga0068855_100220928 3300005563 Bacteria 2125
188 Ga0068855_100420292 3300005563 Bacteria 1462
189 Ga0068855_101892344 3300005563 Bacteria 604
190 Ga0068855_102022938 3300005563 Bacteria 581
191 Ga0070664_100006127 3300005564 Bacteria 9727
192 Ga0070664_100008358 3300005564 Bacteria 8367
193 Ga0070664_100015985 3300005564 Bacteria 6146
194 Ga0070664_100028153 3300005564 Bacteria 4673
195 Ga0070664_100044312 3300005564 Bacteria 3757
196 Ga0070664_100052012 3300005564 Bacteria 3469
197 Ga0070664_100071343 3300005564 Bacteria 2976
198 Ga0070664_100104848 3300005564 Bacteria 2462
199 Ga0070664_100112812 3300005564 Bacteria 2374
200 Ga0070664_101825683 3300005564 Bacteria 577
201 Ga0068857_100021306 3300005577 Bacteria 5706
202 Ga0068857_100032080 3300005577 Bacteria 4643
203 Ga0068857_100037375 3300005577 Bacteria 4301
204 Ga0068857_100041749 3300005577 Bacteria 4067
205 Ga0068857_100098696 3300005577 Bacteria 2619
206 Ga0068857_100101854 3300005577 Bacteria 2577
207 Ga0068857_100203314 3300005577 Bacteria 1806
208 Ga0068857_100301347 3300005577 Bacteria 1477
209 Ga0068857_100669447 3300005577 Bacteria 984
210 Ga0068857_100963352 3300005577 Bacteria 820
211 Ga0068854_100002020 3300005578 Bacteria 12425
212 Ga0068854_100012449 3300005578 Bacteria 5571
213 Ga0068854_100060303 3300005578 Bacteria 2744
214 Ga0068854_100066174 3300005578 Bacteria 2629
215 Ga0068854_100103305 3300005578 Bacteria 2139
216 Ga0068854_100114192 3300005578 Bacteria 2041
217 Ga0068854_100130081 3300005578 Bacteria 1921
218 Ga0068854_100131610 3300005578 Bacteria 1911
219 Ga0068854_100164012 3300005578 Bacteria 1723
220 Ga0068854_100201065 3300005578 Bacteria 1566
221 Ga0068854_101365291 3300005578 Bacteria 640
222 Ga0068856_100028279 3300005614 Bacteria 5474
223 Ga0068856_100123729 3300005614 Bacteria 2589
224 Ga0068856_100127405 3300005614 Bacteria 2549
225 Ga0068856_100155209 3300005614 Bacteria 2299
226 Ga0068856_100226094 3300005614 Bacteria 1887
227 Ga0068856_100230277 3300005614 Bacteria 1868
228 Ga0068856_100304429 3300005614 Bacteria 1612
229 Ga0068856_100371697 3300005614 Bacteria 1449
230 Ga0068856_100434045 3300005614 Bacteria 1334
231 Ga0068856_100648477 3300005614 Bacteria 1076
232 Ga0068856_101911055 3300005614 Bacteria 604
233 Ga0068852_100000080 3300005616 Bacteria 67261
234 Ga0068852_100036113 3300005616 Bacteria 4131
235 Ga0068852_100084288 3300005616 Bacteria 2828
236 Ga0068852_100085473 3300005616 Bacteria 2810
237 Ga0068852_100253888 3300005616 Bacteria 1686
238 Ga0068852_100302190 3300005616 Bacteria 1549
239 Ga0068852_100341078 3300005616 Bacteria 1460
240 Ga0068852_101066886 3300005616 Bacteria 827
241 Ga0068852_102280674 3300005616 Bacteria 562
242 Ga0068852_102682362 3300005616 Bacteria 517
243 Ga0068859_100208144 3300005617 Bacteria 2042
244 Ga0068864_100011035 3300005618 Bacteria 7467
245 Ga0068864_100050549 3300005618 Bacteria 3578
246 Ga0068864_100410801 3300005618 Bacteria 1288
247 Ga0068864_100579694 3300005618 Bacteria 1087
248 Ga0068866_10172362 3300005718 Bacteria 1271
249 Ga0068866_10340148 3300005718 Bacteria 950
250 Ga0068861_100876679 3300005719 Bacteria 848
251 Ga0068851_10057336 3300005834 Bacteria 1988
252 Ga0068851_10191180 3300005834 Bacteria 1138
253 Ga0068851_10197766 3300005834 Bacteria 1121
254 Ga0068870_10233449 3300005840 Bacteria 1132
255 Ga0068870_11373690 3300005840 Bacteria 517
256 Ga0068863_100036340 3300005841 Bacteria 4693
257 Ga0068863_100515485 3300005841 Bacteria 1178
258 Ga0068858_101214651 3300005842 Bacteria 741
259 Ga0068858_101362775 3300005842 Bacteria 698
260 Ga0068860_101522444 3300005843 Bacteria 691
261 Ga0068862_100015063 3300005844 Bacteria 6422
262 Ga0068862_100289346 3300005844 Bacteria 1504
263 Ga0068862_100587939 3300005844 Bacteria 1067
264 Ga0081539_10031722 3300005985 Bacteria 3251
265 Ga0081539_10187597 3300005985 Bacteria 965
266 Ga0070717_10057026 3300006028 Bacteria 3228
267 Ga0070715_10934690 3300006163 Bacteria 536
268 Ga0070716_101126485 3300006173 Bacteria 627
269 Ga0070712_100076676 3300006175 Bacteria 2408
270 Ga0070712_100255640 3300006175 Bacteria 1402
271 Ga0075366_10013298 3300006195 Bacteria 4682
272 Ga0075366_10498345 3300006195 Bacteria 753
273 Ga0097621_100101886 3300006237 Bacteria 2416
274 Ga0097621_100117840 3300006237 Bacteria 2250
275 Ga0075370_10145090 3300006353 Bacteria 1389
276 Ga0068871_100045399 3300006358 Bacteria 3536
277 Ga0068871_100800415 3300006358 Bacteria 869
278 Ga0075434_101143457 3300006871 Bacteria 791
279 Ga0068865_100058549 3300006881 Bacteria 2692
280 Ga0097620_100208141 3300006931 Bacteria 2042
281 Ga0105240_10006781 3300009093 Bacteria 16749
282 Ga0105240_10007009 3300009093 Bacteria 16450
283 Ga0105240_10066426 3300009093 Bacteria 4474
284 Ga0105240_10664865 3300009093 Bacteria 1140
285 Ga0105247_11418484 3300009101 Bacteria 563
286 Ga0105243_10144727 3300009148 Bacteria 2032
287 Ga0105241_10030235 3300009174 Bacteria 4046
288 Ga0105241_10549084 3300009174 Bacteria 1037
289 Ga0105242_10240940 3300009176 Bacteria 1626
290 Ga0105248_10018126 3300009177 Bacteria 7774
291 Ga0105248_10087755 3300009177 Bacteria 3501
292 Ga0105248_10355708 3300009177 Bacteria 1649
293 Ga0105237_10000537 3300009545 Bacteria 53507
294 Ga0105237_10255343 3300009545 Bacteria 1755
295 Ga0105238_10039699 3300009551 Bacteria 4773
296 Ga0105238_10088881 3300009551 Bacteria 3076
297 Ga0105238_10313780 3300009551 Bacteria 1553
298 Ga0105238_11212438 3300009551 Bacteria 779
299 Ga0105238_11230910 3300009551 Bacteria 773
300 Ga0105249_10466678 3300009553 Bacteria 1303
301 Ga0105249_11051390 3300009553 Bacteria 884
302 Ga0105239_10000037 3300010375 Bacteria 206779
303 Ga0105239_10314458 3300010375 Bacteria 1765
304 Ga0105239_11463005 3300010375 Bacteria 789
305 Ga0105246_10005301 3300011119 Bacteria 7848
306 Ga0157373_10007202 3300013100 Bacteria 8296
307 Ga0157373_10010032 3300013100 Bacteria 6979
308 Ga0157373_10021962 3300013100 Bacteria 4631
309 Ga0157373_10109402 3300013100 Bacteria 1943
310 Ga0157373_10169490 3300013100 Bacteria 1536
311 Ga0157371_10007340 3300013102 Bacteria 8938
312 Ga0157371_10035232 3300013102 Bacteria 3587
313 Ga0157371_10049116 3300013102 Bacteria 2998
314 Ga0157371_10059623 3300013102 Bacteria 2705
315 Ga0157371_10133514 3300013102 Bacteria 1766
316 Ga0157371_10248500 3300013102 Bacteria 1280
317 Ga0157371_10523454 3300013102 Bacteria 877
318 Ga0157371_10595720 3300013102 Bacteria 822
319 Ga0157371_11011084 3300013102 Bacteria 634
320 Ga0157371_11096845 3300013102 Bacteria 610
321 Ga0157370_10002707 3300013104 Bacteria 21218
322 Ga0157370_10076487 3300013104 Bacteria 3153
323 Ga0157370_10079228 3300013104 Bacteria 3094
324 Ga0157370_10151510 3300013104 Bacteria 2158
325 Ga0157370_10160823 3300013104 Bacteria 2089
326 Ga0157370_10199646 3300013104 Bacteria 1855
327 Ga0157370_10771049 3300013104 Bacteria 876
328 Ga0157370_11162361 3300013104 Bacteria 697
329 Ga0157369_10003801 3300013105 Bacteria 17942
330 Ga0157369_10007243 3300013105 Bacteria 12769
331 Ga0157369_10066953 3300013105 Bacteria 3863
332 Ga0157369_10071851 3300013105 Bacteria 3714
333 Ga0157369_10128806 3300013105 Bacteria 2682
334 Ga0157369_10727000 3300013105 Bacteria 1022
335 Ga0157369_10852438 3300013105 Bacteria 935
336 Ga0157369_11127075 3300013105 Bacteria 802
337 Ga0157374_10020416 3300013296 Bacteria 5878
338 Ga0163162_10059596 3300013306 Bacteria 3850
339 Ga0157372_10044080 3300013307 Bacteria 4942
340 Ga0157372_10068808 3300013307 Bacteria 3981
341 Ga0157372_10073145 3300013307 Bacteria 3863
342 Ga0157372_10088605 3300013307 Bacteria 3514
343 Ga0157372_11189105 3300013307 Bacteria 881
344 Ga0157372_11380048 3300013307 Bacteria 812
345 Ga0157372_11875919 3300013307 Bacteria 689
346 Ga0157375_10147545 3300013308 Bacteria 2484
347 Ga0157375_10163965 3300013308 Bacteria 2366
348 Ga0157375_11096669 3300013308 Bacteria 932
349 Ga0163163_10246438 3300014325 Bacteria 1837
350 Ga0163163_10325613 3300014325 Bacteria 1591
351 Ga0163163_12069260 3300014325 Bacteria 629
352 Ga0157380_10667922 3300014326 Bacteria 1039
353 Ga0157380_11595072 3300014326 Bacteria 708
354 Ga0157376_11784989 3300014969 Bacteria 651
355 Ga0163161_10624423 3300017792 Bacteria 891
356 Ga0163161_10653749 3300017792 Bacteria 871
357 Ga0163161_11633243 3300017792 Bacteria 569
358 Ga0197907_11037911 3300020069 Bacteria 1008
359 Ga0206356_11278704 3300020070 Bacteria 1962
360 Ga0206354_10981714 3300020081 Bacteria 692
361 Ga0206353_11730985 3300020082 Bacteria 1339
362 Ga0206353_11992502 3300020082 Bacteria 1172
363 Ga0213876_10322083 3300021384 Bacteria 822
364 Ga0213875_10000290 3300021388 Bacteria 48577
365 Ga0213875_10001748 3300021388 Bacteria 13623
366 Ga0224712_10494755 3300022467 Bacteria 591
367 Ga0207697_10098636 3300025315 Bacteria 1244
368 Ga0207656_10033369 3300025321 Bacteria 2144
369 Ga0207682_10002322 3300025893 Bacteria 8572
370 Ga0207682_10005059 3300025893 Bacteria 5405
371 Ga0207688_10027523 3300025901 Bacteria 3127
372 Ga0207688_10142810 3300025901 Bacteria 1410
373 Ga0207680_10048306 3300025903 Bacteria 2527
374 Ga0207680_10444949 3300025903 Bacteria 919
375 Ga0207647_10001813 3300025904 Bacteria 16387
376 Ga0207647_10040266 3300025904 Bacteria 2944
377 Ga0207647_10075755 3300025904 Bacteria 2024
378 Ga0207647_10170273 3300025904 Bacteria 1268
379 Ga0207647_10207190 3300025904 Bacteria 1133
380 Ga0207647_10445076 3300025904 Bacteria 726
381 Ga0207645_10056079 3300025907 Bacteria 2515
382 Ga0207645_10102717 3300025907 Bacteria 1845
383 Ga0207645_10418037 3300025907 Bacteria 903
384 Ga0207645_10662781 3300025907 Bacteria 709
385 Ga0207645_11178665 3300025907 Bacteria 515
386 Ga0207643_10372807 3300025908 Bacteria 899
387 Ga0207705_10005388 3300025909 Bacteria 9568
388 Ga0207705_10007690 3300025909 Bacteria 7925
389 Ga0207705_10018115 3300025909 Bacteria 5035
390 Ga0207705_10024689 3300025909 Bacteria 4289
391 Ga0207705_10047210 3300025909 Bacteria 3096
392 Ga0207705_10062539 3300025909 Bacteria 2689
393 Ga0207705_10102857 3300025909 Bacteria 2103
394 Ga0207705_10462396 3300025909 Bacteria 984
395 Ga0207705_11552762 3300025909 Bacteria 500
396 Ga0207654_10027119 3300025911 Bacteria 3111
397 Ga0207654_10063526 3300025911 Bacteria 2167
398 Ga0207707_10057359 3300025912 Bacteria 3389
399 Ga0207707_10279538 3300025912 Bacteria 1446
400 Ga0207707_10280833 3300025912 Bacteria 1442
401 Ga0207707_10561290 3300025912 Bacteria 969
402 Ga0207707_10850931 3300025912 Bacteria 757
403 Ga0207695_10007423 3300025913 Bacteria 13959
404 Ga0207695_10011915 3300025913 Bacteria 10473
405 Ga0207695_10029355 3300025913 Bacteria 6080
406 Ga0207695_11017084 3300025913 Bacteria 708
407 Ga0207671_10001619 3300025914 Bacteria 25633
408 Ga0207671_10324828 3300025914 Bacteria 1218
409 Ga0207693_10151389 3300025915 Bacteria 1825
410 Ga0207660_10003305 3300025917 Bacteria 10549
411 Ga0207660_10086206 3300025917 Bacteria 2318
412 Ga0207660_10577178 3300025917 Bacteria 915
413 Ga0207660_11111759 3300025917 Bacteria 644
414 Ga0207662_10107759 3300025918 Bacteria 1734
415 Ga0207657_10000025 3300025919 Bacteria 143407
416 Ga0207657_10005455 3300025919 Bacteria 13277
417 Ga0207657_10030205 3300025919 Bacteria 4922
418 Ga0207657_10036050 3300025919 Bacteria 4430
419 Ga0207657_10075781 3300025919 Bacteria 2838
420 Ga0207657_10077500 3300025919 Bacteria 2801
421 Ga0207657_10091163 3300025919 Bacteria 2542
422 Ga0207657_10612349 3300025919 Bacteria 849
423 Ga0207657_10629046 3300025919 Bacteria 836
424 Ga0207657_11200558 3300025919 Bacteria 576
425 Ga0207649_10004864 3300025920 Bacteria 7266
426 Ga0207649_10005078 3300025920 Bacteria 7115
427 Ga0207649_10019810 3300025920 Bacteria 3850
428 Ga0207649_10025328 3300025920 Bacteria 3457
429 Ga0207649_10155218 3300025920 Bacteria 1580
430 Ga0207649_10176627 3300025920 Bacteria 1492
431 Ga0207649_10222242 3300025920 Bacteria 1346
432 Ga0207649_10256273 3300025920 Bacteria 1262
433 Ga0207649_10422534 3300025920 Bacteria 1001
434 Ga0207649_10440825 3300025920 Bacteria 981
435 Ga0207649_10647799 3300025920 Bacteria 816
436 Ga0207649_11029124 3300025920 Bacteria 648
437 Ga0207652_10022343 3300025921 Bacteria 5232
438 Ga0207652_10037074 3300025921 Bacteria 4126
439 Ga0207652_10296681 3300025921 Bacteria 1459
440 Ga0207652_10411710 3300025921 Bacteria 1219
441 Ga0207652_10827060 3300025921 Bacteria 821
442 Ga0207652_10975762 3300025921 Bacteria 746
443 Ga0207652_10997575 3300025921 Bacteria 736
444 Ga0207652_11306985 3300025921 Bacteria 628
445 Ga0207652_11356391 3300025921 Bacteria 614
446 Ga0207681_10089125 3300025923 Bacteria 2199
447 Ga0207694_10157047 3300025924 Bacteria 1835
448 Ga0207694_10300106 3300025924 Bacteria 1322
449 Ga0207694_11700994 3300025924 Bacteria 531
450 Ga0207650_10003983 3300025925 Bacteria 10109
451 Ga0207650_10005243 3300025925 Bacteria 8838
452 Ga0207650_10056731 3300025925 Bacteria 2911
453 Ga0207650_10059949 3300025925 Bacteria 2839
454 Ga0207650_10136900 3300025925 Bacteria 1922
455 Ga0207650_10791936 3300025925 Bacteria 803
456 Ga0207659_10296944 3300025926 Bacteria 1326
457 Ga0207659_11750835 3300025926 Bacteria 528
458 Ga0207700_10264379 3300025928 Bacteria 1474
459 Ga0207700_10461701 3300025928 Bacteria 1120
460 Ga0207664_10210898 3300025929 Bacteria 1680
461 Ga0207664_10400248 3300025929 Bacteria 1221
462 Ga0207644_10012709 3300025931 Bacteria 5597
463 Ga0207644_10028411 3300025931 Bacteria 3871
464 Ga0207644_10365287 3300025931 Bacteria 1175
465 Ga0207644_10943589 3300025931 Bacteria 723
466 Ga0207690_10001649 3300025932 Bacteria 13796
467 Ga0207690_10002294 3300025932 Bacteria 11671
468 Ga0207690_10006261 3300025932 Bacteria 7047
469 Ga0207690_10015857 3300025932 Bacteria 4574
470 Ga0207690_10110498 3300025932 Bacteria 1979
471 Ga0207690_10265298 3300025932 Bacteria 1332
472 Ga0207690_10294602 3300025932 Bacteria 1268
473 Ga0207690_10474845 3300025932 Bacteria 1008
474 Ga0207690_10498116 3300025932 Bacteria 985
475 Ga0207690_10870322 3300025932 Bacteria 746
476 Ga0207690_11108451 3300025932 Bacteria 660
477 Ga0207690_11349837 3300025932 Bacteria 596
478 Ga0207706_10000035 3300025933 Bacteria 138894
479 Ga0207706_10004726 3300025933 Bacteria 12754
480 Ga0207706_10006217 3300025933 Bacteria 11096
481 Ga0207706_10007214 3300025933 Bacteria 10277
482 Ga0207706_10012472 3300025933 Bacteria 7743
483 Ga0207706_10014583 3300025933 Bacteria 7117
484 Ga0207706_10015536 3300025933 Bacteria 6878
485 Ga0207706_10022400 3300025933 Bacteria 5671
486 Ga0207706_10195408 3300025933 Bacteria 1775
487 Ga0207706_11323984 3300025933 Bacteria 594
488 Ga0207669_10436429 3300025937 Bacteria 1034
489 Ga0207669_10704312 3300025937 Bacteria 830
490 Ga0207669_10704623 3300025937 Bacteria 830
491 Ga0207669_11911535 3300025937 Bacteria 507
492 Ga0207704_10500478 3300025938 Bacteria 979
493 Ga0207704_11846507 3300025938 Bacteria 520
494 Ga0207691_10058949 3300025940 Bacteria 3492
495 Ga0207691_10069370 3300025940 Bacteria 3184
496 Ga0207691_10373691 3300025940 Bacteria 1217
497 Ga0207711_10003948 3300025941 Bacteria 12756
498 Ga0207711_10031933 3300025941 Bacteria 4449
499 Ga0207711_10060071 3300025941 Bacteria 3275
500 Ga0207711_10093518 3300025941 Bacteria 2648
501 Ga0207661_10031880 3300025944 Bacteria 4076
502 Ga0207661_10141688 3300025944 Bacteria 2069
503 Ga0207661_10299074 3300025944 Bacteria 1442
504 Ga0207661_10628074 3300025944 Bacteria 987
505 Ga0207679_10041055 3300025945 Bacteria 3316
506 Ga0207679_10046459 3300025945 Bacteria 3147
507 Ga0207679_10069689 3300025945 Bacteria 2647
508 Ga0207679_10079898 3300025945 Bacteria 2495
509 Ga0207679_10128316 3300025945 Bacteria 2030
510 Ga0207679_10315938 3300025945 Bacteria 1351
511 Ga0207679_10585141 3300025945 Bacteria 1004
512 Ga0207679_11100401 3300025945 Bacteria 729
513 Ga0207679_11152533 3300025945 Bacteria 711
514 Ga0207667_10005573 3300025949 Bacteria 15365
515 Ga0207667_10022754 3300025949 Bacteria 6913
516 Ga0207667_10030008 3300025949 Bacteria 5888
517 Ga0207667_10039390 3300025949 Bacteria 5037
518 Ga0207667_10096721 3300025949 Bacteria 3047
519 Ga0207667_10141162 3300025949 Bacteria 2480
520 Ga0207667_10203856 3300025949 Bacteria 2029
521 Ga0207667_10278078 3300025949 Bacteria 1711
522 Ga0207667_10565294 3300025949 Bacteria 1149
523 Ga0207667_10583516 3300025949 Bacteria 1128
524 Ga0207651_10129972 3300025960 Bacteria 1926
525 Ga0207651_10352687 3300025960 Bacteria 1239
526 Ga0207651_10502205 3300025960 Bacteria 1049
527 Ga0207651_10789069 3300025960 Bacteria 841
528 Ga0207668_10687374 3300025972 Bacteria 898
529 Ga0207668_11610722 3300025972 Bacteria 586
530 Ga0207640_10007994 3300025981 Bacteria 5843
531 Ga0207640_10017876 3300025981 Bacteria 4156
532 Ga0207640_10033867 3300025981 Bacteria 3183
533 Ga0207640_10042073 3300025981 Bacteria 2910
534 Ga0207640_10125050 3300025981 Bacteria 1850
535 Ga0207640_10224906 3300025981 Bacteria 1439
536 Ga0207640_10733586 3300025981 Bacteria 850
537 Ga0207640_11232058 3300025981 Bacteria 666
538 Ga0207658_10505566 3300025986 Bacteria 1077
539 Ga0207658_11573279 3300025986 Bacteria 601
540 Ga0207677_11384386 3300026023 Bacteria 648
541 Ga0207639_10002227 3300026041 Bacteria 13059
542 Ga0207639_10006776 3300026041 Bacteria 7799
543 Ga0207639_10527046 3300026041 Bacteria 1082
544 Ga0207639_10565216 3300026041 Bacteria 1046
545 Ga0207639_11561699 3300026041 Bacteria 619
546 Ga0207639_11764713 3300026041 Bacteria 579
547 Ga0207639_12141944 3300026041 Bacteria 520
548 Ga0207678_10029833 3300026067 Bacteria 4762
549 Ga0207678_10034003 3300026067 Bacteria 4440
550 Ga0207678_10154812 3300026067 Bacteria 1957
551 Ga0207678_11083388 3300026067 Bacteria 709
552 Ga0207708_10304603 3300026075 Bacteria 1297
553 Ga0207708_11588807 3300026075 Bacteria 575
554 Ga0207702_10045280 3300026078 Bacteria 3702
555 Ga0207702_10058169 3300026078 Bacteria 3289
556 Ga0207702_10145647 3300026078 Bacteria 2149
557 Ga0207702_10216426 3300026078 Bacteria 1783
558 Ga0207702_10325193 3300026078 Bacteria 1465
559 Ga0207702_10462988 3300026078 Bacteria 1232
560 Ga0207702_10467387 3300026078 Bacteria 1226
561 Ga0207702_10586041 3300026078 Bacteria 1093
562 Ga0207702_11021691 3300026078 Bacteria 820
563 Ga0207702_11211742 3300026078 Bacteria 749
564 Ga0207702_11344721 3300026078 Bacteria 708
565 Ga0207702_12240559 3300026078 Bacteria 535
566 Ga0207702_12405728 3300026078 Bacteria 514
567 Ga0207641_10005913 3300026088 Bacteria 10377
568 Ga0207641_10028372 3300026088 Bacteria 4625
569 Ga0207641_10420872 3300026088 Bacteria 1286
570 Ga0207648_10251207 3300026089 Bacteria 1576
571 Ga0207648_10594099 3300026089 Bacteria 1020
572 Ga0207676_10057289 3300026095 Bacteria 3068
573 Ga0207676_10111010 3300026095 Bacteria 2294
574 Ga0207676_10147396 3300026095 Bacteria 2022
575 Ga0207676_10735205 3300026095 Bacteria 959
576 Ga0207676_11067055 3300026095 Bacteria 798
577 Ga0207674_10008356 3300026116 Bacteria 11973
578 Ga0207674_10017107 3300026116 Bacteria 7915
579 Ga0207674_10019197 3300026116 Bacteria 7413
580 Ga0207674_10020237 3300026116 Bacteria 7195
581 Ga0207674_10058174 3300026116 Bacteria 3917
582 Ga0207674_10138496 3300026116 Bacteria 2394
583 Ga0207674_10148267 3300026116 Bacteria 2304
584 Ga0207674_10179775 3300026116 Bacteria 2067
585 Ga0207674_10237401 3300026116 Bacteria 1770
586 Ga0207674_10615532 3300026116 Bacteria 1049
587 Ga0207683_10002122 3300026121 Bacteria 17419
588 Ga0207683_10025091 3300026121 Bacteria 5140
589 Ga0207683_10072641 3300026121 Bacteria 3043
590 Ga0207683_10128869 3300026121 Bacteria 2275
591 Ga0207683_10767403 3300026121 Bacteria 895
592 Ga0207683_11470409 3300026121 Bacteria 629
593 Ga0207698_10001421 3300026142 Bacteria 13902
594 Ga0207698_10048861 3300026142 Bacteria 3215
595 Ga0207698_10080221 3300026142 Bacteria 2628
596 Ga0207698_10181655 3300026142 Bacteria 1864
597 Ga0207698_10224205 3300026142 Bacteria 1701
598 Ga0207698_10427401 3300026142 Bacteria 1273
599 Ga0207698_10697829 3300026142 Bacteria 1010
600 Ga0207698_11160205 3300026142 Bacteria 786
601 Ga0209983_1044774 3300027665 Bacteria 962
602 Ga0209974_10020537 3300027876 Bacteria 2189
603 Ga0268266_10005684 3300028379 Bacteria 11561
604 Ga0268266_10295346 3300028379 Bacteria 1510
605 Ga0268265_10003749 3300028380 Bacteria 10805
606 Ga0268265_10194357 3300028380 Bacteria 1755
607 Ga0268265_10702615 3300028380 Bacteria 977
608 Ga0268265_10974010 3300028380 Bacteria 837
609 Ga0268264_10117885 3300028381 Bacteria 2335
610 Ga0268264_11390068 3300028381 Bacteria 712
611 Ga0316182_1241054 3300030745 Bacteria 1203
612 Ga0307408_100052411 3300031548 Bacteria 2943
613 Ga0307408_100079237 3300031548 Bacteria 2450
614 Ga0307408_100321644 3300031548 Bacteria 1303
615 Ga0307408_100623213 3300031548 Bacteria 961
616 Ga0307408_101096956 3300031548 Bacteria 738
617 Ga0307408_101594227 3300031548 Bacteria 620
618 Ga0307508_10005777 3300031616 Bacteria 11701
619 Ga0307516_10377704 3300031730 Bacteria 1079
620 Ga0307405_10028074 3300031731 Bacteria 3273
621 Ga0307405_10058424 3300031731 Bacteria 2427
622 Ga0307405_10089559 3300031731 Bacteria 2033
623 Ga0307405_10128123 3300031731 Bacteria 1749
624 Ga0307405_10155695 3300031731 Bacteria 1612
625 Ga0307405_10287996 3300031731 Bacteria 1240
626 Ga0307405_10602943 3300031731 Bacteria 896
627 Ga0307405_11275107 3300031731 Bacteria 638
628 Ga0307413_10039345 3300031824 Bacteria 2749
629 Ga0307413_10078405 3300031824 Bacteria 2107
630 Ga0307413_10111906 3300031824 Bacteria 1829
631 Ga0307413_10127709 3300031824 Bacteria 1734
632 Ga0307413_10194031 3300031824 Bacteria 1460
633 Ga0307413_10508913 3300031824 Bacteria 968
634 Ga0307413_10640228 3300031824 Bacteria 875
635 Ga0307413_10816868 3300031824 Bacteria 785
636 Ga0307413_10965446 3300031824 Bacteria 728
637 Ga0307413_11272816 3300031824 Bacteria 642
638 Ga0307413_11541720 3300031824 Bacteria 588
639 Ga0307413_11961180 3300031824 Bacteria 527
640 Ga0307410_10006349 3300031852 Bacteria 6373
641 Ga0307410_10007723 3300031852 Bacteria 5905
642 Ga0307410_10008622 3300031852 Bacteria 5666
643 Ga0307410_10009439 3300031852 Bacteria 5471
644 Ga0307410_10009559 3300031852 Bacteria 5445
645 Ga0307410_10023342 3300031852 Bacteria 3843
646 Ga0307410_10075276 3300031852 Bacteria 2353
647 Ga0307410_10077933 3300031852 Bacteria 2318
648 Ga0307410_10182313 3300031852 Bacteria 1590
649 Ga0307410_10195061 3300031852 Bacteria 1542
650 Ga0307410_10365023 3300031852 Bacteria 1157
651 Ga0307410_10642449 3300031852 Bacteria 889
652 Ga0307410_10802994 3300031852 Bacteria 800
653 Ga0307410_10924253 3300031852 Bacteria 748
654 Ga0307410_11767062 3300031852 Bacteria 549
655 Ga0307406_10006895 3300031901 Bacteria 6291
656 Ga0307406_10008718 3300031901 Bacteria 5668
657 Ga0307406_10137336 3300031901 Bacteria 1725
658 Ga0307406_10152317 3300031901 Bacteria 1651
659 Ga0307406_10216262 3300031901 Bacteria 1421
660 Ga0307406_10244690 3300031901 Bacteria 1347
661 Ga0307406_10250596 3300031901 Bacteria 1334
662 Ga0307406_10328916 3300031901 Bacteria 1185
663 Ga0307406_10705270 3300031901 Bacteria 843
664 Ga0307407_10008681 3300031903 Bacteria 4680
665 Ga0307407_10057654 3300031903 Bacteria 2254
666 Ga0307407_10544673 3300031903 Bacteria 857
667 Ga0307407_10920400 3300031903 Bacteria 672
668 Ga0307412_10049835 3300031911 Bacteria 2760
669 Ga0307412_10066453 3300031911 Bacteria 2444
670 Ga0307412_10094323 3300031911 Bacteria 2101
671 Ga0307412_10144964 3300031911 Bacteria 1744
672 Ga0307412_10235140 3300031911 Bacteria 1413
673 Ga0307412_10380548 3300031911 Bacteria 1142
674 Ga0307412_10428783 3300031911 Bacteria 1083
675 Ga0307412_10642134 3300031911 Bacteria 904
676 Ga0307412_10805437 3300031911 Bacteria 816
677 Ga0307412_10963874 3300031911 Bacteria 751
678 Ga0307412_11383382 3300031911 Bacteria 636
679 Ga0307412_11492884 3300031911 Bacteria 614
680 Ga0307412_12153983 3300031911 Bacteria 518
681 Ga0307409_100012429 3300031995 Bacteria 5425
682 Ga0307409_100012656 3300031995 Bacteria 5387
683 Ga0307409_100026189 3300031995 Bacteria 4108
684 Ga0307409_100031426 3300031995 Bacteria 3832
685 Ga0307409_100041754 3300031995 Bacteria 3429
686 Ga0307409_100057304 3300031995 Bacteria 3018
687 Ga0307409_100118408 3300031995 Bacteria 2237
688 Ga0307409_100157943 3300031995 Bacteria 1979
689 Ga0307409_100308298 3300031995 Bacteria 1476
690 Ga0307409_100312447 3300031995 Bacteria 1467
691 Ga0307409_100629002 3300031995 Bacteria 1064
692 Ga0307409_101141156 3300031995 Bacteria 801
693 Ga0307409_101568511 3300031995 Bacteria 686
694 Ga0307409_102203956 3300031995 Bacteria 580
695 Ga0307409_102299955 3300031995 Bacteria 568
696 Ga0307409_102407435 3300031995 Bacteria 555
697 Ga0307416_100013256 3300032002 Bacteria 5595
698 Ga0307416_100051461 3300032002 Bacteria 3290
699 Ga0307416_100151324 3300032002 Bacteria 2128
700 Ga0307416_100176854 3300032002 Bacteria 1995
701 Ga0307416_100296949 3300032002 Bacteria 1603
702 Ga0307416_100316144 3300032002 Bacteria 1561
703 Ga0307416_100463705 3300032002 Bacteria 1323
704 Ga0307416_100778005 3300032002 Bacteria 1051
705 Ga0307416_100882357 3300032002 Bacteria 994
706 Ga0307416_103525912 3300032002 Bacteria 523
707 Ga0307414_10024413 3300032004 Bacteria 3855
708 Ga0307414_10048296 3300032004 Bacteria 2935
709 Ga0307414_10089508 3300032004 Bacteria 2281
710 Ga0307414_10116239 3300032004 Bacteria 2047
711 Ga0307414_10433823 3300032004 Bacteria 1148
712 Ga0307414_10651294 3300032004 Bacteria 950
713 Ga0307414_10688921 3300032004 Bacteria 924
714 Ga0307414_10776759 3300032004 Bacteria 872
715 Ga0307414_11103783 3300032004 Bacteria 732
716 Ga0307414_11440747 3300032004 Bacteria 640
717 Ga0307414_11752512 3300032004 Bacteria 579
718 Ga0307414_12190051 3300032004 Bacteria 516
719 Ga0307414_12229151 3300032004 Bacteria 511
720 Ga0307411_10003885 3300032005 Bacteria 7042
721 Ga0307411_10006805 3300032005 Bacteria 5756
722 Ga0307411_10011287 3300032005 Bacteria 4813
723 Ga0307411_10016098 3300032005 Bacteria 4225
724 Ga0307411_10046046 3300032005 Bacteria 2809
725 Ga0307411_10083427 3300032005 Bacteria 2207
726 Ga0307411_10138201 3300032005 Bacteria 1792
727 Ga0307411_10144195 3300032005 Bacteria 1760
728 Ga0307411_10157256 3300032005 Bacteria 1697
729 Ga0307411_10199614 3300032005 Bacteria 1535
730 Ga0307411_10246784 3300032005 Bacteria 1401
731 Ga0307411_10255970 3300032005 Bacteria 1379
732 Ga0307411_10517187 3300032005 Bacteria 1012
733 Ga0307411_10681765 3300032005 Bacteria 893
734 Ga0307411_10745347 3300032005 Bacteria 857
735 Ga0307411_10856601 3300032005 Bacteria 804
736 Ga0307411_10968413 3300032005 Bacteria 760
737 Ga0307411_11112371 3300032005 Bacteria 713
738 Ga0307411_11162968 3300032005 Bacteria 698
739 Ga0307411_12125847 3300032005 Bacteria 525
740 Ga0307415_100008798 3300032126 Bacteria 5619
741 Ga0307415_100015267 3300032126 Bacteria 4541
742 Ga0307415_100032212 3300032126 Bacteria 3387
743 Ga0307415_100102274 3300032126 Bacteria 2105
744 Ga0307415_100164042 3300032126 Bacteria 1726
745 Ga0307415_100177081 3300032126 Bacteria 1669
746 Ga0307415_100270131 3300032126 Bacteria 1392
747 Ga0307415_100289019 3300032126 Bacteria 1352
748 Ga0307415_100445351 3300032126 Bacteria 1118
749 Ga0307415_101094834 3300032126 Bacteria 745
750 Ga0307415_101246440 3300032126 Bacteria 702
751 Ga0307415_101688760 3300032126 Bacteria 610
752 Ga0307415_102270198 3300032126 Bacteria 532
753 Ga0307415_102437092 3300032126 Bacteria 515
754 Ga0373948_0093434 3300034817 Bacteria 701
755 Ga0373959_0122794 3300034820 Bacteria 636
756 Ga0373943_0017501 3300035170 Bacteria 3280
757 Ga0373946_0043931 3300035171 Bacteria 1843
758 Ga0373962_0038593 3300035242 Bacteria 1337
759 Ga0373931_0045351 3300035691 Bacteria 2321
760 Ga0373935_0011078 3300035692 Bacteria 5417
761 Ga0373927_0116668 3300035695 Bacteria 1741
762 Ga0316584_0431676 3300036712 Bacteria 934
763 Ga0373925_0026804 3300037068 Bacteria 4219
764 Ga0395899_0003475 3300037312 Bacteria 12483
765 Ga0395899_0018618 3300037312 Bacteria 5278
766 Ga0395899_0030331 3300037312 Bacteria 4067
767 Ga0395899_0034256 3300037312 Bacteria 3812
768 Ga0395899_0071240 3300037312 Bacteria 2543
769 Ga0395899_0073350 3300037312 Bacteria 2503
770 Ga0395899_0082030 3300037312 Bacteria 2345
771 Ga0395899_0288361 3300037312 Bacteria 1114
772 Ga0395899_0293452 3300037312 Bacteria 1102
773 Ga0395899_0424679 3300037312 Bacteria 875
774 Ga0395899_0558604 3300037312 Bacteria 735
775 Ga0395899_0710525 3300037312 Bacteria 629
776 Ga0395900_0000595 3300037418 Bacteria 49632
777 Ga0395900_0000959 3300037418 Bacteria 37589
778 Ga0395900_0002345 3300037418 Bacteria 20967
779 Ga0395900_0004691 3300037418 Bacteria 14409
780 Ga0395900_0005137 3300037418 Bacteria 13748
781 Ga0395900_0006375 3300037418 Bacteria 12300
782 Ga0395900_0027498 3300037418 Bacteria 5827
783 Ga0395900_0027891 3300037418 Bacteria 5783
784 Ga0395900_0048729 3300037418 Bacteria 4364
785 Ga0395900_0052554 3300037418 Bacteria 4194
786 Ga0395900_0143251 3300037418 Bacteria 2446
787 Ga0395900_0160755 3300037418 Bacteria 2291
788 Ga0395900_0225574 3300037418 Bacteria 1886
789 Ga0395900_0239431 3300037418 Bacteria 1821
790 Ga0395900_0253212 3300037418 Bacteria 1761
791 Ga0395900_0330585 3300037418 Bacteria 1502
792 Ga0395900_0417424 3300037418 Bacteria 1303
793 Ga0395900_0454591 3300037418 Bacteria 1236
794 Ga0395900_0596395 3300037418 Bacteria 1045
795 Ga0395900_0732050 3300037418 Bacteria 920
796 Ga0395900_0807790 3300037418 Bacteria 865
797 Ga0395900_1444234 3300037418 Bacteria 600
798 Ga0395898_0001974 3300037466 Bacteria 25803
799 Ga0395898_0022525 3300037466 Bacteria 6380
800 Ga0395898_0052554 3300037466 Bacteria 3981
801 Ga0395898_0057911 3300037466 Bacteria 3773
802 Ga0395898_0059672 3300037466 Bacteria 3710
803 Ga0395898_0078412 3300037466 Bacteria 3187
804 Ga0395898_0111660 3300037466 Bacteria 2620
805 Ga0395898_0141049 3300037466 Bacteria 2307
806 Ga0395898_0167811 3300037466 Bacteria 2098
807 Ga0395898_0230953 3300037466 Bacteria 1764
808 Ga0395898_0404508 3300037466 Bacteria 1301
809 Ga0395898_0785862 3300037466 Bacteria 892
810 Ga0395898_1077198 3300037466 Bacteria 738
811 Ga0395905_0000102 3300037471 Bacteria 143700
812 Ga0395905_0000575 3300037471 Bacteria 49664
813 Ga0395905_0001565 3300037471 Bacteria 27333
814 Ga0395905_0002603 3300037471 Bacteria 19866
815 Ga0395905_0002657 3300037471 Bacteria 19618
816 Ga0395905_0004693 3300037471 Bacteria 14126
817 Ga0395905_0006316 3300037471 Bacteria 11945
818 Ga0395905_0008794 3300037471 Bacteria 9924
819 Ga0395905_0015514 3300037471 Bacteria 7242
820 Ga0395905_0015852 3300037471 Bacteria 7160
821 Ga0395905_0016098 3300037471 Bacteria 7108
822 Ga0395905_0022798 3300037471 Bacteria 5920
823 Ga0395905_0027589 3300037471 Bacteria 5354
824 Ga0395905_0065854 3300037471 Bacteria 3392
825 Ga0395905_0073609 3300037471 Bacteria 3202
826 Ga0395905_0101516 3300037471 Bacteria 2700
827 Ga0395905_0102479 3300037471 Bacteria 2687
828 Ga0395905_0108793 3300037471 Bacteria 2602
829 Ga0395905_0156898 3300037471 Bacteria 2140
830 Ga0395905_0286039 3300037471 Bacteria 1535
831 Ga0395905_0337298 3300037471 Bacteria 1398
832 Ga0395905_0353762 3300037471 Bacteria 1361
833 Ga0395905_0518731 3300037471 Bacteria 1092
834 Ga0395905_0755185 3300037471 Bacteria 875
835 Ga0395905_1312361 3300037471 Bacteria 627
836 Ga0395905_1497223 3300037471 Bacteria 579
837 Ga0436364_0349181 3300037853 Bacteria 33938
838 Ga0436364_0462751 3300037853 Bacteria 45616
839 Ga0436364_1104629 3300037853 Bacteria 656
840 Ga0395901_0003383 3300038443 Bacteria 16065
841 Ga0395901_0014240 3300038443 Bacteria 8097
842 Ga0395901_0041970 3300038443 Bacteria 4741
843 Ga0395901_0078502 3300038443 Bacteria 3447
844 Ga0395901_0100434 3300038443 Bacteria 3035
845 Ga0395901_0110910 3300038443 Bacteria 2881
846 Ga0395901_0112340 3300038443 Bacteria 2861
847 Ga0395901_0121036 3300038443 Bacteria 2750
848 Ga0395901_0164245 3300038443 Bacteria 2331
849 Ga0395901_0174103 3300038443 Bacteria 2257
850 Ga0395901_0190544 3300038443 Bacteria 2150
851 Ga0395901_0274183 3300038443 Bacteria 1754
852 Ga0395901_0399850 3300038443 Bacteria 1411
853 Ga0395901_0418790 3300038443 Bacteria 1374
854 Ga0395901_0446605 3300038443 Bacteria 1323
855 Ga0395901_0503803 3300038443 Bacteria 1232
856 Ga0395901_0523333 3300038443 Bacteria 1204
857 Ga0395901_0684828 3300038443 Bacteria 1024
858 Ga0395901_0758789 3300038443 Bacteria 962
859 Ga0395901_0846898 3300038443 Bacteria 900
860 Ga0395901_0995589 3300038443 Bacteria 814
861 Ga0395901_1607526 3300038443 Bacteria 603
862 Ga0436365_0747204 3300039437 Bacteria 1683
863 Ga0436363_1174985 3300039450 Bacteria 983
864 Ga0439439_0101021 3300041406 Bacteria 794
865 Ga0451798_0734138 3300041458 Bacteria 961
866 Ga0451839_1101509 3300041496 Bacteria 643
867 Ga0451847_0796925 3300041503 Bacteria 661
868 Ga0451851_1358461 3300041507 Bacteria 542
869 Ga0451853_2998369 3300041512 Bacteria 624
870 Ga0439431_0043143 3300041997 Bacteria 1154
871 Ga0439443_006155 3300042003 Bacteria 1633
872 Ga0439448_0002126 3300042005 Bacteria 5334
873 Ga0439448_0372381 3300042005 Bacteria 510
874 Ga0439455_0056225 3300042012 Bacteria 1036
875 Ga0439457_070607 3300042014 Bacteria 796
876 Ga0450920_048228 3300042122 Bacteria 853
877 Ga0450906_072332 3300042145 Bacteria 618
878 Ga0439458_0000026 3300042157 Bacteria 23094
879 Ga0439458_0000344 3300042157 Bacteria 11619
880 Ga0439458_0006868 3300042157 Bacteria 2537
881 Ga0439435_0011950 3300042436 Bacteria 2092
882 Ga0450916_080647 3300042530 Bacteria 555
883 Ga0451577_0954630 3300042876 Bacteria 771
884 Ga0466969_0030656 3300044656 Bacteria 2740
885 Ga0466969_0079912 3300044656 Bacteria 1562
886 Ga0466965_0581730 3300044683 Bacteria 635
887 Ga0466965_0708707 3300044683 Bacteria 578
888 Ga0466966_0044069 3300044684 Bacteria 2857
889 Ga0466961_0005026 3300044693 Bacteria 8317
890 Ga0466961_0110935 3300044693 Bacteria 1726
891 Ga0466963_0002982 3300044694 Bacteria 9565
892 Ga0466963_0022002 3300044694 Bacteria 4031
893 Ga0466963_0093524 3300044694 Bacteria 2050
894 Ga0466963_0171742 3300044694 Bacteria 1511
895 Ga0466963_0351152 3300044694 Bacteria 1039
896 Ga0466963_0869495 3300044694 Bacteria 635
897 Ga0466963_0982309 3300044694 Bacteria 595
898 Ga0453684_1588915 3300044712 Bacteria 672
899 Ga0466971_0424092 3300044719 Bacteria 650
900 Ga0466971_0564889 3300044719 Bacteria 565
901 Ga0466968_0011606 3300044735 Bacteria 3435
902 Ga0466970_0584201 3300044765 Bacteria 647
903 Ga0466970_0765596 3300044765 Bacteria 564
904 Ga0466957_0020493 3300044842 Bacteria 3891
905 Ga0466957_0093517 3300044842 Bacteria 1887
906 Ga0466957_0117586 3300044842 Bacteria 1692
907 Ga0466957_1106577 3300044842 Bacteria 571
908 Ga0466957_1285891 3300044842 Bacteria 531
909 Ga0466960_0661655 3300044901 Bacteria 624
910 Ga0466959_0055502 3300045049 Bacteria 2892
911 Ga0466959_0076191 3300045049 Bacteria 2422
912 Ga0466959_0135900 3300045049 Bacteria 1740
913 Ga0466959_0289001 3300045049 Bacteria 1124
914 Ga0466959_0377614 3300045049 Bacteria 965
915 Ga0466958_0055629 3300045836 Bacteria 2401
916 Ga0466958_0061647 3300045836 Bacteria 2285
917 Ga0466958_0097427 3300045836 Bacteria 1825
918 Ga0466958_0159034 3300045836 Bacteria 1427
919 Ga0466958_0409025 3300045836 Bacteria 876
920 Ga0466958_1033926 3300045836 Bacteria 536
921 Ga0466967_0014999 3300045976 Bacteria 6060
922 Ga0466967_0019317 3300045976 Bacteria 5475
923 Ga0466967_0071231 3300045976 Bacteria 3112
924 Ga0466967_0181568 3300045976 Bacteria 1985
925 Ga0466967_0381659 3300045976 Bacteria 1368
926 Ga0466967_0601466 3300045976 Bacteria 1085
927 Ga0466967_0704090 3300045976 Bacteria 1000
928 Ga0466967_1252869 3300045976 Bacteria 739
929 Ga0466967_1837309 3300045976 Bacteria 603
930 Ga0466967_2542756 3300045976 Bacteria 507
931 Ga0495632_0006109 3300046519 Bacteria 7806
932 Ga0495643_0134689 3300046522 Bacteria 1237
933 Ga0495663_0098090 3300046525 Bacteria 962
934 Ga0495598_0054004 3300046537 Bacteria 1219
935 Ga0495598_0071886 3300046537 Bacteria 1091
936 Ga0495598_0158152 3300046537 Bacteria 795
937 Ga0495621_0042884 3300046539 Bacteria 1594
938 Ga0495621_0068941 3300046539 Bacteria 1299
939 Ga0495621_0148797 3300046539 Bacteria 920
940 Ga0495621_0217518 3300046539 Bacteria 772
941 Ga0495633_0553231 3300046558 Bacteria 518
942 Ga0495669_0003890 3300046684 Bacteria 6144
943 Ga0495669_0007912 3300046684 Bacteria 4464
944 Ga0495669_0126485 3300046684 Bacteria 1201
945 Ga0495687_077545 3300047443 Bacteria 1312
946 Ga0495677_0007140 3300047445 Bacteria 4183
947 Ga0495677_0214731 3300047445 Bacteria 749
948 Ga0495686_0000025 3300047472 Bacteria 388098
949 Ga0495615_0261210 3300048090 Bacteria 551
950 Ga0496100_0026998 3300048903 Bacteria 3525
951 Ga0496101_0152809 3300048904 Bacteria 1766
952 Ga0496101_0209439 3300048904 Bacteria 1510
953 Ga0496102_0454275 3300048905 Bacteria 1202
954 Ga0496102_0567845 3300048905 Bacteria 1057
955 Ga0496103_0154035 3300048906 Bacteria 1473
956 Ga0496104_0516364 3300048907 Bacteria 1106
957 Ga0496104_0751988 3300048907 Bacteria 882
958 Ga0496106_0047495 3300048909 Bacteria 3231
959 Ga0496107_0085960 3300048910 Bacteria 2295
960 Ga0496108_0032321 3300048911 Bacteria 4347
961 Ga0496108_0092944 3300048911 Bacteria 2565
962 Ga0496109_0019045 3300048912 Bacteria 6046
963 Ga0496109_0712012 3300048912 Bacteria 941
964 Ga0496109_1063564 3300048912 Bacteria 746
965 Ga0496110_0054777 3300048913 Bacteria 3508
966 Ga0496110_0961670 3300048913 Bacteria 761
967 Ga0496111_0009760 3300048914 Bacteria 6417
968 Ga0496111_0039388 3300048914 Bacteria 3388
969 Ga0496111_0210355 3300048914 Bacteria 1445
970 Ga0496112_0108739 3300048915 Bacteria 2743
971 Ga0496112_1278665 3300048915 Bacteria 649
972 Ga0496113_0009504 3300048916 Bacteria 6378
973 Ga0496113_0111040 3300048916 Bacteria 2134
974 Ga0496114_0026393 3300048917 Bacteria 4755
975 Ga0496114_0037188 3300048917 Bacteria 4026
976 Ga0496115_0097251 3300048918 Bacteria 2411
977 Ga0496115_0780767 3300048918 Bacteria 745
978 Ga0496115_1369350 3300048918 Bacteria 524
979 Ga0496117_0164371 3300048920 Bacteria 1296
980 Ga0496117_0194404 3300048920 Bacteria 1152
981 Ga0496118_0082983 3300048921 Bacteria 2243
982 Ga0496121_0000066 3300048924 Bacteria 267065
983 Ga0496122_0008044 3300048925 Bacteria 11506
984 Ga0496123_0000643 3300048926 Bacteria 58206
985 Ga0496124_0072716 3300048927 Bacteria 2847
986 Ga0496126_0002370 3300048929 Bacteria 25680
987 Ga0496126_0003867 3300048929 Bacteria 18473
988 Ga0496126_0122651 3300048929 Bacteria 2252
989 Ga0501031_0225520 3300049568 Bacteria 1220
990 Ga0501032_0002057 3300049569 Bacteria 15884
991 Ga0501033_0030447 3300049570 Bacteria 4056
992 Ga0501034_0221589 3300049571 Bacteria 1844
993 Ga0501036_0103968 3300049572 Bacteria 2402
994 Ga0501037_0051813 3300049573 Bacteria 3002
995 Ga0501037_0824300 3300049573 Bacteria 612
996 Ga0501038_0233976 3300049574 Bacteria 1461
997 Ga0501038_0673033 3300049574 Bacteria 777
998 Ga0501039_1542726 3300049575 Bacteria 510
999 Ga0501042_0988872 3300049578 Bacteria 613
1000 Ga0501043_0007681 3300049579 Bacteria 8542
1001 Ga0501043_0589590 3300049579 Bacteria 822
1002 Ga0501047_0195622 3300049581 Bacteria 1884
1003 Ga0501047_0573951 3300049581 Bacteria 951
1004 Ga0501048_0789503 3300049582 Bacteria 682
1005 Ga0501067_0007695 3300049583 Bacteria 5992
1006 Ga0501068_0000415 3300049584 Bacteria 21599
1007 Ga0501071_0714498 3300049587 Bacteria 772
1008 Ga0501071_1295546 3300049587 Bacteria 563
1009 Ga0501073_0000003 3300049589 Bacteria 294975
1010 Ga0501073_0702989 3300049589 Bacteria 697
1011 Ga0501077_0002396 3300049593 Bacteria 11243
1012 Ga0501259_140579 3300049688 Bacteria 591
1013 Ga0501080_0000242 3300049742 Bacteria 41048
1014 Ga0501080_0966717 3300049742 Bacteria 740
1015 Ga0501268_027757 3300049765 Bacteria 1008
1016 Ga0501035_1281392 3300049822 Bacteria 566
1017 Ga0501044_0031428 3300049823 Bacteria 5589
1018 Ga0501044_0059089 3300049823 Bacteria 3930
1019 Ga0501044_1664103 3300049823 Bacteria 503
1020 nmdc:mga07m45_246059_c1 3300050496 Bacteria 1040
1021 nmdc:mga07m45_821175_c1 3300050496 Bacteria 532
1022 Ga0590071_217222 3300059421 Bacteria 505
1023 Ga0587128_103791 3300059630 Bacteria 599
1024 Ga0466962_0029955 3300061719 Bacteria 2606
1025 Ga0466962_0078896 3300061719 Bacteria 1574
1026 Ga0466962_0225265 3300061719 Bacteria 919
1027 Ga0466962_0598491 3300061719 Bacteria 562
1028 2644126785 2643221622 Bacteria 4212502
1029 3000865865 3000865235 Bacteria 3106258
1030 Ga0070677_10085431
1031 JGI24741J21665_1009587
1032 JGI24741J21665_1015597
1033 JGI24741J21665_1063032
1034 JGI24740J21852_10004319
1035 JGI24740J21852_10017233
1036 JGI24737J22298_10014181
1037 JGI24735J21928_10002858
1038 JGI24735J21928_10010404
1039 JGI24738J21930_10042157
1040 rootH1_10057308
1041 rootH1_10214045
1042 Ga0065715_10363199
1043 Ga0065707_10104014
1044 Ga0070658_10001812
1045 Ga0070658_10004882
1046 Ga0070658_10005900
1047 Ga0070658_10021687
1048 Ga0070658_10083721
1049 Ga0070658_10120769
1050 Ga0070658_10214504
1051 Ga0070658_10594883
1052 Ga0070658_10701198
1053 Ga0070658_10788485
1054 Ga0070658_11653841
1055 Ga0070676_10074124
1056 Ga0070683_100038356
1057 Ga0070683_100042663
1058 Ga0070683_100051973
1059 Ga0070683_100164256
1060 Ga0070683_100313365
1061 Ga0070683_100407587
1062 Ga0070683_100833830
1063 Ga0070670_100002202
1064 Ga0070670_100052381
1065 Ga0070670_100098676
1066 Ga0070670_100101102
1067 Ga0070670_100664008
1068 Ga0070670_101571501
1069 Ga0070677_10004794
1070 Ga0070677_10392010
1071 Ga0070666_10012847
1072 Ga0070666_10063696
1073 Ga0070680_100001450
1074 Ga0070680_100017931
1075 Ga0070680_100089669
1076 Ga0070680_100125083
1077 Ga0070680_100506025
1078 Ga0070680_101243851
1079 Ga0070680_101356344
1080 Ga0070682_100047471
1081 Ga0070682_100639366
1082 Ga0070682_101690106
1083 Ga0068868_101418681
1084 Ga0070660_100003962
1085 Ga0070660_100012252
1086 Ga0070660_100046638
1087 Ga0070660_100059507
1088 Ga0070660_100140197
1089 Ga0070660_100190667
1090 Ga0070660_100335812
1091 Ga0070660_100346684
1092 Ga0070660_100908596
1093 Ga0070660_101635403
1094 Ga0070691_10006086
1095 Ga0070691_10067251
1096 Ga0070661_100034434
1097 Ga0070661_100043207
1098 Ga0070661_100049090
1099 Ga0070661_100054191
1100 Ga0070661_100060032
1101 Ga0070661_100066088
1102 Ga0070661_100094270
1103 Ga0070661_100108693
1104 Ga0070661_100117559
1105 Ga0070661_100163341
1106 Ga0070661_100221835
1107 Ga0070661_100683825
1108 Ga0070692_10101958
1109 Ga0070668_101019219
1110 Ga0070668_101422467
1111 Ga0070669_100097309
1112 Ga0070669_100687803
1113 Ga0070669_101124958
1114 Ga0070675_100073494
1115 Ga0070675_100407209
1116 Ga0070675_102093588
1117 Ga0070671_100020373
1118 Ga0070671_100056156
1119 Ga0070671_100058503
1120 Ga0070671_100454155
1121 Ga0070671_100697482
1122 Ga0070671_101181799
1123 Ga0070671_101603293
1124 Ga0070674_100032808
1125 Ga0070674_100099347
1126 Ga0070674_100211949
1127 Ga0070674_101681305
1128 Ga0070673_100052580
1129 Ga0070673_100157734
1130 Ga0070673_100204483
1131 Ga0070673_100467878
1132 Ga0070673_101131393
1133 Ga0070673_101760955
1134 Ga0070659_100002216
1135 Ga0070659_100005262
1136 Ga0070659_100026983
1137 Ga0070659_100030144
1138 Ga0070659_100096137
1139 Ga0070659_100115850
1140 Ga0070659_100425267
1141 Ga0070659_100438499
1142 Ga0070659_100499015
1143 Ga0070659_100657927
1144 Ga0070659_101175541
1145 Ga0070659_101623569
1146 Ga0070659_101837899
1147 Ga0070667_101238438
1148 Ga0070667_101298063
1149 Ga0070709_10108935
1150 Ga0070714_100084447
1151 Ga0070714_100189986
1152 Ga0070714_100500356
1153 Ga0070714_100530349
1154 Ga0070714_100537828
1155 Ga0070713_100032231
1156 Ga0070713_100096380
1157 Ga0070713_100413521
1158 Ga0070711_101038932
1159 Ga0070700_100249000
1160 Ga0070663_100012832
1161 Ga0070663_100019960
1162 Ga0070663_100143232
1163 Ga0070663_100645420
1164 Ga0070678_100011307
1165 Ga0070678_100020999
1166 Ga0070678_100023289
1167 Ga0070662_100001539
1168 Ga0070662_100004204
1169 Ga0070662_100004720
1170 Ga0070662_100004991
1171 Ga0070662_100011626
1172 Ga0070662_100012652
1173 Ga0070662_100031255
1174 Ga0070662_100045042
1175 Ga0070662_100118981
1176 Ga0070662_100126867
1177 Ga0070662_100210023
1178 Ga0070662_100435041
1179 Ga0070662_100535808
1180 Ga0070662_100757746
1181 Ga0070681_10001339
1182 Ga0070681_10014993
1183 Ga0070681_10066166
1184 Ga0070681_10349728
1185 Ga0070681_10634359
1186 Ga0070679_100003454
1187 Ga0070679_100027930
1188 Ga0070679_100082376
1189 Ga0070679_100141140
1190 Ga0070679_100191409
1191 Ga0070679_100274145
1192 Ga0070679_100394128
1193 Ga0070679_100611104
1194 Ga0070679_100744898
1195 Ga0070679_100759368
1196 Ga0070684_100011579
1197 Ga0070684_100128515
1198 Ga0070684_100132298
1199 Ga0070684_100149849
1200 Ga0068853_100001957
1201 Ga0068853_100077698
1202 Ga0068853_100384335
1203 Ga0068853_100385435
1204 Ga0068853_100418774
1205 Ga0070672_100051075
1206 Ga0070672_100256561
1207 Ga0070693_100057759
1208 Ga0070665_100006804
1209 Ga0070665_100026298
1210 Ga0070665_100211587
1211 Ga0068855_100004751
1212 Ga0068855_100052431
1213 Ga0068855_100072304
1214 Ga0068855_100132730
1215 Ga0068855_100172964
1216 Ga0068855_100220928
1217 Ga0068855_100420292
1218 Ga0068855_101892344
1219 Ga0068855_102022938
1220 Ga0070664_100006127
1221 Ga0070664_100008358
1222 Ga0070664_100015985
1223 Ga0070664_100028153
1224 Ga0070664_100044312
1225 Ga0070664_100052012
1226 Ga0070664_100071343
1227 Ga0070664_100104848
1228 Ga0070664_100112812
1229 Ga0070664_101825683
1230 Ga0068857_100021306
1231 Ga0068857_100032080
1232 Ga0068857_100037375
1233 Ga0068857_100041749
1234 Ga0068857_100098696
1235 Ga0068857_100101854
1236 Ga0068857_100203314
1237 Ga0068857_100301347
1238 Ga0068857_100669447
1239 Ga0068857_100963352
1240 Ga0068854_100002020
1241 Ga0068854_100012449
1242 Ga0068854_100060303
1243 Ga0068854_100066174
1244 Ga0068854_100103305
1245 Ga0068854_100114192
1246 Ga0068854_100130081
1247 Ga0068854_100131610
1248 Ga0068854_100164012
1249 Ga0068854_100201065
1250 Ga0068854_101365291
1251 Ga0068856_100028279
1252 Ga0068856_100123729
1253 Ga0068856_100127405
1254 Ga0068856_100155209
1255 Ga0068856_100226094
1256 Ga0068856_100230277
1257 Ga0068856_100304429
1258 Ga0068856_100371697
1259 Ga0068856_100434045
1260 Ga0068856_100648477
1261 Ga0068856_101911055
1262 Ga0068852_100000080
1263 Ga0068852_100036113
1264 Ga0068852_100084288
1265 Ga0068852_100085473
1266 Ga0068852_100253888
1267 Ga0068852_100302190
1268 Ga0068852_100341078
1269 Ga0068852_101066886
1270 Ga0068852_102280674
1271 Ga0068852_102682362
1272 Ga0068859_100208144
1273 Ga0068864_100011035
1274 Ga0068864_100050549
1275 Ga0068864_100410801
1276 Ga0068864_100579694
1277 Ga0068866_10172362
1278 Ga0068866_10340148
1279 Ga0068861_100876679
1280 Ga0068851_10057336
1281 Ga0068851_10191180
1282 Ga0068851_10197766
1283 Ga0068870_10233449
1284 Ga0068870_11373690
1285 Ga0068863_100036340
1286 Ga0068863_100515485
1287 Ga0068858_101214651
1288 Ga0068858_101362775
1289 Ga0068860_101522444
1290 Ga0068862_100015063
1291 Ga0068862_100289346
1292 Ga0068862_100587939
1293 Ga0081539_10031722
1294 Ga0081539_10187597
1295 Ga0070717_10057026
1296 Ga0070715_10934690
1297 Ga0070716_101126485
1298 Ga0070712_100076676
1299 Ga0070712_100255640
1300 Ga0075366_10013298
1301 Ga0075366_10498345
1302 Ga0097621_100101886
1303 Ga0097621_100117840
1304 Ga0075370_10145090
1305 Ga0068871_100045399
1306 Ga0068871_100800415
1307 Ga0075434_101143457
1308 Ga0068865_100058549
1309 Ga0097620_100208141
1310 Ga0105240_10006781
1311 Ga0105240_10007009
1312 Ga0105240_10066426
1313 Ga0105240_10664865
1314 Ga0105247_11418484
1315 Ga0105243_10144727
1316 Ga0105241_10030235
1317 Ga0105241_10549084
1318 Ga0105242_10240940
1319 Ga0105248_10018126
1320 Ga0105248_10087755
1321 Ga0105248_10355708
1322 Ga0105237_10000537
1323 Ga0105237_10255343
1324 Ga0105238_10039699
1325 Ga0105238_10088881
1326 Ga0105238_10313780
1327 Ga0105238_11212438
1328 Ga0105238_11230910
1329 Ga0105249_10466678
1330 Ga0105249_11051390
1331 Ga0105239_10000037
1332 Ga0105239_10314458
1333 Ga0105239_11463005
1334 Ga0105246_10005301
1335 Ga0157373_10007202
1336 Ga0157373_10010032
1337 Ga0157373_10021962
1338 Ga0157373_10109402
1339 Ga0157373_10169490
1340 Ga0157371_10007340
1341 Ga0157371_10035232
1342 Ga0157371_10049116
1343 Ga0157371_10059623
1344 Ga0157371_10133514
1345 Ga0157371_10248500
1346 Ga0157371_10523454
1347 Ga0157371_10595720
1348 Ga0157371_11011084
1349 Ga0157371_11096845
1350 Ga0157370_10002707
1351 Ga0157370_10076487
1352 Ga0157370_10079228
1353 Ga0157370_10151510
1354 Ga0157370_10160823
1355 Ga0157370_10199646
1356 Ga0157370_10771049
1357 Ga0157370_11162361
1358 Ga0157369_10003801
1359 Ga0157369_10007243
1360 Ga0157369_10066953
1361 Ga0157369_10071851
1362 Ga0157369_10128806
1363 Ga0157369_10727000
1364 Ga0157369_10852438
1365 Ga0157369_11127075
1366 Ga0157374_10020416
1367 Ga0163162_10059596
1368 Ga0157372_10044080
1369 Ga0157372_10068808
1370 Ga0157372_10073145
1371 Ga0157372_10088605
1372 Ga0157372_11189105
1373 Ga0157372_11380048
1374 Ga0157372_11875919
1375 Ga0157375_10147545
1376 Ga0157375_10163965
1377 Ga0157375_11096669
1378 Ga0163163_10246438
1379 Ga0163163_10325613
1380 Ga0163163_12069260
1381 Ga0157380_10667922
1382 Ga0157380_11595072
1383 Ga0157376_11784989
1384 Ga0163161_10624423
1385 Ga0163161_10653749
1386 Ga0163161_11633243
1387 Ga0197907_11037911
1388 Ga0206356_11278704
1389 Ga0206354_10981714
1390 Ga0206353_11730985
1391 Ga0206353_11992502
1392 Ga0213876_10322083
1393 Ga0213875_10000290
1394 Ga0213875_10001748
1395 Ga0224712_10494755
1396 Ga0207697_10098636
1397 Ga0207656_10033369
1398 Ga0207682_10002322
1399 Ga0207682_10005059
1400 Ga0207688_10027523
1401 Ga0207688_10142810
1402 Ga0207680_10048306
1403 Ga0207680_10444949
1404 Ga0207647_10001813
1405 Ga0207647_10040266
1406 Ga0207647_10075755
1407 Ga0207647_10170273
1408 Ga0207647_10207190
1409 Ga0207647_10445076
1410 Ga0207645_10056079
1411 Ga0207645_10102717
1412 Ga0207645_10418037
1413 Ga0207645_10662781
1414 Ga0207645_11178665
1415 Ga0207643_10372807
1416 Ga0207705_10005388
1417 Ga0207705_10007690
1418 Ga0207705_10018115
1419 Ga0207705_10024689
1420 Ga0207705_10047210
1421 Ga0207705_10062539
1422 Ga0207705_10102857
1423 Ga0207705_10462396
1424 Ga0207705_11552762
1425 Ga0207654_10027119
1426 Ga0207654_10063526
1427 Ga0207707_10057359
1428 Ga0207707_10279538
1429 Ga0207707_10280833
1430 Ga0207707_10561290
1431 Ga0207707_10850931
1432 Ga0207695_10007423
1433 Ga0207695_10011915
1434 Ga0207695_10029355
1435 Ga0207695_11017084
1436 Ga0207671_10001619
1437 Ga0207671_10324828
1438 Ga0207693_10151389
1439 Ga0207660_10003305
1440 Ga0207660_10086206
1441 Ga0207660_10577178
1442 Ga0207660_11111759
1443 Ga0207662_10107759
1444 Ga0207657_10000025
1445 Ga0207657_10005455
1446 Ga0207657_10030205
1447 Ga0207657_10036050
1448 Ga0207657_10075781
1449 Ga0207657_10077500
1450 Ga0207657_10091163
1451 Ga0207657_10612349
1452 Ga0207657_10629046
1453 Ga0207657_11200558
1454 Ga0207649_10004864
1455 Ga0207649_10005078
1456 Ga0207649_10019810
1457 Ga0207649_10025328
1458 Ga0207649_10155218
1459 Ga0207649_10176627
1460 Ga0207649_10222242
1461 Ga0207649_10256273
1462 Ga0207649_10422534
1463 Ga0207649_10440825
1464 Ga0207649_10647799
1465 Ga0207649_11029124
1466 Ga0207652_10022343
1467 Ga0207652_10037074
1468 Ga0207652_10296681
1469 Ga0207652_10411710
1470 Ga0207652_10827060
1471 Ga0207652_10975762
1472 Ga0207652_10997575
1473 Ga0207652_11306985
1474 Ga0207652_11356391
1475 Ga0207681_10089125
1476 Ga0207694_10157047
1477 Ga0207694_10300106
1478 Ga0207694_11700994
1479 Ga0207650_10003983
1480 Ga0207650_10005243
1481 Ga0207650_10056731
1482 Ga0207650_10059949
1483 Ga0207650_10136900
1484 Ga0207650_10791936
1485 Ga0207659_10296944
1486 Ga0207659_11750835
1487 Ga0207700_10264379
1488 Ga0207700_10461701
1489 Ga0207664_10210898
1490 Ga0207664_10400248
1491 Ga0207644_10012709
1492 Ga0207644_10028411
1493 Ga0207644_10365287
1494 Ga0207644_10943589
1495 Ga0207690_10001649
1496 Ga0207690_10002294
1497 Ga0207690_10006261
1498 Ga0207690_10015857
1499 Ga0207690_10110498
1500 Ga0207690_10265298
1501 Ga0207690_10294602
1502 Ga0207690_10474845
1503 Ga0207690_10498116
1504 Ga0207690_10870322
1505 Ga0207690_11108451
1506 Ga0207690_11349837
1507 Ga0207706_10000035
1508 Ga0207706_10004726
1509 Ga0207706_10006217
1510 Ga0207706_10007214
1511 Ga0207706_10012472
1512 Ga0207706_10014583
1513 Ga0207706_10015536
1514 Ga0207706_10022400
1515 Ga0207706_10195408
1516 Ga0207706_11323984
1517 Ga0207669_10436429
1518 Ga0207669_10704312
1519 Ga0207669_10704623
1520 Ga0207669_11911535
1521 Ga0207704_10500478
1522 Ga0207704_11846507
1523 Ga0207691_10058949
1524 Ga0207691_10069370
1525 Ga0207691_10373691
1526 Ga0207711_10003948
1527 Ga0207711_10031933
1528 Ga0207711_10060071
1529 Ga0207711_10093518
1530 Ga0207661_10031880
1531 Ga0207661_10141688
1532 Ga0207661_10299074
1533 Ga0207661_10628074
1534 Ga0207679_10041055
1535 Ga0207679_10046459
1536 Ga0207679_10069689
1537 Ga0207679_10079898
1538 Ga0207679_10128316
1539 Ga0207679_10315938
1540 Ga0207679_10585141
1541 Ga0207679_11100401
1542 Ga0207679_11152533
1543 Ga0207667_10005573
1544 Ga0207667_10022754
1545 Ga0207667_10030008
1546 Ga0207667_10039390
1547 Ga0207667_10096721
1548 Ga0207667_10141162
1549 Ga0207667_10203856
1550 Ga0207667_10278078
1551 Ga0207667_10565294
1552 Ga0207667_10583516
1553 Ga0207651_10129972
1554 Ga0207651_10352687
1555 Ga0207651_10502205
1556 Ga0207651_10789069
1557 Ga0207668_10687374
1558 Ga0207668_11610722
1559 Ga0207640_10007994
1560 Ga0207640_10017876
1561 Ga0207640_10033867
1562 Ga0207640_10042073
1563 Ga0207640_10125050
1564 Ga0207640_10224906
1565 Ga0207640_10733586
1566 Ga0207640_11232058
1567 Ga0207658_10505566
1568 Ga0207658_11573279
1569 Ga0207677_11384386
1570 Ga0207639_10002227
1571 Ga0207639_10006776
1572 Ga0207639_10527046
1573 Ga0207639_10565216
1574 Ga0207639_11561699
1575 Ga0207639_11764713
1576 Ga0207639_12141944
1577 Ga0207678_10029833
1578 Ga0207678_10034003
1579 Ga0207678_10154812
1580 Ga0207678_11083388
1581 Ga0207708_10304603
1582 Ga0207708_11588807
1583 Ga0207702_10045280
1584 Ga0207702_10058169
1585 Ga0207702_10145647
1586 Ga0207702_10216426
1587 Ga0207702_10325193
1588 Ga0207702_10462988
1589 Ga0207702_10467387
1590 Ga0207702_10586041
1591 Ga0207702_11021691
1592 Ga0207702_11211742
1593 Ga0207702_11344721
1594 Ga0207702_12240559
1595 Ga0207702_12405728
1596 Ga0207641_10005913
1597 Ga0207641_10028372
1598 Ga0207641_10420872
1599 Ga0207648_10251207
1600 Ga0207648_10594099
1601 Ga0207676_10057289
1602 Ga0207676_10111010
1603 Ga0207676_10147396
1604 Ga0207676_10735205
1605 Ga0207676_11067055
1606 Ga0207674_10008356
1607 Ga0207674_10017107
1608 Ga0207674_10019197
1609 Ga0207674_10020237
1610 Ga0207674_10058174
1611 Ga0207674_10138496
1612 Ga0207674_10148267
1613 Ga0207674_10179775
1614 Ga0207674_10237401
1615 Ga0207674_10615532
1616 Ga0207683_10002122
1617 Ga0207683_10025091
1618 Ga0207683_10072641
1619 Ga0207683_10128869
1620 Ga0207683_10767403
1621 Ga0207683_11470409
1622 Ga0207698_10001421
1623 Ga0207698_10048861
1624 Ga0207698_10080221
1625 Ga0207698_10181655
1626 Ga0207698_10224205
1627 Ga0207698_10427401
1628 Ga0207698_10697829
1629 Ga0207698_11160205
1630 Ga0209983_1044774
1631 Ga0209974_10020537
1632 Ga0268266_10005684
1633 Ga0268266_10295346
1634 Ga0268265_10003749
1635 Ga0268265_10194357
1636 Ga0268265_10702615
1637 Ga0268265_10974010
1638 Ga0268264_10117885
1639 Ga0268264_11390068
1640 Ga0316182_1241054
1641 Ga0307408_100052411
1642 Ga0307408_100079237
1643 Ga0307408_100321644
1644 Ga0307408_100623213
1645 Ga0307408_101096956
1646 Ga0307408_101594227
1647 Ga0307508_10005777
1648 Ga0307516_10377704
1649 Ga0307405_10028074
1650 Ga0307405_10058424
1651 Ga0307405_10089559
1652 Ga0307405_10128123
1653 Ga0307405_10155695
1654 Ga0307405_10287996
1655 Ga0307405_10602943
1656 Ga0307405_11275107
1657 Ga0307413_10039345
1658 Ga0307413_10078405
1659 Ga0307413_10111906
1660 Ga0307413_10127709
1661 Ga0307413_10194031
1662 Ga0307413_10508913
1663 Ga0307413_10640228
1664 Ga0307413_10816868
1665 Ga0307413_10965446
1666 Ga0307413_11272816
1667 Ga0307413_11541720
1668 Ga0307413_11961180
1669 Ga0307410_10006349
1670 Ga0307410_10007723
1671 Ga0307410_10008622
1672 Ga0307410_10009439
1673 Ga0307410_10009559
1674 Ga0307410_10023342
1675 Ga0307410_10075276
1676 Ga0307410_10077933
1677 Ga0307410_10182313
1678 Ga0307410_10195061
1679 Ga0307410_10365023
1680 Ga0307410_10642449
1681 Ga0307410_10802994
1682 Ga0307410_10924253
1683 Ga0307410_11767062
1684 Ga0307406_10006895
1685 Ga0307406_10008718
1686 Ga0307406_10137336
1687 Ga0307406_10152317
1688 Ga0307406_10216262
1689 Ga0307406_10244690
1690 Ga0307406_10250596
1691 Ga0307406_10328916
1692 Ga0307406_10705270
1693 Ga0307407_10008681
1694 Ga0307407_10057654
1695 Ga0307407_10544673
1696 Ga0307407_10920400
1697 Ga0307412_10049835
1698 Ga0307412_10066453
1699 Ga0307412_10094323
1700 Ga0307412_10144964
1701 Ga0307412_10235140
1702 Ga0307412_10380548
1703 Ga0307412_10428783
1704 Ga0307412_10642134
1705 Ga0307412_10805437
1706 Ga0307412_10963874
1707 Ga0307412_11383382
1708 Ga0307412_11492884
1709 Ga0307412_12153983
1710 Ga0307409_100012429
1711 Ga0307409_100012656
1712 Ga0307409_100026189
1713 Ga0307409_100031426
1714 Ga0307409_100041754
1715 Ga0307409_100057304
1716 Ga0307409_100118408
1717 Ga0307409_100157943
1718 Ga0307409_100308298
1719 Ga0307409_100312447
1720 Ga0307409_100629002
1721 Ga0307409_101141156
1722 Ga0307409_101568511
1723 Ga0307409_102203956
1724 Ga0307409_102299955
1725 Ga0307409_102407435
1726 Ga0307416_100013256
1727 Ga0307416_100051461
1728 Ga0307416_100151324
1729 Ga0307416_100176854
1730 Ga0307416_100296949
1731 Ga0307416_100316144
1732 Ga0307416_100463705
1733 Ga0307416_100778005
1734 Ga0307416_100882357
1735 Ga0307416_103525912
1736 Ga0307414_10024413
1737 Ga0307414_10048296
1738 Ga0307414_10089508
1739 Ga0307414_10116239
1740 Ga0307414_10433823
1741 Ga0307414_10651294
1742 Ga0307414_10688921
1743 Ga0307414_10776759
1744 Ga0307414_11103783
1745 Ga0307414_11440747
1746 Ga0307414_11752512
1747 Ga0307414_12190051
1748 Ga0307414_12229151
1749 Ga0307411_10003885
1750 Ga0307411_10006805
1751 Ga0307411_10011287
1752 Ga0307411_10016098
1753 Ga0307411_10046046
1754 Ga0307411_10083427
1755 Ga0307411_10138201
1756 Ga0307411_10144195
1757 Ga0307411_10157256
1758 Ga0307411_10199614
1759 Ga0307411_10246784
1760 Ga0307411_10255970
1761 Ga0307411_10517187
1762 Ga0307411_10681765
1763 Ga0307411_10745347
1764 Ga0307411_10856601
1765 Ga0307411_10968413
1766 Ga0307411_11112371
1767 Ga0307411_11162968
1768 Ga0307411_12125847
1769 Ga0307415_100008798
1770 Ga0307415_100015267
1771 Ga0307415_100032212
1772 Ga0307415_100102274
1773 Ga0307415_100164042
1774 Ga0307415_100177081
1775 Ga0307415_100270131
1776 Ga0307415_100289019
1777 Ga0307415_100445351
1778 Ga0307415_101094834
1779 Ga0307415_101246440
1780 Ga0307415_101688760
1781 Ga0307415_102270198
1782 Ga0307415_102437092
1783 Ga0373948_0093434
1784 Ga0373959_0122794
1785 Ga0373943_0017501
1786 Ga0373946_0043931
1787 Ga0373962_0038593
1788 Ga0373931_0045351
1789 Ga0373935_0011078
1790 Ga0373927_0116668
1791 Ga0316584_0431676
1792 Ga0373925_0026804
1793 Ga0395899_0003475
1794 Ga0395899_0018618
1795 Ga0395899_0030331
1796 Ga0395899_0034256
1797 Ga0395899_0071240
1798 Ga0395899_0073350
1799 Ga0395899_0082030
1800 Ga0395899_0288361
1801 Ga0395899_0293452
1802 Ga0395899_0424679
1803 Ga0395899_0558604
1804 Ga0395899_0710525
1805 Ga0395900_0000595
1806 Ga0395900_0000959
1807 Ga0395900_0002345
1808 Ga0395900_0004691
1809 Ga0395900_0005137
1810 Ga0395900_0006375
1811 Ga0395900_0027498
1812 Ga0395900_0027891
1813 Ga0395900_0048729
1814 Ga0395900_0052554
1815 Ga0395900_0143251
1816 Ga0395900_0160755
1817 Ga0395900_0225574
1818 Ga0395900_0239431
1819 Ga0395900_0253212
1820 Ga0395900_0330585
1821 Ga0395900_0417424
1822 Ga0395900_0454591
1823 Ga0395900_0596395
1824 Ga0395900_0732050
1825 Ga0395900_0807790
1826 Ga0395900_1444234
1827 Ga0395898_0001974
1828 Ga0395898_0022525
1829 Ga0395898_0052554
1830 Ga0395898_0057911
1831 Ga0395898_0059672
1832 Ga0395898_0078412
1833 Ga0395898_0111660
1834 Ga0395898_0141049
1835 Ga0395898_0167811
1836 Ga0395898_0230953
1837 Ga0395898_0404508
1838 Ga0395898_0785862
1839 Ga0395898_1077198
1840 Ga0395905_0000102
1841 Ga0395905_0000575
1842 Ga0395905_0001565
1843 Ga0395905_0002603
1844 Ga0395905_0002657
1845 Ga0395905_0004693
1846 Ga0395905_0006316
1847 Ga0395905_0008794
1848 Ga0395905_0015514
1849 Ga0395905_0015852
1850 Ga0395905_0016098
1851 Ga0395905_0022798
1852 Ga0395905_0027589
1853 Ga0395905_0065854
1854 Ga0395905_0073609
1855 Ga0395905_0101516
1856 Ga0395905_0102479
1857 Ga0395905_0108793
1858 Ga0395905_0156898
1859 Ga0395905_0286039
1860 Ga0395905_0337298
1861 Ga0395905_0353762
1862 Ga0395905_0518731
1863 Ga0395905_0755185
1864 Ga0395905_1312361
1865 Ga0395905_1497223
1866 Ga0436364_0349181
1867 Ga0436364_0462751
1868 Ga0436364_1104629
1869 Ga0395901_0003383
1870 Ga0395901_0014240
1871 Ga0395901_0041970
1872 Ga0395901_0078502
1873 Ga0395901_0100434
1874 Ga0395901_0110910
1875 Ga0395901_0112340
1876 Ga0395901_0121036
1877 Ga0395901_0164245
1878 Ga0395901_0174103
1879 Ga0395901_0190544
1880 Ga0395901_0274183
1881 Ga0395901_0399850
1882 Ga0395901_0418790
1883 Ga0395901_0446605
1884 Ga0395901_0503803
1885 Ga0395901_0523333
1886 Ga0395901_0684828
1887 Ga0395901_0758789
1888 Ga0395901_0846898
1889 Ga0395901_0995589
1890 Ga0395901_1607526
1891 Ga0436365_0747204
1892 Ga0436363_1174985
1893 Ga0439439_0101021
1894 Ga0451798_0734138
1895 Ga0451839_1101509
1896 Ga0451847_0796925
1897 Ga0451851_1358461
1898 Ga0451853_2998369
1899 Ga0439431_0043143
1900 Ga0439443_006155
1901 Ga0439448_0002126
1902 Ga0439448_0372381
1903 Ga0439455_0056225
1904 Ga0439457_070607
1905 Ga0450920_048228
1906 Ga0450906_072332
1907 Ga0439458_0000026
1908 Ga0439458_0000344
1909 Ga0439458_0006868
1910 Ga0439435_0011950
1911 Ga0450916_080647
1912 Ga0451577_0954630
1913 Ga0466969_0030656
1914 Ga0466969_0079912
1915 Ga0466965_0581730
1916 Ga0466965_0708707
1917 Ga0466966_0044069
1918 Ga0466961_0005026
1919 Ga0466961_0110935
1920 Ga0466963_0002982
1921 Ga0466963_0022002
1922 Ga0466963_0093524
1923 Ga0466963_0171742
1924 Ga0466963_0351152
1925 Ga0466963_0869495
1926 Ga0466963_0982309
1927 Ga0453684_1588915
1928 Ga0466971_0424092
1929 Ga0466971_0564889
1930 Ga0466968_0011606
1931 Ga0466970_0584201
1932 Ga0466970_0765596
1933 Ga0466957_0020493
1934 Ga0466957_0093517
1935 Ga0466957_0117586
1936 Ga0466957_1106577
1937 Ga0466957_1285891
1938 Ga0466960_0661655
1939 Ga0466959_0055502
1940 Ga0466959_0076191
1941 Ga0466959_0135900
1942 Ga0466959_0289001
1943 Ga0466959_0377614
1944 Ga0466958_0055629
1945 Ga0466958_0061647
1946 Ga0466958_0097427
1947 Ga0466958_0159034
1948 Ga0466958_0409025
1949 Ga0466958_1033926
1950 Ga0466967_0014999
1951 Ga0466967_0019317
1952 Ga0466967_0071231
1953 Ga0466967_0181568
1954 Ga0466967_0381659
1955 Ga0466967_0601466
1956 Ga0466967_0704090
1957 Ga0466967_1252869
1958 Ga0466967_1837309
1959 Ga0466967_2542756
1960 Ga0495632_0006109
1961 Ga0495643_0134689
1962 Ga0495663_0098090
1963 Ga0495598_0054004
1964 Ga0495598_0071886
1965 Ga0495598_0158152
1966 Ga0495621_0042884
1967 Ga0495621_0068941
1968 Ga0495621_0148797
1969 Ga0495621_0217518
1970 Ga0495633_0553231
1971 Ga0495669_0003890
1972 Ga0495669_0007912
1973 Ga0495669_0126485
1974 Ga0495687_077545
1975 Ga0495677_0007140
1976 Ga0495677_0214731
1977 Ga0495686_0000025
1978 Ga0495615_0261210
1979 Ga0496100_0026998
1980 Ga0496101_0152809
1981 Ga0496101_0209439
1982 Ga0496102_0454275
1983 Ga0496102_0567845
1984 Ga0496103_0154035
1985 Ga0496104_0516364
1986 Ga0496104_0751988
1987 Ga0496106_0047495
1988 Ga0496107_0085960
1989 Ga0496108_0032321
1990 Ga0496108_0092944
1991 Ga0496109_0019045
1992 Ga0496109_0712012
1993 Ga0496109_1063564
1994 Ga0496110_0054777
1995 Ga0496110_0961670
1996 Ga0496111_0009760
1997 Ga0496111_0039388
1998 Ga0496111_0210355
1999 Ga0496112_0108739
2000 Ga0496112_1278665
2001 Ga0496113_0009504
2002 Ga0496113_0111040
2003 Ga0496114_0026393
2004 Ga0496114_0037188
2005 Ga0496115_0097251
2006 Ga0496115_0780767
2007 Ga0496115_1369350
2008 Ga0496117_0164371
2009 Ga0496117_0194404
2010 Ga0496118_0082983
2011 Ga0496121_0000066
2012 Ga0496122_0008044
2013 Ga0496123_0000643
2014 Ga0496124_0072716
2015 Ga0496126_0002370
2016 Ga0496126_0003867
2017 Ga0496126_0122651
2018 Ga0501031_0225520
2019 Ga0501032_0002057
2020 Ga0501033_0030447
2021 Ga0501034_0221589
2022 Ga0501036_0103968
2023 Ga0501037_0051813
2024 Ga0501037_0824300
2025 Ga0501038_0233976
2026 Ga0501038_0673033
2027 Ga0501039_1542726
2028 Ga0501042_0988872
2029 Ga0501043_0007681
2030 Ga0501043_0589590
2031 Ga0501047_0195622
2032 Ga0501047_0573951
2033 Ga0501048_0789503
2034 Ga0501067_0007695
2035 Ga0501068_0000415
2036 Ga0501071_0714498
2037 Ga0501071_1295546
2038 Ga0501073_0000003
2039 Ga0501073_0702989
2040 Ga0501077_0002396
2041 Ga0501259_140579
2042 Ga0501080_0000242
2043 Ga0501080_0966717
2044 Ga0501268_027757
2045 Ga0501035_1281392
2046 Ga0501044_0031428
2047 Ga0501044_0059089
2048 Ga0501044_1664103
2049 nmdc:mga07m45_246059_c1
2050 nmdc:mga07m45_821175_c1
2051 Ga0590071_217222
2052 Ga0587128_103791
2053 Ga0466962_0029955
2054 Ga0466962_0078896
2055 Ga0466962_0225265
2056 Ga0466962_0598491
2057 2644126785
2058 3000865865

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04956

TrbC

TrbC/VIRB2 pilin

1

93

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nn4-assembly1.cif.gz_A crystal structure of bacillus subtilis yqgq, pfam duf910 0.9416 48 86
6t0s-assembly1.cif.gz_B bat influenza a polymerase stuttering complex using 44-mer vrna template with intact oligo(u) sequence 0.9089 48 88
2f6m-assembly2.cif.gz_D structure of a vps23-c:vps28-n subcomplex 0.9086 40 84
6tw1-assembly1.cif.gz_B bat influenza a polymerase termination complex with pyrophosphate using 44-mer vrna template with mutated oligo(u) sequence 0.9043 48 88
6t0v-assembly1.cif.gz_B bat influenza a polymerase elongation complex with incoming utp analogue (complete polymerase) 0.9035 48 87
ID Description Score Start End Superfamily
2nn4A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;YqgQ-like 0.9416 48 86 1.10.287.760
2nn4B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;YqgQ-like 0.9242 52 86 1.10.287.760
2nn4C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;YqgQ-like 0.9149 52 86 1.10.287.760
af_A0A1D6K665_189_255_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.9121 54 80 1.10.238.10
2f6mD00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Vps28 N-terminal domain 0.9086 40 84 1.20.1440.200
ID Description Score Start End GO Terms
AF-A0A7J2NGD6-F1-model_v4 Uncharacterized protein 0.88 35 90 GO:0016020
AF-A0A256XFV2-F1-model_v4 Uncharacterized protein 0.8337 31 96
AF-A0A7J4K9A9-F1-model_v4 DUF4231 domain-containing protein 0.8006 39 97
AF-A0A3A6NNH7-F1-model_v4 Uncharacterized protein 0.786 28 96 GO:0016020
AF-A0A0Q9ETE6-F1-model_v4 Recombinase family protein 0.7809 26 96 GO:0000150
GO:0003677

Map