F488580

General Info

Members Datasets Scaffolds Average Seq Length
1029 430 2058 158

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0067146|Ga0395898_0067146_2042_2581
Length 179
Sequence MAKTSKPKKKKAPAKTAVKKPRGAKRAGKATPLFTIGYEQAKPAAVMKELEAAKIDLVVDTRAVAASRRPGFSKRQLSASLVEAGIGYVHLQKLGTPAEGRQAARAGDRDTLMRVYDAHINKPEPQAELGKLVSLIKSGKRIALLCYCRDPKTCHRSQIVKRVKARLPLEVENLIPPLF

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
74 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
85 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
117 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
118 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
119 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
120 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
121 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
139 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
140 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
141 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
142 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
143 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
161 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
163 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
237 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
239 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
245 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
248 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
249 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
250 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
251 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
252 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
253 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
254 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
255 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
256 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
257 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
258 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
259 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
260 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
261 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
262 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
263 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
265 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
266 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
267 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
268 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
269 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
270 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
271 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
272 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
273 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
274 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
275 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
276 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
277 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
278 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
279 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
280 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
282 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
283 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
284 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
287 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
288 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
289 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
292 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
293 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
294 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
295 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
296 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
297 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
298 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
299 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
300 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
301 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
302 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
303 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
304 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
305 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
306 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
307 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
308 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
311 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
312 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
313 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
317 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
318 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
319 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
320 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
321 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
322 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
323 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
324 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
325 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
326 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
327 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
328 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
329 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
330 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
331 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
332 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
333 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
334 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
335 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
336 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
337 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
338 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
339 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
340 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
341 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
342 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
343 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
344 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
345 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
346 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
347 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
348 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
349 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
350 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
351 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
352 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
353 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
354 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
355 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
356 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
357 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
358 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
359 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
360 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
361 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
362 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
363 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
364 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
365 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
366 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
369 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
378 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
386 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
387 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
388 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
396 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
397 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
398 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
399 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
400 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
401 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
402 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
403 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
404 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
405 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
406 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
407 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
409 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
410 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
411 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
412 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
413 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
414 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
415 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
416 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
417 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
418 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
419 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
420 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
421 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
422 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
423 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
424 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
425 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
426 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
427 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
428 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
429 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
430 2842694124 Methylopila sp. R-72369 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.78
Nodule 0
Rhizoplane 6.41
Rhizosphere 91.93
Stem 0
Stem Tuber 0
Unclassified 7.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0067146 3300037466 Bacteria 3473
2 MRS1b_contig_7410661 2162886011 Bacteria 821
3 2214756332 2209111006 Bacteria 3109
4 ARSoilYngRDRAFT_c00187 3300000042 Bacteria 10438
5 ARcpr5yngRDRAFT_c000626 3300000043 Bacteria 4432
6 ARSoilOldRDRAFT_c000105 3300000044 Bacteria 15779
7 ARCol0oldRDRAFT_c00945 3300000045 Bacteria 2244
8 ARCol0yngRDRAFT_1000034 3300000652 Bacteria 23733
9 JGI24736J21556_1020600 3300001904 Bacteria 1035
10 JGI24741J21665_1018201 3300001915 Bacteria 1125
11 JGI24746J21847_1001098 3300001977 Bacteria 4254
12 JGI24739J22299_10000164 3300001989 Bacteria 21825
13 JGI24737J22298_10001508 3300001990 Bacteria 8287
14 JGI24737J22298_10001579 3300001990 Bacteria 8106
15 JGI24743J22301_10012313 3300001991 Bacteria 1554
16 JGI24750J21931_1000344 3300002070 Bacteria 7887
17 JGI24745J21846_1001611 3300002073 Bacteria 2215
18 JGI24738J21930_10000112 3300002075 Bacteria 19038
19 JGI24749J21850_1000411 3300002076 Bacteria 6398
20 JGI24744J21845_10024671 3300002077 Bacteria 1175
21 JGI24035J26624_1000107 3300002126 Bacteria 7155
22 JGI24034J26672_10001485 3300002239 Bacteria 3118
23 JGI24742J22300_10000359 3300002244 Bacteria 6705
24 JGI24751J29686_10062096 3300002459 Bacteria 769
25 JGI24751J29686_10092099 3300002459 Unclassified 631
26 JGI25406J46586_10033300 3300003203 Bacteria 1904
27 JGI26128J50194_1007301 3300003347 Unclassified 712
28 Ga0065712_10071820 3300005290 Bacteria 5036
29 Ga0065712_10098339 3300005290 Bacteria 2122
30 Ga0065712_10615400 3300005290 Bacteria 569
31 Ga0065715_10001049 3300005293 Bacteria 8311
32 Ga0065715_10001550 3300005293 Bacteria 6014
33 Ga0065715_10208859 3300005293 Bacteria 1317
34 Ga0065707_10123077 3300005295 Bacteria 2073
35 Ga0070658_10115505 3300005327 Bacteria 2227
36 Ga0070676_10000755 3300005328 Bacteria 15911
37 Ga0070676_10236745 3300005328 Bacteria 1212
38 Ga0070683_100000376 3300005329 Bacteria 31004
39 Ga0070683_100105366 3300005329 Bacteria 2658
40 Ga0070683_100617469 3300005329 Unclassified 1038
41 Ga0070690_100001711 3300005330 Bacteria 11573
42 Ga0070690_100006546 3300005330 Bacteria 6613
43 Ga0070690_100221375 3300005330 Bacteria 1326
44 Ga0070670_100235031 3300005331 Bacteria 1595
45 Ga0070670_100577328 3300005331 Bacteria 1005
46 Ga0070670_100665518 3300005331 Bacteria 935
47 Ga0070677_10001502 3300005333 Bacteria 7381
48 Ga0068869_100000523 3300005334 Bacteria 21387
49 Ga0068869_100661514 3300005334 Bacteria 888
50 Ga0070666_10001839 3300005335 Bacteria 12930
51 Ga0070666_10006461 3300005335 Bacteria 7206
52 Ga0070680_100007212 3300005336 Bacteria 8473
53 Ga0070680_100102774 3300005336 Bacteria 2374
54 Ga0070680_100124334 3300005336 Bacteria 2155
55 Ga0070680_101282681 3300005336 Bacteria 634
56 Ga0070682_100000141 3300005337 Bacteria 57251
57 Ga0070682_100010911 3300005337 Bacteria 5176
58 Ga0070682_100308753 3300005337 Bacteria 1164
59 Ga0070682_100466906 3300005337 Bacteria 970
60 Ga0068868_100037520 3300005338 Bacteria 3757
61 Ga0068868_100259259 3300005338 Bacteria 1465
62 Ga0068868_100717048 3300005338 Unclassified 896
63 Ga0070660_100002574 3300005339 Bacteria 12436
64 Ga0070660_100430741 3300005339 Unclassified 1093
65 Ga0070689_100038887 3300005340 Bacteria 3641
66 Ga0070689_100049550 3300005340 Bacteria 3243
67 Ga0070689_100084736 3300005340 Bacteria 2491
68 Ga0070689_100224298 3300005340 Bacteria 1543
69 Ga0070691_10000190 3300005341 Bacteria 20511
70 Ga0070691_10060821 3300005341 Bacteria 1816
71 Ga0070687_100000212 3300005343 Bacteria 20234
72 Ga0070687_100030889 3300005343 Bacteria 2622
73 Ga0070661_100000242 3300005344 Bacteria 44945
74 Ga0070661_100092283 3300005344 Bacteria 2243
75 Ga0070661_100686622 3300005344 Bacteria 833
76 Ga0070661_101125174 3300005344 Bacteria 655
77 Ga0070661_101250019 3300005344 Bacteria 622
78 Ga0070692_10007147 3300005345 Bacteria 4901
79 Ga0070669_100000593 3300005353 Bacteria 26849
80 Ga0070675_100000165 3300005354 Bacteria 40656
81 Ga0070671_100010995 3300005355 Bacteria 7262
82 Ga0070671_100091245 3300005355 Bacteria 2551
83 Ga0070671_100250203 3300005355 Unclassified 1505
84 Ga0070671_100397850 3300005355 Bacteria 1178
85 Ga0070674_100000450 3300005356 Bacteria 20737
86 Ga0070673_100781188 3300005364 Bacteria 881
87 Ga0070688_100028095 3300005365 Bacteria 3355
88 Ga0070688_100036300 3300005365 Bacteria 2997
89 Ga0070688_100064025 3300005365 Bacteria 2332
90 Ga0070659_100000988 3300005366 Bacteria 20880
91 Ga0070659_100016224 3300005366 Bacteria 5590
92 Ga0070659_100965221 3300005366 Unclassified 747
93 Ga0070667_100000759 3300005367 Bacteria 30677
94 Ga0070667_100084445 3300005367 Bacteria 2721
95 Ga0070703_10006259 3300005406 Bacteria 3335
96 Ga0070709_10003620 3300005434 Bacteria 8296
97 Ga0070709_10066394 3300005434 Bacteria 2314
98 Ga0070714_100023744 3300005435 Bacteria 5041
99 Ga0070714_100024265 3300005435 Bacteria 4989
100 Ga0070714_100040478 3300005435 Bacteria 3928
101 Ga0070714_100207666 3300005435 Bacteria 1794
102 Ga0070713_100156668 3300005436 Bacteria 2030
103 Ga0070713_100190763 3300005436 Bacteria 1846
104 Ga0070713_100681284 3300005436 Bacteria 981
105 Ga0070713_101606664 3300005436 Unclassified 631
106 Ga0070710_10008897 3300005437 Bacteria 4900
107 Ga0070710_10010783 3300005437 Bacteria 4495
108 Ga0070710_10304996 3300005437 Bacteria 1040
109 Ga0070710_10360499 3300005437 Bacteria 965
110 Ga0070701_10000103 3300005438 Bacteria 24021
111 Ga0070711_100122379 3300005439 Bacteria 1926
112 Ga0070711_100231133 3300005439 Bacteria 1442
113 Ga0070711_100277590 3300005439 Bacteria 1324
114 Ga0070711_100357520 3300005439 Unclassified 1175
115 Ga0070705_100029576 3300005440 Bacteria 3015
116 Ga0070705_100072916 3300005440 Bacteria 2082
117 Ga0070705_100136287 3300005440 Bacteria 1609
118 Ga0070700_100000364 3300005441 Bacteria 23195
119 Ga0070694_100000880 3300005444 Bacteria 16931
120 Ga0070694_100334790 3300005444 Bacteria 1169
121 Ga0070708_100103778 3300005445 Bacteria 2607
122 Ga0070663_100000417 3300005455 Bacteria 22399
123 Ga0070663_100095890 3300005455 Bacteria 2206
124 Ga0070663_100331488 3300005455 Bacteria 1227
125 Ga0070678_100001012 3300005456 Bacteria 14620
126 Ga0070678_100020403 3300005456 Bacteria 4347
127 Ga0070678_100135201 3300005456 Bacteria 1965
128 Ga0070678_100266982 3300005456 Bacteria 1442
129 Ga0070662_100000796 3300005457 Bacteria 19367
130 Ga0070662_100834181 3300005457 Bacteria 785
131 Ga0070681_10002475 3300005458 Bacteria 16918
132 Ga0070681_10016649 3300005458 Bacteria 7339
133 Ga0070681_10076422 3300005458 Bacteria 3307
134 Ga0070681_10139375 3300005458 Bacteria 2355
135 Ga0070681_10160379 3300005458 Bacteria 2173
136 Ga0070681_10824898 3300005458 Bacteria 845
137 Ga0068867_100009775 3300005459 Bacteria 6759
138 Ga0068867_100330952 3300005459 Bacteria 1265
139 Ga0070685_10000547 3300005466 Bacteria 21062
140 Ga0070685_10051382 3300005466 Bacteria 2383
141 Ga0070699_100602141 3300005518 Bacteria 1002
142 Ga0070679_100010894 3300005530 Bacteria 8638
143 Ga0070679_100131590 3300005530 Bacteria 2483
144 Ga0070679_100358833 3300005530 Bacteria 1405
145 Ga0070684_100000755 3300005535 Bacteria 22399
146 Ga0070684_100060283 3300005535 Bacteria 3318
147 Ga0070684_100065596 3300005535 Bacteria 3186
148 Ga0070684_100601370 3300005535 Bacteria 1022
149 Ga0070697_100044337 3300005536 Bacteria 3602
150 Ga0068853_100000483 3300005539 Bacteria 27159
151 Ga0068853_100245345 3300005539 Bacteria 1642
152 Ga0070672_100000527 3300005543 Bacteria 22399
153 Ga0070686_100002014 3300005544 Bacteria 11269
154 Ga0070686_100062310 3300005544 Bacteria 2413
155 Ga0070686_100164667 3300005544 Unclassified 1564
156 Ga0070695_100003705 3300005545 Bacteria 8902
157 Ga0070696_100006474 3300005546 Bacteria 7828
158 Ga0070696_100007364 3300005546 Bacteria 7349
159 Ga0070696_100340163 3300005546 Unclassified 1159
160 Ga0070696_100692801 3300005546 Unclassified 830
161 Ga0070693_100000199 3300005547 Bacteria 28265
162 Ga0070693_100030479 3300005547 Bacteria 2949
163 Ga0070693_100103745 3300005547 Bacteria 1737
164 Ga0070693_100295687 3300005547 Bacteria 1089
165 Ga0070665_100207388 3300005548 Bacteria 1960
166 Ga0070665_100278950 3300005548 Bacteria 1673
167 Ga0070704_100022794 3300005549 Bacteria 4078
168 Ga0068855_100004444 3300005563 Bacteria 17127
169 Ga0068855_100020137 3300005563 Bacteria 8011
170 Ga0068855_100031660 3300005563 Bacteria 6315
171 Ga0068855_100235987 3300005563 Bacteria 2045
172 Ga0068855_100284778 3300005563 Bacteria 1834
173 Ga0070664_100000895 3300005564 Bacteria 23168
174 Ga0070664_100124321 3300005564 Bacteria 2262
175 Ga0070664_100285222 3300005564 Bacteria 1490
176 Ga0070664_100739967 3300005564 Bacteria 917
177 Ga0068857_100001816 3300005577 Bacteria 17161
178 Ga0068857_100363630 3300005577 Bacteria 1341
179 Ga0068857_100618475 3300005577 Bacteria 1025
180 Ga0068854_100001666 3300005578 Bacteria 13522
181 Ga0068856_100001538 3300005614 Bacteria 24179
182 Ga0068856_100164360 3300005614 Bacteria 2230
183 Ga0068856_100449012 3300005614 Bacteria 1310
184 Ga0070702_100001415 3300005615 Bacteria 9801
185 Ga0068852_100002972 3300005616 Bacteria 11773
186 Ga0068852_100079588 3300005616 Bacteria 2903
187 Ga0068852_100110846 3300005616 Bacteria 2494
188 Ga0068852_100514371 3300005616 Bacteria 1194
189 Ga0068859_100013486 3300005617 Bacteria 8195
190 Ga0068859_100173949 3300005617 Bacteria 2235
191 Ga0068859_100310289 3300005617 Unclassified 1671
192 Ga0068859_101007969 3300005617 Bacteria 915
193 Ga0068864_100001172 3300005618 Bacteria 21814
194 Ga0068864_100018526 3300005618 Bacteria 5818
195 Ga0068864_100210126 3300005618 Bacteria 1791
196 Ga0068864_100276215 3300005618 Bacteria 1567
197 Ga0068866_10003190 3300005718 Bacteria 6752
198 Ga0068861_100005060 3300005719 Bacteria 8895
199 Ga0068851_10108129 3300005834 Bacteria 1482
200 Ga0068870_10000155 3300005840 Bacteria 23940
201 Ga0068863_100000495 3300005841 Bacteria 39957
202 Ga0068858_100000783 3300005842 Bacteria 33229
203 Ga0068858_100049192 3300005842 Bacteria 3904
204 Ga0068858_100112198 3300005842 Bacteria 2546
205 Ga0068860_100024037 3300005843 Bacteria 5891
206 Ga0068860_100745695 3300005843 Bacteria 991
207 Ga0068862_100020432 3300005844 Bacteria 5532
208 Ga0068862_100445539 3300005844 Bacteria 1220
209 Ga0068862_101152857 3300005844 Bacteria 772
210 Ga0081455_10000204 3300005937 Bacteria 75793
211 Ga0081455_10242172 3300005937 Bacteria 1325
212 Ga0081539_10004321 3300005985 Bacteria 15860
213 Ga0070717_10006465 3300006028 Bacteria 8622
214 Ga0070717_10423517 3300006028 Bacteria 1198
215 Ga0075432_10147364 3300006058 Unclassified 902
216 Ga0070715_10029891 3300006163 Bacteria 2198
217 Ga0070716_100003033 3300006173 Bacteria 7836
218 Ga0070716_100548250 3300006173 Bacteria 862
219 Ga0070716_100706632 3300006173 Unclassified 771
220 Ga0070712_100254997 3300006175 Bacteria 1403
221 Ga0070712_100269137 3300006175 Bacteria 1368
222 Ga0070712_100562458 3300006175 Bacteria 962
223 Ga0070712_101002837 3300006175 Unclassified 723
224 Ga0075367_10216870 3300006178 Bacteria 1197
225 Ga0075366_10008368 3300006195 Bacteria 5747
226 Ga0097621_100000010 3300006237 Bacteria 112867
227 Ga0097621_100021075 3300006237 Bacteria 5034
228 Ga0097621_100048453 3300006237 Bacteria 3447
229 Ga0068871_100000034 3300006358 Bacteria 71462
230 Ga0068871_100030893 3300006358 Bacteria 4221
231 Ga0068871_100059648 3300006358 Bacteria 3109
232 Ga0075428_100381795 3300006844 Bacteria 1510
233 Ga0075428_101007026 3300006844 Bacteria 882
234 Ga0075430_100005590 3300006846 Bacteria 10623
235 Ga0075431_100004052 3300006847 Bacteria 14278
236 Ga0075433_10000774 3300006852 Bacteria 21997
237 Ga0075433_10009145 3300006852 Bacteria 7912
238 Ga0075433_10267078 3300006852 Bacteria 1516
239 Ga0075434_100001700 3300006871 Bacteria 18837
240 Ga0075434_100005910 3300006871 Bacteria 11193
241 Ga0075434_100061647 3300006871 Bacteria 3732
242 Ga0075434_100234596 3300006871 Bacteria 1854
243 Ga0075434_100944090 3300006871 Bacteria 877
244 Ga0075429_100007130 3300006880 Bacteria 9709
245 Ga0068865_100000230 3300006881 Bacteria 31147
246 Ga0068865_100162809 3300006881 Bacteria 1703
247 Ga0068865_100951326 3300006881 Bacteria 750
248 Ga0075436_100085251 3300006914 Bacteria 2193
249 Ga0075436_100093945 3300006914 Bacteria 2086
250 Ga0075436_100264830 3300006914 Bacteria 1226
251 Ga0097620_100013487 3300006931 Bacteria 8195
252 Ga0097620_100173947 3300006931 Bacteria 2235
253 Ga0097620_100310281 3300006931 Unclassified 1671
254 Ga0097620_101007933 3300006931 Bacteria 915
255 Ga0075435_100054003 3300007076 Bacteria 3242
256 Ga0075435_100300755 3300007076 Bacteria 1372
257 Ga0105251_10009243 3300009011 Bacteria 5842
258 Ga0105250_10055797 3300009092 Bacteria 1585
259 Ga0105240_10101227 3300009093 Bacteria 3505
260 Ga0105240_10398388 3300009093 Bacteria 1551
261 Ga0111539_10000932 3300009094 Bacteria 38323
262 Ga0111539_10002162 3300009094 Bacteria 26296
263 Ga0111539_10010377 3300009094 Bacteria 11726
264 Ga0111539_11341449 3300009094 Bacteria 830
265 Ga0105245_10000258 3300009098 Bacteria 50464
266 Ga0105245_10152565 3300009098 Bacteria 2186
267 Ga0105245_11023069 3300009098 Bacteria 871
268 Ga0105245_11211651 3300009098 Bacteria 803
269 Ga0105245_11634296 3300009098 Unclassified 696
270 Ga0105247_10002128 3300009101 Bacteria 13684
271 Ga0105247_10038860 3300009101 Bacteria 2907
272 Ga0114129_10207007 3300009147 Bacteria 2654
273 Ga0114129_10234184 3300009147 Bacteria 2472
274 Ga0105243_10000846 3300009148 Bacteria 29054
275 Ga0105243_10065468 3300009148 Bacteria 2919
276 Ga0105243_10247884 3300009148 Bacteria 1589
277 Ga0105243_10612432 3300009148 Unclassified 1050
278 Ga0105241_10002261 3300009174 Bacteria 14471
279 Ga0105241_10125441 3300009174 Bacteria 2072
280 Ga0105241_10165873 3300009174 Bacteria 1820
281 Ga0105241_10282491 3300009174 Bacteria 1418
282 Ga0105241_10751454 3300009174 Bacteria 894
283 Ga0105242_10000037 3300009176 Bacteria 91293
284 Ga0105242_10009393 3300009176 Bacteria 7503
285 Ga0105242_10178096 3300009176 Bacteria 1874
286 Ga0105248_10000744 3300009177 Bacteria 36599
287 Ga0105248_10056701 3300009177 Bacteria 4395
288 Ga0105248_10149553 3300009177 Bacteria 2635
289 Ga0105248_10185800 3300009177 Bacteria 2342
290 Ga0105248_10857143 3300009177 Unclassified 1025
291 Ga0105237_10037795 3300009545 Bacteria 4878
292 Ga0105237_10053692 3300009545 Bacteria 4041
293 Ga0105237_10142292 3300009545 Bacteria 2393
294 Ga0105238_10012092 3300009551 Bacteria 8698
295 Ga0105238_10070510 3300009551 Bacteria 3494
296 Ga0105238_10236325 3300009551 Bacteria 1805
297 Ga0105249_10000209 3300009553 Bacteria 67037
298 Ga0105249_10117280 3300009553 Bacteria 2525
299 Ga0105249_10295751 3300009553 Bacteria 1622
300 Ga0105249_11075648 3300009553 Unclassified 874
301 Ga0099796_10003664 3300010159 Bacteria 3601
302 Ga0105239_10001464 3300010375 Bacteria 31391
303 Ga0105239_10012186 3300010375 Bacteria 9585
304 Ga0105239_10488895 3300010375 Bacteria 1399
305 Ga0105239_10710429 3300010375 Unclassified 1149
306 Ga0105239_10835107 3300010375 Bacteria 1056
307 Ga0105246_10002021 3300011119 Bacteria 12259
308 Ga0105246_10062610 3300011119 Bacteria 2592
309 Ga0105246_10482729 3300011119 Bacteria 1049
310 Ga0105246_11317413 3300011119 Bacteria 670
311 Ga0157320_1021615 3300012481 Unclassified 591
312 Ga0157337_1002622 3300012483 Bacteria 1032
313 Ga0157335_1004003 3300012492 Unclassified 972
314 Ga0157339_1002627 3300012505 Bacteria 1231
315 Ga0157342_1004833 3300012507 Bacteria 1215
316 Ga0157338_1008326 3300012515 Unclassified 1003
317 Ga0157373_10014658 3300013100 Bacteria 5748
318 Ga0157373_10196765 3300013100 Bacteria 1421
319 Ga0157371_10008348 3300013102 Bacteria 8263
320 Ga0157371_10060753 3300013102 Bacteria 2679
321 Ga0157370_10510019 3300013104 Bacteria 1104
322 Ga0157370_11080666 3300013104 Unclassified 725
323 Ga0157369_10532119 3300013105 Bacteria 1215
324 Ga0157369_11142614 3300013105 Bacteria 796
325 Ga0157374_10137924 3300013296 Bacteria 2366
326 Ga0157374_10282802 3300013296 Bacteria 1638
327 Ga0157374_10299961 3300013296 Bacteria 1589
328 Ga0157378_10015202 3300013297 Bacteria 6740
329 Ga0157378_10133927 3300013297 Bacteria 2296
330 Ga0157378_10297844 3300013297 Bacteria 1560
331 Ga0157378_11414961 3300013297 Unclassified 738
332 Ga0163162_10001677 3300013306 Bacteria 20764
333 Ga0163162_10017229 3300013306 Bacteria 7069
334 Ga0163162_10044150 3300013306 Bacteria 4463
335 Ga0163162_10163610 3300013306 Bacteria 2348
336 Ga0163162_10895406 3300013306 Bacteria 1001
337 Ga0157372_10006418 3300013307 Bacteria 12516
338 Ga0157372_10052004 3300013307 Bacteria 4560
339 Ga0157372_10117836 3300013307 Bacteria 3046
340 Ga0157372_10886625 3300013307 Bacteria 1035
341 Ga0157372_11720725 3300013307 Unclassified 721
342 Ga0157375_10000263 3300013308 Bacteria 47730
343 Ga0157375_10135976 3300013308 Bacteria 2582
344 Ga0157375_10192704 3300013308 Bacteria 2193
345 Ga0157375_11439516 3300013308 Bacteria 812
346 Ga0163163_10037332 3300014325 Bacteria 4726
347 Ga0163163_10074510 3300014325 Bacteria 3386
348 Ga0163163_10316586 3300014325 Bacteria 1614
349 Ga0163163_10317763 3300014325 Bacteria 1611
350 Ga0163163_12934105 3300014325 Bacteria 532
351 Ga0157380_10000294 3300014326 Bacteria 30013
352 Ga0157380_10122182 3300014326 Bacteria 2207
353 Ga0157380_13237656 3300014326 Bacteria 520
354 Ga0182008_10408393 3300014497 Unclassified 731
355 Ga0157377_10001223 3300014745 Bacteria 10958
356 Ga0157377_10143335 3300014745 Bacteria 1470
357 Ga0157379_10002453 3300014968 Bacteria 15540
358 Ga0157379_10025614 3300014968 Bacteria 5242
359 Ga0157379_10115199 3300014968 Bacteria 2417
360 Ga0157379_10185057 3300014968 Bacteria 1882
361 Ga0157379_10196082 3300014968 Bacteria 1825
362 Ga0157379_10329815 3300014968 Bacteria 1394
363 Ga0157376_10000342 3300014969 Bacteria 31043
364 Ga0157376_10134633 3300014969 Bacteria 2210
365 Ga0157376_10151167 3300014969 Bacteria 2094
366 Ga0163161_10000523 3300017792 Bacteria 31363
367 Ga0163161_10381004 3300017792 Bacteria 1127
368 Ga0213875_10001962 3300021388 Bacteria 12731
369 Ga0207666_1000010 3300025271 Bacteria 46973
370 Ga0207666_1000667 3300025271 Bacteria 4112
371 Ga0207673_1000505 3300025290 Bacteria 4125
372 Ga0207697_10000186 3300025315 Bacteria 32405
373 Ga0207697_10003939 3300025315 Bacteria 7220
374 Ga0207713_1044991 3300025735 Bacteria 1807
375 Ga0207653_10012427 3300025885 Bacteria 2658
376 Ga0207682_10000123 3300025893 Bacteria 34953
377 Ga0207692_10032812 3300025898 Bacteria 2498
378 Ga0207692_10284192 3300025898 Bacteria 1002
379 Ga0207692_11009394 3300025898 Bacteria 550
380 Ga0207642_10005605 3300025899 Bacteria 4110
381 Ga0207710_10002765 3300025900 Bacteria 8022
382 Ga0207710_10006531 3300025900 Bacteria 4972
383 Ga0207710_10257605 3300025900 Bacteria 874
384 Ga0207688_10000340 3300025901 Bacteria 21590
385 Ga0207688_10000889 3300025901 Bacteria 15094
386 Ga0207688_10203185 3300025901 Bacteria 1189
387 Ga0207680_10116477 3300025903 Bacteria 1741
388 Ga0207647_10011455 3300025904 Bacteria 6219
389 Ga0207647_10040398 3300025904 Bacteria 2938
390 Ga0207685_10028132 3300025905 Bacteria 1976
391 Ga0207685_10045413 3300025905 Bacteria 1666
392 Ga0207699_10004580 3300025906 Bacteria 6605
393 Ga0207645_10000023 3300025907 Bacteria 98724
394 Ga0207645_10049222 3300025907 Bacteria 2691
395 Ga0207643_10000007 3300025908 Bacteria 171706
396 Ga0207684_10527420 3300025910 Bacteria 1011
397 Ga0207654_10003445 3300025911 Bacteria 8001
398 Ga0207654_10050507 3300025911 Bacteria 2390
399 Ga0207707_10111063 3300025912 Bacteria 2396
400 Ga0207707_10275817 3300025912 Bacteria 1457
401 Ga0207707_10287031 3300025912 Bacteria 1424
402 Ga0207695_10194754 3300025913 Bacteria 1943
403 Ga0207695_10264455 3300025913 Bacteria 1617
404 Ga0207695_10965032 3300025913 Unclassified 732
405 Ga0207695_11052260 3300025913 Bacteria 693
406 Ga0207671_10024741 3300025914 Bacteria 4510
407 Ga0207671_10039604 3300025914 Bacteria 3489
408 Ga0207693_10185639 3300025915 Bacteria 1637
409 Ga0207693_10580563 3300025915 Bacteria 873
410 Ga0207663_10128103 3300025916 Bacteria 1749
411 Ga0207663_10514025 3300025916 Unclassified 932
412 Ga0207663_10543919 3300025916 Bacteria 907
413 Ga0207660_10000393 3300025917 Bacteria 28822
414 Ga0207660_10076398 3300025917 Bacteria 2449
415 Ga0207660_10163077 3300025917 Bacteria 1721
416 Ga0207660_10186507 3300025917 Bacteria 1613
417 Ga0207662_10000136 3300025918 Bacteria 35258
418 Ga0207662_10063446 3300025918 Bacteria 2222
419 Ga0207662_10652402 3300025918 Bacteria 735
420 Ga0207662_10789516 3300025918 Bacteria 669
421 Ga0207657_10002615 3300025919 Bacteria 19455
422 Ga0207657_10320497 3300025919 Bacteria 1226
423 Ga0207649_10000434 3300025920 Bacteria 30314
424 Ga0207649_10306640 3300025920 Bacteria 1162
425 Ga0207652_10001720 3300025921 Bacteria 19098
426 Ga0207652_10076720 3300025921 Bacteria 2915
427 Ga0207652_10127620 3300025921 Bacteria 2266
428 Ga0207652_10272766 3300025921 Bacteria 1526
429 Ga0207652_10569695 3300025921 Bacteria 1017
430 Ga0207652_10824789 3300025921 Bacteria 822
431 Ga0207681_10000273 3300025923 Bacteria 38704
432 Ga0207681_10295327 3300025923 Bacteria 1280
433 Ga0207694_10103091 3300025924 Bacteria 2262
434 Ga0207650_10020018 3300025925 Bacteria 4712
435 Ga0207650_10169465 3300025925 Bacteria 1735
436 Ga0207650_10944291 3300025925 Bacteria 733
437 Ga0207659_10000097 3300025926 Bacteria 51545
438 Ga0207659_10007932 3300025926 Bacteria 6566
439 Ga0207659_10670072 3300025926 Bacteria 887
440 Ga0207687_10120117 3300025927 Bacteria 1964
441 Ga0207687_10223689 3300025927 Unclassified 1483
442 Ga0207687_10449343 3300025927 Bacteria 1069
443 Ga0207700_10003518 3300025928 Bacteria 9127
444 Ga0207700_10097601 3300025928 Bacteria 2335
445 Ga0207700_10334032 3300025928 Bacteria 1316
446 Ga0207664_10048472 3300025929 Bacteria 3341
447 Ga0207664_10198976 3300025929 Bacteria 1728
448 Ga0207664_10209836 3300025929 Bacteria 1685
449 Ga0207664_10469011 3300025929 Bacteria 1125
450 Ga0207664_11007045 3300025929 Unclassified 747
451 Ga0207644_10003263 3300025931 Bacteria 10474
452 Ga0207644_10005450 3300025931 Bacteria 8289
453 Ga0207644_10557139 3300025931 Unclassified 949
454 Ga0207690_10000962 3300025932 Bacteria 18398
455 Ga0207690_10139249 3300025932 Bacteria 1786
456 Ga0207706_10000867 3300025933 Bacteria 31142
457 Ga0207706_10059941 3300025933 Bacteria 3352
458 Ga0207706_10098568 3300025933 Bacteria 2571
459 Ga0207686_10002591 3300025934 Bacteria 9812
460 Ga0207686_10032046 3300025934 Bacteria 3125
461 Ga0207686_10037852 3300025934 Bacteria 2914
462 Ga0207709_11316769 3300025935 Unclassified 597
463 Ga0207670_10000536 3300025936 Bacteria 20898
464 Ga0207670_10082190 3300025936 Bacteria 2257
465 Ga0207670_10610018 3300025936 Bacteria 897
466 Ga0207669_10001135 3300025937 Bacteria 11370
467 Ga0207669_10165681 3300025937 Bacteria 1567
468 Ga0207704_10000119 3300025938 Bacteria 43208
469 Ga0207704_10003914 3300025938 Bacteria 6770
470 Ga0207704_10939779 3300025938 Bacteria 729
471 Ga0207665_10000417 3300025939 Bacteria 29333
472 Ga0207665_10015059 3300025939 Bacteria 5079
473 Ga0207665_10144157 3300025939 Bacteria 1701
474 Ga0207665_11128519 3300025939 Bacteria 625
475 Ga0207691_10000544 3300025940 Bacteria 37754
476 Ga0207691_10217984 3300025940 Bacteria 1655
477 Ga0207711_10002468 3300025941 Bacteria 16502
478 Ga0207711_10099011 3300025941 Bacteria 2577
479 Ga0207711_10125801 3300025941 Bacteria 2293
480 Ga0207711_10289961 3300025941 Bacteria 1508
481 Ga0207711_10572557 3300025941 Unclassified 1053
482 Ga0207689_10001743 3300025942 Bacteria 20521
483 Ga0207689_10117899 3300025942 Bacteria 2183
484 Ga0207689_10296686 3300025942 Bacteria 1339
485 Ga0207661_10000785 3300025944 Bacteria 20682
486 Ga0207661_10223394 3300025944 Bacteria 1665
487 Ga0207661_10455646 3300025944 Bacteria 1165
488 Ga0207679_10000029 3300025945 Bacteria 183002
489 Ga0207679_10128429 3300025945 Bacteria 2030
490 Ga0207679_10128984 3300025945 Bacteria 2026
491 Ga0207679_10468933 3300025945 Bacteria 1119
492 Ga0207679_10799771 3300025945 Bacteria 860
493 Ga0207679_10822530 3300025945 Bacteria 847
494 Ga0207667_10016422 3300025949 Bacteria 8368
495 Ga0207667_10044449 3300025949 Bacteria 4706
496 Ga0207667_10068650 3300025949 Bacteria 3690
497 Ga0207667_10863785 3300025949 Unclassified 898
498 Ga0207667_10955605 3300025949 Bacteria 846
499 Ga0207651_10000083 3300025960 Bacteria 42310
500 Ga0207651_10139913 3300025960 Bacteria 1868
501 Ga0207712_10000471 3300025961 Bacteria 33929
502 Ga0207712_10084342 3300025961 Bacteria 2321
503 Ga0207712_10281977 3300025961 Bacteria 1356
504 Ga0207712_10586101 3300025961 Bacteria 963
505 Ga0207668_10000862 3300025972 Bacteria 18292
506 Ga0207640_10003185 3300025981 Bacteria 8831
507 Ga0207658_10002203 3300025986 Bacteria 14473
508 Ga0207658_10198152 3300025986 Bacteria 1674
509 Ga0207677_10000992 3300026023 Bacteria 15647
510 Ga0207677_10264725 3300026023 Bacteria 1403
511 Ga0207703_10014801 3300026035 Bacteria 6087
512 Ga0207703_10098576 3300026035 Bacteria 2472
513 Ga0207703_10104241 3300026035 Bacteria 2409
514 Ga0207703_10122397 3300026035 Bacteria 2235
515 Ga0207703_10148000 3300026035 Bacteria 2045
516 Ga0207639_10004451 3300026041 Bacteria 9457
517 Ga0207639_10177779 3300026041 Bacteria 1808
518 Ga0207678_10001568 3300026067 Bacteria 21015
519 Ga0207678_10030143 3300026067 Bacteria 4735
520 Ga0207678_10048617 3300026067 Bacteria 3666
521 Ga0207678_10241654 3300026067 Bacteria 1546
522 Ga0207708_10004251 3300026075 Bacteria 10546
523 Ga0207708_10023945 3300026075 Bacteria 4617
524 Ga0207708_10137355 3300026075 Bacteria 1915
525 Ga0207708_10203604 3300026075 Bacteria 1580
526 Ga0207702_10003639 3300026078 Bacteria 13965
527 Ga0207702_10092756 3300026078 Bacteria 2647
528 Ga0207702_10920268 3300026078 Bacteria 867
529 Ga0207641_10000510 3300026088 Bacteria 43699
530 Ga0207641_10917150 3300026088 Unclassified 870
531 Ga0207641_10959794 3300026088 Unclassified 851
532 Ga0207648_10002351 3300026089 Bacteria 20407
533 Ga0207648_10185015 3300026089 Bacteria 1845
534 Ga0207648_10200614 3300026089 Bacteria 1769
535 Ga0207676_10001371 3300026095 Bacteria 18133
536 Ga0207676_10014152 3300026095 Bacteria 5730
537 Ga0207676_10029204 3300026095 Bacteria 4126
538 Ga0207676_10219149 3300026095 Bacteria 1693
539 Ga0207676_10445788 3300026095 Unclassified 1219
540 Ga0207674_10000608 3300026116 Bacteria 46971
541 Ga0207674_10185416 3300026116 Bacteria 2031
542 Ga0207674_10250096 3300026116 Bacteria 1720
543 Ga0207674_10384519 3300026116 Bacteria 1357
544 Ga0207675_100000805 3300026118 Bacteria 31142
545 Ga0207683_10000082 3300026121 Bacteria 74842
546 Ga0207683_10007216 3300026121 Bacteria 9529
547 Ga0207683_10037275 3300026121 Bacteria 4233
548 Ga0207683_10316409 3300026121 Bacteria 1429
549 Ga0207683_10675933 3300026121 Unclassified 957
550 Ga0207698_10000377 3300026142 Bacteria 25983
551 Ga0207698_10257260 3300026142 Bacteria 1602
552 Ga0207698_10504867 3300026142 Bacteria 1177
553 Ga0207698_11345622 3300026142 Bacteria 729
554 Ga0209973_1011005 3300027252 Bacteria 1079
555 Ga0209984_1008995 3300027424 Bacteria 1263
556 Ga0209179_1056121 3300027512 Bacteria 850
557 Ga0210002_1001321 3300027617 Bacteria 3462
558 Ga0209971_1054660 3300027682 Bacteria 965
559 Ga0209966_1005107 3300027695 Bacteria 2244
560 Ga0209998_10002579 3300027717 Bacteria 4118
561 Ga0209813_10209987 3300027866 Bacteria 724
562 Ga0209974_10005874 3300027876 Bacteria 4304
563 Ga0209974_10020181 3300027876 Bacteria 2209
564 Ga0207428_10000124 3300027907 Bacteria 105795
565 Ga0207428_10000420 3300027907 Bacteria 52679
566 Ga0207428_10000703 3300027907 Bacteria 38851
567 Ga0207428_10905284 3300027907 Unclassified 623
568 Ga0268266_10138505 3300028379 Bacteria 2182
569 Ga0268266_10381955 3300028379 Bacteria 1329
570 Ga0268266_10818748 3300028379 Bacteria 899
571 Ga0268266_11644153 3300028379 Bacteria 618
572 Ga0268265_10001170 3300028380 Bacteria 22993
573 Ga0268265_10352587 3300028380 Bacteria 1344
574 Ga0268264_10001878 3300028381 Bacteria 19073
575 Ga0268264_10203260 3300028381 Bacteria 1814
576 Ga0268264_10217943 3300028381 Bacteria 1755
577 Ga0268264_10394554 3300028381 Bacteria 1328
578 Ga0268264_10590759 3300028381 Unclassified 1093
579 Ga0265337_1004750 3300028556 Bacteria 5571
580 Ga0265338_10081076 3300028800 Bacteria 2723
581 Ga0265338_10534682 3300028800 Bacteria 822
582 Ga0265325_10055164 3300031241 Bacteria 2032
583 Ga0265325_10285780 3300031241 Bacteria 739
584 Ga0265339_10110080 3300031249 Bacteria 1425
585 Ga0265316_10498186 3300031344 Bacteria 870
586 Ga0316575_10055001 3300031665 Bacteria 1585
587 Ga0316575_10068406 3300031665 Bacteria 1425
588 Ga0316583_10000771 3300032133 Bacteria 10056
589 Ga0373930_0001168 3300034816 Bacteria 3838
590 Ga0373948_0000160 3300034817 Bacteria 7409
591 Ga0373948_0010635 3300034817 Unclassified 1611
592 Ga0373958_0001209 3300034819 Bacteria 3443
593 Ga0373958_0003548 3300034819 Bacteria 2256
594 Ga0373958_0004355 3300034819 Bacteria 2094
595 Ga0373959_0002987 3300034820 Bacteria 2687
596 Ga0373959_0008682 3300034820 Bacteria 1735
597 Ga0373959_0012691 3300034820 Unclassified 1509
598 Ga0373938_0000574 3300034957 Bacteria 5948
599 Ga0373938_0030785 3300034957 Bacteria 1147
600 Ga0373928_0002434 3300035084 Bacteria 3607
601 Ga0373928_0005079 3300035084 Bacteria 2509
602 Ga0373928_0019947 3300035084 Unclassified 1402
603 Ga0373929_0005219 3300035085 Bacteria 2335
604 Ga0373929_0024438 3300035085 Bacteria 1248
605 Ga0373929_0036900 3300035085 Unclassified 1069
606 Ga0373934_0088877 3300035086 Bacteria 1244
607 Ga0373934_0145739 3300035086 Bacteria 969
608 Ga0373940_0000069 3300035088 Bacteria 11756
609 Ga0373940_0002640 3300035088 Bacteria 3524
610 Ga0373940_0054586 3300035088 Unclassified 1130
611 Ga0373949_0000870 3300035090 Bacteria 9531
612 Ga0373949_0002073 3300035090 Bacteria 5292
613 Ga0373951_0002636 3300035091 Bacteria 4499
614 Ga0373951_0003101 3300035091 Bacteria 4100
615 Ga0373951_0012104 3300035091 Bacteria 1940
616 Ga0373952_0001400 3300035092 Bacteria 4411
617 Ga0373952_0003512 3300035092 Bacteria 2827
618 Ga0373952_0005360 3300035092 Bacteria 2343
619 Ga0373923_0012915 3300035111 Bacteria 3101
620 Ga0373923_0166864 3300035111 Bacteria 1007
621 Ga0373923_0367730 3300035111 Bacteria 688
622 Ga0373932_0002119 3300035112 Bacteria 5158
623 Ga0373936_0001643 3300035113 Bacteria 8197
624 Ga0373936_0297987 3300035113 Unclassified 727
625 Ga0373939_0001165 3300035114 Bacteria 6436
626 Ga0373939_0003141 3300035114 Bacteria 3883
627 Ga0373939_0064153 3300035114 Bacteria 1178
628 Ga0373941_0000185 3300035115 Bacteria 11732
629 Ga0373941_0001158 3300035115 Bacteria 5499
630 Ga0373945_0000687 3300035116 Bacteria 9768
631 Ga0373945_0000695 3300035116 Bacteria 9737
632 Ga0373945_0203214 3300035116 Bacteria 823
633 Ga0373953_0001909 3300035117 Bacteria 6180
634 Ga0373953_0006813 3300035117 Bacteria 3789
635 Ga0373954_0004095 3300035118 Bacteria 6248
636 Ga0373954_0004312 3300035118 Bacteria 6113
637 Ga0373954_0008788 3300035118 Bacteria 4443
638 Ga0373954_0016524 3300035118 Bacteria 3304
639 Ga0373956_0004180 3300035119 Bacteria 5788
640 Ga0373956_0031693 3300035119 Bacteria 2318
641 Ga0373957_0004330 3300035120 Bacteria 4309
642 Ga0373957_0006881 3300035120 Bacteria 3608
643 Ga0373957_0139488 3300035120 Bacteria 990
644 Ga0373960_0000288 3300035121 Bacteria 9618
645 Ga0373960_0000314 3300035121 Bacteria 9220
646 Ga0373960_0097115 3300035121 Unclassified 950
647 Ga0373943_0003558 3300035170 Bacteria 7091
648 Ga0373943_0025872 3300035170 Bacteria 2745
649 Ga0373946_0011915 3300035171 Bacteria 3249
650 Ga0373946_0057297 3300035171 Bacteria 1648
651 Ga0373946_0451959 3300035171 Bacteria 654
652 Ga0373946_0609450 3300035171 Unclassified 566
653 Ga0373955_0000419 3300035172 Bacteria 17956
654 Ga0373955_0014791 3300035172 Bacteria 3806
655 Ga0373955_0126208 3300035172 Bacteria 1491
656 Ga0373955_0244843 3300035172 Bacteria 1074
657 Ga0373942_0007512 3300035207 Bacteria 2530
658 Ga0373942_0189397 3300035207 Unclassified 677
659 Ga0373961_0000636 3300035241 Bacteria 12674
660 Ga0373961_0001288 3300035241 Bacteria 7639
661 Ga0373961_0005944 3300035241 Bacteria 2932
662 Ga0373961_0110901 3300035241 Bacteria 899
663 Ga0373962_0000974 3300035242 Bacteria 6617
664 Ga0373962_0013472 3300035242 Bacteria 2072
665 Ga0373962_0014241 3300035242 Bacteria 2025
666 Ga0373924_0000402 3300035410 Bacteria 13279
667 Ga0373924_0049898 3300035410 Bacteria 1733
668 Ga0373924_0100828 3300035410 Bacteria 1242
669 Ga0373924_0211517 3300035410 Unclassified 856
670 Ga0373931_0014198 3300035691 Bacteria 3889
671 Ga0373935_0000012 3300035692 Bacteria 81961
672 Ga0373935_0114880 3300035692 Bacteria 1791
673 Ga0373935_0320575 3300035692 Unclassified 1099
674 Ga0373927_0006963 3300035695 Bacteria 7676
675 Ga0373927_0031200 3300035695 Bacteria 3475
676 Ga0373927_0331158 3300035695 Bacteria 1003
677 Ga0373933_0000893 3300035724 Bacteria 18249
678 Ga0373933_0004197 3300035724 Bacteria 7942
679 Ga0373933_0371840 3300035724 Unclassified 930
680 Ga0373947_0002387 3300035725 Bacteria 11336
681 Ga0373947_0013898 3300035725 Bacteria 4615
682 Ga0373947_0106326 3300035725 Bacteria 1768
683 Ga0373937_0000054 3300036401 Bacteria 102542
684 Ga0373937_0036163 3300036401 Bacteria 4499
685 Ga0373937_0084336 3300036401 Bacteria 2939
686 Ga0373937_0260551 3300036401 Bacteria 1635
687 Ga0373937_0334901 3300036401 Unclassified 1433
688 Ga0373937_0626303 3300036401 Bacteria 1021
689 Ga0373925_0000018 3300037068 Bacteria 174213
690 Ga0373925_0149411 3300037068 Bacteria 1833
691 Ga0373925_0374663 3300037068 Bacteria 1158
692 Ga0373925_0532501 3300037068 Bacteria 965
693 Ga0395899_0081389 3300037312 Bacteria 2356
694 Ga0395900_0001369 3300037418 Bacteria 29330
695 Ga0395900_0030158 3300037418 Bacteria 5567
696 Ga0395898_0017006 3300037466 Bacteria 7427
697 Ga0395898_0049455 3300037466 Bacteria 4119
698 Ga0395905_0533525 3300037471 Bacteria 1074
699 Ga0436364_0997377 3300037853 Bacteria 897
700 Ga0436364_1325276 3300037853 Bacteria 58128
701 Ga0395901_0006448 3300038443 Bacteria 11889
702 Ga0395901_0369703 3300038443 Bacteria 1477
703 Ga0242419_022220 3300038698 Unclassified 535
704 Ga0242420_012183 3300038996 Bacteria 1452
705 Ga0436365_1531855 3300039437 Bacteria 1400
706 Ga0436365_1569518 3300039437 Bacteria 1003
707 Ga0436363_0942778 3300039450 Bacteria 1289
708 Ga0436362_0063504 3300039453 Bacteria 800
709 Ga0439450_099769 3300042008 Bacteria 736
710 Ga0439435_0002304 3300042436 Bacteria 3761
711 Ga0439459_0060356 3300042438 Bacteria 855
712 Ga0439464_0098059 3300042439 Bacteria 888
713 Ga0439460_0012096 3300042461 Bacteria 2233
714 Ga0466966_0046303 3300044684 Bacteria 2778
715 Ga0466961_0034949 3300044693 Bacteria 3227
716 Ga0466963_0220717 3300044694 Unclassified 1327
717 Ga0466963_1084952 3300044694 Bacteria 563
718 Ga0466959_0489922 3300045049 Bacteria 831
719 Ga0451576_0309129 3300045051 Unclassified 1654
720 Ga0466958_0038326 3300045836 Bacteria 2876
721 Ga0466958_0191358 3300045836 Bacteria 1300
722 Ga0466967_0732053 3300045976 Bacteria 980
723 Ga0495617_072191 3300046452 Bacteria 1135
724 Ga0495592_0000001 3300046454 Bacteria 305819
725 Ga0495592_0031373 3300046454 Bacteria 4016
726 Ga0495592_0379569 3300046454 Bacteria 900
727 Ga0495592_0701821 3300046454 Unclassified 608
728 Ga0495603_0025839 3300046455 Bacteria 3549
729 Ga0495603_0041607 3300046455 Bacteria 2747
730 Ga0495591_113022 3300046458 Bacteria 666
731 Ga0495629_0002067 3300046459 Bacteria 15573
732 Ga0495629_0006898 3300046459 Bacteria 8377
733 Ga0495629_0041066 3300046459 Bacteria 3255
734 Ga0495629_0076460 3300046459 Bacteria 2337
735 Ga0495641_0017165 3300046461 Bacteria 3781
736 Ga0495641_0089052 3300046461 Unclassified 1380
737 Ga0495651_0003892 3300046462 Bacteria 11420
738 Ga0495651_0003996 3300046462 Bacteria 11277
739 Ga0495651_0013246 3300046462 Bacteria 6376
740 Ga0495653_0000292 3300046463 Bacteria 40544
741 Ga0495653_0010574 3300046463 Bacteria 7556
742 Ga0495653_0038160 3300046463 Bacteria 3770
743 Ga0495653_0196921 3300046463 Bacteria 1370
744 Ga0495653_0245634 3300046463 Bacteria 1190
745 Ga0495580_0035178 3300046472 Bacteria 3602
746 Ga0495582_0059398 3300046473 Bacteria 2109
747 Ga0495582_0110852 3300046473 Bacteria 1541
748 Ga0495639_0030981 3300046475 Bacteria 2378
749 Ga0495639_0051117 3300046475 Bacteria 1879
750 Ga0495639_0064199 3300046475 Bacteria 1687
751 Ga0495662_0002781 3300046476 Bacteria 8842
752 Ga0495662_0028948 3300046476 Bacteria 2674
753 Ga0495662_0278585 3300046476 Bacteria 823
754 Ga0495664_0000001 3300046477 Bacteria 757730
755 Ga0495664_0003348 3300046477 Bacteria 8717
756 Ga0495664_0078730 3300046477 Bacteria 1974
757 Ga0495584_0041089 3300046491 Bacteria 2335
758 Ga0495594_0026532 3300046499 Bacteria 3117
759 Ga0495594_0038501 3300046499 Bacteria 2611
760 Ga0495594_0233935 3300046499 Bacteria 1047
761 Ga0495607_0458264 3300046501 Bacteria 571
762 Ga0495608_0000050 3300046511 Bacteria 96603
763 Ga0495608_0009807 3300046511 Bacteria 6683
764 Ga0495608_0071850 3300046511 Bacteria 2257
765 Ga0495608_0092126 3300046511 Bacteria 1959
766 Ga0495608_0715829 3300046511 Bacteria 595
767 Ga0495618_0000045 3300046514 Bacteria 94654
768 Ga0495618_0004751 3300046514 Bacteria 8305
769 Ga0495618_0072201 3300046514 Bacteria 2196
770 Ga0495618_0199829 3300046514 Bacteria 1265
771 Ga0495628_0000003 3300046516 Bacteria 470339
772 Ga0495628_0002046 3300046516 Bacteria 18273
773 Ga0495628_0049119 3300046516 Bacteria 3341
774 Ga0495628_0091598 3300046516 Bacteria 2353
775 Ga0495630_0002190 3300046517 Bacteria 13605
776 Ga0495630_0030402 3300046517 Bacteria 4017
777 Ga0495630_0055331 3300046517 Bacteria 2973
778 Ga0495631_0117810 3300046518 Bacteria 1142
779 Ga0495637_0038624 3300046520 Bacteria 2066
780 Ga0495644_0061346 3300046523 Bacteria 1413
781 Ga0495663_0103796 3300046525 Bacteria 938
782 Ga0495666_0007624 3300046526 Bacteria 5416
783 Ga0495666_0021257 3300046526 Bacteria 3211
784 Ga0495652_0000001 3300046529 Bacteria 1045081
785 Ga0495652_0020932 3300046529 Bacteria 5812
786 Ga0495665_0261136 3300046531 Bacteria 890
787 Ga0495640_0000006 3300046533 Bacteria 285419
788 Ga0495640_0008637 3300046533 Bacteria 7984
789 Ga0495640_0033258 3300046533 Bacteria 3665
790 Ga0495640_0179741 3300046533 Bacteria 1348
791 Ga0495586_0004089 3300046535 Bacteria 7817
792 Ga0495586_0029120 3300046535 Bacteria 2956
793 Ga0495586_0073218 3300046535 Bacteria 1874
794 Ga0495587_0000028 3300046536 Bacteria 138663
795 Ga0495587_0006079 3300046536 Bacteria 7876
796 Ga0495587_0013640 3300046536 Bacteria 5105
797 Ga0495598_0003603 3300046537 Bacteria 3303
798 Ga0495609_0177304 3300046538 Bacteria 898
799 Ga0495645_0000004 3300046543 Bacteria 532661
800 Ga0495645_0343798 3300046543 Bacteria 963
801 Ga0495622_0013106 3300046557 Bacteria 3847
802 Ga0495622_0262309 3300046557 Bacteria 758
803 Ga0495667_0000001 3300046559 Bacteria 834831
804 Ga0495667_0002342 3300046559 Bacteria 12672
805 Ga0495667_0141398 3300046559 Bacteria 1551
806 Ga0495656_0009862 3300046615 Bacteria 3450
807 Ga0495634_0000531 3300046642 Bacteria 37387
808 Ga0495634_0019375 3300046642 Bacteria 4836
809 Ga0495634_0025736 3300046642 Bacteria 4109
810 Ga0495634_0185453 3300046642 Bacteria 1300
811 Ga0495611_0051766 3300046648 Bacteria 1851
812 Ga0495635_0000007 3300046663 Bacteria 278786
813 Ga0495635_0000736 3300046663 Bacteria 21173
814 Ga0495635_0025074 3300046663 Bacteria 4154
815 Ga0495635_0340919 3300046663 Bacteria 1001
816 Ga0495659_0317643 3300046664 Bacteria 661
817 Ga0495588_0013638 3300046674 Bacteria 3873
818 Ga0495657_0000136 3300046675 Bacteria 65707
819 Ga0495657_0025115 3300046675 Bacteria 4234
820 Ga0495657_0065329 3300046675 Bacteria 2393
821 Ga0495657_0089251 3300046675 Bacteria 1981
822 Ga0495599_0000002 3300046678 Bacteria 348168
823 Ga0495599_0002064 3300046678 Bacteria 11642
824 Ga0495599_0155610 3300046678 Unclassified 1414
825 Ga0495623_0000052 3300046679 Bacteria 71268
826 Ga0495623_0002286 3300046679 Bacteria 12776
827 Ga0495646_0000036 3300046680 Bacteria 81182
828 Ga0495646_0002741 3300046680 Bacteria 10885
829 Ga0495646_0054470 3300046680 Bacteria 2405
830 Ga0495646_0147666 3300046680 Bacteria 1310
831 Ga0495647_0010583 3300046681 Bacteria 3143
832 Ga0495647_0038031 3300046681 Bacteria 1818
833 Ga0495647_0159922 3300046681 Bacteria 970
834 Ga0495658_0001370 3300046683 Bacteria 12779
835 Ga0495658_0018935 3300046683 Bacteria 3588
836 Ga0495669_0020794 3300046684 Bacteria 2844
837 Ga0495669_0359342 3300046684 Unclassified 704
838 Ga0495613_0006674 3300046689 Bacteria 8621
839 Ga0495613_0039955 3300046689 Bacteria 3476
840 Ga0495613_0098623 3300046689 Bacteria 2111
841 Ga0495624_0014439 3300046690 Bacteria 5358
842 Ga0495624_0174582 3300046690 Bacteria 1310
843 Ga0495670_0006726 3300046691 Bacteria 5655
844 Ga0495600_0000037 3300046809 Bacteria 78434
845 Ga0495600_0003589 3300046809 Bacteria 9137
846 Ga0495600_0109398 3300046809 Bacteria 1799
847 Ga0495581_0002869 3300047315 Bacteria 9849
848 Ga0495581_0005348 3300047315 Bacteria 7424
849 Ga0495581_0046501 3300047315 Bacteria 2508
850 Ga0495581_0114681 3300047315 Bacteria 1567
851 Ga0495581_0125649 3300047315 Bacteria 1493
852 Ga0495604_0000602 3300047317 Bacteria 31009
853 Ga0495604_0020434 3300047317 Bacteria 5288
854 Ga0495604_0058771 3300047317 Bacteria 2952
855 Ga0495604_0075847 3300047317 Bacteria 2530
856 Ga0495674_0000001 3300047319 Bacteria 778665
857 Ga0495674_0012879 3300047319 Bacteria 7875
858 Ga0495674_0046522 3300047319 Bacteria 3850
859 Ga0495674_0146363 3300047319 Bacteria 1983
860 Ga0495676_0072815 3300047321 Bacteria 2637
861 Ga0495676_0251189 3300047321 Bacteria 1206
862 Ga0495680_0000705 3300047322 Bacteria 37488
863 Ga0495680_0011290 3300047322 Bacteria 7916
864 Ga0495680_0021145 3300047322 Bacteria 5453
865 Ga0495680_0036428 3300047322 Bacteria 3949
866 Ga0495680_0116258 3300047322 Bacteria 1978
867 Ga0495675_0000049 3300047444 Bacteria 80913
868 Ga0495675_0000480 3300047444 Bacteria 26138
869 Ga0495684_0000046 3300047471 Bacteria 92658
870 Ga0495684_0009067 3300047471 Bacteria 7683
871 Ga0495684_0529609 3300047471 Unclassified 805
872 Ga0495593_0009427 3300047673 Bacteria 5664
873 Ga0495593_0013719 3300047673 Bacteria 4615
874 Ga0495593_0070727 3300047673 Bacteria 1812
875 Ga0495602_0000102 3300048088 Bacteria 81094
876 Ga0495602_0178747 3300048088 Bacteria 1639
877 Ga0495602_0352227 3300048088 Bacteria 1062
878 Ga0495614_0022914 3300048089 Bacteria 2692
879 Ga0496100_0000057 3300048903 Bacteria 67216
880 Ga0496100_0008197 3300048903 Bacteria 5818
881 Ga0496100_0068502 3300048903 Bacteria 2360
882 Ga0496101_0065500 3300048904 Bacteria 2649
883 Ga0496101_0167695 3300048904 Bacteria 1686
884 Ga0496101_0253127 3300048904 Unclassified 1372
885 Ga0496102_0001628 3300048905 Bacteria 19791
886 Ga0496102_0023116 3300048905 Bacteria 5517
887 Ga0496102_0232125 3300048905 Bacteria 1739
888 Ga0496102_0241653 3300048905 Unclassified 1702
889 Ga0496102_0257080 3300048905 Bacteria 1646
890 Ga0496102_0398302 3300048905 Bacteria 1294
891 Ga0496102_0441266 3300048905 Bacteria 1221
892 Ga0496103_0039242 3300048906 Bacteria 2910
893 Ga0496103_0306285 3300048906 Unclassified 1022
894 Ga0496104_0059037 3300048907 Bacteria 3631
895 Ga0496104_0062929 3300048907 Bacteria 3518
896 Ga0496104_0072866 3300048907 Bacteria 3267
897 Ga0496104_0120451 3300048907 Bacteria 2519
898 Ga0496104_0156717 3300048907 Bacteria 2185
899 Ga0496105_0071127 3300048908 Bacteria 2875
900 Ga0496105_0116920 3300048908 Bacteria 2199
901 Ga0496105_0523047 3300048908 Unclassified 929
902 Ga0496106_0028707 3300048909 Bacteria 4144
903 Ga0496106_0423263 3300048909 Bacteria 1070
904 Ga0496107_0001129 3300048910 Bacteria 16115
905 Ga0496107_0064606 3300048910 Bacteria 2653
906 Ga0496107_0192756 3300048910 Bacteria 1514
907 Ga0496107_0785625 3300048910 Bacteria 697
908 Ga0496108_0003535 3300048911 Bacteria 12534
909 Ga0496108_0043797 3300048911 Bacteria 3738
910 Ga0496108_0086379 3300048911 Bacteria 2663
911 Ga0496108_0160018 3300048911 Bacteria 1945
912 Ga0496109_0002432 3300048912 Bacteria 15587
913 Ga0496109_0033913 3300048912 Bacteria 4594
914 Ga0496109_0061718 3300048912 Bacteria 3427
915 Ga0496109_0074074 3300048912 Bacteria 3130
916 Ga0496109_0093167 3300048912 Bacteria 2787
917 Ga0496109_0144608 3300048912 Bacteria 2224
918 Ga0496110_0077993 3300048913 Bacteria 2948
919 Ga0496110_0083286 3300048913 Bacteria 2853
920 Ga0496110_0143879 3300048913 Bacteria 2156
921 Ga0496110_0691338 3300048913 Unclassified 921
922 Ga0496111_0022875 3300048914 Bacteria 4381
923 Ga0496111_0043097 3300048914 Bacteria 3243
924 Ga0496111_0098747 3300048914 Bacteria 2144
925 Ga0496111_0171211 3300048914 Bacteria 1613
926 Ga0496111_0310351 3300048914 Bacteria 1169
927 Ga0496112_0070793 3300048915 Bacteria 3446
928 Ga0496112_0079005 3300048915 Bacteria 3254
929 Ga0496112_0100086 3300048915 Bacteria 2868
930 Ga0496112_0121818 3300048915 Bacteria 2578
931 Ga0496112_0339166 3300048915 Unclassified 1446
932 Ga0496112_0406554 3300048915 Unclassified 1301
933 Ga0496112_1029737 3300048915 Bacteria 743
934 Ga0496113_0049425 3300048916 Bacteria 3131
935 Ga0496113_0057193 3300048916 Bacteria 2930
936 Ga0496113_0076978 3300048916 Bacteria 2549
937 Ga0496114_0002944 3300048917 Bacteria 13059
938 Ga0496114_0010304 3300048917 Bacteria 7438
939 Ga0496114_0757422 3300048917 Bacteria 848
940 Ga0496115_0002786 3300048918 Bacteria 12565
941 Ga0496115_0047377 3300048918 Bacteria 3437
942 Ga0496115_0142243 3300048918 Bacteria 1979
943 Ga0496115_0189633 3300048918 Bacteria 1698
944 Ga0496115_0508287 3300048918 Bacteria 967
945 Ga0496121_0601147 3300048924 Bacteria 679
946 Ga0496125_0131914 3300048928 Bacteria 1757
947 Ga0501031_0327693 3300049568 Bacteria 992
948 Ga0501036_0652256 3300049572 Bacteria 871
949 Ga0501037_0783430 3300049573 Bacteria 630
950 Ga0501042_0127565 3300049578 Bacteria 1832
951 Ga0501046_0776403 3300049580 Bacteria 672
952 Ga0501047_0722528 3300049581 Unclassified 813
953 Ga0501048_0152945 3300049582 Bacteria 1632
954 Ga0501048_1282069 3300049582 Unclassified 527
955 Ga0501067_0538171 3300049583 Bacteria 654
956 Ga0501068_0271736 3300049584 Bacteria 1082
957 Ga0501068_1095784 3300049584 Bacteria 527
958 Ga0501070_0244160 3300049586 Bacteria 1470
959 Ga0501071_0013555 3300049587 Bacteria 5558
960 Ga0501072_0044486 3300049588 Bacteria 3491
961 Ga0501073_0045999 3300049589 Bacteria 3072
962 Ga0501075_0299893 3300049591 Bacteria 1224
963 Ga0501076_0661325 3300049592 Bacteria 862
964 Ga0501077_0123062 3300049593 Unclassified 1644
965 Ga0501077_0460576 3300049593 Bacteria 814
966 Ga0501079_0216088 3300049741 Bacteria 1498
967 Ga0501079_0404254 3300049741 Bacteria 1071
968 Ga0501081_0073391 3300049743 Bacteria 2386
969 Ga0501083_0008454 3300049744 Bacteria 7274
970 Ga0501083_0853241 3300049744 Bacteria 593
971 Ga0501044_0555230 3300049823 Bacteria 1045
972 Ga0501045_0576953 3300049824 Bacteria 833
973 nmdc:mga03n38_606528_c1 3300050490 Bacteria 624
974 nmdc:mga0k408_120181_c1 3300050493 Bacteria 1556
975 nmdc:mga0k408_746501_c1 3300050493 Unclassified 572
976 nmdc:mga06z11_211456_c1 3300050494 Bacteria 1130
977 nmdc:mga05p37_45_c2 3300050507 Bacteria 24882
978 nmdc:mga05p37_839451_c1 3300050507 Bacteria 999
979 nmdc:mga05p37_92628_c1 3300050507 Bacteria 3724
980 nmdc:mga09592_1055_c1 3300050508 Bacteria 21846
981 nmdc:mga0qj67_1012_c1 3300050509 Bacteria 19405
982 nmdc:mga0qj67_92436_c1 3300050509 Bacteria 2432
983 nmdc:mga06r32_56570_c1 3300050510 Bacteria 3766
984 nmdc:mga08y16_1134_c1 3300050511 Bacteria 26246
985 nmdc:mga08y16_12172_c1 3300050511 Bacteria 9043
986 nmdc:mga08y16_1989_c1 3300050511 Bacteria 20867
987 nmdc:mga0n895_286420_c1 3300050512 Bacteria 1670
988 nmdc:mga0n895_3165_c1 3300050512 Bacteria 13152
989 nmdc:mga0n895_404960_c1 3300050512 Bacteria 1380
990 nmdc:mga0n895_50_c1 3300050512 Bacteria 71634
991 nmdc:mga0rr50_45762_c1 3300050513 Bacteria 3219
992 nmdc:mga0rr50_77520_c1 3300050513 Bacteria 2554
993 nmdc:mga0rr50_950190_c1 3300050513 Unclassified 733
994 nmdc:mga08x19_536788_c1 3300050514 Bacteria 827
995 nmdc:mga08x19_75835_c1 3300050514 Bacteria 2199
996 nmdc:mga08x19_86249_c1 3300050514 Bacteria 2067
997 nmdc:mga0a205_171569_c1 3300050515 Unclassified 2065
998 nmdc:mga0a205_2228_c1 3300050515 Bacteria 17060
999 nmdc:mga0a205_5479_c1 3300050515 Bacteria 11429
1000 Ga0495601_0000006 3300053077 Bacteria 373770
1001 Ga0495601_0004549 3300053077 Bacteria 8015
1002 Ga0495601_0010204 3300053077 Bacteria 5583
1003 Ga0495601_0011553 3300053077 Bacteria 5288
1004 Ga0495601_0041259 3300053077 Bacteria 2892
1005 Ga0495601_0189704 3300053077 Bacteria 1343
1006 Ga0495612_0000004 3300053078 Bacteria 286946
1007 Ga0495612_0004274 3300053078 Bacteria 5935
1008 Ga0495612_0139684 3300053078 Bacteria 1050
1009 Ga0495612_0210593 3300053078 Bacteria 859
1010 Ga0495595_0000227 3300053084 Bacteria 22346
1011 Ga0495595_0000420 3300053084 Bacteria 16034
1012 Ga0495595_0002620 3300053084 Bacteria 7052
1013 Ga0495595_0003875 3300053084 Bacteria 5969
1014 Ga0495595_0109261 3300053084 Bacteria 1339
1015 Ga0495619_0000027 3300053085 Bacteria 165001
1016 Ga0495619_0000260 3300053085 Bacteria 38574
1017 Ga0495619_0013843 3300053085 Bacteria 5090
1018 Ga0495619_0016793 3300053085 Bacteria 4634
1019 Ga0495619_0053926 3300053085 Bacteria 2661
1020 Ga0495619_0057856 3300053085 Bacteria 2572
1021 Ga0495619_0060868 3300053085 Bacteria 2510
1022 Ga0500566_0193529 3300053094 Bacteria 1033
1023 Ga0501084_0544356 3300054114 Unclassified 981
1024 Ga0501082_0007806 3300060353 Bacteria 9234
1025 Ga0501082_0222206 3300060353 Bacteria 1643
1026 Ga0466962_0034260 3300061719 Bacteria 2431
1027 Ga0530510_0219739 3300061734 Bacteria 1412
1028 Ga0530510_0767135 3300061734 Bacteria 735
1029 2842695400 2842694124 Bacteria 4063419
1030 Ga0395898_0067146
1031 MRS1b_contig_7410661
1032 2214756332
1033 ARSoilYngRDRAFT_c00187
1034 ARcpr5yngRDRAFT_c000626
1035 ARSoilOldRDRAFT_c000105
1036 ARCol0oldRDRAFT_c00945
1037 ARCol0yngRDRAFT_1000034
1038 JGI24736J21556_1020600
1039 JGI24741J21665_1018201
1040 JGI24746J21847_1001098
1041 JGI24739J22299_10000164
1042 JGI24737J22298_10001508
1043 JGI24737J22298_10001579
1044 JGI24743J22301_10012313
1045 JGI24750J21931_1000344
1046 JGI24745J21846_1001611
1047 JGI24738J21930_10000112
1048 JGI24749J21850_1000411
1049 JGI24744J21845_10024671
1050 JGI24035J26624_1000107
1051 JGI24034J26672_10001485
1052 JGI24742J22300_10000359
1053 JGI24751J29686_10062096
1054 JGI24751J29686_10092099
1055 JGI25406J46586_10033300
1056 JGI26128J50194_1007301
1057 Ga0065712_10071820
1058 Ga0065712_10098339
1059 Ga0065712_10615400
1060 Ga0065715_10001049
1061 Ga0065715_10001550
1062 Ga0065715_10208859
1063 Ga0065707_10123077
1064 Ga0070658_10115505
1065 Ga0070676_10000755
1066 Ga0070676_10236745
1067 Ga0070683_100000376
1068 Ga0070683_100105366
1069 Ga0070683_100617469
1070 Ga0070690_100001711
1071 Ga0070690_100006546
1072 Ga0070690_100221375
1073 Ga0070670_100235031
1074 Ga0070670_100577328
1075 Ga0070670_100665518
1076 Ga0070677_10001502
1077 Ga0068869_100000523
1078 Ga0068869_100661514
1079 Ga0070666_10001839
1080 Ga0070666_10006461
1081 Ga0070680_100007212
1082 Ga0070680_100102774
1083 Ga0070680_100124334
1084 Ga0070680_101282681
1085 Ga0070682_100000141
1086 Ga0070682_100010911
1087 Ga0070682_100308753
1088 Ga0070682_100466906
1089 Ga0068868_100037520
1090 Ga0068868_100259259
1091 Ga0068868_100717048
1092 Ga0070660_100002574
1093 Ga0070660_100430741
1094 Ga0070689_100038887
1095 Ga0070689_100049550
1096 Ga0070689_100084736
1097 Ga0070689_100224298
1098 Ga0070691_10000190
1099 Ga0070691_10060821
1100 Ga0070687_100000212
1101 Ga0070687_100030889
1102 Ga0070661_100000242
1103 Ga0070661_100092283
1104 Ga0070661_100686622
1105 Ga0070661_101125174
1106 Ga0070661_101250019
1107 Ga0070692_10007147
1108 Ga0070669_100000593
1109 Ga0070675_100000165
1110 Ga0070671_100010995
1111 Ga0070671_100091245
1112 Ga0070671_100250203
1113 Ga0070671_100397850
1114 Ga0070674_100000450
1115 Ga0070673_100781188
1116 Ga0070688_100028095
1117 Ga0070688_100036300
1118 Ga0070688_100064025
1119 Ga0070659_100000988
1120 Ga0070659_100016224
1121 Ga0070659_100965221
1122 Ga0070667_100000759
1123 Ga0070667_100084445
1124 Ga0070703_10006259
1125 Ga0070709_10003620
1126 Ga0070709_10066394
1127 Ga0070714_100023744
1128 Ga0070714_100024265
1129 Ga0070714_100040478
1130 Ga0070714_100207666
1131 Ga0070713_100156668
1132 Ga0070713_100190763
1133 Ga0070713_100681284
1134 Ga0070713_101606664
1135 Ga0070710_10008897
1136 Ga0070710_10010783
1137 Ga0070710_10304996
1138 Ga0070710_10360499
1139 Ga0070701_10000103
1140 Ga0070711_100122379
1141 Ga0070711_100231133
1142 Ga0070711_100277590
1143 Ga0070711_100357520
1144 Ga0070705_100029576
1145 Ga0070705_100072916
1146 Ga0070705_100136287
1147 Ga0070700_100000364
1148 Ga0070694_100000880
1149 Ga0070694_100334790
1150 Ga0070708_100103778
1151 Ga0070663_100000417
1152 Ga0070663_100095890
1153 Ga0070663_100331488
1154 Ga0070678_100001012
1155 Ga0070678_100020403
1156 Ga0070678_100135201
1157 Ga0070678_100266982
1158 Ga0070662_100000796
1159 Ga0070662_100834181
1160 Ga0070681_10002475
1161 Ga0070681_10016649
1162 Ga0070681_10076422
1163 Ga0070681_10139375
1164 Ga0070681_10160379
1165 Ga0070681_10824898
1166 Ga0068867_100009775
1167 Ga0068867_100330952
1168 Ga0070685_10000547
1169 Ga0070685_10051382
1170 Ga0070699_100602141
1171 Ga0070679_100010894
1172 Ga0070679_100131590
1173 Ga0070679_100358833
1174 Ga0070684_100000755
1175 Ga0070684_100060283
1176 Ga0070684_100065596
1177 Ga0070684_100601370
1178 Ga0070697_100044337
1179 Ga0068853_100000483
1180 Ga0068853_100245345
1181 Ga0070672_100000527
1182 Ga0070686_100002014
1183 Ga0070686_100062310
1184 Ga0070686_100164667
1185 Ga0070695_100003705
1186 Ga0070696_100006474
1187 Ga0070696_100007364
1188 Ga0070696_100340163
1189 Ga0070696_100692801
1190 Ga0070693_100000199
1191 Ga0070693_100030479
1192 Ga0070693_100103745
1193 Ga0070693_100295687
1194 Ga0070665_100207388
1195 Ga0070665_100278950
1196 Ga0070704_100022794
1197 Ga0068855_100004444
1198 Ga0068855_100020137
1199 Ga0068855_100031660
1200 Ga0068855_100235987
1201 Ga0068855_100284778
1202 Ga0070664_100000895
1203 Ga0070664_100124321
1204 Ga0070664_100285222
1205 Ga0070664_100739967
1206 Ga0068857_100001816
1207 Ga0068857_100363630
1208 Ga0068857_100618475
1209 Ga0068854_100001666
1210 Ga0068856_100001538
1211 Ga0068856_100164360
1212 Ga0068856_100449012
1213 Ga0070702_100001415
1214 Ga0068852_100002972
1215 Ga0068852_100079588
1216 Ga0068852_100110846
1217 Ga0068852_100514371
1218 Ga0068859_100013486
1219 Ga0068859_100173949
1220 Ga0068859_100310289
1221 Ga0068859_101007969
1222 Ga0068864_100001172
1223 Ga0068864_100018526
1224 Ga0068864_100210126
1225 Ga0068864_100276215
1226 Ga0068866_10003190
1227 Ga0068861_100005060
1228 Ga0068851_10108129
1229 Ga0068870_10000155
1230 Ga0068863_100000495
1231 Ga0068858_100000783
1232 Ga0068858_100049192
1233 Ga0068858_100112198
1234 Ga0068860_100024037
1235 Ga0068860_100745695
1236 Ga0068862_100020432
1237 Ga0068862_100445539
1238 Ga0068862_101152857
1239 Ga0081455_10000204
1240 Ga0081455_10242172
1241 Ga0081539_10004321
1242 Ga0070717_10006465
1243 Ga0070717_10423517
1244 Ga0075432_10147364
1245 Ga0070715_10029891
1246 Ga0070716_100003033
1247 Ga0070716_100548250
1248 Ga0070716_100706632
1249 Ga0070712_100254997
1250 Ga0070712_100269137
1251 Ga0070712_100562458
1252 Ga0070712_101002837
1253 Ga0075367_10216870
1254 Ga0075366_10008368
1255 Ga0097621_100000010
1256 Ga0097621_100021075
1257 Ga0097621_100048453
1258 Ga0068871_100000034
1259 Ga0068871_100030893
1260 Ga0068871_100059648
1261 Ga0075428_100381795
1262 Ga0075428_101007026
1263 Ga0075430_100005590
1264 Ga0075431_100004052
1265 Ga0075433_10000774
1266 Ga0075433_10009145
1267 Ga0075433_10267078
1268 Ga0075434_100001700
1269 Ga0075434_100005910
1270 Ga0075434_100061647
1271 Ga0075434_100234596
1272 Ga0075434_100944090
1273 Ga0075429_100007130
1274 Ga0068865_100000230
1275 Ga0068865_100162809
1276 Ga0068865_100951326
1277 Ga0075436_100085251
1278 Ga0075436_100093945
1279 Ga0075436_100264830
1280 Ga0097620_100013487
1281 Ga0097620_100173947
1282 Ga0097620_100310281
1283 Ga0097620_101007933
1284 Ga0075435_100054003
1285 Ga0075435_100300755
1286 Ga0105251_10009243
1287 Ga0105250_10055797
1288 Ga0105240_10101227
1289 Ga0105240_10398388
1290 Ga0111539_10000932
1291 Ga0111539_10002162
1292 Ga0111539_10010377
1293 Ga0111539_11341449
1294 Ga0105245_10000258
1295 Ga0105245_10152565
1296 Ga0105245_11023069
1297 Ga0105245_11211651
1298 Ga0105245_11634296
1299 Ga0105247_10002128
1300 Ga0105247_10038860
1301 Ga0114129_10207007
1302 Ga0114129_10234184
1303 Ga0105243_10000846
1304 Ga0105243_10065468
1305 Ga0105243_10247884
1306 Ga0105243_10612432
1307 Ga0105241_10002261
1308 Ga0105241_10125441
1309 Ga0105241_10165873
1310 Ga0105241_10282491
1311 Ga0105241_10751454
1312 Ga0105242_10000037
1313 Ga0105242_10009393
1314 Ga0105242_10178096
1315 Ga0105248_10000744
1316 Ga0105248_10056701
1317 Ga0105248_10149553
1318 Ga0105248_10185800
1319 Ga0105248_10857143
1320 Ga0105237_10037795
1321 Ga0105237_10053692
1322 Ga0105237_10142292
1323 Ga0105238_10012092
1324 Ga0105238_10070510
1325 Ga0105238_10236325
1326 Ga0105249_10000209
1327 Ga0105249_10117280
1328 Ga0105249_10295751
1329 Ga0105249_11075648
1330 Ga0099796_10003664
1331 Ga0105239_10001464
1332 Ga0105239_10012186
1333 Ga0105239_10488895
1334 Ga0105239_10710429
1335 Ga0105239_10835107
1336 Ga0105246_10002021
1337 Ga0105246_10062610
1338 Ga0105246_10482729
1339 Ga0105246_11317413
1340 Ga0157320_1021615
1341 Ga0157337_1002622
1342 Ga0157335_1004003
1343 Ga0157339_1002627
1344 Ga0157342_1004833
1345 Ga0157338_1008326
1346 Ga0157373_10014658
1347 Ga0157373_10196765
1348 Ga0157371_10008348
1349 Ga0157371_10060753
1350 Ga0157370_10510019
1351 Ga0157370_11080666
1352 Ga0157369_10532119
1353 Ga0157369_11142614
1354 Ga0157374_10137924
1355 Ga0157374_10282802
1356 Ga0157374_10299961
1357 Ga0157378_10015202
1358 Ga0157378_10133927
1359 Ga0157378_10297844
1360 Ga0157378_11414961
1361 Ga0163162_10001677
1362 Ga0163162_10017229
1363 Ga0163162_10044150
1364 Ga0163162_10163610
1365 Ga0163162_10895406
1366 Ga0157372_10006418
1367 Ga0157372_10052004
1368 Ga0157372_10117836
1369 Ga0157372_10886625
1370 Ga0157372_11720725
1371 Ga0157375_10000263
1372 Ga0157375_10135976
1373 Ga0157375_10192704
1374 Ga0157375_11439516
1375 Ga0163163_10037332
1376 Ga0163163_10074510
1377 Ga0163163_10316586
1378 Ga0163163_10317763
1379 Ga0163163_12934105
1380 Ga0157380_10000294
1381 Ga0157380_10122182
1382 Ga0157380_13237656
1383 Ga0182008_10408393
1384 Ga0157377_10001223
1385 Ga0157377_10143335
1386 Ga0157379_10002453
1387 Ga0157379_10025614
1388 Ga0157379_10115199
1389 Ga0157379_10185057
1390 Ga0157379_10196082
1391 Ga0157379_10329815
1392 Ga0157376_10000342
1393 Ga0157376_10134633
1394 Ga0157376_10151167
1395 Ga0163161_10000523
1396 Ga0163161_10381004
1397 Ga0213875_10001962
1398 Ga0207666_1000010
1399 Ga0207666_1000667
1400 Ga0207673_1000505
1401 Ga0207697_10000186
1402 Ga0207697_10003939
1403 Ga0207713_1044991
1404 Ga0207653_10012427
1405 Ga0207682_10000123
1406 Ga0207692_10032812
1407 Ga0207692_10284192
1408 Ga0207692_11009394
1409 Ga0207642_10005605
1410 Ga0207710_10002765
1411 Ga0207710_10006531
1412 Ga0207710_10257605
1413 Ga0207688_10000340
1414 Ga0207688_10000889
1415 Ga0207688_10203185
1416 Ga0207680_10116477
1417 Ga0207647_10011455
1418 Ga0207647_10040398
1419 Ga0207685_10028132
1420 Ga0207685_10045413
1421 Ga0207699_10004580
1422 Ga0207645_10000023
1423 Ga0207645_10049222
1424 Ga0207643_10000007
1425 Ga0207684_10527420
1426 Ga0207654_10003445
1427 Ga0207654_10050507
1428 Ga0207707_10111063
1429 Ga0207707_10275817
1430 Ga0207707_10287031
1431 Ga0207695_10194754
1432 Ga0207695_10264455
1433 Ga0207695_10965032
1434 Ga0207695_11052260
1435 Ga0207671_10024741
1436 Ga0207671_10039604
1437 Ga0207693_10185639
1438 Ga0207693_10580563
1439 Ga0207663_10128103
1440 Ga0207663_10514025
1441 Ga0207663_10543919
1442 Ga0207660_10000393
1443 Ga0207660_10076398
1444 Ga0207660_10163077
1445 Ga0207660_10186507
1446 Ga0207662_10000136
1447 Ga0207662_10063446
1448 Ga0207662_10652402
1449 Ga0207662_10789516
1450 Ga0207657_10002615
1451 Ga0207657_10320497
1452 Ga0207649_10000434
1453 Ga0207649_10306640
1454 Ga0207652_10001720
1455 Ga0207652_10076720
1456 Ga0207652_10127620
1457 Ga0207652_10272766
1458 Ga0207652_10569695
1459 Ga0207652_10824789
1460 Ga0207681_10000273
1461 Ga0207681_10295327
1462 Ga0207694_10103091
1463 Ga0207650_10020018
1464 Ga0207650_10169465
1465 Ga0207650_10944291
1466 Ga0207659_10000097
1467 Ga0207659_10007932
1468 Ga0207659_10670072
1469 Ga0207687_10120117
1470 Ga0207687_10223689
1471 Ga0207687_10449343
1472 Ga0207700_10003518
1473 Ga0207700_10097601
1474 Ga0207700_10334032
1475 Ga0207664_10048472
1476 Ga0207664_10198976
1477 Ga0207664_10209836
1478 Ga0207664_10469011
1479 Ga0207664_11007045
1480 Ga0207644_10003263
1481 Ga0207644_10005450
1482 Ga0207644_10557139
1483 Ga0207690_10000962
1484 Ga0207690_10139249
1485 Ga0207706_10000867
1486 Ga0207706_10059941
1487 Ga0207706_10098568
1488 Ga0207686_10002591
1489 Ga0207686_10032046
1490 Ga0207686_10037852
1491 Ga0207709_11316769
1492 Ga0207670_10000536
1493 Ga0207670_10082190
1494 Ga0207670_10610018
1495 Ga0207669_10001135
1496 Ga0207669_10165681
1497 Ga0207704_10000119
1498 Ga0207704_10003914
1499 Ga0207704_10939779
1500 Ga0207665_10000417
1501 Ga0207665_10015059
1502 Ga0207665_10144157
1503 Ga0207665_11128519
1504 Ga0207691_10000544
1505 Ga0207691_10217984
1506 Ga0207711_10002468
1507 Ga0207711_10099011
1508 Ga0207711_10125801
1509 Ga0207711_10289961
1510 Ga0207711_10572557
1511 Ga0207689_10001743
1512 Ga0207689_10117899
1513 Ga0207689_10296686
1514 Ga0207661_10000785
1515 Ga0207661_10223394
1516 Ga0207661_10455646
1517 Ga0207679_10000029
1518 Ga0207679_10128429
1519 Ga0207679_10128984
1520 Ga0207679_10468933
1521 Ga0207679_10799771
1522 Ga0207679_10822530
1523 Ga0207667_10016422
1524 Ga0207667_10044449
1525 Ga0207667_10068650
1526 Ga0207667_10863785
1527 Ga0207667_10955605
1528 Ga0207651_10000083
1529 Ga0207651_10139913
1530 Ga0207712_10000471
1531 Ga0207712_10084342
1532 Ga0207712_10281977
1533 Ga0207712_10586101
1534 Ga0207668_10000862
1535 Ga0207640_10003185
1536 Ga0207658_10002203
1537 Ga0207658_10198152
1538 Ga0207677_10000992
1539 Ga0207677_10264725
1540 Ga0207703_10014801
1541 Ga0207703_10098576
1542 Ga0207703_10104241
1543 Ga0207703_10122397
1544 Ga0207703_10148000
1545 Ga0207639_10004451
1546 Ga0207639_10177779
1547 Ga0207678_10001568
1548 Ga0207678_10030143
1549 Ga0207678_10048617
1550 Ga0207678_10241654
1551 Ga0207708_10004251
1552 Ga0207708_10023945
1553 Ga0207708_10137355
1554 Ga0207708_10203604
1555 Ga0207702_10003639
1556 Ga0207702_10092756
1557 Ga0207702_10920268
1558 Ga0207641_10000510
1559 Ga0207641_10917150
1560 Ga0207641_10959794
1561 Ga0207648_10002351
1562 Ga0207648_10185015
1563 Ga0207648_10200614
1564 Ga0207676_10001371
1565 Ga0207676_10014152
1566 Ga0207676_10029204
1567 Ga0207676_10219149
1568 Ga0207676_10445788
1569 Ga0207674_10000608
1570 Ga0207674_10185416
1571 Ga0207674_10250096
1572 Ga0207674_10384519
1573 Ga0207675_100000805
1574 Ga0207683_10000082
1575 Ga0207683_10007216
1576 Ga0207683_10037275
1577 Ga0207683_10316409
1578 Ga0207683_10675933
1579 Ga0207698_10000377
1580 Ga0207698_10257260
1581 Ga0207698_10504867
1582 Ga0207698_11345622
1583 Ga0209973_1011005
1584 Ga0209984_1008995
1585 Ga0209179_1056121
1586 Ga0210002_1001321
1587 Ga0209971_1054660
1588 Ga0209966_1005107
1589 Ga0209998_10002579
1590 Ga0209813_10209987
1591 Ga0209974_10005874
1592 Ga0209974_10020181
1593 Ga0207428_10000124
1594 Ga0207428_10000420
1595 Ga0207428_10000703
1596 Ga0207428_10905284
1597 Ga0268266_10138505
1598 Ga0268266_10381955
1599 Ga0268266_10818748
1600 Ga0268266_11644153
1601 Ga0268265_10001170
1602 Ga0268265_10352587
1603 Ga0268264_10001878
1604 Ga0268264_10203260
1605 Ga0268264_10217943
1606 Ga0268264_10394554
1607 Ga0268264_10590759
1608 Ga0265337_1004750
1609 Ga0265338_10081076
1610 Ga0265338_10534682
1611 Ga0265325_10055164
1612 Ga0265325_10285780
1613 Ga0265339_10110080
1614 Ga0265316_10498186
1615 Ga0316575_10055001
1616 Ga0316575_10068406
1617 Ga0316583_10000771
1618 Ga0373930_0001168
1619 Ga0373948_0000160
1620 Ga0373948_0010635
1621 Ga0373958_0001209
1622 Ga0373958_0003548
1623 Ga0373958_0004355
1624 Ga0373959_0002987
1625 Ga0373959_0008682
1626 Ga0373959_0012691
1627 Ga0373938_0000574
1628 Ga0373938_0030785
1629 Ga0373928_0002434
1630 Ga0373928_0005079
1631 Ga0373928_0019947
1632 Ga0373929_0005219
1633 Ga0373929_0024438
1634 Ga0373929_0036900
1635 Ga0373934_0088877
1636 Ga0373934_0145739
1637 Ga0373940_0000069
1638 Ga0373940_0002640
1639 Ga0373940_0054586
1640 Ga0373949_0000870
1641 Ga0373949_0002073
1642 Ga0373951_0002636
1643 Ga0373951_0003101
1644 Ga0373951_0012104
1645 Ga0373952_0001400
1646 Ga0373952_0003512
1647 Ga0373952_0005360
1648 Ga0373923_0012915
1649 Ga0373923_0166864
1650 Ga0373923_0367730
1651 Ga0373932_0002119
1652 Ga0373936_0001643
1653 Ga0373936_0297987
1654 Ga0373939_0001165
1655 Ga0373939_0003141
1656 Ga0373939_0064153
1657 Ga0373941_0000185
1658 Ga0373941_0001158
1659 Ga0373945_0000687
1660 Ga0373945_0000695
1661 Ga0373945_0203214
1662 Ga0373953_0001909
1663 Ga0373953_0006813
1664 Ga0373954_0004095
1665 Ga0373954_0004312
1666 Ga0373954_0008788
1667 Ga0373954_0016524
1668 Ga0373956_0004180
1669 Ga0373956_0031693
1670 Ga0373957_0004330
1671 Ga0373957_0006881
1672 Ga0373957_0139488
1673 Ga0373960_0000288
1674 Ga0373960_0000314
1675 Ga0373960_0097115
1676 Ga0373943_0003558
1677 Ga0373943_0025872
1678 Ga0373946_0011915
1679 Ga0373946_0057297
1680 Ga0373946_0451959
1681 Ga0373946_0609450
1682 Ga0373955_0000419
1683 Ga0373955_0014791
1684 Ga0373955_0126208
1685 Ga0373955_0244843
1686 Ga0373942_0007512
1687 Ga0373942_0189397
1688 Ga0373961_0000636
1689 Ga0373961_0001288
1690 Ga0373961_0005944
1691 Ga0373961_0110901
1692 Ga0373962_0000974
1693 Ga0373962_0013472
1694 Ga0373962_0014241
1695 Ga0373924_0000402
1696 Ga0373924_0049898
1697 Ga0373924_0100828
1698 Ga0373924_0211517
1699 Ga0373931_0014198
1700 Ga0373935_0000012
1701 Ga0373935_0114880
1702 Ga0373935_0320575
1703 Ga0373927_0006963
1704 Ga0373927_0031200
1705 Ga0373927_0331158
1706 Ga0373933_0000893
1707 Ga0373933_0004197
1708 Ga0373933_0371840
1709 Ga0373947_0002387
1710 Ga0373947_0013898
1711 Ga0373947_0106326
1712 Ga0373937_0000054
1713 Ga0373937_0036163
1714 Ga0373937_0084336
1715 Ga0373937_0260551
1716 Ga0373937_0334901
1717 Ga0373937_0626303
1718 Ga0373925_0000018
1719 Ga0373925_0149411
1720 Ga0373925_0374663
1721 Ga0373925_0532501
1722 Ga0395899_0081389
1723 Ga0395900_0001369
1724 Ga0395900_0030158
1725 Ga0395898_0017006
1726 Ga0395898_0049455
1727 Ga0395905_0533525
1728 Ga0436364_0997377
1729 Ga0436364_1325276
1730 Ga0395901_0006448
1731 Ga0395901_0369703
1732 Ga0242419_022220
1733 Ga0242420_012183
1734 Ga0436365_1531855
1735 Ga0436365_1569518
1736 Ga0436363_0942778
1737 Ga0436362_0063504
1738 Ga0439450_099769
1739 Ga0439435_0002304
1740 Ga0439459_0060356
1741 Ga0439464_0098059
1742 Ga0439460_0012096
1743 Ga0466966_0046303
1744 Ga0466961_0034949
1745 Ga0466963_0220717
1746 Ga0466963_1084952
1747 Ga0466959_0489922
1748 Ga0451576_0309129
1749 Ga0466958_0038326
1750 Ga0466958_0191358
1751 Ga0466967_0732053
1752 Ga0495617_072191
1753 Ga0495592_0000001
1754 Ga0495592_0031373
1755 Ga0495592_0379569
1756 Ga0495592_0701821
1757 Ga0495603_0025839
1758 Ga0495603_0041607
1759 Ga0495591_113022
1760 Ga0495629_0002067
1761 Ga0495629_0006898
1762 Ga0495629_0041066
1763 Ga0495629_0076460
1764 Ga0495641_0017165
1765 Ga0495641_0089052
1766 Ga0495651_0003892
1767 Ga0495651_0003996
1768 Ga0495651_0013246
1769 Ga0495653_0000292
1770 Ga0495653_0010574
1771 Ga0495653_0038160
1772 Ga0495653_0196921
1773 Ga0495653_0245634
1774 Ga0495580_0035178
1775 Ga0495582_0059398
1776 Ga0495582_0110852
1777 Ga0495639_0030981
1778 Ga0495639_0051117
1779 Ga0495639_0064199
1780 Ga0495662_0002781
1781 Ga0495662_0028948
1782 Ga0495662_0278585
1783 Ga0495664_0000001
1784 Ga0495664_0003348
1785 Ga0495664_0078730
1786 Ga0495584_0041089
1787 Ga0495594_0026532
1788 Ga0495594_0038501
1789 Ga0495594_0233935
1790 Ga0495607_0458264
1791 Ga0495608_0000050
1792 Ga0495608_0009807
1793 Ga0495608_0071850
1794 Ga0495608_0092126
1795 Ga0495608_0715829
1796 Ga0495618_0000045
1797 Ga0495618_0004751
1798 Ga0495618_0072201
1799 Ga0495618_0199829
1800 Ga0495628_0000003
1801 Ga0495628_0002046
1802 Ga0495628_0049119
1803 Ga0495628_0091598
1804 Ga0495630_0002190
1805 Ga0495630_0030402
1806 Ga0495630_0055331
1807 Ga0495631_0117810
1808 Ga0495637_0038624
1809 Ga0495644_0061346
1810 Ga0495663_0103796
1811 Ga0495666_0007624
1812 Ga0495666_0021257
1813 Ga0495652_0000001
1814 Ga0495652_0020932
1815 Ga0495665_0261136
1816 Ga0495640_0000006
1817 Ga0495640_0008637
1818 Ga0495640_0033258
1819 Ga0495640_0179741
1820 Ga0495586_0004089
1821 Ga0495586_0029120
1822 Ga0495586_0073218
1823 Ga0495587_0000028
1824 Ga0495587_0006079
1825 Ga0495587_0013640
1826 Ga0495598_0003603
1827 Ga0495609_0177304
1828 Ga0495645_0000004
1829 Ga0495645_0343798
1830 Ga0495622_0013106
1831 Ga0495622_0262309
1832 Ga0495667_0000001
1833 Ga0495667_0002342
1834 Ga0495667_0141398
1835 Ga0495656_0009862
1836 Ga0495634_0000531
1837 Ga0495634_0019375
1838 Ga0495634_0025736
1839 Ga0495634_0185453
1840 Ga0495611_0051766
1841 Ga0495635_0000007
1842 Ga0495635_0000736
1843 Ga0495635_0025074
1844 Ga0495635_0340919
1845 Ga0495659_0317643
1846 Ga0495588_0013638
1847 Ga0495657_0000136
1848 Ga0495657_0025115
1849 Ga0495657_0065329
1850 Ga0495657_0089251
1851 Ga0495599_0000002
1852 Ga0495599_0002064
1853 Ga0495599_0155610
1854 Ga0495623_0000052
1855 Ga0495623_0002286
1856 Ga0495646_0000036
1857 Ga0495646_0002741
1858 Ga0495646_0054470
1859 Ga0495646_0147666
1860 Ga0495647_0010583
1861 Ga0495647_0038031
1862 Ga0495647_0159922
1863 Ga0495658_0001370
1864 Ga0495658_0018935
1865 Ga0495669_0020794
1866 Ga0495669_0359342
1867 Ga0495613_0006674
1868 Ga0495613_0039955
1869 Ga0495613_0098623
1870 Ga0495624_0014439
1871 Ga0495624_0174582
1872 Ga0495670_0006726
1873 Ga0495600_0000037
1874 Ga0495600_0003589
1875 Ga0495600_0109398
1876 Ga0495581_0002869
1877 Ga0495581_0005348
1878 Ga0495581_0046501
1879 Ga0495581_0114681
1880 Ga0495581_0125649
1881 Ga0495604_0000602
1882 Ga0495604_0020434
1883 Ga0495604_0058771
1884 Ga0495604_0075847
1885 Ga0495674_0000001
1886 Ga0495674_0012879
1887 Ga0495674_0046522
1888 Ga0495674_0146363
1889 Ga0495676_0072815
1890 Ga0495676_0251189
1891 Ga0495680_0000705
1892 Ga0495680_0011290
1893 Ga0495680_0021145
1894 Ga0495680_0036428
1895 Ga0495680_0116258
1896 Ga0495675_0000049
1897 Ga0495675_0000480
1898 Ga0495684_0000046
1899 Ga0495684_0009067
1900 Ga0495684_0529609
1901 Ga0495593_0009427
1902 Ga0495593_0013719
1903 Ga0495593_0070727
1904 Ga0495602_0000102
1905 Ga0495602_0178747
1906 Ga0495602_0352227
1907 Ga0495614_0022914
1908 Ga0496100_0000057
1909 Ga0496100_0008197
1910 Ga0496100_0068502
1911 Ga0496101_0065500
1912 Ga0496101_0167695
1913 Ga0496101_0253127
1914 Ga0496102_0001628
1915 Ga0496102_0023116
1916 Ga0496102_0232125
1917 Ga0496102_0241653
1918 Ga0496102_0257080
1919 Ga0496102_0398302
1920 Ga0496102_0441266
1921 Ga0496103_0039242
1922 Ga0496103_0306285
1923 Ga0496104_0059037
1924 Ga0496104_0062929
1925 Ga0496104_0072866
1926 Ga0496104_0120451
1927 Ga0496104_0156717
1928 Ga0496105_0071127
1929 Ga0496105_0116920
1930 Ga0496105_0523047
1931 Ga0496106_0028707
1932 Ga0496106_0423263
1933 Ga0496107_0001129
1934 Ga0496107_0064606
1935 Ga0496107_0192756
1936 Ga0496107_0785625
1937 Ga0496108_0003535
1938 Ga0496108_0043797
1939 Ga0496108_0086379
1940 Ga0496108_0160018
1941 Ga0496109_0002432
1942 Ga0496109_0033913
1943 Ga0496109_0061718
1944 Ga0496109_0074074
1945 Ga0496109_0093167
1946 Ga0496109_0144608
1947 Ga0496110_0077993
1948 Ga0496110_0083286
1949 Ga0496110_0143879
1950 Ga0496110_0691338
1951 Ga0496111_0022875
1952 Ga0496111_0043097
1953 Ga0496111_0098747
1954 Ga0496111_0171211
1955 Ga0496111_0310351
1956 Ga0496112_0070793
1957 Ga0496112_0079005
1958 Ga0496112_0100086
1959 Ga0496112_0121818
1960 Ga0496112_0339166
1961 Ga0496112_0406554
1962 Ga0496112_1029737
1963 Ga0496113_0049425
1964 Ga0496113_0057193
1965 Ga0496113_0076978
1966 Ga0496114_0002944
1967 Ga0496114_0010304
1968 Ga0496114_0757422
1969 Ga0496115_0002786
1970 Ga0496115_0047377
1971 Ga0496115_0142243
1972 Ga0496115_0189633
1973 Ga0496115_0508287
1974 Ga0496121_0601147
1975 Ga0496125_0131914
1976 Ga0501031_0327693
1977 Ga0501036_0652256
1978 Ga0501037_0783430
1979 Ga0501042_0127565
1980 Ga0501046_0776403
1981 Ga0501047_0722528
1982 Ga0501048_0152945
1983 Ga0501048_1282069
1984 Ga0501067_0538171
1985 Ga0501068_0271736
1986 Ga0501068_1095784
1987 Ga0501070_0244160
1988 Ga0501071_0013555
1989 Ga0501072_0044486
1990 Ga0501073_0045999
1991 Ga0501075_0299893
1992 Ga0501076_0661325
1993 Ga0501077_0123062
1994 Ga0501077_0460576
1995 Ga0501079_0216088
1996 Ga0501079_0404254
1997 Ga0501081_0073391
1998 Ga0501083_0008454
1999 Ga0501083_0853241
2000 Ga0501044_0555230
2001 Ga0501045_0576953
2002 nmdc:mga03n38_606528_c1
2003 nmdc:mga0k408_120181_c1
2004 nmdc:mga0k408_746501_c1
2005 nmdc:mga06z11_211456_c1
2006 nmdc:mga05p37_45_c2
2007 nmdc:mga05p37_839451_c1
2008 nmdc:mga05p37_92628_c1
2009 nmdc:mga09592_1055_c1
2010 nmdc:mga0qj67_1012_c1
2011 nmdc:mga0qj67_92436_c1
2012 nmdc:mga06r32_56570_c1
2013 nmdc:mga08y16_1134_c1
2014 nmdc:mga08y16_12172_c1
2015 nmdc:mga08y16_1989_c1
2016 nmdc:mga0n895_286420_c1
2017 nmdc:mga0n895_3165_c1
2018 nmdc:mga0n895_404960_c1
2019 nmdc:mga0n895_50_c1
2020 nmdc:mga0rr50_45762_c1
2021 nmdc:mga0rr50_77520_c1
2022 nmdc:mga0rr50_950190_c1
2023 nmdc:mga08x19_536788_c1
2024 nmdc:mga08x19_75835_c1
2025 nmdc:mga08x19_86249_c1
2026 nmdc:mga0a205_171569_c1
2027 nmdc:mga0a205_2228_c1
2028 nmdc:mga0a205_5479_c1
2029 Ga0495601_0000006
2030 Ga0495601_0004549
2031 Ga0495601_0010204
2032 Ga0495601_0011553
2033 Ga0495601_0041259
2034 Ga0495601_0189704
2035 Ga0495612_0000004
2036 Ga0495612_0004274
2037 Ga0495612_0139684
2038 Ga0495612_0210593
2039 Ga0495595_0000227
2040 Ga0495595_0000420
2041 Ga0495595_0002620
2042 Ga0495595_0003875
2043 Ga0495595_0109261
2044 Ga0495619_0000027
2045 Ga0495619_0000260
2046 Ga0495619_0013843
2047 Ga0495619_0016793
2048 Ga0495619_0053926
2049 Ga0495619_0057856
2050 Ga0495619_0060868
2051 Ga0500566_0193529
2052 Ga0501084_0544356
2053 Ga0501082_0007806
2054 Ga0501082_0222206
2055 Ga0466962_0034260
2056 Ga0530510_0219739
2057 Ga0530510_0767135
2058 2842695400

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

42

163

0.94

PF22751

DUF488-N3a

Active DUF488-N3 subclade

59

167

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6o-assembly1.cif.gz_A crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides n-g-(p)y-k-n 0.7238 10 129
2i6i-assembly1.cif.gz_A crystal structures of the archaeal sulfolobus ptp-fold phosphatase 0.7204 10 129
6pqz-assembly1.cif.gz_A p133g/s128a s. typhimurium siroheme synthase 0.6699 14 160
1pjt-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6668 13 160
6p7d-assembly1.cif.gz_B d104n s. typhimurium siroheme synthase 0.661 10 160
ID Description Score Start End Superfamily
af_Q9VVU7_1_266_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6944 25 72 3.40.50.2300
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6866 10 129 3.90.190.10
af_P9WGW7_1_114_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6645 12 156 3.40.1010.10
af_P9WGW7_1_114_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6459 12 156 3.40.1010.10
2qbuB01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6388 12 161 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A6L5FI35-F1-model_v4 DUF488 family protein 0.9649 12 161
AF-A0A7T8MFV8-F1-model_v4 deleted 0.9597 11 161
AF-A0A6L5FI35-F1-model_v4 DUF488 family protein 0.9587 12 161
AF-A0A7D7VI00-F1-model_v4 DUF488 family protein 0.9573 12 157
AF-A0A1E4MYY9-F1-model_v4 deleted 0.9569 12 159

Map