F488585
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1029 | 442 | 2058 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300047446|Ga0495679_000404|Ga0495679_000404_21296_22351 |
| Length | 351 |
| Sequence | MLSGYGAPGWVCGYCPLDENGRGEQMSTVRWGMIGCGSVTELKSGPAFYKAPGSALVAVMGRREEAVRDYAARHGIARFYTDAQALIDDPEVGAVYIATPPASHLEYSLMVAAAGKHCCVEKPMSLNAEQSALMQRTFERAGLHLFVSYYRRSLPRFQQVREWLQAGRIGTLRHLTWTLCKPPAAEDASAANWRTDPAIAGGGYFADLASHGFDLFQYLAGDIVEVSGFTARQAGKYAAEDAVTACWTFSSGALGMGCWNFVADRREDLVELIGSHGRIQFSVFEDQPLRLEGETDEVLEVPCHAHIQWHHVLAMNAHIRGEAEHPSLGIEALKTDRILDKVLQRNPNLPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 64 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 75 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 87 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 90 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 91 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 149 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 150 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 151 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 152 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 153 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 160 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 163 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 164 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 165 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 166 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 167 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 168 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 169 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 170 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 171 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 172 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 173 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 174 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 175 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 176 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 177 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 178 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 179 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 180 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 181 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 182 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 183 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 184 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 185 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 189 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 260 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 261 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 262 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 263 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 264 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 265 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 266 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 267 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 268 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 273 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 275 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 276 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 277 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 278 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 279 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 280 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 281 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 283 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 284 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 285 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 286 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 287 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 288 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 289 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 290 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 291 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 292 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 293 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 294 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 295 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 296 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 297 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 298 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 299 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 300 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 301 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 302 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 303 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 304 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 305 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 306 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 307 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 308 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 309 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 310 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 311 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 312 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 313 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 314 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 315 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 316 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 317 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 318 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 319 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 320 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 321 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 322 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 323 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 324 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 325 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 326 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 327 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 328 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 329 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 330 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 331 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 332 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 333 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 334 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 335 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 336 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 337 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 338 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 339 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 340 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 341 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 342 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 343 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 344 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 345 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 346 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 347 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 348 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 349 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 350 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 351 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 352 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 353 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 354 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 355 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 356 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 357 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 358 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 359 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 360 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 361 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 362 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 363 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 364 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 365 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 366 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 367 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 368 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 369 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 370 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 371 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 372 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 373 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 374 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 375 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 376 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 377 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 378 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 379 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 380 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 381 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 382 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 383 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 384 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 385 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 386 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 387 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 388 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 389 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 390 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 391 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 392 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 393 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 394 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 395 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 396 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 397 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 398 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 399 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 400 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 401 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 402 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 403 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 404 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 405 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 406 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 407 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 408 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 409 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 410 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 411 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 412 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 413 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 414 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 415 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 416 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 417 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 418 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 419 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 420 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 421 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 422 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 423 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 424 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 425 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 426 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 427 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 428 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 429 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 430 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 431 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 432 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 433 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 434 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 435 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 436 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 437 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 438 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 439 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 440 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 441 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 442 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.65 |
| Metatranscriptomes | 0 |
| Isolates | 15.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.97 |
| Nodule | 1.85 |
| Rhizoplane | 4.47 |
| Rhizosphere | 73.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495679_000404 | 3300047446 | Bacteria | 32234 |
| 2 | MRS2a_Contig_103 | 2124908027 | Bacteria | 13981 |
| 3 | JGI24736J21556_1005902 | 3300001904 | Bacteria | 2069 |
| 4 | JGI24737J22298_10000796 | 3300001990 | Bacteria | 11186 |
| 5 | JGI24737J22298_10007923 | 3300001990 | Bacteria | 3575 |
| 6 | JGI24735J21928_10000008 | 3300002067 | Bacteria | 319819 |
| 7 | JGI25155J39150_1000126 | 3300002704 | Bacteria | 37345 |
| 8 | JGI25156J39149_1009124 | 3300002705 | Bacteria | 2437 |
| 9 | JGI25162J39368_1000013 | 3300002737 | Bacteria | 343384 |
| 10 | JGI25162J39368_1000047 | 3300002737 | Viruses | 167507 |
| 11 | JGI25162J39368_1000135 | 3300002737 | Bacteria | 79753 |
| 12 | JGI25162J39368_1000183 | 3300002737 | Bacteria | 67086 |
| 13 | JGI25162J39368_1001813 | 3300002737 | Bacteria | 10028 |
| 14 | JGI25154J39366_1000206 | 3300002738 | Bacteria | 42302 |
| 15 | JGI25163J39215_1000183 | 3300002771 | Bacteria | 24140 |
| 16 | JGI25163J39215_1000226 | 3300002771 | Bacteria | 21091 |
| 17 | JGI25163J39215_1000268 | 3300002771 | Bacteria | 18393 |
| 18 | JGI25164J39214_1000005 | 3300002772 | Bacteria | 343384 |
| 19 | JGI25164J39214_1000103 | 3300002772 | Bacteria | 82040 |
| 20 | JGI25165J46597_1000099 | 3300003214 | Bacteria | 158550 |
| 21 | JGI25165J46597_1000214 | 3300003214 | Bacteria | 82040 |
| 22 | rootH2_10013605 | 3300003320 | Bacteria | 52813 |
| 23 | rootH2_10017421 | 3300003320 | Bacteria | 26803 |
| 24 | rootH2_10117289 | 3300003320 | Bacteria | 2653 |
| 25 | rootH2_10313513 | 3300003320 | Bacteria | 1199 |
| 26 | rootL2_10104135 | 3300003322 | Bacteria | 9618 |
| 27 | rootH1_10032017 | 3300003323 | Unclassified | 1754 |
| 28 | rootH1_10193823 | 3300003323 | Bacteria | 3900 |
| 29 | Ga0055538_1000075 | 3300003751 | Bacteria | 89749 |
| 30 | Ga0055539_1000113 | 3300003752 | Bacteria | 89749 |
| 31 | Ga0055533_1000120 | 3300003756 | Bacteria | 89749 |
| 32 | Ga0055532_1000107 | 3300003758 | Bacteria | 89749 |
| 33 | Ga0055525_1000158 | 3300003759 | Bacteria | 89749 |
| 34 | Ga0055535_1007312 | 3300003761 | Bacteria | 2123 |
| 35 | Ga0055536_1000021 | 3300003781 | Bacteria | 198584 |
| 36 | Ga0055536_1000190 | 3300003781 | Bacteria | 50444 |
| 37 | Ga0055530_10000002 | 3300003791 | Bacteria | 300466 |
| 38 | Ga0055530_10000006 | 3300003791 | Bacteria | 198584 |
| 39 | Ga0055530_10005998 | 3300003791 | Bacteria | 5578 |
| 40 | Ga0055530_10035830 | 3300003791 | Bacteria | 1254 |
| 41 | Ga0055540_1000009 | 3300003792 | Bacteria | 300466 |
| 42 | Ga0055540_1000051 | 3300003792 | Bacteria | 144078 |
| 43 | Ga0055540_1000490 | 3300003792 | Bacteria | 30277 |
| 44 | Ga0055531_10000070 | 3300003794 | Bacteria | 111273 |
| 45 | Ga0055541_1000076 | 3300003841 | Bacteria | 89749 |
| 46 | Ga0065714_10000204 | 3300005288 | Bacteria | 7372 |
| 47 | Ga0065714_10007643 | 3300005288 | Bacteria | 4334 |
| 48 | Ga0065714_10008799 | 3300005288 | Bacteria | 3255 |
| 49 | Ga0065714_10009693 | 3300005288 | Bacteria | 2260 |
| 50 | Ga0065714_10064666 | 3300005288 | Bacteria | 25011 |
| 51 | Ga0065714_10084335 | 3300005288 | Bacteria | 2204 |
| 52 | Ga0065714_10145193 | 3300005288 | Bacteria | 1143 |
| 53 | Ga0065712_10077106 | 3300005290 | Bacteria | 3544 |
| 54 | Ga0065712_10083103 | 3300005290 | Bacteria | 2862 |
| 55 | Ga0065715_10312309 | 3300005293 | Bacteria | 1010 |
| 56 | Ga0070658_10000014 | 3300005327 | Bacteria | 244978 |
| 57 | Ga0070658_10042733 | 3300005327 | Bacteria | 3661 |
| 58 | Ga0070658_10111772 | 3300005327 | Bacteria | 2264 |
| 59 | Ga0070658_10319766 | 3300005327 | Unclassified | 1325 |
| 60 | Ga0070676_10024076 | 3300005328 | Bacteria | 3426 |
| 61 | Ga0070670_100002833 | 3300005331 | Bacteria | 14346 |
| 62 | Ga0070670_100003592 | 3300005331 | Bacteria | 12904 |
| 63 | Ga0070680_100113689 | 3300005336 | Bacteria | 2255 |
| 64 | Ga0070682_100140189 | 3300005337 | Bacteria | 1647 |
| 65 | Ga0068868_100033977 | 3300005338 | Bacteria | 3934 |
| 66 | Ga0068868_100174672 | 3300005338 | Bacteria | 1780 |
| 67 | Ga0070660_100109575 | 3300005339 | Bacteria | 2196 |
| 68 | Ga0070660_100244652 | 3300005339 | Unclassified | 1461 |
| 69 | Ga0070661_100000025 | 3300005344 | Bacteria | 121698 |
| 70 | Ga0070669_100001350 | 3300005353 | Bacteria | 17670 |
| 71 | Ga0070669_100011648 | 3300005353 | Bacteria | 6239 |
| 72 | Ga0070671_100005292 | 3300005355 | Bacteria | 10296 |
| 73 | Ga0070659_100000148 | 3300005366 | Bacteria | 53569 |
| 74 | Ga0070678_100000566 | 3300005456 | Bacteria | 18121 |
| 75 | Ga0070662_100000054 | 3300005457 | Bacteria | 60719 |
| 76 | Ga0070662_100012024 | 3300005457 | Bacteria | 5730 |
| 77 | Ga0070681_10063938 | 3300005458 | Bacteria | 3652 |
| 78 | Ga0068867_100009805 | 3300005459 | Bacteria | 6749 |
| 79 | Ga0070679_100010692 | 3300005530 | Bacteria | 8711 |
| 80 | Ga0070679_100087045 | 3300005530 | Bacteria | 3111 |
| 81 | Ga0070684_100154977 | 3300005535 | Bacteria | 2077 |
| 82 | Ga0068853_100031762 | 3300005539 | Bacteria | 4468 |
| 83 | Ga0070665_100000010 | 3300005548 | Bacteria | 529545 |
| 84 | Ga0070665_100082756 | 3300005548 | Bacteria | 3215 |
| 85 | Ga0068855_100033283 | 3300005563 | Bacteria | 6153 |
| 86 | Ga0068855_100125751 | 3300005563 | Bacteria | 2931 |
| 87 | Ga0068855_100264905 | 3300005563 | Bacteria | 1913 |
| 88 | Ga0068855_100538583 | 3300005563 | Bacteria | 1265 |
| 89 | Ga0070664_100000019 | 3300005564 | Bacteria | 121708 |
| 90 | Ga0068854_100271770 | 3300005578 | Bacteria | 1361 |
| 91 | Ga0068854_100292771 | 3300005578 | Bacteria | 1314 |
| 92 | Ga0068856_100000023 | 3300005614 | Bacteria | 141671 |
| 93 | Ga0068856_100005294 | 3300005614 | Bacteria | 12730 |
| 94 | Ga0068852_100004334 | 3300005616 | Bacteria | 10015 |
| 95 | Ga0068866_10050089 | 3300005718 | Bacteria | 2119 |
| 96 | Ga0068861_100151749 | 3300005719 | Bacteria | 1902 |
| 97 | Ga0068851_10000374 | 3300005834 | Bacteria | 20243 |
| 98 | Ga0075364_10107354 | 3300006051 | Bacteria | 1861 |
| 99 | Ga0075366_10000507 | 3300006195 | Bacteria | 17971 |
| 100 | Ga0075366_10001582 | 3300006195 | Bacteria | 11391 |
| 101 | Ga0097621_100000247 | 3300006237 | Bacteria | 36324 |
| 102 | Ga0068871_100003906 | 3300006358 | Bacteria | 10272 |
| 103 | Ga0068865_100000076 | 3300006881 | Bacteria | 51732 |
| 104 | Ga0075436_100254380 | 3300006914 | Bacteria | 1251 |
| 105 | Ga0079104_1000081 | 3300006946 | Bacteria | 140632 |
| 106 | Ga0079104_1012017 | 3300006946 | Bacteria | 2747 |
| 107 | Ga0105251_10001274 | 3300009011 | Bacteria | 21776 |
| 108 | Ga0105251_10004867 | 3300009011 | Bacteria | 8961 |
| 109 | Ga0105251_10012899 | 3300009011 | Bacteria | 4702 |
| 110 | Ga0105251_10023891 | 3300009011 | Bacteria | 3147 |
| 111 | Ga0105251_10035947 | 3300009011 | Bacteria | 2441 |
| 112 | Ga0105244_10001220 | 3300009036 | Bacteria | 21071 |
| 113 | Ga0105244_10002515 | 3300009036 | Bacteria | 13789 |
| 114 | Ga0105244_10002808 | 3300009036 | Bacteria | 12931 |
| 115 | Ga0105244_10027155 | 3300009036 | Bacteria | 3088 |
| 116 | Ga0105244_10035204 | 3300009036 | Bacteria | 2631 |
| 117 | Ga0105244_10093060 | 3300009036 | Bacteria | 1481 |
| 118 | Ga0105250_10000087 | 3300009092 | Bacteria | 81632 |
| 119 | Ga0105250_10000267 | 3300009092 | Bacteria | 42329 |
| 120 | Ga0105250_10002218 | 3300009092 | Bacteria | 9896 |
| 121 | Ga0105250_10084611 | 3300009092 | Bacteria | 1287 |
| 122 | Ga0105240_10000173 | 3300009093 | Bacteria | 131281 |
| 123 | Ga0105240_10048462 | 3300009093 | Bacteria | 5369 |
| 124 | Ga0105240_10065366 | 3300009093 | Bacteria | 4515 |
| 125 | Ga0105240_10237399 | 3300009093 | Bacteria | 2115 |
| 126 | Ga0105243_10000067 | 3300009148 | Bacteria | 123656 |
| 127 | Ga0105243_10000337 | 3300009148 | Bacteria | 51319 |
| 128 | Ga0105243_10008683 | 3300009148 | Bacteria | 7789 |
| 129 | Ga0105243_10050347 | 3300009148 | Bacteria | 3290 |
| 130 | Ga0105241_10001338 | 3300009174 | Bacteria | 18702 |
| 131 | Ga0105241_10021419 | 3300009174 | Bacteria | 4778 |
| 132 | Ga0105242_10002307 | 3300009176 | Bacteria | 15054 |
| 133 | Ga0105242_10003180 | 3300009176 | Bacteria | 12809 |
| 134 | Ga0105242_10401789 | 3300009176 | Bacteria | 1279 |
| 135 | Ga0105237_10002438 | 3300009545 | Bacteria | 23082 |
| 136 | Ga0105237_10002957 | 3300009545 | Bacteria | 20562 |
| 137 | Ga0105237_10006614 | 3300009545 | Bacteria | 12813 |
| 138 | Ga0105237_10008782 | 3300009545 | Bacteria | 10901 |
| 139 | Ga0105237_10015332 | 3300009545 | Bacteria | 7982 |
| 140 | Ga0105239_10000816 | 3300010375 | Bacteria | 44236 |
| 141 | Ga0105239_10003173 | 3300010375 | Bacteria | 20361 |
| 142 | Ga0105239_10017987 | 3300010375 | Bacteria | 7816 |
| 143 | Ga0105239_10047642 | 3300010375 | Bacteria | 4697 |
| 144 | Ga0105239_10086933 | 3300010375 | Bacteria | 3446 |
| 145 | Ga0105239_10110143 | 3300010375 | Bacteria | 3052 |
| 146 | Ga0105239_10194163 | 3300010375 | Bacteria | 2273 |
| 147 | Ga0105246_10000469 | 3300011119 | Bacteria | 21755 |
| 148 | Ga0105246_10000586 | 3300011119 | Bacteria | 20188 |
| 149 | Ga0105246_10021731 | 3300011119 | Bacteria | 4133 |
| 150 | Ga0105246_10021760 | 3300011119 | Bacteria | 4130 |
| 151 | Ga0157345_1000289 | 3300012498 | Bacteria | 6704 |
| 152 | Ga0157373_10000284 | 3300013100 | Bacteria | 40521 |
| 153 | Ga0157373_10000746 | 3300013100 | Bacteria | 25237 |
| 154 | Ga0157373_10003109 | 3300013100 | Bacteria | 12543 |
| 155 | Ga0157373_10009443 | 3300013100 | Bacteria | 7206 |
| 156 | Ga0157373_10016882 | 3300013100 | Bacteria | 5323 |
| 157 | Ga0157373_10026359 | 3300013100 | Bacteria | 4198 |
| 158 | Ga0157373_10039620 | 3300013100 | Bacteria | 3373 |
| 159 | Ga0157373_10040884 | 3300013100 | Bacteria | 3317 |
| 160 | Ga0157373_10053258 | 3300013100 | Bacteria | 2877 |
| 161 | Ga0157373_10240657 | 3300013100 | Bacteria | 1279 |
| 162 | Ga0157371_10000298 | 3300013102 | Bacteria | 65719 |
| 163 | Ga0157371_10000308 | 3300013102 | Bacteria | 63557 |
| 164 | Ga0157370_10024460 | 3300013104 | Bacteria | 5982 |
| 165 | Ga0157370_10028024 | 3300013104 | Bacteria | 5545 |
| 166 | Ga0157370_10108148 | 3300013104 | Bacteria | 2600 |
| 167 | Ga0157369_10001344 | 3300013105 | Bacteria | 30365 |
| 168 | Ga0157369_10003664 | 3300013105 | Bacteria | 18238 |
| 169 | Ga0157369_10004545 | 3300013105 | Bacteria | 16317 |
| 170 | Ga0157369_10007394 | 3300013105 | Bacteria | 12644 |
| 171 | Ga0157369_10035679 | 3300013105 | Bacteria | 5451 |
| 172 | Ga0157369_10095042 | 3300013105 | Bacteria | 3181 |
| 173 | Ga0157374_10001476 | 3300013296 | Bacteria | 19869 |
| 174 | Ga0157374_10002139 | 3300013296 | Bacteria | 16656 |
| 175 | Ga0157374_10005179 | 3300013296 | Bacteria | 10934 |
| 176 | Ga0163162_10000075 | 3300013306 | Bacteria | 90751 |
| 177 | Ga0163162_10000082 | 3300013306 | Bacteria | 86888 |
| 178 | Ga0163162_10007367 | 3300013306 | Bacteria | 10697 |
| 179 | Ga0163162_10071839 | 3300013306 | Bacteria | 3515 |
| 180 | Ga0163162_10176704 | 3300013306 | Unclassified | 2261 |
| 181 | Ga0163162_10360378 | 3300013306 | Bacteria | 1587 |
| 182 | Ga0157372_10000071 | 3300013307 | Bacteria | 109638 |
| 183 | Ga0157372_10002043 | 3300013307 | Bacteria | 21955 |
| 184 | Ga0157372_10005233 | 3300013307 | Bacteria | 13785 |
| 185 | Ga0157372_10022369 | 3300013307 | Bacteria | 6839 |
| 186 | Ga0157372_10139570 | 3300013307 | Bacteria | 2791 |
| 187 | Ga0157375_10000312 | 3300013308 | Bacteria | 43933 |
| 188 | Ga0157375_10004026 | 3300013308 | Bacteria | 12751 |
| 189 | Ga0157375_10062535 | 3300013308 | Bacteria | 3700 |
| 190 | Ga0157375_10118484 | 3300013308 | Bacteria | 2754 |
| 191 | Ga0182008_10002137 | 3300014497 | Bacteria | 12598 |
| 192 | Ga0182008_10002346 | 3300014497 | Bacteria | 11912 |
| 193 | Ga0182008_10005700 | 3300014497 | Bacteria | 7050 |
| 194 | Ga0182008_10012243 | 3300014497 | Bacteria | 4530 |
| 195 | Ga0182008_10051361 | 3300014497 | Bacteria | 2045 |
| 196 | Ga0182008_10064865 | 3300014497 | Bacteria | 1797 |
| 197 | Ga0157376_10079089 | 3300014969 | Bacteria | 2818 |
| 198 | Ga0182006_1000794 | 3300015261 | Bacteria | 21216 |
| 199 | Ga0182006_1004990 | 3300015261 | Bacteria | 6395 |
| 200 | Ga0182006_1006185 | 3300015261 | Bacteria | 5590 |
| 201 | Ga0182006_1036177 | 3300015261 | Bacteria | 1964 |
| 202 | Ga0182006_1045074 | 3300015261 | Bacteria | 1718 |
| 203 | Ga0182006_1087605 | 3300015261 | Bacteria | 1125 |
| 204 | Ga0182007_10001805 | 3300015262 | Bacteria | 11165 |
| 205 | Ga0182007_10040970 | 3300015262 | Bacteria | 1545 |
| 206 | Ga0182005_1005881 | 3300015265 | Bacteria | 3799 |
| 207 | Ga0182005_1027507 | 3300015265 | Bacteria | 1550 |
| 208 | Ga0182005_1027733 | 3300015265 | Bacteria | 1544 |
| 209 | Ga0163161_10000167 | 3300017792 | Bacteria | 60151 |
| 210 | Ga0163161_10001360 | 3300017792 | Bacteria | 18143 |
| 211 | Ga0163161_10025013 | 3300017792 | Bacteria | 4221 |
| 212 | Ga0163161_10026293 | 3300017792 | Bacteria | 4123 |
| 213 | Ga0163161_10026513 | 3300017792 | Bacteria | 4104 |
| 214 | Ga0163161_10028075 | 3300017792 | Bacteria | 3994 |
| 215 | Ga0163161_10045106 | 3300017792 | Bacteria | 3178 |
| 216 | Ga0163161_10062320 | 3300017792 | Bacteria | 2716 |
| 217 | Ga0163161_10129330 | 3300017792 | Bacteria | 1903 |
| 218 | Ga0213872_10000597 | 3300021361 | Bacteria | 27544 |
| 219 | Ga0213872_10001019 | 3300021361 | Bacteria | 19525 |
| 220 | Ga0213872_10002575 | 3300021361 | Bacteria | 10562 |
| 221 | Ga0213872_10016991 | 3300021361 | Bacteria | 3369 |
| 222 | Ga0213872_10024639 | 3300021361 | Bacteria | 2769 |
| 223 | Ga0213872_10031662 | 3300021361 | Bacteria | 2424 |
| 224 | Ga0213872_10035629 | 3300021361 | Bacteria | 2275 |
| 225 | Ga0213872_10038438 | 3300021361 | Bacteria | 2184 |
| 226 | Ga0209435_100201 | 3300025206 | Bacteria | 17317 |
| 227 | Ga0209435_101268 | 3300025206 | Bacteria | 3320 |
| 228 | Ga0209760_100035 | 3300025207 | Bacteria | 132204 |
| 229 | Ga0209760_100923 | 3300025207 | Bacteria | 3647 |
| 230 | Ga0209784_100113 | 3300025224 | Bacteria | 89916 |
| 231 | Ga0209566_100138 | 3300025225 | Bacteria | 89916 |
| 232 | Ga0209674_100158 | 3300025226 | Bacteria | 89916 |
| 233 | Ga0209672_101444 | 3300025228 | Bacteria | 8507 |
| 234 | Ga0209147_100167 | 3300025229 | Bacteria | 89916 |
| 235 | Ga0209563_100134 | 3300025230 | Bacteria | 89916 |
| 236 | Ga0209563_100887 | 3300025230 | Bacteria | 8876 |
| 237 | Ga0207427_100015 | 3300025231 | Bacteria | 542133 |
| 238 | Ga0207427_100018 | 3300025231 | Bacteria | 530735 |
| 239 | Ga0209437_100027 | 3300025233 | Bacteria | 542133 |
| 240 | Ga0209437_100031 | 3300025233 | Bacteria | 530871 |
| 241 | Ga0209437_100089 | 3300025233 | Bacteria | 250476 |
| 242 | Ga0209258_101107 | 3300025242 | Bacteria | 11393 |
| 243 | Ga0209646_1000093 | 3300025246 | Bacteria | 183840 |
| 244 | Ga0209646_1002448 | 3300025246 | Bacteria | 4113 |
| 245 | Ga0209026_1000537 | 3300025250 | Bacteria | 26098 |
| 246 | Ga0209026_1002474 | 3300025250 | Bacteria | 6888 |
| 247 | Ga0209026_1004259 | 3300025250 | Bacteria | 4335 |
| 248 | Ga0209026_1006723 | 3300025250 | Bacteria | 2752 |
| 249 | Ga0209677_100104 | 3300025253 | Bacteria | 89916 |
| 250 | Ga0209759_1000248 | 3300025256 | Bacteria | 80537 |
| 251 | Ga0209129_1013944 | 3300025258 | Bacteria | 1737 |
| 252 | Ga0209233_1000012 | 3300025261 | Bacteria | 1019519 |
| 253 | Ga0209233_1000039 | 3300025261 | Bacteria | 542133 |
| 254 | Ga0209233_1001941 | 3300025261 | Bacteria | 7883 |
| 255 | Ga0209675_1007568 | 3300025291 | Bacteria | 4138 |
| 256 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 257 | Ga0209676_1000017 | 3300025292 | Bacteria | 643409 |
| 258 | Ga0209676_1001754 | 3300025292 | Bacteria | 18480 |
| 259 | Ga0209676_1027203 | 3300025292 | Bacteria | 1804 |
| 260 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 261 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 262 | Ga0209050_1000062 | 3300025298 | Bacteria | 316538 |
| 263 | Ga0209050_1000318 | 3300025298 | Bacteria | 97317 |
| 264 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 265 | Ga0209051_1000008 | 3300025303 | Bacteria | 706935 |
| 266 | Ga0209051_1000060 | 3300025303 | Bacteria | 257304 |
| 267 | Ga0209051_1032530 | 3300025303 | Bacteria | 1988 |
| 268 | Ga0209257_1000171 | 3300025304 | Bacteria | 168276 |
| 269 | Ga0209257_1014560 | 3300025304 | Bacteria | 3368 |
| 270 | Ga0207696_1000002 | 3300025711 | Bacteria | 1098043 |
| 271 | Ga0207696_1000041 | 3300025711 | Bacteria | 311695 |
| 272 | Ga0207696_1000948 | 3300025711 | Bacteria | 17705 |
| 273 | Ga0207696_1004218 | 3300025711 | Bacteria | 6250 |
| 274 | Ga0207655_1000137 | 3300025728 | Bacteria | 140084 |
| 275 | Ga0207655_1000171 | 3300025728 | Bacteria | 118865 |
| 276 | Ga0207655_1002517 | 3300025728 | Bacteria | 14749 |
| 277 | Ga0207655_1006436 | 3300025728 | Bacteria | 7783 |
| 278 | Ga0207655_1008643 | 3300025728 | Bacteria | 6433 |
| 279 | Ga0207655_1009931 | 3300025728 | Bacteria | 5847 |
| 280 | Ga0207655_1021409 | 3300025728 | Bacteria | 3283 |
| 281 | Ga0207655_1022261 | 3300025728 | Bacteria | 3185 |
| 282 | Ga0207713_1000281 | 3300025735 | Bacteria | 59913 |
| 283 | Ga0207713_1004734 | 3300025735 | Bacteria | 8754 |
| 284 | Ga0207713_1007192 | 3300025735 | Bacteria | 6633 |
| 285 | Ga0207713_1009201 | 3300025735 | Bacteria | 5594 |
| 286 | Ga0207713_1009264 | 3300025735 | Bacteria | 5573 |
| 287 | Ga0207713_1011920 | 3300025735 | Bacteria | 4689 |
| 288 | Ga0207713_1039843 | 3300025735 | Bacteria | 1978 |
| 289 | Ga0207713_1058938 | 3300025735 | Bacteria | 1476 |
| 290 | Ga0207642_10014697 | 3300025899 | Bacteria | 2897 |
| 291 | Ga0207647_10000046 | 3300025904 | Bacteria | 90148 |
| 292 | Ga0207647_10000154 | 3300025904 | Bacteria | 54378 |
| 293 | Ga0207645_10002749 | 3300025907 | Bacteria | 13705 |
| 294 | Ga0207705_10000107 | 3300025909 | Bacteria | 94984 |
| 295 | Ga0207705_10033443 | 3300025909 | Bacteria | 3673 |
| 296 | Ga0207705_10088234 | 3300025909 | Bacteria | 2269 |
| 297 | Ga0207654_10010413 | 3300025911 | Bacteria | 4734 |
| 298 | Ga0207707_10171326 | 3300025912 | Bacteria | 1897 |
| 299 | Ga0207695_10000053 | 3300025913 | Bacteria | 396740 |
| 300 | Ga0207695_10024070 | 3300025913 | Bacteria | 6862 |
| 301 | Ga0207695_10114600 | 3300025913 | Bacteria | 2670 |
| 302 | Ga0207671_10002724 | 3300025914 | Bacteria | 18482 |
| 303 | Ga0207671_10003316 | 3300025914 | Bacteria | 16180 |
| 304 | Ga0207671_10003530 | 3300025914 | Bacteria | 15504 |
| 305 | Ga0207671_10003802 | 3300025914 | Bacteria | 14807 |
| 306 | Ga0207671_10006180 | 3300025914 | Bacteria | 10754 |
| 307 | Ga0207671_10007283 | 3300025914 | Bacteria | 9625 |
| 308 | Ga0207657_10131011 | 3300025919 | Bacteria | 2055 |
| 309 | Ga0207649_10000207 | 3300025920 | Bacteria | 49166 |
| 310 | Ga0207652_10007878 | 3300025921 | Bacteria | 8552 |
| 311 | Ga0207681_10015197 | 3300025923 | Bacteria | 4800 |
| 312 | Ga0207650_10000516 | 3300025925 | Bacteria | 31902 |
| 313 | Ga0207650_10002439 | 3300025925 | Bacteria | 12948 |
| 314 | Ga0207644_10006244 | 3300025931 | Bacteria | 7766 |
| 315 | Ga0207690_10000228 | 3300025932 | Bacteria | 41941 |
| 316 | Ga0207706_10000669 | 3300025933 | Bacteria | 36066 |
| 317 | Ga0207706_10024291 | 3300025933 | Bacteria | 5433 |
| 318 | Ga0207686_10005287 | 3300025934 | Bacteria | 6925 |
| 319 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 320 | Ga0207709_10000663 | 3300025935 | Bacteria | 27893 |
| 321 | Ga0207709_10000732 | 3300025935 | Bacteria | 26258 |
| 322 | Ga0207709_10165528 | 3300025935 | Bacteria | 1546 |
| 323 | Ga0207704_10000189 | 3300025938 | Bacteria | 32372 |
| 324 | Ga0207711_10165588 | 3300025941 | Bacteria | 2004 |
| 325 | Ga0207661_10135910 | 3300025944 | Bacteria | 2111 |
| 326 | Ga0207679_10000045 | 3300025945 | Bacteria | 121851 |
| 327 | Ga0207667_10000023 | 3300025949 | Bacteria | 362527 |
| 328 | Ga0207667_10001774 | 3300025949 | Bacteria | 27165 |
| 329 | Ga0207667_10033758 | 3300025949 | Bacteria | 5499 |
| 330 | Ga0207667_10107432 | 3300025949 | Bacteria | 2879 |
| 331 | Ga0207667_10252408 | 3300025949 | Bacteria | 1804 |
| 332 | Ga0207668_10078689 | 3300025972 | Bacteria | 2382 |
| 333 | Ga0207640_10174368 | 3300025981 | Bacteria | 1606 |
| 334 | Ga0207639_10013514 | 3300026041 | Bacteria | 5717 |
| 335 | Ga0207639_10039694 | 3300026041 | Bacteria | 3508 |
| 336 | Ga0207639_10223629 | 3300026041 | Bacteria | 1627 |
| 337 | Ga0207702_10000314 | 3300026078 | Bacteria | 55437 |
| 338 | Ga0207702_10050863 | 3300026078 | Bacteria | 3499 |
| 339 | Ga0207648_10001991 | 3300026089 | Bacteria | 22314 |
| 340 | Ga0207683_10023135 | 3300026121 | Bacteria | 5339 |
| 341 | Ga0207698_10003020 | 3300026142 | Bacteria | 10086 |
| 342 | Ga0209281_1000055 | 3300027111 | Bacteria | 308297 |
| 343 | Ga0209281_1010834 | 3300027111 | Bacteria | 2064 |
| 344 | Ga0207428_10036462 | 3300027907 | Bacteria | 4011 |
| 345 | Ga0207428_10074665 | 3300027907 | Bacteria | 2659 |
| 346 | Ga0268266_10000032 | 3300028379 | Bacteria | 395079 |
| 347 | Ga0307517_10000429 | 3300028786 | Bacteria | 72171 |
| 348 | Ga0307515_10000427 | 3300028794 | Bacteria | 101325 |
| 349 | Ga0307515_10001574 | 3300028794 | Bacteria | 50970 |
| 350 | Ga0307511_10143773 | 3300030521 | Bacteria | 1392 |
| 351 | Ga0316179_1075791 | 3300030734 | Bacteria | 1172 |
| 352 | Ga0316178_1138348 | 3300030735 | Bacteria | 19370 |
| 353 | Ga0307509_10040907 | 3300031507 | Bacteria | 5037 |
| 354 | Ga0307408_100124995 | 3300031548 | Bacteria | 1998 |
| 355 | Ga0307405_10000308 | 3300031731 | Bacteria | 18037 |
| 356 | Ga0307412_10010738 | 3300031911 | Bacteria | 5282 |
| 357 | Ga0307412_10031505 | 3300031911 | Bacteria | 3350 |
| 358 | Ga0307409_100042340 | 3300031995 | Bacteria | 3410 |
| 359 | Ga0307414_10069589 | 3300032004 | Bacteria | 2530 |
| 360 | Ga0307414_10244540 | 3300032004 | Bacteria | 1487 |
| 361 | Ga0307507_10000510 | 3300033179 | Bacteria | 81853 |
| 362 | Ga0307510_10001152 | 3300033180 | Bacteria | 28416 |
| 363 | Ga0307510_10056409 | 3300033180 | Bacteria | 4091 |
| 364 | Ga0395899_0018418 | 3300037312 | Bacteria | 5310 |
| 365 | Ga0395899_0039160 | 3300037312 | Bacteria | 3550 |
| 366 | Ga0395900_0000194 | 3300037418 | Bacteria | 97768 |
| 367 | Ga0395900_0014468 | 3300037418 | Bacteria | 8052 |
| 368 | Ga0395900_0188256 | 3300037418 | Bacteria | 2094 |
| 369 | Ga0395905_0000716 | 3300037471 | Bacteria | 43859 |
| 370 | Ga0395905_0017061 | 3300037471 | Bacteria | 6894 |
| 371 | Ga0395905_0205600 | 3300037471 | Bacteria | 1845 |
| 372 | Ga0395901_0001250 | 3300038443 | Bacteria | 27039 |
| 373 | Ga0395901_0134318 | 3300038443 | Bacteria | 2600 |
| 374 | Ga0436361_0211220 | 3300039447 | Bacteria | 46566 |
| 375 | Ga0436361_0221882 | 3300039447 | Bacteria | 2853 |
| 376 | Ga0436361_0668973 | 3300039447 | Bacteria | 4207 |
| 377 | Ga0436361_0867242 | 3300039447 | Bacteria | 1308 |
| 378 | Ga0436361_0882838 | 3300039447 | Bacteria | 25023 |
| 379 | Ga0436361_0919984 | 3300039447 | Bacteria | 1944 |
| 380 | Ga0436361_0985195 | 3300039447 | Bacteria | 2719 |
| 381 | Ga0436361_1068986 | 3300039447 | Bacteria | 20698 |
| 382 | Ga0436361_1085609 | 3300039447 | Bacteria | 1997 |
| 383 | Ga0439438_001430 | 3300041405 | Bacteria | 10528 |
| 384 | Ga0439438_001450 | 3300041405 | Bacteria | 10450 |
| 385 | Ga0439438_001746 | 3300041405 | Bacteria | 9552 |
| 386 | Ga0439438_009993 | 3300041405 | Bacteria | 3036 |
| 387 | Ga0439438_017054 | 3300041405 | Bacteria | 2099 |
| 388 | Ga0439447_000672 | 3300041407 | Bacteria | 12691 |
| 389 | Ga0439447_002312 | 3300041407 | Bacteria | 6977 |
| 390 | Ga0439447_009750 | 3300041407 | Bacteria | 2890 |
| 391 | Ga0439447_009926 | 3300041407 | Bacteria | 2854 |
| 392 | Ga0439447_023701 | 3300041407 | Bacteria | 1596 |
| 393 | Ga0439466_0017383 | 3300041411 | Bacteria | 2592 |
| 394 | Ga0439466_0042843 | 3300041411 | Bacteria | 1505 |
| 395 | Ga0439466_0059429 | 3300041411 | Bacteria | 1234 |
| 396 | Ga0439448_0021133 | 3300042005 | Bacteria | 2017 |
| 397 | Ga0439432_000242 | 3300042006 | Bacteria | 19606 |
| 398 | Ga0439432_012783 | 3300042006 | Bacteria | 2863 |
| 399 | Ga0439432_065816 | 3300042006 | Bacteria | 1110 |
| 400 | Ga0439451_006645 | 3300042009 | Bacteria | 2363 |
| 401 | Ga0439452_000059 | 3300042010 | Bacteria | 101639 |
| 402 | Ga0439452_001296 | 3300042010 | Bacteria | 10536 |
| 403 | Ga0439452_005686 | 3300042010 | Bacteria | 3989 |
| 404 | Ga0439452_011254 | 3300042010 | Bacteria | 2577 |
| 405 | Ga0439452_014153 | 3300042010 | Bacteria | 2222 |
| 406 | Ga0439456_003923 | 3300042013 | Bacteria | 3022 |
| 407 | Ga0439456_013993 | 3300042013 | Bacteria | 1671 |
| 408 | Ga0439463_000602 | 3300042016 | Bacteria | 9969 |
| 409 | Ga0439463_024929 | 3300042016 | Bacteria | 1499 |
| 410 | Ga0450911_000021 | 3300042115 | Bacteria | 98705 |
| 411 | Ga0450911_001399 | 3300042115 | Bacteria | 5595 |
| 412 | Ga0450922_000392 | 3300042124 | Bacteria | 4691 |
| 413 | Ga0450923_030361 | 3300042125 | Bacteria | 1099 |
| 414 | Ga0450900_006012 | 3300042136 | Bacteria | 1454 |
| 415 | Ga0450902_012779 | 3300042137 | Bacteria | 1347 |
| 416 | Ga0450903_002525 | 3300042138 | Bacteria | 3250 |
| 417 | Ga0450903_003560 | 3300042138 | Bacteria | 2689 |
| 418 | Ga0450904_001682 | 3300042139 | Bacteria | 2953 |
| 419 | Ga0450906_000044 | 3300042145 | Bacteria | 20181 |
| 420 | Ga0450906_008784 | 3300042145 | Bacteria | 1942 |
| 421 | Ga0450907_000302 | 3300042146 | Bacteria | 16536 |
| 422 | Ga0450907_001596 | 3300042146 | Bacteria | 4801 |
| 423 | Ga0439434_0000011 | 3300042435 | Bacteria | 46716 |
| 424 | Ga0439460_0001823 | 3300042461 | Bacteria | 5071 |
| 425 | Ga0439460_0024050 | 3300042461 | Bacteria | 1684 |
| 426 | Ga0466966_0033277 | 3300044684 | Bacteria | 3338 |
| 427 | Ga0466957_0044881 | 3300044842 | Bacteria | 2679 |
| 428 | Ga0466958_0001201 | 3300045836 | Bacteria | 12123 |
| 429 | Ga0495617_000870 | 3300046452 | Bacteria | 14238 |
| 430 | Ga0495617_006912 | 3300046452 | Bacteria | 3961 |
| 431 | Ga0495617_009184 | 3300046452 | Bacteria | 3398 |
| 432 | Ga0495617_031806 | 3300046452 | Bacteria | 1771 |
| 433 | Ga0495617_034104 | 3300046452 | Bacteria | 1707 |
| 434 | Ga0495617_042761 | 3300046452 | Bacteria | 1514 |
| 435 | Ga0495617_070851 | 3300046452 | Bacteria | 1146 |
| 436 | Ga0495627_000472 | 3300046453 | Bacteria | 34403 |
| 437 | Ga0495627_004200 | 3300046453 | Bacteria | 6101 |
| 438 | Ga0495627_006510 | 3300046453 | Bacteria | 4575 |
| 439 | Ga0495627_006823 | 3300046453 | Bacteria | 4440 |
| 440 | Ga0495603_0010705 | 3300046455 | Bacteria | 5562 |
| 441 | Ga0495590_0008435 | 3300046457 | Bacteria | 3935 |
| 442 | Ga0495591_000296 | 3300046458 | Bacteria | 45423 |
| 443 | Ga0495591_000493 | 3300046458 | Bacteria | 31276 |
| 444 | Ga0495591_000566 | 3300046458 | Bacteria | 28402 |
| 445 | Ga0495591_007753 | 3300046458 | Bacteria | 4502 |
| 446 | Ga0495591_010894 | 3300046458 | Bacteria | 3481 |
| 447 | Ga0495591_011921 | 3300046458 | Bacteria | 3264 |
| 448 | Ga0495591_012291 | 3300046458 | Bacteria | 3194 |
| 449 | Ga0495591_025646 | 3300046458 | Bacteria | 1845 |
| 450 | Ga0495591_033584 | 3300046458 | Bacteria | 1517 |
| 451 | Ga0495591_036512 | 3300046458 | Bacteria | 1429 |
| 452 | Ga0495591_037692 | 3300046458 | Bacteria | 1397 |
| 453 | Ga0495591_041142 | 3300046458 | Bacteria | 1313 |
| 454 | Ga0495591_056310 | 3300046458 | Bacteria | 1057 |
| 455 | Ga0495629_0088909 | 3300046459 | Bacteria | 2155 |
| 456 | Ga0495638_0019149 | 3300046460 | Bacteria | 4531 |
| 457 | Ga0495638_0028493 | 3300046460 | Bacteria | 3605 |
| 458 | Ga0495638_0034052 | 3300046460 | Bacteria | 3253 |
| 459 | Ga0495638_0042937 | 3300046460 | Bacteria | 2854 |
| 460 | Ga0495638_0055596 | 3300046460 | Bacteria | 2458 |
| 461 | Ga0495638_0127913 | 3300046460 | Bacteria | 1495 |
| 462 | Ga0495653_0178097 | 3300046463 | Bacteria | 1461 |
| 463 | Ga0495650_0000119 | 3300046471 | Bacteria | 185719 |
| 464 | Ga0495650_0013035 | 3300046471 | Bacteria | 4428 |
| 465 | Ga0495650_0045466 | 3300046471 | Bacteria | 1848 |
| 466 | Ga0495650_0053869 | 3300046471 | Bacteria | 1644 |
| 467 | Ga0495605_0003359 | 3300046474 | Bacteria | 9568 |
| 468 | Ga0495605_0012032 | 3300046474 | Bacteria | 4811 |
| 469 | Ga0495605_0042918 | 3300046474 | Bacteria | 2244 |
| 470 | Ga0495605_0052042 | 3300046474 | Bacteria | 1991 |
| 471 | Ga0495605_0056648 | 3300046474 | Bacteria | 1889 |
| 472 | Ga0495605_0066601 | 3300046474 | Bacteria | 1710 |
| 473 | Ga0495605_0070107 | 3300046474 | Bacteria | 1658 |
| 474 | Ga0495639_0047506 | 3300046475 | Bacteria | 1945 |
| 475 | Ga0495639_0065198 | 3300046475 | Bacteria | 1675 |
| 476 | Ga0495584_0009110 | 3300046491 | Bacteria | 5125 |
| 477 | Ga0495584_0010833 | 3300046491 | Bacteria | 4679 |
| 478 | Ga0495584_0012379 | 3300046491 | Bacteria | 4354 |
| 479 | Ga0495584_0012396 | 3300046491 | Bacteria | 4351 |
| 480 | Ga0495584_0017553 | 3300046491 | Bacteria | 3640 |
| 481 | Ga0495584_0021308 | 3300046491 | Bacteria | 3293 |
| 482 | Ga0495584_0072448 | 3300046491 | Bacteria | 1731 |
| 483 | Ga0495584_0073410 | 3300046491 | Bacteria | 1719 |
| 484 | Ga0495585_0000173 | 3300046492 | Bacteria | 69500 |
| 485 | Ga0495585_0001130 | 3300046492 | Bacteria | 21890 |
| 486 | Ga0495585_0005932 | 3300046492 | Bacteria | 7646 |
| 487 | Ga0495585_0008849 | 3300046492 | Bacteria | 6075 |
| 488 | Ga0495585_0016170 | 3300046492 | Bacteria | 4324 |
| 489 | Ga0495585_0016173 | 3300046492 | Bacteria | 4324 |
| 490 | Ga0495585_0019074 | 3300046492 | Bacteria | 3957 |
| 491 | Ga0495585_0023103 | 3300046492 | Bacteria | 3568 |
| 492 | Ga0495585_0033080 | 3300046492 | Bacteria | 2929 |
| 493 | Ga0495585_0056277 | 3300046492 | Bacteria | 2172 |
| 494 | Ga0495585_0082991 | 3300046492 | Bacteria | 1734 |
| 495 | Ga0495585_0093164 | 3300046492 | Bacteria | 1620 |
| 496 | Ga0495594_0032406 | 3300046499 | Bacteria | 2836 |
| 497 | Ga0495594_0057041 | 3300046499 | Bacteria | 2156 |
| 498 | Ga0495596_0043823 | 3300046500 | Bacteria | 1763 |
| 499 | Ga0495596_0051765 | 3300046500 | Bacteria | 1608 |
| 500 | Ga0495607_0000583 | 3300046501 | Bacteria | 35519 |
| 501 | Ga0495607_0002315 | 3300046501 | Bacteria | 15623 |
| 502 | Ga0495607_0010286 | 3300046501 | Bacteria | 6293 |
| 503 | Ga0495607_0017311 | 3300046501 | Bacteria | 4628 |
| 504 | Ga0495607_0022056 | 3300046501 | Bacteria | 4003 |
| 505 | Ga0495607_0076606 | 3300046501 | Bacteria | 1849 |
| 506 | Ga0495607_0104827 | 3300046501 | Bacteria | 1508 |
| 507 | Ga0495583_0000393 | 3300046506 | Bacteria | 66835 |
| 508 | Ga0495583_0000565 | 3300046506 | Bacteria | 51302 |
| 509 | Ga0495583_0002481 | 3300046506 | Bacteria | 15672 |
| 510 | Ga0495583_0009025 | 3300046506 | Bacteria | 6008 |
| 511 | Ga0495583_0026909 | 3300046506 | Bacteria | 2844 |
| 512 | Ga0495583_0056226 | 3300046506 | Bacteria | 1775 |
| 513 | Ga0495583_0064293 | 3300046506 | Bacteria | 1628 |
| 514 | Ga0495606_0000008 | 3300046507 | Bacteria | 321373 |
| 515 | Ga0495606_0000016 | 3300046507 | Bacteria | 284865 |
| 516 | Ga0495606_0001301 | 3300046507 | Bacteria | 34410 |
| 517 | Ga0495606_0002511 | 3300046507 | Bacteria | 21151 |
| 518 | Ga0495606_0004228 | 3300046507 | Bacteria | 14535 |
| 519 | Ga0495606_0009581 | 3300046507 | Bacteria | 8168 |
| 520 | Ga0495606_0019691 | 3300046507 | Bacteria | 5007 |
| 521 | Ga0495606_0024959 | 3300046507 | Bacteria | 4292 |
| 522 | Ga0495606_0032541 | 3300046507 | Bacteria | 3611 |
| 523 | Ga0495606_0038983 | 3300046507 | Bacteria | 3209 |
| 524 | Ga0495606_0055845 | 3300046507 | Bacteria | 2551 |
| 525 | Ga0495606_0092855 | 3300046507 | Bacteria | 1852 |
| 526 | Ga0495606_0103677 | 3300046507 | Bacteria | 1727 |
| 527 | Ga0495606_0106635 | 3300046507 | Bacteria | 1696 |
| 528 | Ga0495610_0000950 | 3300046512 | Bacteria | 26825 |
| 529 | Ga0495610_0001695 | 3300046512 | Bacteria | 19375 |
| 530 | Ga0495610_0002038 | 3300046512 | Bacteria | 17252 |
| 531 | Ga0495610_0004779 | 3300046512 | Bacteria | 9885 |
| 532 | Ga0495610_0008698 | 3300046512 | Bacteria | 6534 |
| 533 | Ga0495610_0012262 | 3300046512 | Bacteria | 5173 |
| 534 | Ga0495610_0019310 | 3300046512 | Bacteria | 3820 |
| 535 | Ga0495610_0022519 | 3300046512 | Bacteria | 3444 |
| 536 | Ga0495610_0026020 | 3300046512 | Bacteria | 3130 |
| 537 | Ga0495610_0102899 | 3300046512 | Bacteria | 1276 |
| 538 | Ga0495616_0003965 | 3300046513 | Bacteria | 9419 |
| 539 | Ga0495616_0008966 | 3300046513 | Bacteria | 5878 |
| 540 | Ga0495616_0012363 | 3300046513 | Bacteria | 4849 |
| 541 | Ga0495616_0013653 | 3300046513 | Bacteria | 4574 |
| 542 | Ga0495616_0015329 | 3300046513 | Bacteria | 4262 |
| 543 | Ga0495616_0016860 | 3300046513 | Bacteria | 4035 |
| 544 | Ga0495616_0017236 | 3300046513 | Bacteria | 3984 |
| 545 | Ga0495616_0020336 | 3300046513 | Bacteria | 3614 |
| 546 | Ga0495616_0058784 | 3300046513 | Bacteria | 1892 |
| 547 | Ga0495616_0093139 | 3300046513 | Bacteria | 1423 |
| 548 | Ga0495620_0000374 | 3300046515 | Bacteria | 30623 |
| 549 | Ga0495620_0010030 | 3300046515 | Bacteria | 5010 |
| 550 | Ga0495620_0012437 | 3300046515 | Bacteria | 4395 |
| 551 | Ga0495620_0023330 | 3300046515 | Bacteria | 2960 |
| 552 | Ga0495620_0047075 | 3300046515 | Bacteria | 1858 |
| 553 | Ga0495620_0060516 | 3300046515 | Bacteria | 1578 |
| 554 | Ga0495631_0000355 | 3300046518 | Bacteria | 31547 |
| 555 | Ga0495631_0007027 | 3300046518 | Bacteria | 5758 |
| 556 | Ga0495631_0007788 | 3300046518 | Bacteria | 5434 |
| 557 | Ga0495631_0037261 | 3300046518 | Bacteria | 2167 |
| 558 | Ga0495631_0039200 | 3300046518 | Bacteria | 2103 |
| 559 | Ga0495631_0082888 | 3300046518 | Bacteria | 1382 |
| 560 | Ga0495632_0000922 | 3300046519 | Bacteria | 25785 |
| 561 | Ga0495632_0008122 | 3300046519 | Bacteria | 6493 |
| 562 | Ga0495632_0012089 | 3300046519 | Bacteria | 4994 |
| 563 | Ga0495632_0049483 | 3300046519 | Bacteria | 2077 |
| 564 | Ga0495632_0079952 | 3300046519 | Bacteria | 1560 |
| 565 | Ga0495632_0100639 | 3300046519 | Bacteria | 1362 |
| 566 | Ga0495637_0000912 | 3300046520 | Bacteria | 18980 |
| 567 | Ga0495637_0002577 | 3300046520 | Bacteria | 9963 |
| 568 | Ga0495637_0012131 | 3300046520 | Bacteria | 4126 |
| 569 | Ga0495637_0045708 | 3300046520 | Bacteria | 1855 |
| 570 | Ga0495637_0047666 | 3300046520 | Bacteria | 1807 |
| 571 | Ga0495637_0051225 | 3300046520 | Bacteria | 1729 |
| 572 | Ga0495637_0062588 | 3300046520 | Bacteria | 1522 |
| 573 | Ga0495637_0062979 | 3300046520 | Bacteria | 1516 |
| 574 | Ga0495637_0070523 | 3300046520 | Bacteria | 1411 |
| 575 | Ga0495637_0147525 | 3300046520 | Bacteria | 889 |
| 576 | Ga0495643_0042789 | 3300046522 | Bacteria | 2466 |
| 577 | Ga0495643_0136002 | 3300046522 | Bacteria | 1229 |
| 578 | Ga0495643_0140189 | 3300046522 | Bacteria | 1206 |
| 579 | Ga0495644_0040389 | 3300046523 | Bacteria | 1759 |
| 580 | Ga0495644_0048255 | 3300046523 | Bacteria | 1599 |
| 581 | Ga0495644_0099818 | 3300046523 | Bacteria | 1098 |
| 582 | Ga0495648_0003303 | 3300046524 | Bacteria | 14238 |
| 583 | Ga0495648_0010360 | 3300046524 | Bacteria | 7103 |
| 584 | Ga0495648_0020119 | 3300046524 | Bacteria | 4669 |
| 585 | Ga0495648_0022931 | 3300046524 | Bacteria | 4284 |
| 586 | Ga0495648_0045334 | 3300046524 | Bacteria | 2735 |
| 587 | Ga0495648_0055413 | 3300046524 | Bacteria | 2390 |
| 588 | Ga0495648_0057911 | 3300046524 | Bacteria | 2320 |
| 589 | Ga0495648_0062603 | 3300046524 | Bacteria | 2202 |
| 590 | Ga0495648_0091771 | 3300046524 | Bacteria | 1698 |
| 591 | Ga0495648_0095720 | 3300046524 | Bacteria | 1651 |
| 592 | Ga0495648_0104585 | 3300046524 | Bacteria | 1554 |
| 593 | Ga0495648_0143040 | 3300046524 | Bacteria | 1256 |
| 594 | Ga0495648_0199712 | 3300046524 | Bacteria | 1002 |
| 595 | Ga0495666_0087660 | 3300046526 | Bacteria | 1470 |
| 596 | Ga0495642_0000008 | 3300046528 | Bacteria | 162190 |
| 597 | Ga0495642_0000042 | 3300046528 | Bacteria | 75891 |
| 598 | Ga0495654_0000247 | 3300046530 | Bacteria | 50392 |
| 599 | Ga0495654_0002152 | 3300046530 | Bacteria | 12848 |
| 600 | Ga0495654_0004247 | 3300046530 | Bacteria | 8563 |
| 601 | Ga0495654_0009129 | 3300046530 | Bacteria | 5439 |
| 602 | Ga0495654_0019471 | 3300046530 | Bacteria | 3550 |
| 603 | Ga0495654_0021962 | 3300046530 | Bacteria | 3318 |
| 604 | Ga0495654_0022389 | 3300046530 | Bacteria | 3282 |
| 605 | Ga0495654_0026857 | 3300046530 | Bacteria | 2956 |
| 606 | Ga0495654_0060686 | 3300046530 | Bacteria | 1817 |
| 607 | Ga0495654_0085601 | 3300046530 | Bacteria | 1470 |
| 608 | Ga0495654_0122186 | 3300046530 | Bacteria | 1177 |
| 609 | Ga0495609_0007888 | 3300046538 | Bacteria | 5262 |
| 610 | Ga0495609_0015803 | 3300046538 | Bacteria | 3527 |
| 611 | Ga0495609_0023737 | 3300046538 | Bacteria | 2816 |
| 612 | Ga0495609_0042536 | 3300046538 | Bacteria | 2040 |
| 613 | Ga0495609_0074471 | 3300046538 | Bacteria | 1489 |
| 614 | Ga0495609_0081176 | 3300046538 | Bacteria | 1417 |
| 615 | Ga0495597_0013829 | 3300046542 | Bacteria | 3857 |
| 616 | Ga0495597_0023378 | 3300046542 | Bacteria | 2858 |
| 617 | Ga0495597_0032537 | 3300046542 | Bacteria | 2366 |
| 618 | Ga0495597_0038539 | 3300046542 | Bacteria | 2141 |
| 619 | Ga0495597_0045860 | 3300046542 | Bacteria | 1938 |
| 620 | Ga0495622_0006105 | 3300046557 | Bacteria | 5597 |
| 621 | Ga0495622_0023073 | 3300046557 | Bacteria | 2900 |
| 622 | Ga0495622_0027135 | 3300046557 | Bacteria | 2672 |
| 623 | Ga0495622_0037018 | 3300046557 | Bacteria | 2273 |
| 624 | Ga0495633_0000072 | 3300046558 | Bacteria | 131197 |
| 625 | Ga0495633_0012874 | 3300046558 | Bacteria | 4428 |
| 626 | Ga0495633_0019024 | 3300046558 | Bacteria | 3477 |
| 627 | Ga0495633_0030984 | 3300046558 | Bacteria | 2596 |
| 628 | Ga0495633_0077716 | 3300046558 | Bacteria | 1545 |
| 629 | Ga0495656_0017763 | 3300046615 | Bacteria | 2719 |
| 630 | Ga0495668_0000009 | 3300046616 | Bacteria | 492623 |
| 631 | Ga0495611_0000237 | 3300046648 | Bacteria | 38116 |
| 632 | Ga0495611_0106621 | 3300046648 | Bacteria | 1303 |
| 633 | Ga0495611_0155717 | 3300046648 | Bacteria | 1067 |
| 634 | Ga0495625_0000017 | 3300046660 | Bacteria | 299728 |
| 635 | Ga0495625_0000831 | 3300046660 | Bacteria | 42424 |
| 636 | Ga0495625_0001531 | 3300046660 | Bacteria | 27626 |
| 637 | Ga0495625_0004263 | 3300046660 | Bacteria | 13615 |
| 638 | Ga0495625_0004710 | 3300046660 | Bacteria | 12772 |
| 639 | Ga0495625_0014203 | 3300046660 | Bacteria | 6368 |
| 640 | Ga0495625_0019811 | 3300046660 | Bacteria | 5206 |
| 641 | Ga0495625_0041611 | 3300046660 | Bacteria | 3344 |
| 642 | Ga0495625_0064010 | 3300046660 | Bacteria | 2595 |
| 643 | Ga0495625_0065750 | 3300046660 | Bacteria | 2555 |
| 644 | Ga0495625_0075780 | 3300046660 | Bacteria | 2353 |
| 645 | Ga0495625_0081611 | 3300046660 | Bacteria | 2250 |
| 646 | Ga0495625_0121051 | 3300046660 | Bacteria | 1781 |
| 647 | Ga0495625_0138473 | 3300046660 | Bacteria | 1643 |
| 648 | Ga0495625_0147148 | 3300046660 | Bacteria | 1585 |
| 649 | Ga0495625_0201716 | 3300046660 | Bacteria | 1312 |
| 650 | Ga0495625_0266612 | 3300046660 | Bacteria | 1106 |
| 651 | Ga0495659_0016010 | 3300046664 | Bacteria | 2469 |
| 652 | Ga0495659_0051133 | 3300046664 | Bacteria | 1504 |
| 653 | Ga0495661_0000083 | 3300046665 | Bacteria | 116027 |
| 654 | Ga0495661_0004073 | 3300046665 | Bacteria | 10647 |
| 655 | Ga0495661_0007434 | 3300046665 | Bacteria | 7639 |
| 656 | Ga0495661_0035519 | 3300046665 | Bacteria | 3126 |
| 657 | Ga0495661_0046344 | 3300046665 | Bacteria | 2655 |
| 658 | Ga0495661_0062988 | 3300046665 | Bacteria | 2194 |
| 659 | Ga0495661_0078905 | 3300046665 | Bacteria | 1903 |
| 660 | Ga0495661_0080558 | 3300046665 | Bacteria | 1878 |
| 661 | Ga0495661_0085826 | 3300046665 | Bacteria | 1803 |
| 662 | Ga0495661_0091530 | 3300046665 | Bacteria | 1729 |
| 663 | Ga0495661_0116157 | 3300046665 | Bacteria | 1485 |
| 664 | Ga0495661_0125569 | 3300046665 | Bacteria | 1412 |
| 665 | Ga0495588_0041348 | 3300046674 | Bacteria | 2353 |
| 666 | Ga0495588_0045254 | 3300046674 | Bacteria | 2256 |
| 667 | Ga0495588_0111080 | 3300046674 | Bacteria | 1444 |
| 668 | Ga0495588_0175823 | 3300046674 | Bacteria | 1131 |
| 669 | Ga0495646_0022272 | 3300046680 | Bacteria | 3997 |
| 670 | Ga0495658_0018289 | 3300046683 | Bacteria | 3641 |
| 671 | Ga0495669_0073974 | 3300046684 | Bacteria | 1557 |
| 672 | Ga0495613_0026066 | 3300046689 | Bacteria | 4356 |
| 673 | Ga0495624_0000375 | 3300046690 | Bacteria | 35610 |
| 674 | Ga0495670_0006113 | 3300046691 | Bacteria | 5907 |
| 675 | Ga0495670_0013452 | 3300046691 | Bacteria | 4025 |
| 676 | Ga0495670_0018020 | 3300046691 | Bacteria | 3478 |
| 677 | Ga0495670_0054151 | 3300046691 | Bacteria | 2009 |
| 678 | Ga0495670_0077162 | 3300046691 | Bacteria | 1693 |
| 679 | Ga0495670_0093581 | 3300046691 | Bacteria | 1540 |
| 680 | Ga0495670_0143613 | 3300046691 | Bacteria | 1249 |
| 681 | Ga0495671_0000078 | 3300046692 | Bacteria | 93314 |
| 682 | Ga0495671_0005595 | 3300046692 | Bacteria | 7333 |
| 683 | Ga0495671_0015967 | 3300046692 | Bacteria | 4018 |
| 684 | Ga0495671_0024323 | 3300046692 | Bacteria | 3155 |
| 685 | Ga0495671_0033887 | 3300046692 | Bacteria | 2599 |
| 686 | Ga0495671_0042385 | 3300046692 | Bacteria | 2287 |
| 687 | Ga0495671_0063573 | 3300046692 | Bacteria | 1817 |
| 688 | Ga0495671_0073070 | 3300046692 | Bacteria | 1683 |
| 689 | Ga0495671_0075975 | 3300046692 | Bacteria | 1647 |
| 690 | Ga0495671_0122729 | 3300046692 | Bacteria | 1267 |
| 691 | Ga0495649_0000121 | 3300046694 | Bacteria | 68443 |
| 692 | Ga0495649_0008007 | 3300046694 | Bacteria | 6386 |
| 693 | Ga0495649_0014048 | 3300046694 | Bacteria | 4600 |
| 694 | Ga0495649_0014159 | 3300046694 | Bacteria | 4580 |
| 695 | Ga0495649_0016475 | 3300046694 | Bacteria | 4188 |
| 696 | Ga0495649_0019747 | 3300046694 | Bacteria | 3784 |
| 697 | Ga0495649_0029003 | 3300046694 | Bacteria | 3065 |
| 698 | Ga0495649_0054483 | 3300046694 | Bacteria | 2163 |
| 699 | Ga0495649_0069511 | 3300046694 | Bacteria | 1888 |
| 700 | Ga0495649_0133836 | 3300046694 | Bacteria | 1307 |
| 701 | Ga0495589_0001533 | 3300046794 | Bacteria | 13305 |
| 702 | Ga0495589_0003419 | 3300046794 | Bacteria | 8593 |
| 703 | Ga0495589_0008918 | 3300046794 | Bacteria | 5219 |
| 704 | Ga0495589_0013295 | 3300046794 | Bacteria | 4248 |
| 705 | Ga0495589_0072385 | 3300046794 | Bacteria | 1683 |
| 706 | Ga0495589_0085637 | 3300046794 | Bacteria | 1531 |
| 707 | Ga0495660_0002089 | 3300046810 | Bacteria | 12940 |
| 708 | Ga0495660_0016523 | 3300046810 | Bacteria | 4254 |
| 709 | Ga0495660_0016617 | 3300046810 | Bacteria | 4242 |
| 710 | Ga0495660_0022892 | 3300046810 | Bacteria | 3565 |
| 711 | Ga0495660_0027263 | 3300046810 | Bacteria | 3233 |
| 712 | Ga0495660_0064559 | 3300046810 | Bacteria | 1956 |
| 713 | Ga0495660_0131219 | 3300046810 | Bacteria | 1257 |
| 714 | Ga0495604_0046135 | 3300047317 | Bacteria | 3397 |
| 715 | Ga0495636_0040592 | 3300047318 | Bacteria | 1929 |
| 716 | Ga0495672_0000899 | 3300047320 | Bacteria | 31152 |
| 717 | Ga0495672_0003453 | 3300047320 | Bacteria | 13522 |
| 718 | Ga0495672_0009377 | 3300047320 | Bacteria | 7098 |
| 719 | Ga0495672_0023438 | 3300047320 | Bacteria | 3995 |
| 720 | Ga0495672_0024411 | 3300047320 | Bacteria | 3894 |
| 721 | Ga0495672_0065356 | 3300047320 | Bacteria | 2079 |
| 722 | Ga0495672_0066594 | 3300047320 | Bacteria | 2054 |
| 723 | Ga0495672_0104905 | 3300047320 | Bacteria | 1526 |
| 724 | Ga0495672_0123492 | 3300047320 | Bacteria | 1372 |
| 725 | Ga0495676_0023687 | 3300047321 | Bacteria | 5323 |
| 726 | Ga0495680_0002703 | 3300047322 | Bacteria | 17898 |
| 727 | Ga0495683_0001770 | 3300047323 | Bacteria | 13612 |
| 728 | Ga0495683_0001796 | 3300047323 | Bacteria | 13527 |
| 729 | Ga0495683_0016005 | 3300047323 | Bacteria | 3895 |
| 730 | Ga0495683_0041954 | 3300047323 | Bacteria | 2307 |
| 731 | Ga0495683_0067597 | 3300047323 | Bacteria | 1759 |
| 732 | Ga0495683_0118944 | 3300047323 | Bacteria | 1255 |
| 733 | Ga0495687_000902 | 3300047443 | Bacteria | 31106 |
| 734 | Ga0495687_005379 | 3300047443 | Bacteria | 8182 |
| 735 | Ga0495687_020573 | 3300047443 | Bacteria | 3212 |
| 736 | Ga0495677_0006346 | 3300047445 | Bacteria | 4465 |
| 737 | Ga0495679_000877 | 3300047446 | Bacteria | 18861 |
| 738 | Ga0495679_005883 | 3300047446 | Bacteria | 5378 |
| 739 | Ga0495679_010191 | 3300047446 | Bacteria | 3706 |
| 740 | Ga0495679_027145 | 3300047446 | Bacteria | 1893 |
| 741 | Ga0495679_038958 | 3300047446 | Bacteria | 1485 |
| 742 | Ga0495679_041748 | 3300047446 | Bacteria | 1418 |
| 743 | Ga0495673_0001089 | 3300047469 | Bacteria | 23654 |
| 744 | Ga0495673_0003850 | 3300047469 | Bacteria | 9681 |
| 745 | Ga0495673_0025014 | 3300047469 | Bacteria | 2873 |
| 746 | Ga0495673_0025424 | 3300047469 | Bacteria | 2843 |
| 747 | Ga0495673_0030232 | 3300047469 | Bacteria | 2546 |
| 748 | Ga0495673_0042691 | 3300047469 | Bacteria | 2033 |
| 749 | Ga0495673_0047749 | 3300047469 | Bacteria | 1890 |
| 750 | Ga0495681_0000368 | 3300047470 | Bacteria | 35164 |
| 751 | Ga0495681_0013414 | 3300047470 | Bacteria | 4752 |
| 752 | Ga0495681_0018316 | 3300047470 | Bacteria | 3861 |
| 753 | Ga0495681_0024203 | 3300047470 | Bacteria | 3205 |
| 754 | Ga0495681_0030700 | 3300047470 | Bacteria | 2732 |
| 755 | Ga0495681_0055218 | 3300047470 | Bacteria | 1852 |
| 756 | Ga0495681_0061625 | 3300047470 | Bacteria | 1727 |
| 757 | Ga0495681_0093693 | 3300047470 | Bacteria | 1322 |
| 758 | Ga0495684_0111704 | 3300047471 | Bacteria | 2062 |
| 759 | Ga0495686_0001124 | 3300047472 | Bacteria | 31635 |
| 760 | Ga0495686_0003529 | 3300047472 | Bacteria | 13475 |
| 761 | Ga0495686_0008633 | 3300047472 | Bacteria | 7443 |
| 762 | Ga0495686_0017772 | 3300047472 | Bacteria | 4786 |
| 763 | Ga0495686_0050886 | 3300047472 | Bacteria | 2601 |
| 764 | Ga0495686_0141853 | 3300047472 | Bacteria | 1417 |
| 765 | Ga0495593_0047038 | 3300047673 | Bacteria | 2296 |
| 766 | Ga0495602_0002824 | 3300048088 | Bacteria | 17768 |
| 767 | Ga0495626_0002208 | 3300048091 | Bacteria | 13956 |
| 768 | Ga0495626_0002697 | 3300048091 | Bacteria | 11998 |
| 769 | Ga0495626_0005609 | 3300048091 | Bacteria | 7277 |
| 770 | Ga0495626_0010358 | 3300048091 | Bacteria | 4977 |
| 771 | Ga0495626_0011647 | 3300048091 | Bacteria | 4642 |
| 772 | Ga0495626_0017276 | 3300048091 | Bacteria | 3648 |
| 773 | Ga0495626_0019649 | 3300048091 | Bacteria | 3376 |
| 774 | Ga0495626_0024676 | 3300048091 | Bacteria | 2945 |
| 775 | Ga0495626_0032891 | 3300048091 | Bacteria | 2487 |
| 776 | Ga0495626_0112366 | 3300048091 | Bacteria | 1178 |
| 777 | Ga0496107_0333256 | 3300048910 | Bacteria | 1129 |
| 778 | Ga0496110_0084401 | 3300048913 | Bacteria | 2834 |
| 779 | Ga0496112_0043696 | 3300048915 | Bacteria | 4388 |
| 780 | Ga0496115_0000196 | 3300048918 | Bacteria | 56608 |
| 781 | Ga0496115_0199741 | 3300048918 | Bacteria | 1652 |
| 782 | Ga0496116_0000114 | 3300048919 | Bacteria | 174131 |
| 783 | Ga0496116_0002218 | 3300048919 | Bacteria | 20659 |
| 784 | Ga0496116_0017123 | 3300048919 | Bacteria | 5641 |
| 785 | Ga0496116_0097036 | 3300048919 | Bacteria | 1773 |
| 786 | Ga0496116_0111009 | 3300048919 | Bacteria | 1611 |
| 787 | Ga0496117_0000654 | 3300048920 | Bacteria | 55492 |
| 788 | Ga0496117_0001257 | 3300048920 | Bacteria | 37760 |
| 789 | Ga0496117_0007831 | 3300048920 | Bacteria | 10277 |
| 790 | Ga0496117_0011197 | 3300048920 | Bacteria | 8055 |
| 791 | Ga0496117_0040370 | 3300048920 | Bacteria | 3432 |
| 792 | Ga0496117_0115402 | 3300048920 | Bacteria | 1662 |
| 793 | Ga0496117_0133402 | 3300048920 | Bacteria | 1500 |
| 794 | Ga0496117_0180858 | 3300048920 | Bacteria | 1212 |
| 795 | Ga0496118_0026967 | 3300048921 | Bacteria | 4875 |
| 796 | Ga0496118_0029390 | 3300048921 | Bacteria | 4609 |
| 797 | Ga0496118_0045743 | 3300048921 | Bacteria | 3412 |
| 798 | Ga0496118_0056650 | 3300048921 | Bacteria | 2944 |
| 799 | Ga0496118_0073983 | 3300048921 | Bacteria | 2437 |
| 800 | Ga0496118_0118987 | 3300048921 | Bacteria | 1728 |
| 801 | Ga0496119_0007077 | 3300048922 | Bacteria | 10203 |
| 802 | Ga0496119_0024521 | 3300048922 | Bacteria | 4240 |
| 803 | Ga0496119_0085653 | 3300048922 | Bacteria | 1803 |
| 804 | Ga0496120_0005052 | 3300048923 | Bacteria | 10696 |
| 805 | Ga0496120_0023266 | 3300048923 | Bacteria | 3880 |
| 806 | Ga0496120_0130690 | 3300048923 | Bacteria | 1286 |
| 807 | Ga0496121_0000286 | 3300048924 | Bacteria | 104838 |
| 808 | Ga0496121_0027827 | 3300048924 | Bacteria | 5279 |
| 809 | Ga0496121_0157549 | 3300048924 | Bacteria | 1664 |
| 810 | Ga0496121_0170770 | 3300048924 | Bacteria | 1580 |
| 811 | Ga0496122_0004747 | 3300048925 | Bacteria | 16654 |
| 812 | Ga0496122_0006189 | 3300048925 | Bacteria | 13889 |
| 813 | Ga0496122_0037766 | 3300048925 | Bacteria | 3881 |
| 814 | Ga0496122_0157104 | 3300048925 | Bacteria | 1393 |
| 815 | Ga0496122_0185700 | 3300048925 | Bacteria | 1233 |
| 816 | Ga0496123_0000709 | 3300048926 | Bacteria | 54590 |
| 817 | Ga0496123_0002397 | 3300048926 | Bacteria | 23427 |
| 818 | Ga0496123_0022339 | 3300048926 | Bacteria | 4879 |
| 819 | Ga0496123_0024318 | 3300048926 | Bacteria | 4607 |
| 820 | Ga0496123_0026470 | 3300048926 | Bacteria | 4342 |
| 821 | Ga0496123_0052966 | 3300048926 | Bacteria | 2686 |
| 822 | Ga0496123_0162170 | 3300048926 | Bacteria | 1190 |
| 823 | Ga0496124_0003392 | 3300048927 | Bacteria | 19563 |
| 824 | Ga0496124_0024765 | 3300048927 | Bacteria | 5448 |
| 825 | Ga0496124_0050291 | 3300048927 | Bacteria | 3552 |
| 826 | Ga0496124_0067215 | 3300048927 | Bacteria | 2983 |
| 827 | Ga0496124_0125675 | 3300048927 | Bacteria | 2043 |
| 828 | Ga0496124_0166370 | 3300048927 | Bacteria | 1713 |
| 829 | Ga0496125_0000266 | 3300048928 | Bacteria | 107204 |
| 830 | Ga0496125_0002439 | 3300048928 | Bacteria | 24162 |
| 831 | Ga0496125_0007844 | 3300048928 | Bacteria | 11282 |
| 832 | Ga0496125_0007972 | 3300048928 | Bacteria | 11185 |
| 833 | Ga0496125_0011480 | 3300048928 | Bacteria | 8854 |
| 834 | Ga0496125_0016074 | 3300048928 | Bacteria | 7203 |
| 835 | Ga0496125_0016812 | 3300048928 | Bacteria | 7012 |
| 836 | Ga0496125_0054788 | 3300048928 | Bacteria | 3256 |
| 837 | Ga0496125_0138126 | 3300048928 | Bacteria | 1700 |
| 838 | Ga0496125_0144959 | 3300048928 | Bacteria | 1643 |
| 839 | Ga0496125_0155748 | 3300048928 | Bacteria | 1561 |
| 840 | Ga0496126_0015231 | 3300048929 | Bacteria | 7741 |
| 841 | Ga0496126_0046630 | 3300048929 | Bacteria | 3972 |
| 842 | Ga0496126_0174490 | 3300048929 | Bacteria | 1829 |
| 843 | Ga0495678_000453 | 3300049459 | Bacteria | 40691 |
| 844 | Ga0495678_007247 | 3300049459 | Bacteria | 5776 |
| 845 | Ga0495678_008194 | 3300049459 | Bacteria | 5304 |
| 846 | Ga0495678_008230 | 3300049459 | Bacteria | 5289 |
| 847 | Ga0495678_040218 | 3300049459 | Bacteria | 1881 |
| 848 | Ga0495678_046394 | 3300049459 | Bacteria | 1708 |
| 849 | Ga0495678_082199 | 3300049459 | Bacteria | 1153 |
| 850 | Ga0495682_0004703 | 3300049460 | Bacteria | 5779 |
| 851 | Ga0495682_0005360 | 3300049460 | Bacteria | 5338 |
| 852 | Ga0495682_0007775 | 3300049460 | Bacteria | 4246 |
| 853 | Ga0495682_0015513 | 3300049460 | Bacteria | 2886 |
| 854 | Ga0495682_0016621 | 3300049460 | Bacteria | 2784 |
| 855 | Ga0495682_0031696 | 3300049460 | Bacteria | 1953 |
| 856 | nmdc:mga0k408_1786_c1 | 3300050493 | Bacteria | 11530 |
| 857 | nmdc:mga0k408_296_c1 | 3300050493 | Bacteria | 27045 |
| 858 | nmdc:mga08x19_220535_c1 | 3300050514 | Bacteria | 1303 |
| 859 | Ga0500641_0000076 | 3300053096 | Bacteria | 40059 |
| 860 | Ga0500572_019674 | 3300053111 | Bacteria | 1766 |
| 861 | Ga0500592_001686 | 3300053116 | Bacteria | 3580 |
| 862 | Ga0500608_002735 | 3300053122 | Bacteria | 6488 |
| 863 | Ga0500608_005577 | 3300053122 | Bacteria | 5021 |
| 864 | Ga0500618_000040 | 3300053125 | Bacteria | 112548 |
| 865 | Ga0500621_078893 | 3300053126 | Bacteria | 1321 |
| 866 | Ga0500642_0047750 | 3300053130 | Bacteria | 1877 |
| 867 | Ga0500564_053743 | 3300053138 | Bacteria | 1839 |
| 868 | Ga0500622_0035466 | 3300053156 | Bacteria | 2610 |
| 869 | Ga0500622_0071357 | 3300053156 | Bacteria | 1755 |
| 870 | Ga0500624_000837 | 3300053157 | Bacteria | 6970 |
| 871 | Ga0500634_0001078 | 3300053161 | Bacteria | 10072 |
| 872 | 2511248938 | 2511231003 | Bacteria | 5606035 |
| 873 | 2511254223 | 2511231004 | Bacteria | 6669789 |
| 874 | 2511267397 | 2511231006 | Bacteria | 6794709 |
| 875 | 2511278382 | 2511231008 | Bacteria | 6624100 |
| 876 | 2511292631 | 2511231010 | Bacteria | 6373152 |
| 877 | 2511298100 | 2511231011 | Bacteria | 6149768 |
| 878 | 2511300983 | 2511231012 | Bacteria | 6738011 |
| 879 | 2511314304 | 2511231014 | Bacteria | 6462302 |
| 880 | 2511318950 | 2511231015 | Bacteria | 6598026 |
| 881 | 2511324440 | 2511231016 | Bacteria | 6704427 |
| 882 | 2511330273 | 2511231017 | Bacteria | 6503007 |
| 883 | 2511350826 | 2511231020 | Bacteria | 6115223 |
| 884 | 2511367826 | 2511231023 | Bacteria | 6808468 |
| 885 | 2511415490 | 2511231031 | Bacteria | 6558529 |
| 886 | 2512325432 | 2512047018 | Bacteria | 6663241 |
| 887 | 2547501632 | 2547132130 | Bacteria | 4660562 |
| 888 | 2555670692 | 2554235341 | Bacteria | 6867980 |
| 889 | 2583793220 | 2582580891 | Bacteria | 6800976 |
| 890 | 2597864307 | 2597489888 | Bacteria | 6179543 |
| 891 | 2597869532 | 2597489889 | Bacteria | 6297495 |
| 892 | 2599357757 | 2599185160 | Bacteria | 6844013 |
| 893 | 2599358630 | 2599185161 | Bacteria | 6960462 |
| 894 | 2599365849 | 2599185162 | Bacteria | 6957254 |
| 895 | 2599371273 | 2599185163 | Bacteria | 6995158 |
| 896 | 2599382528 | 2599185164 | Bacteria | 6841688 |
| 897 | 2599388975 | 2599185165 | Bacteria | 6843250 |
| 898 | 2599390182 | 2599185166 | Bacteria | 6959206 |
| 899 | 2599401944 | 2599185167 | Bacteria | 6353609 |
| 900 | 2599402316 | 2599185168 | Bacteria | 6997636 |
| 901 | 2599453864 | 2599185179 | Bacteria | 6611171 |
| 902 | 2599463755 | 2599185181 | Bacteria | 6844519 |
| 903 | 2599471560 | 2599185182 | Bacteria | 6883168 |
| 904 | 2599476629 | 2599185184 | Bacteria | 6430550 |
| 905 | 2599492774 | 2599185186 | Bacteria | 6831633 |
| 906 | 2599510035 | 2599185189 | Bacteria | 5862825 |
| 907 | 2599515438 | 2599185190 | Bacteria | 6285678 |
| 908 | 2599521456 | 2599185191 | Bacteria | 6297582 |
| 909 | 2599881069 | 2599185288 | Bacteria | 6666191 |
| 910 | 2599884209 | 2599185289 | Bacteria | 6778765 |
| 911 | 2599894817 | 2599185290 | Bacteria | 6289611 |
| 912 | 2599899214 | 2599185291 | Bacteria | 6775623 |
| 913 | 2599949648 | 2599185303 | Bacteria | 6512725 |
| 914 | 2599958650 | 2599185305 | Bacteria | 6748700 |
| 915 | 2599994640 | 2599185311 | Bacteria | 6354990 |
| 916 | 2600003486 | 2599185313 | Bacteria | 6658188 |
| 917 | 2600018063 | 2599185315 | Bacteria | 6771107 |
| 918 | 2600022748 | 2599185316 | Bacteria | 6320029 |
| 919 | 2600042192 | 2599185319 | Bacteria | 6637840 |
| 920 | 2600052582 | 2599185321 | Bacteria | 6764560 |
| 921 | 2600064850 | 2599185323 | Bacteria | 6688755 |
| 922 | 2600069490 | 2599185324 | Bacteria | 6590677 |
| 923 | 2600076116 | 2599185325 | Bacteria | 6324919 |
| 924 | 2600216887 | 2599185356 | Bacteria | 6843884 |
| 925 | 2601691627 | 2600255296 | Bacteria | 5784754 |
| 926 | 2601777058 | 2600255313 | Bacteria | 6842543 |
| 927 | 2601798720 | 2600255318 | Bacteria | 6383414 |
| 928 | 2606077614 | 2603880185 | Bacteria | 6379190 |
| 929 | 2606130211 | 2603880199 | Bacteria | 6377649 |
| 930 | 2621300173 | 2619619299 | Bacteria | 6649820 |
| 931 | 2624481115 | 2623620443 | Bacteria | 6427864 |
| 932 | 2643871039 | 2643221571 | Bacteria | 6228673 |
| 933 | 2643954168 | 2643221589 | Bacteria | 6250934 |
| 934 | 2644022977 | 2643221602 | Bacteria | 6249926 |
| 935 | 2644185744 | 2643221633 | Bacteria | 6733554 |
| 936 | 2644622470 | 2643221713 | Bacteria | 6554480 |
| 937 | 2671091356 | 2667528170 | Bacteria | 6786960 |
| 938 | 2671096195 | 2667528171 | Bacteria | 6900659 |
| 939 | 2677901137 | 2675903420 | Bacteria | 6247433 |
| 940 | 2715750636 | 2713897148 | Bacteria | 5883533 |
| 941 | 2715757168 | 2713897149 | Bacteria | 6506249 |
| 942 | 2723248452 | 2721755607 | Bacteria | 5841722 |
| 943 | 2738675130 | 2738541265 | Bacteria | 6594665 |
| 944 | 2738753420 | 2738541282 | Bacteria | 6593925 |
| 945 | 2738810512 | 2738541294 | Bacteria | 6925949 |
| 946 | 2738862332 | 2738541303 | Bacteria | 6591772 |
| 947 | 2738897872 | 2738541309 | Bacteria | 6926455 |
| 948 | 2739257026 | 2738543015 | Bacteria | 6750701 |
| 949 | 2739313142 | 2738543025 | Bacteria | 6600348 |
| 950 | 2743738345 | 2740892503 | Bacteria | 6855563 |
| 951 | 2774120199 | 2773857670 | Bacteria | 6407454 |
| 952 | 2774134088 | 2773857673 | Bacteria | 6513460 |
| 953 | 2784264145 | 2784132063 | Bacteria | 6262788 |
| 954 | 2784311870 | 2784132072 | Bacteria | 6596533 |
| 955 | 2808932828 | 2808606377 | Bacteria | 6646337 |
| 956 | 2808954950 | 2808606381 | Bacteria | 6646461 |
| 957 | 2808978517 | 2808606385 | Bacteria | 6711065 |
| 958 | 2808993956 | 2808606388 | Bacteria | 6706662 |
| 959 | 2809215133 | 2808606445 | Bacteria | 6057339 |
| 960 | 2816518412 | 2816332141 | Bacteria | 4436036 |
| 961 | 2817491519 | 2816332298 | Bacteria | 6852809 |
| 962 | 2819658021 | 2818991456 | Bacteria | 6123676 |
| 963 | 2819700371 | 2818991464 | Bacteria | 6907494 |
| 964 | 2834033412 | 2834028612 | Bacteria | 6354979 |
| 965 | 2842394479 | 2842391507 | Bacteria | 4486072 |
| 966 | 2842827264 | 2842826826 | Bacteria | 5974129 |
| 967 | 2842835079 | 2842832357 | Bacteria | 5959113 |
| 968 | 2842841680 | 2842837860 | Bacteria | 6066181 |
| 969 | 2842846816 | 2842843487 | Bacteria | 6004777 |
| 970 | 2844671302 | 2844665904 | Bacteria | 6817974 |
| 971 | 2852617453 | 2852612431 | Bacteria | 6885235 |
| 972 | 2852625156 | 2852623160 | Bacteria | 4376875 |
| 973 | 2852657770 | 2852657418 | Bacteria | 6472974 |
| 974 | 2852672428 | 2852667396 | Bacteria | 6885555 |
| 975 | 2860870392 | 2860867994 | Bacteria | 5645326 |
| 976 | 2878033053 | 2878029506 | Bacteria | 6418441 |
| 977 | 2880233775 | 2880230671 | Bacteria | 6140320 |
| 978 | 2884934171 | 2884933994 | Bacteria | 4535041 |
| 979 | 2904523914 | 2904518522 | Bacteria | 6068986 |
| 980 | 2904552001 | 2904550169 | Bacteria | 6221258 |
| 981 | 2908450144 | 2908446538 | Bacteria | 6829095 |
| 982 | 2912967191 | 2912963787 | Bacteria | 5646108 |
| 983 | 2917074525 | 2917070673 | Bacteria | 6868303 |
| 984 | 2919067202 | 2919063839 | Bacteria | 6302690 |
| 985 | 2919137027 | 2919134579 | Bacteria | 4480386 |
| 986 | 2919390177 | 2919385768 | Bacteria | 5897293 |
| 987 | 2919442719 | 2919437846 | Bacteria | 6199444 |
| 988 | 2919460484 | 2919456309 | Bacteria | 6586567 |
| 989 | 2919489327 | 2919487758 | Bacteria | 5929766 |
| 990 | 2923157400 | 2923153595 | Bacteria | 6870622 |
| 991 | 2928078578 | 2928078545 | Bacteria | 6534839 |
| 992 | 2928151745 | 2928147474 | Bacteria | 6512076 |
| 993 | 2929192228 | 2929189879 | Bacteria | 5930554 |
| 994 | 2931370221 | 2931369376 | Bacteria | 6847892 |
| 995 | 2931394328 | 2931390751 | Bacteria | 6273349 |
| 996 | 2932084360 | 2932082852 | Bacteria | 6563563 |
| 997 | 2935355413 | 2935353572 | Unclassified | 6955622 |
| 998 | 2939642648 | 2939636861 | Bacteria | 6297853 |
| 999 | 2945933852 | 2945928738 | Bacteria | 6053221 |
| 1000 | 2945964245 | 2945961074 | Bacteria | 7342064 |
| 1001 | 2946030645 | 2946027586 | Bacteria | 6049274 |
| 1002 | 2947237451 | 2947233263 | Bacteria | 6439278 |
| 1003 | 2961064846 | 2961064222 | Bacteria | 4749990 |
| 1004 | 2969307959 | 2969304461 | Bacteria | 6601805 |
| 1005 | 2971404873 | 2971403814 | Bacteria | 7370929 |
| 1006 | 2984288735 | 2984286254 | Bacteria | 6702062 |
| 1007 | 2998142457 | 2998139840 | Bacteria | 6073514 |
| 1008 | 3007513945 | 3007511990 | Bacteria | 6481491 |
| 1009 | 3007616812 | 3007614139 | Bacteria | 6053559 |
| 1010 | 3007724260 | 3007718800 | Bacteria | 5971527 |
| 1011 | 3007856620 | 3007855910 | Bacteria | 5637581 |
| 1012 | 3007861627 | 3007861166 | Bacteria | 6045338 |
| 1013 | 637321042 | 637000220 | Bacteria | 7074893 |
| 1014 | 8015691554 | 8015687852 | Bacteria | 6613826 |
| 1015 | 8029998239 | 8029995093 | Bacteria | 5990776 |
| 1016 | 8054290704 | 8054285046 | Bacteria | 6919322 |
| 1017 | 8054347960 | 8054347763 | Bacteria | 5901107 |
| 1018 | 8054505823 | 8054503363 | Bacteria | 6101651 |
| 1019 | 8055774761 | 8055770955 | Bacteria | 6827675 |
| 1020 | 8055820457 | 8055817908 | Bacteria | 6609162 |
| 1021 | 8056128530 | 8056125926 | Bacteria | 6228218 |
| 1022 | 8056135075 | 8056131705 | Bacteria | 6107031 |
| 1023 | 8056149840 | 8056148874 | Bacteria | 6479865 |
| 1024 | 8056159169 | 8056155041 | Bacteria | 6486948 |
| 1025 | 8056166462 | 8056161164 | Bacteria | 6106669 |
| 1026 | 8056168623 | 8056166840 | Bacteria | 5820959 |
| 1027 | 8056173991 | 8056172158 | Bacteria | 6133900 |
| 1028 | 8056177880 | 8056177738 | Bacteria | 6748268 |
| 1029 | 8056571278 | 8056569372 | Bacteria | 5997322 |
| 1030 | Ga0495679_000404 | |||
| 1031 | MRS2a_Contig_103 | |||
| 1032 | JGI24736J21556_1005902 | |||
| 1033 | JGI24737J22298_10000796 | |||
| 1034 | JGI24737J22298_10007923 | |||
| 1035 | JGI24735J21928_10000008 | |||
| 1036 | JGI25155J39150_1000126 | |||
| 1037 | JGI25156J39149_1009124 | |||
| 1038 | JGI25162J39368_1000013 | |||
| 1039 | JGI25162J39368_1000047 | |||
| 1040 | JGI25162J39368_1000135 | |||
| 1041 | JGI25162J39368_1000183 | |||
| 1042 | JGI25162J39368_1001813 | |||
| 1043 | JGI25154J39366_1000206 | |||
| 1044 | JGI25163J39215_1000183 | |||
| 1045 | JGI25163J39215_1000226 | |||
| 1046 | JGI25163J39215_1000268 | |||
| 1047 | JGI25164J39214_1000005 | |||
| 1048 | JGI25164J39214_1000103 | |||
| 1049 | JGI25165J46597_1000099 | |||
| 1050 | JGI25165J46597_1000214 | |||
| 1051 | rootH2_10013605 | |||
| 1052 | rootH2_10017421 | |||
| 1053 | rootH2_10117289 | |||
| 1054 | rootH2_10313513 | |||
| 1055 | rootL2_10104135 | |||
| 1056 | rootH1_10032017 | |||
| 1057 | rootH1_10193823 | |||
| 1058 | Ga0055538_1000075 | |||
| 1059 | Ga0055539_1000113 | |||
| 1060 | Ga0055533_1000120 | |||
| 1061 | Ga0055532_1000107 | |||
| 1062 | Ga0055525_1000158 | |||
| 1063 | Ga0055535_1007312 | |||
| 1064 | Ga0055536_1000021 | |||
| 1065 | Ga0055536_1000190 | |||
| 1066 | Ga0055530_10000002 | |||
| 1067 | Ga0055530_10000006 | |||
| 1068 | Ga0055530_10005998 | |||
| 1069 | Ga0055530_10035830 | |||
| 1070 | Ga0055540_1000009 | |||
| 1071 | Ga0055540_1000051 | |||
| 1072 | Ga0055540_1000490 | |||
| 1073 | Ga0055531_10000070 | |||
| 1074 | Ga0055541_1000076 | |||
| 1075 | Ga0065714_10000204 | |||
| 1076 | Ga0065714_10007643 | |||
| 1077 | Ga0065714_10008799 | |||
| 1078 | Ga0065714_10009693 | |||
| 1079 | Ga0065714_10064666 | |||
| 1080 | Ga0065714_10084335 | |||
| 1081 | Ga0065714_10145193 | |||
| 1082 | Ga0065712_10077106 | |||
| 1083 | Ga0065712_10083103 | |||
| 1084 | Ga0065715_10312309 | |||
| 1085 | Ga0070658_10000014 | |||
| 1086 | Ga0070658_10042733 | |||
| 1087 | Ga0070658_10111772 | |||
| 1088 | Ga0070658_10319766 | |||
| 1089 | Ga0070676_10024076 | |||
| 1090 | Ga0070670_100002833 | |||
| 1091 | Ga0070670_100003592 | |||
| 1092 | Ga0070680_100113689 | |||
| 1093 | Ga0070682_100140189 | |||
| 1094 | Ga0068868_100033977 | |||
| 1095 | Ga0068868_100174672 | |||
| 1096 | Ga0070660_100109575 | |||
| 1097 | Ga0070660_100244652 | |||
| 1098 | Ga0070661_100000025 | |||
| 1099 | Ga0070669_100001350 | |||
| 1100 | Ga0070669_100011648 | |||
| 1101 | Ga0070671_100005292 | |||
| 1102 | Ga0070659_100000148 | |||
| 1103 | Ga0070678_100000566 | |||
| 1104 | Ga0070662_100000054 | |||
| 1105 | Ga0070662_100012024 | |||
| 1106 | Ga0070681_10063938 | |||
| 1107 | Ga0068867_100009805 | |||
| 1108 | Ga0070679_100010692 | |||
| 1109 | Ga0070679_100087045 | |||
| 1110 | Ga0070684_100154977 | |||
| 1111 | Ga0068853_100031762 | |||
| 1112 | Ga0070665_100000010 | |||
| 1113 | Ga0070665_100082756 | |||
| 1114 | Ga0068855_100033283 | |||
| 1115 | Ga0068855_100125751 | |||
| 1116 | Ga0068855_100264905 | |||
| 1117 | Ga0068855_100538583 | |||
| 1118 | Ga0070664_100000019 | |||
| 1119 | Ga0068854_100271770 | |||
| 1120 | Ga0068854_100292771 | |||
| 1121 | Ga0068856_100000023 | |||
| 1122 | Ga0068856_100005294 | |||
| 1123 | Ga0068852_100004334 | |||
| 1124 | Ga0068866_10050089 | |||
| 1125 | Ga0068861_100151749 | |||
| 1126 | Ga0068851_10000374 | |||
| 1127 | Ga0075364_10107354 | |||
| 1128 | Ga0075366_10000507 | |||
| 1129 | Ga0075366_10001582 | |||
| 1130 | Ga0097621_100000247 | |||
| 1131 | Ga0068871_100003906 | |||
| 1132 | Ga0068865_100000076 | |||
| 1133 | Ga0075436_100254380 | |||
| 1134 | Ga0079104_1000081 | |||
| 1135 | Ga0079104_1012017 | |||
| 1136 | Ga0105251_10001274 | |||
| 1137 | Ga0105251_10004867 | |||
| 1138 | Ga0105251_10012899 | |||
| 1139 | Ga0105251_10023891 | |||
| 1140 | Ga0105251_10035947 | |||
| 1141 | Ga0105244_10001220 | |||
| 1142 | Ga0105244_10002515 | |||
| 1143 | Ga0105244_10002808 | |||
| 1144 | Ga0105244_10027155 | |||
| 1145 | Ga0105244_10035204 | |||
| 1146 | Ga0105244_10093060 | |||
| 1147 | Ga0105250_10000087 | |||
| 1148 | Ga0105250_10000267 | |||
| 1149 | Ga0105250_10002218 | |||
| 1150 | Ga0105250_10084611 | |||
| 1151 | Ga0105240_10000173 | |||
| 1152 | Ga0105240_10048462 | |||
| 1153 | Ga0105240_10065366 | |||
| 1154 | Ga0105240_10237399 | |||
| 1155 | Ga0105243_10000067 | |||
| 1156 | Ga0105243_10000337 | |||
| 1157 | Ga0105243_10008683 | |||
| 1158 | Ga0105243_10050347 | |||
| 1159 | Ga0105241_10001338 | |||
| 1160 | Ga0105241_10021419 | |||
| 1161 | Ga0105242_10002307 | |||
| 1162 | Ga0105242_10003180 | |||
| 1163 | Ga0105242_10401789 | |||
| 1164 | Ga0105237_10002438 | |||
| 1165 | Ga0105237_10002957 | |||
| 1166 | Ga0105237_10006614 | |||
| 1167 | Ga0105237_10008782 | |||
| 1168 | Ga0105237_10015332 | |||
| 1169 | Ga0105239_10000816 | |||
| 1170 | Ga0105239_10003173 | |||
| 1171 | Ga0105239_10017987 | |||
| 1172 | Ga0105239_10047642 | |||
| 1173 | Ga0105239_10086933 | |||
| 1174 | Ga0105239_10110143 | |||
| 1175 | Ga0105239_10194163 | |||
| 1176 | Ga0105246_10000469 | |||
| 1177 | Ga0105246_10000586 | |||
| 1178 | Ga0105246_10021731 | |||
| 1179 | Ga0105246_10021760 | |||
| 1180 | Ga0157345_1000289 | |||
| 1181 | Ga0157373_10000284 | |||
| 1182 | Ga0157373_10000746 | |||
| 1183 | Ga0157373_10003109 | |||
| 1184 | Ga0157373_10009443 | |||
| 1185 | Ga0157373_10016882 | |||
| 1186 | Ga0157373_10026359 | |||
| 1187 | Ga0157373_10039620 | |||
| 1188 | Ga0157373_10040884 | |||
| 1189 | Ga0157373_10053258 | |||
| 1190 | Ga0157373_10240657 | |||
| 1191 | Ga0157371_10000298 | |||
| 1192 | Ga0157371_10000308 | |||
| 1193 | Ga0157370_10024460 | |||
| 1194 | Ga0157370_10028024 | |||
| 1195 | Ga0157370_10108148 | |||
| 1196 | Ga0157369_10001344 | |||
| 1197 | Ga0157369_10003664 | |||
| 1198 | Ga0157369_10004545 | |||
| 1199 | Ga0157369_10007394 | |||
| 1200 | Ga0157369_10035679 | |||
| 1201 | Ga0157369_10095042 | |||
| 1202 | Ga0157374_10001476 | |||
| 1203 | Ga0157374_10002139 | |||
| 1204 | Ga0157374_10005179 | |||
| 1205 | Ga0163162_10000075 | |||
| 1206 | Ga0163162_10000082 | |||
| 1207 | Ga0163162_10007367 | |||
| 1208 | Ga0163162_10071839 | |||
| 1209 | Ga0163162_10176704 | |||
| 1210 | Ga0163162_10360378 | |||
| 1211 | Ga0157372_10000071 | |||
| 1212 | Ga0157372_10002043 | |||
| 1213 | Ga0157372_10005233 | |||
| 1214 | Ga0157372_10022369 | |||
| 1215 | Ga0157372_10139570 | |||
| 1216 | Ga0157375_10000312 | |||
| 1217 | Ga0157375_10004026 | |||
| 1218 | Ga0157375_10062535 | |||
| 1219 | Ga0157375_10118484 | |||
| 1220 | Ga0182008_10002137 | |||
| 1221 | Ga0182008_10002346 | |||
| 1222 | Ga0182008_10005700 | |||
| 1223 | Ga0182008_10012243 | |||
| 1224 | Ga0182008_10051361 | |||
| 1225 | Ga0182008_10064865 | |||
| 1226 | Ga0157376_10079089 | |||
| 1227 | Ga0182006_1000794 | |||
| 1228 | Ga0182006_1004990 | |||
| 1229 | Ga0182006_1006185 | |||
| 1230 | Ga0182006_1036177 | |||
| 1231 | Ga0182006_1045074 | |||
| 1232 | Ga0182006_1087605 | |||
| 1233 | Ga0182007_10001805 | |||
| 1234 | Ga0182007_10040970 | |||
| 1235 | Ga0182005_1005881 | |||
| 1236 | Ga0182005_1027507 | |||
| 1237 | Ga0182005_1027733 | |||
| 1238 | Ga0163161_10000167 | |||
| 1239 | Ga0163161_10001360 | |||
| 1240 | Ga0163161_10025013 | |||
| 1241 | Ga0163161_10026293 | |||
| 1242 | Ga0163161_10026513 | |||
| 1243 | Ga0163161_10028075 | |||
| 1244 | Ga0163161_10045106 | |||
| 1245 | Ga0163161_10062320 | |||
| 1246 | Ga0163161_10129330 | |||
| 1247 | Ga0213872_10000597 | |||
| 1248 | Ga0213872_10001019 | |||
| 1249 | Ga0213872_10002575 | |||
| 1250 | Ga0213872_10016991 | |||
| 1251 | Ga0213872_10024639 | |||
| 1252 | Ga0213872_10031662 | |||
| 1253 | Ga0213872_10035629 | |||
| 1254 | Ga0213872_10038438 | |||
| 1255 | Ga0209435_100201 | |||
| 1256 | Ga0209435_101268 | |||
| 1257 | Ga0209760_100035 | |||
| 1258 | Ga0209760_100923 | |||
| 1259 | Ga0209784_100113 | |||
| 1260 | Ga0209566_100138 | |||
| 1261 | Ga0209674_100158 | |||
| 1262 | Ga0209672_101444 | |||
| 1263 | Ga0209147_100167 | |||
| 1264 | Ga0209563_100134 | |||
| 1265 | Ga0209563_100887 | |||
| 1266 | Ga0207427_100015 | |||
| 1267 | Ga0207427_100018 | |||
| 1268 | Ga0209437_100027 | |||
| 1269 | Ga0209437_100031 | |||
| 1270 | Ga0209437_100089 | |||
| 1271 | Ga0209258_101107 | |||
| 1272 | Ga0209646_1000093 | |||
| 1273 | Ga0209646_1002448 | |||
| 1274 | Ga0209026_1000537 | |||
| 1275 | Ga0209026_1002474 | |||
| 1276 | Ga0209026_1004259 | |||
| 1277 | Ga0209026_1006723 | |||
| 1278 | Ga0209677_100104 | |||
| 1279 | Ga0209759_1000248 | |||
| 1280 | Ga0209129_1013944 | |||
| 1281 | Ga0209233_1000012 | |||
| 1282 | Ga0209233_1000039 | |||
| 1283 | Ga0209233_1001941 | |||
| 1284 | Ga0209675_1007568 | |||
| 1285 | Ga0209676_1000002 | |||
| 1286 | Ga0209676_1000017 | |||
| 1287 | Ga0209676_1001754 | |||
| 1288 | Ga0209676_1027203 | |||
| 1289 | Ga0209050_1000006 | |||
| 1290 | Ga0209050_1000009 | |||
| 1291 | Ga0209050_1000062 | |||
| 1292 | Ga0209050_1000318 | |||
| 1293 | Ga0209051_1000001 | |||
| 1294 | Ga0209051_1000008 | |||
| 1295 | Ga0209051_1000060 | |||
| 1296 | Ga0209051_1032530 | |||
| 1297 | Ga0209257_1000171 | |||
| 1298 | Ga0209257_1014560 | |||
| 1299 | Ga0207696_1000002 | |||
| 1300 | Ga0207696_1000041 | |||
| 1301 | Ga0207696_1000948 | |||
| 1302 | Ga0207696_1004218 | |||
| 1303 | Ga0207655_1000137 | |||
| 1304 | Ga0207655_1000171 | |||
| 1305 | Ga0207655_1002517 | |||
| 1306 | Ga0207655_1006436 | |||
| 1307 | Ga0207655_1008643 | |||
| 1308 | Ga0207655_1009931 | |||
| 1309 | Ga0207655_1021409 | |||
| 1310 | Ga0207655_1022261 | |||
| 1311 | Ga0207713_1000281 | |||
| 1312 | Ga0207713_1004734 | |||
| 1313 | Ga0207713_1007192 | |||
| 1314 | Ga0207713_1009201 | |||
| 1315 | Ga0207713_1009264 | |||
| 1316 | Ga0207713_1011920 | |||
| 1317 | Ga0207713_1039843 | |||
| 1318 | Ga0207713_1058938 | |||
| 1319 | Ga0207642_10014697 | |||
| 1320 | Ga0207647_10000046 | |||
| 1321 | Ga0207647_10000154 | |||
| 1322 | Ga0207645_10002749 | |||
| 1323 | Ga0207705_10000107 | |||
| 1324 | Ga0207705_10033443 | |||
| 1325 | Ga0207705_10088234 | |||
| 1326 | Ga0207654_10010413 | |||
| 1327 | Ga0207707_10171326 | |||
| 1328 | Ga0207695_10000053 | |||
| 1329 | Ga0207695_10024070 | |||
| 1330 | Ga0207695_10114600 | |||
| 1331 | Ga0207671_10002724 | |||
| 1332 | Ga0207671_10003316 | |||
| 1333 | Ga0207671_10003530 | |||
| 1334 | Ga0207671_10003802 | |||
| 1335 | Ga0207671_10006180 | |||
| 1336 | Ga0207671_10007283 | |||
| 1337 | Ga0207657_10131011 | |||
| 1338 | Ga0207649_10000207 | |||
| 1339 | Ga0207652_10007878 | |||
| 1340 | Ga0207681_10015197 | |||
| 1341 | Ga0207650_10000516 | |||
| 1342 | Ga0207650_10002439 | |||
| 1343 | Ga0207644_10006244 | |||
| 1344 | Ga0207690_10000228 | |||
| 1345 | Ga0207706_10000669 | |||
| 1346 | Ga0207706_10024291 | |||
| 1347 | Ga0207686_10005287 | |||
| 1348 | Ga0207709_10000004 | |||
| 1349 | Ga0207709_10000663 | |||
| 1350 | Ga0207709_10000732 | |||
| 1351 | Ga0207709_10165528 | |||
| 1352 | Ga0207704_10000189 | |||
| 1353 | Ga0207711_10165588 | |||
| 1354 | Ga0207661_10135910 | |||
| 1355 | Ga0207679_10000045 | |||
| 1356 | Ga0207667_10000023 | |||
| 1357 | Ga0207667_10001774 | |||
| 1358 | Ga0207667_10033758 | |||
| 1359 | Ga0207667_10107432 | |||
| 1360 | Ga0207667_10252408 | |||
| 1361 | Ga0207668_10078689 | |||
| 1362 | Ga0207640_10174368 | |||
| 1363 | Ga0207639_10013514 | |||
| 1364 | Ga0207639_10039694 | |||
| 1365 | Ga0207639_10223629 | |||
| 1366 | Ga0207702_10000314 | |||
| 1367 | Ga0207702_10050863 | |||
| 1368 | Ga0207648_10001991 | |||
| 1369 | Ga0207683_10023135 | |||
| 1370 | Ga0207698_10003020 | |||
| 1371 | Ga0209281_1000055 | |||
| 1372 | Ga0209281_1010834 | |||
| 1373 | Ga0207428_10036462 | |||
| 1374 | Ga0207428_10074665 | |||
| 1375 | Ga0268266_10000032 | |||
| 1376 | Ga0307517_10000429 | |||
| 1377 | Ga0307515_10000427 | |||
| 1378 | Ga0307515_10001574 | |||
| 1379 | Ga0307511_10143773 | |||
| 1380 | Ga0316179_1075791 | |||
| 1381 | Ga0316178_1138348 | |||
| 1382 | Ga0307509_10040907 | |||
| 1383 | Ga0307408_100124995 | |||
| 1384 | Ga0307405_10000308 | |||
| 1385 | Ga0307412_10010738 | |||
| 1386 | Ga0307412_10031505 | |||
| 1387 | Ga0307409_100042340 | |||
| 1388 | Ga0307414_10069589 | |||
| 1389 | Ga0307414_10244540 | |||
| 1390 | Ga0307507_10000510 | |||
| 1391 | Ga0307510_10001152 | |||
| 1392 | Ga0307510_10056409 | |||
| 1393 | Ga0395899_0018418 | |||
| 1394 | Ga0395899_0039160 | |||
| 1395 | Ga0395900_0000194 | |||
| 1396 | Ga0395900_0014468 | |||
| 1397 | Ga0395900_0188256 | |||
| 1398 | Ga0395905_0000716 | |||
| 1399 | Ga0395905_0017061 | |||
| 1400 | Ga0395905_0205600 | |||
| 1401 | Ga0395901_0001250 | |||
| 1402 | Ga0395901_0134318 | |||
| 1403 | Ga0436361_0211220 | |||
| 1404 | Ga0436361_0221882 | |||
| 1405 | Ga0436361_0668973 | |||
| 1406 | Ga0436361_0867242 | |||
| 1407 | Ga0436361_0882838 | |||
| 1408 | Ga0436361_0919984 | |||
| 1409 | Ga0436361_0985195 | |||
| 1410 | Ga0436361_1068986 | |||
| 1411 | Ga0436361_1085609 | |||
| 1412 | Ga0439438_001430 | |||
| 1413 | Ga0439438_001450 | |||
| 1414 | Ga0439438_001746 | |||
| 1415 | Ga0439438_009993 | |||
| 1416 | Ga0439438_017054 | |||
| 1417 | Ga0439447_000672 | |||
| 1418 | Ga0439447_002312 | |||
| 1419 | Ga0439447_009750 | |||
| 1420 | Ga0439447_009926 | |||
| 1421 | Ga0439447_023701 | |||
| 1422 | Ga0439466_0017383 | |||
| 1423 | Ga0439466_0042843 | |||
| 1424 | Ga0439466_0059429 | |||
| 1425 | Ga0439448_0021133 | |||
| 1426 | Ga0439432_000242 | |||
| 1427 | Ga0439432_012783 | |||
| 1428 | Ga0439432_065816 | |||
| 1429 | Ga0439451_006645 | |||
| 1430 | Ga0439452_000059 | |||
| 1431 | Ga0439452_001296 | |||
| 1432 | Ga0439452_005686 | |||
| 1433 | Ga0439452_011254 | |||
| 1434 | Ga0439452_014153 | |||
| 1435 | Ga0439456_003923 | |||
| 1436 | Ga0439456_013993 | |||
| 1437 | Ga0439463_000602 | |||
| 1438 | Ga0439463_024929 | |||
| 1439 | Ga0450911_000021 | |||
| 1440 | Ga0450911_001399 | |||
| 1441 | Ga0450922_000392 | |||
| 1442 | Ga0450923_030361 | |||
| 1443 | Ga0450900_006012 | |||
| 1444 | Ga0450902_012779 | |||
| 1445 | Ga0450903_002525 | |||
| 1446 | Ga0450903_003560 | |||
| 1447 | Ga0450904_001682 | |||
| 1448 | Ga0450906_000044 | |||
| 1449 | Ga0450906_008784 | |||
| 1450 | Ga0450907_000302 | |||
| 1451 | Ga0450907_001596 | |||
| 1452 | Ga0439434_0000011 | |||
| 1453 | Ga0439460_0001823 | |||
| 1454 | Ga0439460_0024050 | |||
| 1455 | Ga0466966_0033277 | |||
| 1456 | Ga0466957_0044881 | |||
| 1457 | Ga0466958_0001201 | |||
| 1458 | Ga0495617_000870 | |||
| 1459 | Ga0495617_006912 | |||
| 1460 | Ga0495617_009184 | |||
| 1461 | Ga0495617_031806 | |||
| 1462 | Ga0495617_034104 | |||
| 1463 | Ga0495617_042761 | |||
| 1464 | Ga0495617_070851 | |||
| 1465 | Ga0495627_000472 | |||
| 1466 | Ga0495627_004200 | |||
| 1467 | Ga0495627_006510 | |||
| 1468 | Ga0495627_006823 | |||
| 1469 | Ga0495603_0010705 | |||
| 1470 | Ga0495590_0008435 | |||
| 1471 | Ga0495591_000296 | |||
| 1472 | Ga0495591_000493 | |||
| 1473 | Ga0495591_000566 | |||
| 1474 | Ga0495591_007753 | |||
| 1475 | Ga0495591_010894 | |||
| 1476 | Ga0495591_011921 | |||
| 1477 | Ga0495591_012291 | |||
| 1478 | Ga0495591_025646 | |||
| 1479 | Ga0495591_033584 | |||
| 1480 | Ga0495591_036512 | |||
| 1481 | Ga0495591_037692 | |||
| 1482 | Ga0495591_041142 | |||
| 1483 | Ga0495591_056310 | |||
| 1484 | Ga0495629_0088909 | |||
| 1485 | Ga0495638_0019149 | |||
| 1486 | Ga0495638_0028493 | |||
| 1487 | Ga0495638_0034052 | |||
| 1488 | Ga0495638_0042937 | |||
| 1489 | Ga0495638_0055596 | |||
| 1490 | Ga0495638_0127913 | |||
| 1491 | Ga0495653_0178097 | |||
| 1492 | Ga0495650_0000119 | |||
| 1493 | Ga0495650_0013035 | |||
| 1494 | Ga0495650_0045466 | |||
| 1495 | Ga0495650_0053869 | |||
| 1496 | Ga0495605_0003359 | |||
| 1497 | Ga0495605_0012032 | |||
| 1498 | Ga0495605_0042918 | |||
| 1499 | Ga0495605_0052042 | |||
| 1500 | Ga0495605_0056648 | |||
| 1501 | Ga0495605_0066601 | |||
| 1502 | Ga0495605_0070107 | |||
| 1503 | Ga0495639_0047506 | |||
| 1504 | Ga0495639_0065198 | |||
| 1505 | Ga0495584_0009110 | |||
| 1506 | Ga0495584_0010833 | |||
| 1507 | Ga0495584_0012379 | |||
| 1508 | Ga0495584_0012396 | |||
| 1509 | Ga0495584_0017553 | |||
| 1510 | Ga0495584_0021308 | |||
| 1511 | Ga0495584_0072448 | |||
| 1512 | Ga0495584_0073410 | |||
| 1513 | Ga0495585_0000173 | |||
| 1514 | Ga0495585_0001130 | |||
| 1515 | Ga0495585_0005932 | |||
| 1516 | Ga0495585_0008849 | |||
| 1517 | Ga0495585_0016170 | |||
| 1518 | Ga0495585_0016173 | |||
| 1519 | Ga0495585_0019074 | |||
| 1520 | Ga0495585_0023103 | |||
| 1521 | Ga0495585_0033080 | |||
| 1522 | Ga0495585_0056277 | |||
| 1523 | Ga0495585_0082991 | |||
| 1524 | Ga0495585_0093164 | |||
| 1525 | Ga0495594_0032406 | |||
| 1526 | Ga0495594_0057041 | |||
| 1527 | Ga0495596_0043823 | |||
| 1528 | Ga0495596_0051765 | |||
| 1529 | Ga0495607_0000583 | |||
| 1530 | Ga0495607_0002315 | |||
| 1531 | Ga0495607_0010286 | |||
| 1532 | Ga0495607_0017311 | |||
| 1533 | Ga0495607_0022056 | |||
| 1534 | Ga0495607_0076606 | |||
| 1535 | Ga0495607_0104827 | |||
| 1536 | Ga0495583_0000393 | |||
| 1537 | Ga0495583_0000565 | |||
| 1538 | Ga0495583_0002481 | |||
| 1539 | Ga0495583_0009025 | |||
| 1540 | Ga0495583_0026909 | |||
| 1541 | Ga0495583_0056226 | |||
| 1542 | Ga0495583_0064293 | |||
| 1543 | Ga0495606_0000008 | |||
| 1544 | Ga0495606_0000016 | |||
| 1545 | Ga0495606_0001301 | |||
| 1546 | Ga0495606_0002511 | |||
| 1547 | Ga0495606_0004228 | |||
| 1548 | Ga0495606_0009581 | |||
| 1549 | Ga0495606_0019691 | |||
| 1550 | Ga0495606_0024959 | |||
| 1551 | Ga0495606_0032541 | |||
| 1552 | Ga0495606_0038983 | |||
| 1553 | Ga0495606_0055845 | |||
| 1554 | Ga0495606_0092855 | |||
| 1555 | Ga0495606_0103677 | |||
| 1556 | Ga0495606_0106635 | |||
| 1557 | Ga0495610_0000950 | |||
| 1558 | Ga0495610_0001695 | |||
| 1559 | Ga0495610_0002038 | |||
| 1560 | Ga0495610_0004779 | |||
| 1561 | Ga0495610_0008698 | |||
| 1562 | Ga0495610_0012262 | |||
| 1563 | Ga0495610_0019310 | |||
| 1564 | Ga0495610_0022519 | |||
| 1565 | Ga0495610_0026020 | |||
| 1566 | Ga0495610_0102899 | |||
| 1567 | Ga0495616_0003965 | |||
| 1568 | Ga0495616_0008966 | |||
| 1569 | Ga0495616_0012363 | |||
| 1570 | Ga0495616_0013653 | |||
| 1571 | Ga0495616_0015329 | |||
| 1572 | Ga0495616_0016860 | |||
| 1573 | Ga0495616_0017236 | |||
| 1574 | Ga0495616_0020336 | |||
| 1575 | Ga0495616_0058784 | |||
| 1576 | Ga0495616_0093139 | |||
| 1577 | Ga0495620_0000374 | |||
| 1578 | Ga0495620_0010030 | |||
| 1579 | Ga0495620_0012437 | |||
| 1580 | Ga0495620_0023330 | |||
| 1581 | Ga0495620_0047075 | |||
| 1582 | Ga0495620_0060516 | |||
| 1583 | Ga0495631_0000355 | |||
| 1584 | Ga0495631_0007027 | |||
| 1585 | Ga0495631_0007788 | |||
| 1586 | Ga0495631_0037261 | |||
| 1587 | Ga0495631_0039200 | |||
| 1588 | Ga0495631_0082888 | |||
| 1589 | Ga0495632_0000922 | |||
| 1590 | Ga0495632_0008122 | |||
| 1591 | Ga0495632_0012089 | |||
| 1592 | Ga0495632_0049483 | |||
| 1593 | Ga0495632_0079952 | |||
| 1594 | Ga0495632_0100639 | |||
| 1595 | Ga0495637_0000912 | |||
| 1596 | Ga0495637_0002577 | |||
| 1597 | Ga0495637_0012131 | |||
| 1598 | Ga0495637_0045708 | |||
| 1599 | Ga0495637_0047666 | |||
| 1600 | Ga0495637_0051225 | |||
| 1601 | Ga0495637_0062588 | |||
| 1602 | Ga0495637_0062979 | |||
| 1603 | Ga0495637_0070523 | |||
| 1604 | Ga0495637_0147525 | |||
| 1605 | Ga0495643_0042789 | |||
| 1606 | Ga0495643_0136002 | |||
| 1607 | Ga0495643_0140189 | |||
| 1608 | Ga0495644_0040389 | |||
| 1609 | Ga0495644_0048255 | |||
| 1610 | Ga0495644_0099818 | |||
| 1611 | Ga0495648_0003303 | |||
| 1612 | Ga0495648_0010360 | |||
| 1613 | Ga0495648_0020119 | |||
| 1614 | Ga0495648_0022931 | |||
| 1615 | Ga0495648_0045334 | |||
| 1616 | Ga0495648_0055413 | |||
| 1617 | Ga0495648_0057911 | |||
| 1618 | Ga0495648_0062603 | |||
| 1619 | Ga0495648_0091771 | |||
| 1620 | Ga0495648_0095720 | |||
| 1621 | Ga0495648_0104585 | |||
| 1622 | Ga0495648_0143040 | |||
| 1623 | Ga0495648_0199712 | |||
| 1624 | Ga0495666_0087660 | |||
| 1625 | Ga0495642_0000008 | |||
| 1626 | Ga0495642_0000042 | |||
| 1627 | Ga0495654_0000247 | |||
| 1628 | Ga0495654_0002152 | |||
| 1629 | Ga0495654_0004247 | |||
| 1630 | Ga0495654_0009129 | |||
| 1631 | Ga0495654_0019471 | |||
| 1632 | Ga0495654_0021962 | |||
| 1633 | Ga0495654_0022389 | |||
| 1634 | Ga0495654_0026857 | |||
| 1635 | Ga0495654_0060686 | |||
| 1636 | Ga0495654_0085601 | |||
| 1637 | Ga0495654_0122186 | |||
| 1638 | Ga0495609_0007888 | |||
| 1639 | Ga0495609_0015803 | |||
| 1640 | Ga0495609_0023737 | |||
| 1641 | Ga0495609_0042536 | |||
| 1642 | Ga0495609_0074471 | |||
| 1643 | Ga0495609_0081176 | |||
| 1644 | Ga0495597_0013829 | |||
| 1645 | Ga0495597_0023378 | |||
| 1646 | Ga0495597_0032537 | |||
| 1647 | Ga0495597_0038539 | |||
| 1648 | Ga0495597_0045860 | |||
| 1649 | Ga0495622_0006105 | |||
| 1650 | Ga0495622_0023073 | |||
| 1651 | Ga0495622_0027135 | |||
| 1652 | Ga0495622_0037018 | |||
| 1653 | Ga0495633_0000072 | |||
| 1654 | Ga0495633_0012874 | |||
| 1655 | Ga0495633_0019024 | |||
| 1656 | Ga0495633_0030984 | |||
| 1657 | Ga0495633_0077716 | |||
| 1658 | Ga0495656_0017763 | |||
| 1659 | Ga0495668_0000009 | |||
| 1660 | Ga0495611_0000237 | |||
| 1661 | Ga0495611_0106621 | |||
| 1662 | Ga0495611_0155717 | |||
| 1663 | Ga0495625_0000017 | |||
| 1664 | Ga0495625_0000831 | |||
| 1665 | Ga0495625_0001531 | |||
| 1666 | Ga0495625_0004263 | |||
| 1667 | Ga0495625_0004710 | |||
| 1668 | Ga0495625_0014203 | |||
| 1669 | Ga0495625_0019811 | |||
| 1670 | Ga0495625_0041611 | |||
| 1671 | Ga0495625_0064010 | |||
| 1672 | Ga0495625_0065750 | |||
| 1673 | Ga0495625_0075780 | |||
| 1674 | Ga0495625_0081611 | |||
| 1675 | Ga0495625_0121051 | |||
| 1676 | Ga0495625_0138473 | |||
| 1677 | Ga0495625_0147148 | |||
| 1678 | Ga0495625_0201716 | |||
| 1679 | Ga0495625_0266612 | |||
| 1680 | Ga0495659_0016010 | |||
| 1681 | Ga0495659_0051133 | |||
| 1682 | Ga0495661_0000083 | |||
| 1683 | Ga0495661_0004073 | |||
| 1684 | Ga0495661_0007434 | |||
| 1685 | Ga0495661_0035519 | |||
| 1686 | Ga0495661_0046344 | |||
| 1687 | Ga0495661_0062988 | |||
| 1688 | Ga0495661_0078905 | |||
| 1689 | Ga0495661_0080558 | |||
| 1690 | Ga0495661_0085826 | |||
| 1691 | Ga0495661_0091530 | |||
| 1692 | Ga0495661_0116157 | |||
| 1693 | Ga0495661_0125569 | |||
| 1694 | Ga0495588_0041348 | |||
| 1695 | Ga0495588_0045254 | |||
| 1696 | Ga0495588_0111080 | |||
| 1697 | Ga0495588_0175823 | |||
| 1698 | Ga0495646_0022272 | |||
| 1699 | Ga0495658_0018289 | |||
| 1700 | Ga0495669_0073974 | |||
| 1701 | Ga0495613_0026066 | |||
| 1702 | Ga0495624_0000375 | |||
| 1703 | Ga0495670_0006113 | |||
| 1704 | Ga0495670_0013452 | |||
| 1705 | Ga0495670_0018020 | |||
| 1706 | Ga0495670_0054151 | |||
| 1707 | Ga0495670_0077162 | |||
| 1708 | Ga0495670_0093581 | |||
| 1709 | Ga0495670_0143613 | |||
| 1710 | Ga0495671_0000078 | |||
| 1711 | Ga0495671_0005595 | |||
| 1712 | Ga0495671_0015967 | |||
| 1713 | Ga0495671_0024323 | |||
| 1714 | Ga0495671_0033887 | |||
| 1715 | Ga0495671_0042385 | |||
| 1716 | Ga0495671_0063573 | |||
| 1717 | Ga0495671_0073070 | |||
| 1718 | Ga0495671_0075975 | |||
| 1719 | Ga0495671_0122729 | |||
| 1720 | Ga0495649_0000121 | |||
| 1721 | Ga0495649_0008007 | |||
| 1722 | Ga0495649_0014048 | |||
| 1723 | Ga0495649_0014159 | |||
| 1724 | Ga0495649_0016475 | |||
| 1725 | Ga0495649_0019747 | |||
| 1726 | Ga0495649_0029003 | |||
| 1727 | Ga0495649_0054483 | |||
| 1728 | Ga0495649_0069511 | |||
| 1729 | Ga0495649_0133836 | |||
| 1730 | Ga0495589_0001533 | |||
| 1731 | Ga0495589_0003419 | |||
| 1732 | Ga0495589_0008918 | |||
| 1733 | Ga0495589_0013295 | |||
| 1734 | Ga0495589_0072385 | |||
| 1735 | Ga0495589_0085637 | |||
| 1736 | Ga0495660_0002089 | |||
| 1737 | Ga0495660_0016523 | |||
| 1738 | Ga0495660_0016617 | |||
| 1739 | Ga0495660_0022892 | |||
| 1740 | Ga0495660_0027263 | |||
| 1741 | Ga0495660_0064559 | |||
| 1742 | Ga0495660_0131219 | |||
| 1743 | Ga0495604_0046135 | |||
| 1744 | Ga0495636_0040592 | |||
| 1745 | Ga0495672_0000899 | |||
| 1746 | Ga0495672_0003453 | |||
| 1747 | Ga0495672_0009377 | |||
| 1748 | Ga0495672_0023438 | |||
| 1749 | Ga0495672_0024411 | |||
| 1750 | Ga0495672_0065356 | |||
| 1751 | Ga0495672_0066594 | |||
| 1752 | Ga0495672_0104905 | |||
| 1753 | Ga0495672_0123492 | |||
| 1754 | Ga0495676_0023687 | |||
| 1755 | Ga0495680_0002703 | |||
| 1756 | Ga0495683_0001770 | |||
| 1757 | Ga0495683_0001796 | |||
| 1758 | Ga0495683_0016005 | |||
| 1759 | Ga0495683_0041954 | |||
| 1760 | Ga0495683_0067597 | |||
| 1761 | Ga0495683_0118944 | |||
| 1762 | Ga0495687_000902 | |||
| 1763 | Ga0495687_005379 | |||
| 1764 | Ga0495687_020573 | |||
| 1765 | Ga0495677_0006346 | |||
| 1766 | Ga0495679_000877 | |||
| 1767 | Ga0495679_005883 | |||
| 1768 | Ga0495679_010191 | |||
| 1769 | Ga0495679_027145 | |||
| 1770 | Ga0495679_038958 | |||
| 1771 | Ga0495679_041748 | |||
| 1772 | Ga0495673_0001089 | |||
| 1773 | Ga0495673_0003850 | |||
| 1774 | Ga0495673_0025014 | |||
| 1775 | Ga0495673_0025424 | |||
| 1776 | Ga0495673_0030232 | |||
| 1777 | Ga0495673_0042691 | |||
| 1778 | Ga0495673_0047749 | |||
| 1779 | Ga0495681_0000368 | |||
| 1780 | Ga0495681_0013414 | |||
| 1781 | Ga0495681_0018316 | |||
| 1782 | Ga0495681_0024203 | |||
| 1783 | Ga0495681_0030700 | |||
| 1784 | Ga0495681_0055218 | |||
| 1785 | Ga0495681_0061625 | |||
| 1786 | Ga0495681_0093693 | |||
| 1787 | Ga0495684_0111704 | |||
| 1788 | Ga0495686_0001124 | |||
| 1789 | Ga0495686_0003529 | |||
| 1790 | Ga0495686_0008633 | |||
| 1791 | Ga0495686_0017772 | |||
| 1792 | Ga0495686_0050886 | |||
| 1793 | Ga0495686_0141853 | |||
| 1794 | Ga0495593_0047038 | |||
| 1795 | Ga0495602_0002824 | |||
| 1796 | Ga0495626_0002208 | |||
| 1797 | Ga0495626_0002697 | |||
| 1798 | Ga0495626_0005609 | |||
| 1799 | Ga0495626_0010358 | |||
| 1800 | Ga0495626_0011647 | |||
| 1801 | Ga0495626_0017276 | |||
| 1802 | Ga0495626_0019649 | |||
| 1803 | Ga0495626_0024676 | |||
| 1804 | Ga0495626_0032891 | |||
| 1805 | Ga0495626_0112366 | |||
| 1806 | Ga0496107_0333256 | |||
| 1807 | Ga0496110_0084401 | |||
| 1808 | Ga0496112_0043696 | |||
| 1809 | Ga0496115_0000196 | |||
| 1810 | Ga0496115_0199741 | |||
| 1811 | Ga0496116_0000114 | |||
| 1812 | Ga0496116_0002218 | |||
| 1813 | Ga0496116_0017123 | |||
| 1814 | Ga0496116_0097036 | |||
| 1815 | Ga0496116_0111009 | |||
| 1816 | Ga0496117_0000654 | |||
| 1817 | Ga0496117_0001257 | |||
| 1818 | Ga0496117_0007831 | |||
| 1819 | Ga0496117_0011197 | |||
| 1820 | Ga0496117_0040370 | |||
| 1821 | Ga0496117_0115402 | |||
| 1822 | Ga0496117_0133402 | |||
| 1823 | Ga0496117_0180858 | |||
| 1824 | Ga0496118_0026967 | |||
| 1825 | Ga0496118_0029390 | |||
| 1826 | Ga0496118_0045743 | |||
| 1827 | Ga0496118_0056650 | |||
| 1828 | Ga0496118_0073983 | |||
| 1829 | Ga0496118_0118987 | |||
| 1830 | Ga0496119_0007077 | |||
| 1831 | Ga0496119_0024521 | |||
| 1832 | Ga0496119_0085653 | |||
| 1833 | Ga0496120_0005052 | |||
| 1834 | Ga0496120_0023266 | |||
| 1835 | Ga0496120_0130690 | |||
| 1836 | Ga0496121_0000286 | |||
| 1837 | Ga0496121_0027827 | |||
| 1838 | Ga0496121_0157549 | |||
| 1839 | Ga0496121_0170770 | |||
| 1840 | Ga0496122_0004747 | |||
| 1841 | Ga0496122_0006189 | |||
| 1842 | Ga0496122_0037766 | |||
| 1843 | Ga0496122_0157104 | |||
| 1844 | Ga0496122_0185700 | |||
| 1845 | Ga0496123_0000709 | |||
| 1846 | Ga0496123_0002397 | |||
| 1847 | Ga0496123_0022339 | |||
| 1848 | Ga0496123_0024318 | |||
| 1849 | Ga0496123_0026470 | |||
| 1850 | Ga0496123_0052966 | |||
| 1851 | Ga0496123_0162170 | |||
| 1852 | Ga0496124_0003392 | |||
| 1853 | Ga0496124_0024765 | |||
| 1854 | Ga0496124_0050291 | |||
| 1855 | Ga0496124_0067215 | |||
| 1856 | Ga0496124_0125675 | |||
| 1857 | Ga0496124_0166370 | |||
| 1858 | Ga0496125_0000266 | |||
| 1859 | Ga0496125_0002439 | |||
| 1860 | Ga0496125_0007844 | |||
| 1861 | Ga0496125_0007972 | |||
| 1862 | Ga0496125_0011480 | |||
| 1863 | Ga0496125_0016074 | |||
| 1864 | Ga0496125_0016812 | |||
| 1865 | Ga0496125_0054788 | |||
| 1866 | Ga0496125_0138126 | |||
| 1867 | Ga0496125_0144959 | |||
| 1868 | Ga0496125_0155748 | |||
| 1869 | Ga0496126_0015231 | |||
| 1870 | Ga0496126_0046630 | |||
| 1871 | Ga0496126_0174490 | |||
| 1872 | Ga0495678_000453 | |||
| 1873 | Ga0495678_007247 | |||
| 1874 | Ga0495678_008194 | |||
| 1875 | Ga0495678_008230 | |||
| 1876 | Ga0495678_040218 | |||
| 1877 | Ga0495678_046394 | |||
| 1878 | Ga0495678_082199 | |||
| 1879 | Ga0495682_0004703 | |||
| 1880 | Ga0495682_0005360 | |||
| 1881 | Ga0495682_0007775 | |||
| 1882 | Ga0495682_0015513 | |||
| 1883 | Ga0495682_0016621 | |||
| 1884 | Ga0495682_0031696 | |||
| 1885 | nmdc:mga0k408_1786_c1 | |||
| 1886 | nmdc:mga0k408_296_c1 | |||
| 1887 | nmdc:mga08x19_220535_c1 | |||
| 1888 | Ga0500641_0000076 | |||
| 1889 | Ga0500572_019674 | |||
| 1890 | Ga0500592_001686 | |||
| 1891 | Ga0500608_002735 | |||
| 1892 | Ga0500608_005577 | |||
| 1893 | Ga0500618_000040 | |||
| 1894 | Ga0500621_078893 | |||
| 1895 | Ga0500642_0047750 | |||
| 1896 | Ga0500564_053743 | |||
| 1897 | Ga0500622_0035466 | |||
| 1898 | Ga0500622_0071357 | |||
| 1899 | Ga0500624_000837 | |||
| 1900 | Ga0500634_0001078 | |||
| 1901 | 2511248938 | |||
| 1902 | 2511254223 | |||
| 1903 | 2511267397 | |||
| 1904 | 2511278382 | |||
| 1905 | 2511292631 | |||
| 1906 | 2511298100 | |||
| 1907 | 2511300983 | |||
| 1908 | 2511314304 | |||
| 1909 | 2511318950 | |||
| 1910 | 2511324440 | |||
| 1911 | 2511330273 | |||
| 1912 | 2511350826 | |||
| 1913 | 2511367826 | |||
| 1914 | 2511415490 | |||
| 1915 | 2512325432 | |||
| 1916 | 2547501632 | |||
| 1917 | 2555670692 | |||
| 1918 | 2583793220 | |||
| 1919 | 2597864307 | |||
| 1920 | 2597869532 | |||
| 1921 | 2599357757 | |||
| 1922 | 2599358630 | |||
| 1923 | 2599365849 | |||
| 1924 | 2599371273 | |||
| 1925 | 2599382528 | |||
| 1926 | 2599388975 | |||
| 1927 | 2599390182 | |||
| 1928 | 2599401944 | |||
| 1929 | 2599402316 | |||
| 1930 | 2599453864 | |||
| 1931 | 2599463755 | |||
| 1932 | 2599471560 | |||
| 1933 | 2599476629 | |||
| 1934 | 2599492774 | |||
| 1935 | 2599510035 | |||
| 1936 | 2599515438 | |||
| 1937 | 2599521456 | |||
| 1938 | 2599881069 | |||
| 1939 | 2599884209 | |||
| 1940 | 2599894817 | |||
| 1941 | 2599899214 | |||
| 1942 | 2599949648 | |||
| 1943 | 2599958650 | |||
| 1944 | 2599994640 | |||
| 1945 | 2600003486 | |||
| 1946 | 2600018063 | |||
| 1947 | 2600022748 | |||
| 1948 | 2600042192 | |||
| 1949 | 2600052582 | |||
| 1950 | 2600064850 | |||
| 1951 | 2600069490 | |||
| 1952 | 2600076116 | |||
| 1953 | 2600216887 | |||
| 1954 | 2601691627 | |||
| 1955 | 2601777058 | |||
| 1956 | 2601798720 | |||
| 1957 | 2606077614 | |||
| 1958 | 2606130211 | |||
| 1959 | 2621300173 | |||
| 1960 | 2624481115 | |||
| 1961 | 2643871039 | |||
| 1962 | 2643954168 | |||
| 1963 | 2644022977 | |||
| 1964 | 2644185744 | |||
| 1965 | 2644622470 | |||
| 1966 | 2671091356 | |||
| 1967 | 2671096195 | |||
| 1968 | 2677901137 | |||
| 1969 | 2715750636 | |||
| 1970 | 2715757168 | |||
| 1971 | 2723248452 | |||
| 1972 | 2738675130 | |||
| 1973 | 2738753420 | |||
| 1974 | 2738810512 | |||
| 1975 | 2738862332 | |||
| 1976 | 2738897872 | |||
| 1977 | 2739257026 | |||
| 1978 | 2739313142 | |||
| 1979 | 2743738345 | |||
| 1980 | 2774120199 | |||
| 1981 | 2774134088 | |||
| 1982 | 2784264145 | |||
| 1983 | 2784311870 | |||
| 1984 | 2808932828 | |||
| 1985 | 2808954950 | |||
| 1986 | 2808978517 | |||
| 1987 | 2808993956 | |||
| 1988 | 2809215133 | |||
| 1989 | 2816518412 | |||
| 1990 | 2817491519 | |||
| 1991 | 2819658021 | |||
| 1992 | 2819700371 | |||
| 1993 | 2834033412 | |||
| 1994 | 2842394479 | |||
| 1995 | 2842827264 | |||
| 1996 | 2842835079 | |||
| 1997 | 2842841680 | |||
| 1998 | 2842846816 | |||
| 1999 | 2844671302 | |||
| 2000 | 2852617453 | |||
| 2001 | 2852625156 | |||
| 2002 | 2852657770 | |||
| 2003 | 2852672428 | |||
| 2004 | 2860870392 | |||
| 2005 | 2878033053 | |||
| 2006 | 2880233775 | |||
| 2007 | 2884934171 | |||
| 2008 | 2904523914 | |||
| 2009 | 2904552001 | |||
| 2010 | 2908450144 | |||
| 2011 | 2912967191 | |||
| 2012 | 2917074525 | |||
| 2013 | 2919067202 | |||
| 2014 | 2919137027 | |||
| 2015 | 2919390177 | |||
| 2016 | 2919442719 | |||
| 2017 | 2919460484 | |||
| 2018 | 2919489327 | |||
| 2019 | 2923157400 | |||
| 2020 | 2928078578 | |||
| 2021 | 2928151745 | |||
| 2022 | 2929192228 | |||
| 2023 | 2931370221 | |||
| 2024 | 2931394328 | |||
| 2025 | 2932084360 | |||
| 2026 | 2935355413 | |||
| 2027 | 2939642648 | |||
| 2028 | 2945933852 | |||
| 2029 | 2945964245 | |||
| 2030 | 2946030645 | |||
| 2031 | 2947237451 | |||
| 2032 | 2961064846 | |||
| 2033 | 2969307959 | |||
| 2034 | 2971404873 | |||
| 2035 | 2984288735 | |||
| 2036 | 2998142457 | |||
| 2037 | 3007513945 | |||
| 2038 | 3007616812 | |||
| 2039 | 3007724260 | |||
| 2040 | 3007856620 | |||
| 2041 | 3007861627 | |||
| 2042 | 637321042 | |||
| 2043 | 8015691554 | |||
| 2044 | 8029998239 | |||
| 2045 | 8054290704 | |||
| 2046 | 8054347960 | |||
| 2047 | 8054505823 | |||
| 2048 | 8055774761 | |||
| 2049 | 8055820457 | |||
| 2050 | 8056128530 | |||
| 2051 | 8056135075 | |||
| 2052 | 8056149840 | |||
| 2053 | 8056159169 | |||
| 2054 | 8056166462 | |||
| 2055 | 8056168623 | |||
| 2056 | 8056173991 | |||
| 2057 | 8056177880 | |||
| 2058 | 8056571278 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1h6d-assembly3.cif.gz_I | oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol | 0.8967 | 4 | 314 |
| 1rye-assembly1.cif.gz_D | crystal structure of the shifted form of the glucose-fructose oxidoreductase from zymomonas mobilis | 0.893 | 1 | 314 |
| 2glx-assembly1.cif.gz_A | crystal structure analysis of bacterial 1,5-af reductase | 0.8908 | 5 | 314 |
| 6z3b-assembly1.cif.gz_B | low resolution structure of rgnanox | 0.8908 | 1 | 314 |
| 6a3i-assembly1.cif.gz_B | levoglucosan dehydrogenase, complex with nadh and levoglucosan | 0.8904 | 4 | 314 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rbvA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9385 | 2 | 117 | 3.40.50.720 |
| 4hadB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9268 | 4 | 115 | 3.40.50.720 |
| af_I1MZG8_3_134_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9182 | 2 | 117 | 3.40.50.720 |
| af_A0A1D8PPX6_1_125_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9168 | 2 | 115 | 3.40.50.720 |
| af_P77503_10_129_3.30.360.10 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9116 | 4 | 117 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E8HMQ9-F1-model_v4 | Oxidoreductase | 0.9838 | 1 | 312 |
GO:0000166
GO:0016491 |
| AF-A0A1G8KK87-F1-model_v4 | Predicted dehydrogenase | 0.9811 | 1 | 314 |
GO:0000166
GO:0016491 |
| AF-A0A7X9M2B5-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9774 | 2 | 314 |
GO:0000166
GO:0016491 |
| AF-A0A1G8KK87-F1-model_v4 | Predicted dehydrogenase | 0.9719 | 1 | 314 |
GO:0000166
GO:0016491 |
| AF-A0A2E8HMQ9-F1-model_v4 | Oxidoreductase | 0.9684 | 1 | 312 |
GO:0000166
GO:0016491 |