F488585

General Info

Members Datasets Scaffolds Average Seq Length
1029 442 2058 323

Family's Representative Sequence

Representative Sequence 3300047446|Ga0495679_000404|Ga0495679_000404_21296_22351
Length 351
Sequence MLSGYGAPGWVCGYCPLDENGRGEQMSTVRWGMIGCGSVTELKSGPAFYKAPGSALVAVMGRREEAVRDYAARHGIARFYTDAQALIDDPEVGAVYIATPPASHLEYSLMVAAAGKHCCVEKPMSLNAEQSALMQRTFERAGLHLFVSYYRRSLPRFQQVREWLQAGRIGTLRHLTWTLCKPPAAEDASAANWRTDPAIAGGGYFADLASHGFDLFQYLAGDIVEVSGFTARQAGKYAAEDAVTACWTFSSGALGMGCWNFVADRREDLVELIGSHGRIQFSVFEDQPLRLEGETDEVLEVPCHAHIQWHHVLAMNAHIRGEAEHPSLGIEALKTDRILDKVLQRNPNLPA

Samples

Sample ID Description Type Environment
1 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
66 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
91 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
152 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
167 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
168 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
171 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
172 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
173 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
174 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
175 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
176 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
177 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
178 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
179 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
180 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
181 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
182 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
183 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
193 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
205 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
237 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
271 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
275 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
276 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
277 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
278 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
279 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
280 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
281 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
282 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
283 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
284 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
285 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
286 2511231004 Pseudomonas sp. GM102 Isolate Nodule
287 2511231006 Pseudomonas sp. GM17 Isolate Nodule
288 2511231008 Pseudomonas sp. GM21 Isolate Nodule
289 2511231010 Pseudomonas sp. GM25 Isolate Nodule
290 2511231011 Pseudomonas sp. GM30 Isolate Nodule
291 2511231012 Pseudomonas sp. GM33 Isolate Nodule
292 2511231014 Pseudomonas sp. GM48 Isolate Nodule
293 2511231015 Pseudomonas sp. GM49 Isolate Nodule
294 2511231016 Pseudomonas sp. GM50 Isolate Nodule
295 2511231017 Pseudomonas sp. GM55 Isolate Nodule
296 2511231020 Pseudomonas sp. GM74 Isolate Nodule
297 2511231023 Pseudomonas sp. GM80 Isolate Nodule
298 2511231031 Pseudomonas sp. GM16 Isolate Nodule
299 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
300 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
301 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
302 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
303 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
304 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
305 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
306 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
307 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
308 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
309 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
310 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
311 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
312 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
313 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
314 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
315 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
316 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
317 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
318 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
319 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
320 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
321 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
322 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
323 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
324 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
325 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
326 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
327 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
328 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
329 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
330 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
331 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
332 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
333 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
334 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
335 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
336 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
337 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
338 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
339 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
340 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
341 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
342 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
343 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
344 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
345 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
346 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
347 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
348 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
349 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
350 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
351 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
352 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
353 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
354 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
355 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
356 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
357 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
358 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
359 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
360 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
361 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
362 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
363 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
364 2773857670 Pseudomonas sp. 478 Isolate Unclassified
365 2773857673 Pseudomonas sp. 443 Isolate Unclassified
366 2784132063 Pseudomonas sp. 424 Isolate Unclassified
367 2784132072 Pseudomonas sp. 460 Isolate Unclassified
368 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
369 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
370 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
371 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
372 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
373 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
374 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
375 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
376 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
377 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
378 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
379 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
380 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
381 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
382 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
383 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
384 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
385 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
386 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
387 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
388 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
389 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
390 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
391 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
392 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
393 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
394 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
395 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
396 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
397 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
398 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
399 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
400 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
401 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
402 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
403 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
404 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
405 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
406 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
407 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
408 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
409 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
410 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
411 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
412 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
413 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
414 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
415 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
416 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
417 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
418 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
419 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
420 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
421 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
422 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
423 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
424 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
425 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
426 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
427 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
428 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
429 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
430 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
431 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
432 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
433 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
434 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
435 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
436 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
437 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
438 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
439 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
440 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
441 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
442 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.65
Metatranscriptomes 0
Isolates 15.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.97
Nodule 1.85
Rhizoplane 4.47
Rhizosphere 73.08
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495679_000404 3300047446 Bacteria 32234
2 MRS2a_Contig_103 2124908027 Bacteria 13981
3 JGI24736J21556_1005902 3300001904 Bacteria 2069
4 JGI24737J22298_10000796 3300001990 Bacteria 11186
5 JGI24737J22298_10007923 3300001990 Bacteria 3575
6 JGI24735J21928_10000008 3300002067 Bacteria 319819
7 JGI25155J39150_1000126 3300002704 Bacteria 37345
8 JGI25156J39149_1009124 3300002705 Bacteria 2437
9 JGI25162J39368_1000013 3300002737 Bacteria 343384
10 JGI25162J39368_1000047 3300002737 Viruses 167507
11 JGI25162J39368_1000135 3300002737 Bacteria 79753
12 JGI25162J39368_1000183 3300002737 Bacteria 67086
13 JGI25162J39368_1001813 3300002737 Bacteria 10028
14 JGI25154J39366_1000206 3300002738 Bacteria 42302
15 JGI25163J39215_1000183 3300002771 Bacteria 24140
16 JGI25163J39215_1000226 3300002771 Bacteria 21091
17 JGI25163J39215_1000268 3300002771 Bacteria 18393
18 JGI25164J39214_1000005 3300002772 Bacteria 343384
19 JGI25164J39214_1000103 3300002772 Bacteria 82040
20 JGI25165J46597_1000099 3300003214 Bacteria 158550
21 JGI25165J46597_1000214 3300003214 Bacteria 82040
22 rootH2_10013605 3300003320 Bacteria 52813
23 rootH2_10017421 3300003320 Bacteria 26803
24 rootH2_10117289 3300003320 Bacteria 2653
25 rootH2_10313513 3300003320 Bacteria 1199
26 rootL2_10104135 3300003322 Bacteria 9618
27 rootH1_10032017 3300003323 Unclassified 1754
28 rootH1_10193823 3300003323 Bacteria 3900
29 Ga0055538_1000075 3300003751 Bacteria 89749
30 Ga0055539_1000113 3300003752 Bacteria 89749
31 Ga0055533_1000120 3300003756 Bacteria 89749
32 Ga0055532_1000107 3300003758 Bacteria 89749
33 Ga0055525_1000158 3300003759 Bacteria 89749
34 Ga0055535_1007312 3300003761 Bacteria 2123
35 Ga0055536_1000021 3300003781 Bacteria 198584
36 Ga0055536_1000190 3300003781 Bacteria 50444
37 Ga0055530_10000002 3300003791 Bacteria 300466
38 Ga0055530_10000006 3300003791 Bacteria 198584
39 Ga0055530_10005998 3300003791 Bacteria 5578
40 Ga0055530_10035830 3300003791 Bacteria 1254
41 Ga0055540_1000009 3300003792 Bacteria 300466
42 Ga0055540_1000051 3300003792 Bacteria 144078
43 Ga0055540_1000490 3300003792 Bacteria 30277
44 Ga0055531_10000070 3300003794 Bacteria 111273
45 Ga0055541_1000076 3300003841 Bacteria 89749
46 Ga0065714_10000204 3300005288 Bacteria 7372
47 Ga0065714_10007643 3300005288 Bacteria 4334
48 Ga0065714_10008799 3300005288 Bacteria 3255
49 Ga0065714_10009693 3300005288 Bacteria 2260
50 Ga0065714_10064666 3300005288 Bacteria 25011
51 Ga0065714_10084335 3300005288 Bacteria 2204
52 Ga0065714_10145193 3300005288 Bacteria 1143
53 Ga0065712_10077106 3300005290 Bacteria 3544
54 Ga0065712_10083103 3300005290 Bacteria 2862
55 Ga0065715_10312309 3300005293 Bacteria 1010
56 Ga0070658_10000014 3300005327 Bacteria 244978
57 Ga0070658_10042733 3300005327 Bacteria 3661
58 Ga0070658_10111772 3300005327 Bacteria 2264
59 Ga0070658_10319766 3300005327 Unclassified 1325
60 Ga0070676_10024076 3300005328 Bacteria 3426
61 Ga0070670_100002833 3300005331 Bacteria 14346
62 Ga0070670_100003592 3300005331 Bacteria 12904
63 Ga0070680_100113689 3300005336 Bacteria 2255
64 Ga0070682_100140189 3300005337 Bacteria 1647
65 Ga0068868_100033977 3300005338 Bacteria 3934
66 Ga0068868_100174672 3300005338 Bacteria 1780
67 Ga0070660_100109575 3300005339 Bacteria 2196
68 Ga0070660_100244652 3300005339 Unclassified 1461
69 Ga0070661_100000025 3300005344 Bacteria 121698
70 Ga0070669_100001350 3300005353 Bacteria 17670
71 Ga0070669_100011648 3300005353 Bacteria 6239
72 Ga0070671_100005292 3300005355 Bacteria 10296
73 Ga0070659_100000148 3300005366 Bacteria 53569
74 Ga0070678_100000566 3300005456 Bacteria 18121
75 Ga0070662_100000054 3300005457 Bacteria 60719
76 Ga0070662_100012024 3300005457 Bacteria 5730
77 Ga0070681_10063938 3300005458 Bacteria 3652
78 Ga0068867_100009805 3300005459 Bacteria 6749
79 Ga0070679_100010692 3300005530 Bacteria 8711
80 Ga0070679_100087045 3300005530 Bacteria 3111
81 Ga0070684_100154977 3300005535 Bacteria 2077
82 Ga0068853_100031762 3300005539 Bacteria 4468
83 Ga0070665_100000010 3300005548 Bacteria 529545
84 Ga0070665_100082756 3300005548 Bacteria 3215
85 Ga0068855_100033283 3300005563 Bacteria 6153
86 Ga0068855_100125751 3300005563 Bacteria 2931
87 Ga0068855_100264905 3300005563 Bacteria 1913
88 Ga0068855_100538583 3300005563 Bacteria 1265
89 Ga0070664_100000019 3300005564 Bacteria 121708
90 Ga0068854_100271770 3300005578 Bacteria 1361
91 Ga0068854_100292771 3300005578 Bacteria 1314
92 Ga0068856_100000023 3300005614 Bacteria 141671
93 Ga0068856_100005294 3300005614 Bacteria 12730
94 Ga0068852_100004334 3300005616 Bacteria 10015
95 Ga0068866_10050089 3300005718 Bacteria 2119
96 Ga0068861_100151749 3300005719 Bacteria 1902
97 Ga0068851_10000374 3300005834 Bacteria 20243
98 Ga0075364_10107354 3300006051 Bacteria 1861
99 Ga0075366_10000507 3300006195 Bacteria 17971
100 Ga0075366_10001582 3300006195 Bacteria 11391
101 Ga0097621_100000247 3300006237 Bacteria 36324
102 Ga0068871_100003906 3300006358 Bacteria 10272
103 Ga0068865_100000076 3300006881 Bacteria 51732
104 Ga0075436_100254380 3300006914 Bacteria 1251
105 Ga0079104_1000081 3300006946 Bacteria 140632
106 Ga0079104_1012017 3300006946 Bacteria 2747
107 Ga0105251_10001274 3300009011 Bacteria 21776
108 Ga0105251_10004867 3300009011 Bacteria 8961
109 Ga0105251_10012899 3300009011 Bacteria 4702
110 Ga0105251_10023891 3300009011 Bacteria 3147
111 Ga0105251_10035947 3300009011 Bacteria 2441
112 Ga0105244_10001220 3300009036 Bacteria 21071
113 Ga0105244_10002515 3300009036 Bacteria 13789
114 Ga0105244_10002808 3300009036 Bacteria 12931
115 Ga0105244_10027155 3300009036 Bacteria 3088
116 Ga0105244_10035204 3300009036 Bacteria 2631
117 Ga0105244_10093060 3300009036 Bacteria 1481
118 Ga0105250_10000087 3300009092 Bacteria 81632
119 Ga0105250_10000267 3300009092 Bacteria 42329
120 Ga0105250_10002218 3300009092 Bacteria 9896
121 Ga0105250_10084611 3300009092 Bacteria 1287
122 Ga0105240_10000173 3300009093 Bacteria 131281
123 Ga0105240_10048462 3300009093 Bacteria 5369
124 Ga0105240_10065366 3300009093 Bacteria 4515
125 Ga0105240_10237399 3300009093 Bacteria 2115
126 Ga0105243_10000067 3300009148 Bacteria 123656
127 Ga0105243_10000337 3300009148 Bacteria 51319
128 Ga0105243_10008683 3300009148 Bacteria 7789
129 Ga0105243_10050347 3300009148 Bacteria 3290
130 Ga0105241_10001338 3300009174 Bacteria 18702
131 Ga0105241_10021419 3300009174 Bacteria 4778
132 Ga0105242_10002307 3300009176 Bacteria 15054
133 Ga0105242_10003180 3300009176 Bacteria 12809
134 Ga0105242_10401789 3300009176 Bacteria 1279
135 Ga0105237_10002438 3300009545 Bacteria 23082
136 Ga0105237_10002957 3300009545 Bacteria 20562
137 Ga0105237_10006614 3300009545 Bacteria 12813
138 Ga0105237_10008782 3300009545 Bacteria 10901
139 Ga0105237_10015332 3300009545 Bacteria 7982
140 Ga0105239_10000816 3300010375 Bacteria 44236
141 Ga0105239_10003173 3300010375 Bacteria 20361
142 Ga0105239_10017987 3300010375 Bacteria 7816
143 Ga0105239_10047642 3300010375 Bacteria 4697
144 Ga0105239_10086933 3300010375 Bacteria 3446
145 Ga0105239_10110143 3300010375 Bacteria 3052
146 Ga0105239_10194163 3300010375 Bacteria 2273
147 Ga0105246_10000469 3300011119 Bacteria 21755
148 Ga0105246_10000586 3300011119 Bacteria 20188
149 Ga0105246_10021731 3300011119 Bacteria 4133
150 Ga0105246_10021760 3300011119 Bacteria 4130
151 Ga0157345_1000289 3300012498 Bacteria 6704
152 Ga0157373_10000284 3300013100 Bacteria 40521
153 Ga0157373_10000746 3300013100 Bacteria 25237
154 Ga0157373_10003109 3300013100 Bacteria 12543
155 Ga0157373_10009443 3300013100 Bacteria 7206
156 Ga0157373_10016882 3300013100 Bacteria 5323
157 Ga0157373_10026359 3300013100 Bacteria 4198
158 Ga0157373_10039620 3300013100 Bacteria 3373
159 Ga0157373_10040884 3300013100 Bacteria 3317
160 Ga0157373_10053258 3300013100 Bacteria 2877
161 Ga0157373_10240657 3300013100 Bacteria 1279
162 Ga0157371_10000298 3300013102 Bacteria 65719
163 Ga0157371_10000308 3300013102 Bacteria 63557
164 Ga0157370_10024460 3300013104 Bacteria 5982
165 Ga0157370_10028024 3300013104 Bacteria 5545
166 Ga0157370_10108148 3300013104 Bacteria 2600
167 Ga0157369_10001344 3300013105 Bacteria 30365
168 Ga0157369_10003664 3300013105 Bacteria 18238
169 Ga0157369_10004545 3300013105 Bacteria 16317
170 Ga0157369_10007394 3300013105 Bacteria 12644
171 Ga0157369_10035679 3300013105 Bacteria 5451
172 Ga0157369_10095042 3300013105 Bacteria 3181
173 Ga0157374_10001476 3300013296 Bacteria 19869
174 Ga0157374_10002139 3300013296 Bacteria 16656
175 Ga0157374_10005179 3300013296 Bacteria 10934
176 Ga0163162_10000075 3300013306 Bacteria 90751
177 Ga0163162_10000082 3300013306 Bacteria 86888
178 Ga0163162_10007367 3300013306 Bacteria 10697
179 Ga0163162_10071839 3300013306 Bacteria 3515
180 Ga0163162_10176704 3300013306 Unclassified 2261
181 Ga0163162_10360378 3300013306 Bacteria 1587
182 Ga0157372_10000071 3300013307 Bacteria 109638
183 Ga0157372_10002043 3300013307 Bacteria 21955
184 Ga0157372_10005233 3300013307 Bacteria 13785
185 Ga0157372_10022369 3300013307 Bacteria 6839
186 Ga0157372_10139570 3300013307 Bacteria 2791
187 Ga0157375_10000312 3300013308 Bacteria 43933
188 Ga0157375_10004026 3300013308 Bacteria 12751
189 Ga0157375_10062535 3300013308 Bacteria 3700
190 Ga0157375_10118484 3300013308 Bacteria 2754
191 Ga0182008_10002137 3300014497 Bacteria 12598
192 Ga0182008_10002346 3300014497 Bacteria 11912
193 Ga0182008_10005700 3300014497 Bacteria 7050
194 Ga0182008_10012243 3300014497 Bacteria 4530
195 Ga0182008_10051361 3300014497 Bacteria 2045
196 Ga0182008_10064865 3300014497 Bacteria 1797
197 Ga0157376_10079089 3300014969 Bacteria 2818
198 Ga0182006_1000794 3300015261 Bacteria 21216
199 Ga0182006_1004990 3300015261 Bacteria 6395
200 Ga0182006_1006185 3300015261 Bacteria 5590
201 Ga0182006_1036177 3300015261 Bacteria 1964
202 Ga0182006_1045074 3300015261 Bacteria 1718
203 Ga0182006_1087605 3300015261 Bacteria 1125
204 Ga0182007_10001805 3300015262 Bacteria 11165
205 Ga0182007_10040970 3300015262 Bacteria 1545
206 Ga0182005_1005881 3300015265 Bacteria 3799
207 Ga0182005_1027507 3300015265 Bacteria 1550
208 Ga0182005_1027733 3300015265 Bacteria 1544
209 Ga0163161_10000167 3300017792 Bacteria 60151
210 Ga0163161_10001360 3300017792 Bacteria 18143
211 Ga0163161_10025013 3300017792 Bacteria 4221
212 Ga0163161_10026293 3300017792 Bacteria 4123
213 Ga0163161_10026513 3300017792 Bacteria 4104
214 Ga0163161_10028075 3300017792 Bacteria 3994
215 Ga0163161_10045106 3300017792 Bacteria 3178
216 Ga0163161_10062320 3300017792 Bacteria 2716
217 Ga0163161_10129330 3300017792 Bacteria 1903
218 Ga0213872_10000597 3300021361 Bacteria 27544
219 Ga0213872_10001019 3300021361 Bacteria 19525
220 Ga0213872_10002575 3300021361 Bacteria 10562
221 Ga0213872_10016991 3300021361 Bacteria 3369
222 Ga0213872_10024639 3300021361 Bacteria 2769
223 Ga0213872_10031662 3300021361 Bacteria 2424
224 Ga0213872_10035629 3300021361 Bacteria 2275
225 Ga0213872_10038438 3300021361 Bacteria 2184
226 Ga0209435_100201 3300025206 Bacteria 17317
227 Ga0209435_101268 3300025206 Bacteria 3320
228 Ga0209760_100035 3300025207 Bacteria 132204
229 Ga0209760_100923 3300025207 Bacteria 3647
230 Ga0209784_100113 3300025224 Bacteria 89916
231 Ga0209566_100138 3300025225 Bacteria 89916
232 Ga0209674_100158 3300025226 Bacteria 89916
233 Ga0209672_101444 3300025228 Bacteria 8507
234 Ga0209147_100167 3300025229 Bacteria 89916
235 Ga0209563_100134 3300025230 Bacteria 89916
236 Ga0209563_100887 3300025230 Bacteria 8876
237 Ga0207427_100015 3300025231 Bacteria 542133
238 Ga0207427_100018 3300025231 Bacteria 530735
239 Ga0209437_100027 3300025233 Bacteria 542133
240 Ga0209437_100031 3300025233 Bacteria 530871
241 Ga0209437_100089 3300025233 Bacteria 250476
242 Ga0209258_101107 3300025242 Bacteria 11393
243 Ga0209646_1000093 3300025246 Bacteria 183840
244 Ga0209646_1002448 3300025246 Bacteria 4113
245 Ga0209026_1000537 3300025250 Bacteria 26098
246 Ga0209026_1002474 3300025250 Bacteria 6888
247 Ga0209026_1004259 3300025250 Bacteria 4335
248 Ga0209026_1006723 3300025250 Bacteria 2752
249 Ga0209677_100104 3300025253 Bacteria 89916
250 Ga0209759_1000248 3300025256 Bacteria 80537
251 Ga0209129_1013944 3300025258 Bacteria 1737
252 Ga0209233_1000012 3300025261 Bacteria 1019519
253 Ga0209233_1000039 3300025261 Bacteria 542133
254 Ga0209233_1001941 3300025261 Bacteria 7883
255 Ga0209675_1007568 3300025291 Bacteria 4138
256 Ga0209676_1000002 3300025292 Bacteria 1732948
257 Ga0209676_1000017 3300025292 Bacteria 643409
258 Ga0209676_1001754 3300025292 Bacteria 18480
259 Ga0209676_1027203 3300025292 Bacteria 1804
260 Ga0209050_1000006 3300025298 Bacteria 1359702
261 Ga0209050_1000009 3300025298 Bacteria 1047265
262 Ga0209050_1000062 3300025298 Bacteria 316538
263 Ga0209050_1000318 3300025298 Bacteria 97317
264 Ga0209051_1000001 3300025303 Bacteria 1732974
265 Ga0209051_1000008 3300025303 Bacteria 706935
266 Ga0209051_1000060 3300025303 Bacteria 257304
267 Ga0209051_1032530 3300025303 Bacteria 1988
268 Ga0209257_1000171 3300025304 Bacteria 168276
269 Ga0209257_1014560 3300025304 Bacteria 3368
270 Ga0207696_1000002 3300025711 Bacteria 1098043
271 Ga0207696_1000041 3300025711 Bacteria 311695
272 Ga0207696_1000948 3300025711 Bacteria 17705
273 Ga0207696_1004218 3300025711 Bacteria 6250
274 Ga0207655_1000137 3300025728 Bacteria 140084
275 Ga0207655_1000171 3300025728 Bacteria 118865
276 Ga0207655_1002517 3300025728 Bacteria 14749
277 Ga0207655_1006436 3300025728 Bacteria 7783
278 Ga0207655_1008643 3300025728 Bacteria 6433
279 Ga0207655_1009931 3300025728 Bacteria 5847
280 Ga0207655_1021409 3300025728 Bacteria 3283
281 Ga0207655_1022261 3300025728 Bacteria 3185
282 Ga0207713_1000281 3300025735 Bacteria 59913
283 Ga0207713_1004734 3300025735 Bacteria 8754
284 Ga0207713_1007192 3300025735 Bacteria 6633
285 Ga0207713_1009201 3300025735 Bacteria 5594
286 Ga0207713_1009264 3300025735 Bacteria 5573
287 Ga0207713_1011920 3300025735 Bacteria 4689
288 Ga0207713_1039843 3300025735 Bacteria 1978
289 Ga0207713_1058938 3300025735 Bacteria 1476
290 Ga0207642_10014697 3300025899 Bacteria 2897
291 Ga0207647_10000046 3300025904 Bacteria 90148
292 Ga0207647_10000154 3300025904 Bacteria 54378
293 Ga0207645_10002749 3300025907 Bacteria 13705
294 Ga0207705_10000107 3300025909 Bacteria 94984
295 Ga0207705_10033443 3300025909 Bacteria 3673
296 Ga0207705_10088234 3300025909 Bacteria 2269
297 Ga0207654_10010413 3300025911 Bacteria 4734
298 Ga0207707_10171326 3300025912 Bacteria 1897
299 Ga0207695_10000053 3300025913 Bacteria 396740
300 Ga0207695_10024070 3300025913 Bacteria 6862
301 Ga0207695_10114600 3300025913 Bacteria 2670
302 Ga0207671_10002724 3300025914 Bacteria 18482
303 Ga0207671_10003316 3300025914 Bacteria 16180
304 Ga0207671_10003530 3300025914 Bacteria 15504
305 Ga0207671_10003802 3300025914 Bacteria 14807
306 Ga0207671_10006180 3300025914 Bacteria 10754
307 Ga0207671_10007283 3300025914 Bacteria 9625
308 Ga0207657_10131011 3300025919 Bacteria 2055
309 Ga0207649_10000207 3300025920 Bacteria 49166
310 Ga0207652_10007878 3300025921 Bacteria 8552
311 Ga0207681_10015197 3300025923 Bacteria 4800
312 Ga0207650_10000516 3300025925 Bacteria 31902
313 Ga0207650_10002439 3300025925 Bacteria 12948
314 Ga0207644_10006244 3300025931 Bacteria 7766
315 Ga0207690_10000228 3300025932 Bacteria 41941
316 Ga0207706_10000669 3300025933 Bacteria 36066
317 Ga0207706_10024291 3300025933 Bacteria 5433
318 Ga0207686_10005287 3300025934 Bacteria 6925
319 Ga0207709_10000004 3300025935 Bacteria 825156
320 Ga0207709_10000663 3300025935 Bacteria 27893
321 Ga0207709_10000732 3300025935 Bacteria 26258
322 Ga0207709_10165528 3300025935 Bacteria 1546
323 Ga0207704_10000189 3300025938 Bacteria 32372
324 Ga0207711_10165588 3300025941 Bacteria 2004
325 Ga0207661_10135910 3300025944 Bacteria 2111
326 Ga0207679_10000045 3300025945 Bacteria 121851
327 Ga0207667_10000023 3300025949 Bacteria 362527
328 Ga0207667_10001774 3300025949 Bacteria 27165
329 Ga0207667_10033758 3300025949 Bacteria 5499
330 Ga0207667_10107432 3300025949 Bacteria 2879
331 Ga0207667_10252408 3300025949 Bacteria 1804
332 Ga0207668_10078689 3300025972 Bacteria 2382
333 Ga0207640_10174368 3300025981 Bacteria 1606
334 Ga0207639_10013514 3300026041 Bacteria 5717
335 Ga0207639_10039694 3300026041 Bacteria 3508
336 Ga0207639_10223629 3300026041 Bacteria 1627
337 Ga0207702_10000314 3300026078 Bacteria 55437
338 Ga0207702_10050863 3300026078 Bacteria 3499
339 Ga0207648_10001991 3300026089 Bacteria 22314
340 Ga0207683_10023135 3300026121 Bacteria 5339
341 Ga0207698_10003020 3300026142 Bacteria 10086
342 Ga0209281_1000055 3300027111 Bacteria 308297
343 Ga0209281_1010834 3300027111 Bacteria 2064
344 Ga0207428_10036462 3300027907 Bacteria 4011
345 Ga0207428_10074665 3300027907 Bacteria 2659
346 Ga0268266_10000032 3300028379 Bacteria 395079
347 Ga0307517_10000429 3300028786 Bacteria 72171
348 Ga0307515_10000427 3300028794 Bacteria 101325
349 Ga0307515_10001574 3300028794 Bacteria 50970
350 Ga0307511_10143773 3300030521 Bacteria 1392
351 Ga0316179_1075791 3300030734 Bacteria 1172
352 Ga0316178_1138348 3300030735 Bacteria 19370
353 Ga0307509_10040907 3300031507 Bacteria 5037
354 Ga0307408_100124995 3300031548 Bacteria 1998
355 Ga0307405_10000308 3300031731 Bacteria 18037
356 Ga0307412_10010738 3300031911 Bacteria 5282
357 Ga0307412_10031505 3300031911 Bacteria 3350
358 Ga0307409_100042340 3300031995 Bacteria 3410
359 Ga0307414_10069589 3300032004 Bacteria 2530
360 Ga0307414_10244540 3300032004 Bacteria 1487
361 Ga0307507_10000510 3300033179 Bacteria 81853
362 Ga0307510_10001152 3300033180 Bacteria 28416
363 Ga0307510_10056409 3300033180 Bacteria 4091
364 Ga0395899_0018418 3300037312 Bacteria 5310
365 Ga0395899_0039160 3300037312 Bacteria 3550
366 Ga0395900_0000194 3300037418 Bacteria 97768
367 Ga0395900_0014468 3300037418 Bacteria 8052
368 Ga0395900_0188256 3300037418 Bacteria 2094
369 Ga0395905_0000716 3300037471 Bacteria 43859
370 Ga0395905_0017061 3300037471 Bacteria 6894
371 Ga0395905_0205600 3300037471 Bacteria 1845
372 Ga0395901_0001250 3300038443 Bacteria 27039
373 Ga0395901_0134318 3300038443 Bacteria 2600
374 Ga0436361_0211220 3300039447 Bacteria 46566
375 Ga0436361_0221882 3300039447 Bacteria 2853
376 Ga0436361_0668973 3300039447 Bacteria 4207
377 Ga0436361_0867242 3300039447 Bacteria 1308
378 Ga0436361_0882838 3300039447 Bacteria 25023
379 Ga0436361_0919984 3300039447 Bacteria 1944
380 Ga0436361_0985195 3300039447 Bacteria 2719
381 Ga0436361_1068986 3300039447 Bacteria 20698
382 Ga0436361_1085609 3300039447 Bacteria 1997
383 Ga0439438_001430 3300041405 Bacteria 10528
384 Ga0439438_001450 3300041405 Bacteria 10450
385 Ga0439438_001746 3300041405 Bacteria 9552
386 Ga0439438_009993 3300041405 Bacteria 3036
387 Ga0439438_017054 3300041405 Bacteria 2099
388 Ga0439447_000672 3300041407 Bacteria 12691
389 Ga0439447_002312 3300041407 Bacteria 6977
390 Ga0439447_009750 3300041407 Bacteria 2890
391 Ga0439447_009926 3300041407 Bacteria 2854
392 Ga0439447_023701 3300041407 Bacteria 1596
393 Ga0439466_0017383 3300041411 Bacteria 2592
394 Ga0439466_0042843 3300041411 Bacteria 1505
395 Ga0439466_0059429 3300041411 Bacteria 1234
396 Ga0439448_0021133 3300042005 Bacteria 2017
397 Ga0439432_000242 3300042006 Bacteria 19606
398 Ga0439432_012783 3300042006 Bacteria 2863
399 Ga0439432_065816 3300042006 Bacteria 1110
400 Ga0439451_006645 3300042009 Bacteria 2363
401 Ga0439452_000059 3300042010 Bacteria 101639
402 Ga0439452_001296 3300042010 Bacteria 10536
403 Ga0439452_005686 3300042010 Bacteria 3989
404 Ga0439452_011254 3300042010 Bacteria 2577
405 Ga0439452_014153 3300042010 Bacteria 2222
406 Ga0439456_003923 3300042013 Bacteria 3022
407 Ga0439456_013993 3300042013 Bacteria 1671
408 Ga0439463_000602 3300042016 Bacteria 9969
409 Ga0439463_024929 3300042016 Bacteria 1499
410 Ga0450911_000021 3300042115 Bacteria 98705
411 Ga0450911_001399 3300042115 Bacteria 5595
412 Ga0450922_000392 3300042124 Bacteria 4691
413 Ga0450923_030361 3300042125 Bacteria 1099
414 Ga0450900_006012 3300042136 Bacteria 1454
415 Ga0450902_012779 3300042137 Bacteria 1347
416 Ga0450903_002525 3300042138 Bacteria 3250
417 Ga0450903_003560 3300042138 Bacteria 2689
418 Ga0450904_001682 3300042139 Bacteria 2953
419 Ga0450906_000044 3300042145 Bacteria 20181
420 Ga0450906_008784 3300042145 Bacteria 1942
421 Ga0450907_000302 3300042146 Bacteria 16536
422 Ga0450907_001596 3300042146 Bacteria 4801
423 Ga0439434_0000011 3300042435 Bacteria 46716
424 Ga0439460_0001823 3300042461 Bacteria 5071
425 Ga0439460_0024050 3300042461 Bacteria 1684
426 Ga0466966_0033277 3300044684 Bacteria 3338
427 Ga0466957_0044881 3300044842 Bacteria 2679
428 Ga0466958_0001201 3300045836 Bacteria 12123
429 Ga0495617_000870 3300046452 Bacteria 14238
430 Ga0495617_006912 3300046452 Bacteria 3961
431 Ga0495617_009184 3300046452 Bacteria 3398
432 Ga0495617_031806 3300046452 Bacteria 1771
433 Ga0495617_034104 3300046452 Bacteria 1707
434 Ga0495617_042761 3300046452 Bacteria 1514
435 Ga0495617_070851 3300046452 Bacteria 1146
436 Ga0495627_000472 3300046453 Bacteria 34403
437 Ga0495627_004200 3300046453 Bacteria 6101
438 Ga0495627_006510 3300046453 Bacteria 4575
439 Ga0495627_006823 3300046453 Bacteria 4440
440 Ga0495603_0010705 3300046455 Bacteria 5562
441 Ga0495590_0008435 3300046457 Bacteria 3935
442 Ga0495591_000296 3300046458 Bacteria 45423
443 Ga0495591_000493 3300046458 Bacteria 31276
444 Ga0495591_000566 3300046458 Bacteria 28402
445 Ga0495591_007753 3300046458 Bacteria 4502
446 Ga0495591_010894 3300046458 Bacteria 3481
447 Ga0495591_011921 3300046458 Bacteria 3264
448 Ga0495591_012291 3300046458 Bacteria 3194
449 Ga0495591_025646 3300046458 Bacteria 1845
450 Ga0495591_033584 3300046458 Bacteria 1517
451 Ga0495591_036512 3300046458 Bacteria 1429
452 Ga0495591_037692 3300046458 Bacteria 1397
453 Ga0495591_041142 3300046458 Bacteria 1313
454 Ga0495591_056310 3300046458 Bacteria 1057
455 Ga0495629_0088909 3300046459 Bacteria 2155
456 Ga0495638_0019149 3300046460 Bacteria 4531
457 Ga0495638_0028493 3300046460 Bacteria 3605
458 Ga0495638_0034052 3300046460 Bacteria 3253
459 Ga0495638_0042937 3300046460 Bacteria 2854
460 Ga0495638_0055596 3300046460 Bacteria 2458
461 Ga0495638_0127913 3300046460 Bacteria 1495
462 Ga0495653_0178097 3300046463 Bacteria 1461
463 Ga0495650_0000119 3300046471 Bacteria 185719
464 Ga0495650_0013035 3300046471 Bacteria 4428
465 Ga0495650_0045466 3300046471 Bacteria 1848
466 Ga0495650_0053869 3300046471 Bacteria 1644
467 Ga0495605_0003359 3300046474 Bacteria 9568
468 Ga0495605_0012032 3300046474 Bacteria 4811
469 Ga0495605_0042918 3300046474 Bacteria 2244
470 Ga0495605_0052042 3300046474 Bacteria 1991
471 Ga0495605_0056648 3300046474 Bacteria 1889
472 Ga0495605_0066601 3300046474 Bacteria 1710
473 Ga0495605_0070107 3300046474 Bacteria 1658
474 Ga0495639_0047506 3300046475 Bacteria 1945
475 Ga0495639_0065198 3300046475 Bacteria 1675
476 Ga0495584_0009110 3300046491 Bacteria 5125
477 Ga0495584_0010833 3300046491 Bacteria 4679
478 Ga0495584_0012379 3300046491 Bacteria 4354
479 Ga0495584_0012396 3300046491 Bacteria 4351
480 Ga0495584_0017553 3300046491 Bacteria 3640
481 Ga0495584_0021308 3300046491 Bacteria 3293
482 Ga0495584_0072448 3300046491 Bacteria 1731
483 Ga0495584_0073410 3300046491 Bacteria 1719
484 Ga0495585_0000173 3300046492 Bacteria 69500
485 Ga0495585_0001130 3300046492 Bacteria 21890
486 Ga0495585_0005932 3300046492 Bacteria 7646
487 Ga0495585_0008849 3300046492 Bacteria 6075
488 Ga0495585_0016170 3300046492 Bacteria 4324
489 Ga0495585_0016173 3300046492 Bacteria 4324
490 Ga0495585_0019074 3300046492 Bacteria 3957
491 Ga0495585_0023103 3300046492 Bacteria 3568
492 Ga0495585_0033080 3300046492 Bacteria 2929
493 Ga0495585_0056277 3300046492 Bacteria 2172
494 Ga0495585_0082991 3300046492 Bacteria 1734
495 Ga0495585_0093164 3300046492 Bacteria 1620
496 Ga0495594_0032406 3300046499 Bacteria 2836
497 Ga0495594_0057041 3300046499 Bacteria 2156
498 Ga0495596_0043823 3300046500 Bacteria 1763
499 Ga0495596_0051765 3300046500 Bacteria 1608
500 Ga0495607_0000583 3300046501 Bacteria 35519
501 Ga0495607_0002315 3300046501 Bacteria 15623
502 Ga0495607_0010286 3300046501 Bacteria 6293
503 Ga0495607_0017311 3300046501 Bacteria 4628
504 Ga0495607_0022056 3300046501 Bacteria 4003
505 Ga0495607_0076606 3300046501 Bacteria 1849
506 Ga0495607_0104827 3300046501 Bacteria 1508
507 Ga0495583_0000393 3300046506 Bacteria 66835
508 Ga0495583_0000565 3300046506 Bacteria 51302
509 Ga0495583_0002481 3300046506 Bacteria 15672
510 Ga0495583_0009025 3300046506 Bacteria 6008
511 Ga0495583_0026909 3300046506 Bacteria 2844
512 Ga0495583_0056226 3300046506 Bacteria 1775
513 Ga0495583_0064293 3300046506 Bacteria 1628
514 Ga0495606_0000008 3300046507 Bacteria 321373
515 Ga0495606_0000016 3300046507 Bacteria 284865
516 Ga0495606_0001301 3300046507 Bacteria 34410
517 Ga0495606_0002511 3300046507 Bacteria 21151
518 Ga0495606_0004228 3300046507 Bacteria 14535
519 Ga0495606_0009581 3300046507 Bacteria 8168
520 Ga0495606_0019691 3300046507 Bacteria 5007
521 Ga0495606_0024959 3300046507 Bacteria 4292
522 Ga0495606_0032541 3300046507 Bacteria 3611
523 Ga0495606_0038983 3300046507 Bacteria 3209
524 Ga0495606_0055845 3300046507 Bacteria 2551
525 Ga0495606_0092855 3300046507 Bacteria 1852
526 Ga0495606_0103677 3300046507 Bacteria 1727
527 Ga0495606_0106635 3300046507 Bacteria 1696
528 Ga0495610_0000950 3300046512 Bacteria 26825
529 Ga0495610_0001695 3300046512 Bacteria 19375
530 Ga0495610_0002038 3300046512 Bacteria 17252
531 Ga0495610_0004779 3300046512 Bacteria 9885
532 Ga0495610_0008698 3300046512 Bacteria 6534
533 Ga0495610_0012262 3300046512 Bacteria 5173
534 Ga0495610_0019310 3300046512 Bacteria 3820
535 Ga0495610_0022519 3300046512 Bacteria 3444
536 Ga0495610_0026020 3300046512 Bacteria 3130
537 Ga0495610_0102899 3300046512 Bacteria 1276
538 Ga0495616_0003965 3300046513 Bacteria 9419
539 Ga0495616_0008966 3300046513 Bacteria 5878
540 Ga0495616_0012363 3300046513 Bacteria 4849
541 Ga0495616_0013653 3300046513 Bacteria 4574
542 Ga0495616_0015329 3300046513 Bacteria 4262
543 Ga0495616_0016860 3300046513 Bacteria 4035
544 Ga0495616_0017236 3300046513 Bacteria 3984
545 Ga0495616_0020336 3300046513 Bacteria 3614
546 Ga0495616_0058784 3300046513 Bacteria 1892
547 Ga0495616_0093139 3300046513 Bacteria 1423
548 Ga0495620_0000374 3300046515 Bacteria 30623
549 Ga0495620_0010030 3300046515 Bacteria 5010
550 Ga0495620_0012437 3300046515 Bacteria 4395
551 Ga0495620_0023330 3300046515 Bacteria 2960
552 Ga0495620_0047075 3300046515 Bacteria 1858
553 Ga0495620_0060516 3300046515 Bacteria 1578
554 Ga0495631_0000355 3300046518 Bacteria 31547
555 Ga0495631_0007027 3300046518 Bacteria 5758
556 Ga0495631_0007788 3300046518 Bacteria 5434
557 Ga0495631_0037261 3300046518 Bacteria 2167
558 Ga0495631_0039200 3300046518 Bacteria 2103
559 Ga0495631_0082888 3300046518 Bacteria 1382
560 Ga0495632_0000922 3300046519 Bacteria 25785
561 Ga0495632_0008122 3300046519 Bacteria 6493
562 Ga0495632_0012089 3300046519 Bacteria 4994
563 Ga0495632_0049483 3300046519 Bacteria 2077
564 Ga0495632_0079952 3300046519 Bacteria 1560
565 Ga0495632_0100639 3300046519 Bacteria 1362
566 Ga0495637_0000912 3300046520 Bacteria 18980
567 Ga0495637_0002577 3300046520 Bacteria 9963
568 Ga0495637_0012131 3300046520 Bacteria 4126
569 Ga0495637_0045708 3300046520 Bacteria 1855
570 Ga0495637_0047666 3300046520 Bacteria 1807
571 Ga0495637_0051225 3300046520 Bacteria 1729
572 Ga0495637_0062588 3300046520 Bacteria 1522
573 Ga0495637_0062979 3300046520 Bacteria 1516
574 Ga0495637_0070523 3300046520 Bacteria 1411
575 Ga0495637_0147525 3300046520 Bacteria 889
576 Ga0495643_0042789 3300046522 Bacteria 2466
577 Ga0495643_0136002 3300046522 Bacteria 1229
578 Ga0495643_0140189 3300046522 Bacteria 1206
579 Ga0495644_0040389 3300046523 Bacteria 1759
580 Ga0495644_0048255 3300046523 Bacteria 1599
581 Ga0495644_0099818 3300046523 Bacteria 1098
582 Ga0495648_0003303 3300046524 Bacteria 14238
583 Ga0495648_0010360 3300046524 Bacteria 7103
584 Ga0495648_0020119 3300046524 Bacteria 4669
585 Ga0495648_0022931 3300046524 Bacteria 4284
586 Ga0495648_0045334 3300046524 Bacteria 2735
587 Ga0495648_0055413 3300046524 Bacteria 2390
588 Ga0495648_0057911 3300046524 Bacteria 2320
589 Ga0495648_0062603 3300046524 Bacteria 2202
590 Ga0495648_0091771 3300046524 Bacteria 1698
591 Ga0495648_0095720 3300046524 Bacteria 1651
592 Ga0495648_0104585 3300046524 Bacteria 1554
593 Ga0495648_0143040 3300046524 Bacteria 1256
594 Ga0495648_0199712 3300046524 Bacteria 1002
595 Ga0495666_0087660 3300046526 Bacteria 1470
596 Ga0495642_0000008 3300046528 Bacteria 162190
597 Ga0495642_0000042 3300046528 Bacteria 75891
598 Ga0495654_0000247 3300046530 Bacteria 50392
599 Ga0495654_0002152 3300046530 Bacteria 12848
600 Ga0495654_0004247 3300046530 Bacteria 8563
601 Ga0495654_0009129 3300046530 Bacteria 5439
602 Ga0495654_0019471 3300046530 Bacteria 3550
603 Ga0495654_0021962 3300046530 Bacteria 3318
604 Ga0495654_0022389 3300046530 Bacteria 3282
605 Ga0495654_0026857 3300046530 Bacteria 2956
606 Ga0495654_0060686 3300046530 Bacteria 1817
607 Ga0495654_0085601 3300046530 Bacteria 1470
608 Ga0495654_0122186 3300046530 Bacteria 1177
609 Ga0495609_0007888 3300046538 Bacteria 5262
610 Ga0495609_0015803 3300046538 Bacteria 3527
611 Ga0495609_0023737 3300046538 Bacteria 2816
612 Ga0495609_0042536 3300046538 Bacteria 2040
613 Ga0495609_0074471 3300046538 Bacteria 1489
614 Ga0495609_0081176 3300046538 Bacteria 1417
615 Ga0495597_0013829 3300046542 Bacteria 3857
616 Ga0495597_0023378 3300046542 Bacteria 2858
617 Ga0495597_0032537 3300046542 Bacteria 2366
618 Ga0495597_0038539 3300046542 Bacteria 2141
619 Ga0495597_0045860 3300046542 Bacteria 1938
620 Ga0495622_0006105 3300046557 Bacteria 5597
621 Ga0495622_0023073 3300046557 Bacteria 2900
622 Ga0495622_0027135 3300046557 Bacteria 2672
623 Ga0495622_0037018 3300046557 Bacteria 2273
624 Ga0495633_0000072 3300046558 Bacteria 131197
625 Ga0495633_0012874 3300046558 Bacteria 4428
626 Ga0495633_0019024 3300046558 Bacteria 3477
627 Ga0495633_0030984 3300046558 Bacteria 2596
628 Ga0495633_0077716 3300046558 Bacteria 1545
629 Ga0495656_0017763 3300046615 Bacteria 2719
630 Ga0495668_0000009 3300046616 Bacteria 492623
631 Ga0495611_0000237 3300046648 Bacteria 38116
632 Ga0495611_0106621 3300046648 Bacteria 1303
633 Ga0495611_0155717 3300046648 Bacteria 1067
634 Ga0495625_0000017 3300046660 Bacteria 299728
635 Ga0495625_0000831 3300046660 Bacteria 42424
636 Ga0495625_0001531 3300046660 Bacteria 27626
637 Ga0495625_0004263 3300046660 Bacteria 13615
638 Ga0495625_0004710 3300046660 Bacteria 12772
639 Ga0495625_0014203 3300046660 Bacteria 6368
640 Ga0495625_0019811 3300046660 Bacteria 5206
641 Ga0495625_0041611 3300046660 Bacteria 3344
642 Ga0495625_0064010 3300046660 Bacteria 2595
643 Ga0495625_0065750 3300046660 Bacteria 2555
644 Ga0495625_0075780 3300046660 Bacteria 2353
645 Ga0495625_0081611 3300046660 Bacteria 2250
646 Ga0495625_0121051 3300046660 Bacteria 1781
647 Ga0495625_0138473 3300046660 Bacteria 1643
648 Ga0495625_0147148 3300046660 Bacteria 1585
649 Ga0495625_0201716 3300046660 Bacteria 1312
650 Ga0495625_0266612 3300046660 Bacteria 1106
651 Ga0495659_0016010 3300046664 Bacteria 2469
652 Ga0495659_0051133 3300046664 Bacteria 1504
653 Ga0495661_0000083 3300046665 Bacteria 116027
654 Ga0495661_0004073 3300046665 Bacteria 10647
655 Ga0495661_0007434 3300046665 Bacteria 7639
656 Ga0495661_0035519 3300046665 Bacteria 3126
657 Ga0495661_0046344 3300046665 Bacteria 2655
658 Ga0495661_0062988 3300046665 Bacteria 2194
659 Ga0495661_0078905 3300046665 Bacteria 1903
660 Ga0495661_0080558 3300046665 Bacteria 1878
661 Ga0495661_0085826 3300046665 Bacteria 1803
662 Ga0495661_0091530 3300046665 Bacteria 1729
663 Ga0495661_0116157 3300046665 Bacteria 1485
664 Ga0495661_0125569 3300046665 Bacteria 1412
665 Ga0495588_0041348 3300046674 Bacteria 2353
666 Ga0495588_0045254 3300046674 Bacteria 2256
667 Ga0495588_0111080 3300046674 Bacteria 1444
668 Ga0495588_0175823 3300046674 Bacteria 1131
669 Ga0495646_0022272 3300046680 Bacteria 3997
670 Ga0495658_0018289 3300046683 Bacteria 3641
671 Ga0495669_0073974 3300046684 Bacteria 1557
672 Ga0495613_0026066 3300046689 Bacteria 4356
673 Ga0495624_0000375 3300046690 Bacteria 35610
674 Ga0495670_0006113 3300046691 Bacteria 5907
675 Ga0495670_0013452 3300046691 Bacteria 4025
676 Ga0495670_0018020 3300046691 Bacteria 3478
677 Ga0495670_0054151 3300046691 Bacteria 2009
678 Ga0495670_0077162 3300046691 Bacteria 1693
679 Ga0495670_0093581 3300046691 Bacteria 1540
680 Ga0495670_0143613 3300046691 Bacteria 1249
681 Ga0495671_0000078 3300046692 Bacteria 93314
682 Ga0495671_0005595 3300046692 Bacteria 7333
683 Ga0495671_0015967 3300046692 Bacteria 4018
684 Ga0495671_0024323 3300046692 Bacteria 3155
685 Ga0495671_0033887 3300046692 Bacteria 2599
686 Ga0495671_0042385 3300046692 Bacteria 2287
687 Ga0495671_0063573 3300046692 Bacteria 1817
688 Ga0495671_0073070 3300046692 Bacteria 1683
689 Ga0495671_0075975 3300046692 Bacteria 1647
690 Ga0495671_0122729 3300046692 Bacteria 1267
691 Ga0495649_0000121 3300046694 Bacteria 68443
692 Ga0495649_0008007 3300046694 Bacteria 6386
693 Ga0495649_0014048 3300046694 Bacteria 4600
694 Ga0495649_0014159 3300046694 Bacteria 4580
695 Ga0495649_0016475 3300046694 Bacteria 4188
696 Ga0495649_0019747 3300046694 Bacteria 3784
697 Ga0495649_0029003 3300046694 Bacteria 3065
698 Ga0495649_0054483 3300046694 Bacteria 2163
699 Ga0495649_0069511 3300046694 Bacteria 1888
700 Ga0495649_0133836 3300046694 Bacteria 1307
701 Ga0495589_0001533 3300046794 Bacteria 13305
702 Ga0495589_0003419 3300046794 Bacteria 8593
703 Ga0495589_0008918 3300046794 Bacteria 5219
704 Ga0495589_0013295 3300046794 Bacteria 4248
705 Ga0495589_0072385 3300046794 Bacteria 1683
706 Ga0495589_0085637 3300046794 Bacteria 1531
707 Ga0495660_0002089 3300046810 Bacteria 12940
708 Ga0495660_0016523 3300046810 Bacteria 4254
709 Ga0495660_0016617 3300046810 Bacteria 4242
710 Ga0495660_0022892 3300046810 Bacteria 3565
711 Ga0495660_0027263 3300046810 Bacteria 3233
712 Ga0495660_0064559 3300046810 Bacteria 1956
713 Ga0495660_0131219 3300046810 Bacteria 1257
714 Ga0495604_0046135 3300047317 Bacteria 3397
715 Ga0495636_0040592 3300047318 Bacteria 1929
716 Ga0495672_0000899 3300047320 Bacteria 31152
717 Ga0495672_0003453 3300047320 Bacteria 13522
718 Ga0495672_0009377 3300047320 Bacteria 7098
719 Ga0495672_0023438 3300047320 Bacteria 3995
720 Ga0495672_0024411 3300047320 Bacteria 3894
721 Ga0495672_0065356 3300047320 Bacteria 2079
722 Ga0495672_0066594 3300047320 Bacteria 2054
723 Ga0495672_0104905 3300047320 Bacteria 1526
724 Ga0495672_0123492 3300047320 Bacteria 1372
725 Ga0495676_0023687 3300047321 Bacteria 5323
726 Ga0495680_0002703 3300047322 Bacteria 17898
727 Ga0495683_0001770 3300047323 Bacteria 13612
728 Ga0495683_0001796 3300047323 Bacteria 13527
729 Ga0495683_0016005 3300047323 Bacteria 3895
730 Ga0495683_0041954 3300047323 Bacteria 2307
731 Ga0495683_0067597 3300047323 Bacteria 1759
732 Ga0495683_0118944 3300047323 Bacteria 1255
733 Ga0495687_000902 3300047443 Bacteria 31106
734 Ga0495687_005379 3300047443 Bacteria 8182
735 Ga0495687_020573 3300047443 Bacteria 3212
736 Ga0495677_0006346 3300047445 Bacteria 4465
737 Ga0495679_000877 3300047446 Bacteria 18861
738 Ga0495679_005883 3300047446 Bacteria 5378
739 Ga0495679_010191 3300047446 Bacteria 3706
740 Ga0495679_027145 3300047446 Bacteria 1893
741 Ga0495679_038958 3300047446 Bacteria 1485
742 Ga0495679_041748 3300047446 Bacteria 1418
743 Ga0495673_0001089 3300047469 Bacteria 23654
744 Ga0495673_0003850 3300047469 Bacteria 9681
745 Ga0495673_0025014 3300047469 Bacteria 2873
746 Ga0495673_0025424 3300047469 Bacteria 2843
747 Ga0495673_0030232 3300047469 Bacteria 2546
748 Ga0495673_0042691 3300047469 Bacteria 2033
749 Ga0495673_0047749 3300047469 Bacteria 1890
750 Ga0495681_0000368 3300047470 Bacteria 35164
751 Ga0495681_0013414 3300047470 Bacteria 4752
752 Ga0495681_0018316 3300047470 Bacteria 3861
753 Ga0495681_0024203 3300047470 Bacteria 3205
754 Ga0495681_0030700 3300047470 Bacteria 2732
755 Ga0495681_0055218 3300047470 Bacteria 1852
756 Ga0495681_0061625 3300047470 Bacteria 1727
757 Ga0495681_0093693 3300047470 Bacteria 1322
758 Ga0495684_0111704 3300047471 Bacteria 2062
759 Ga0495686_0001124 3300047472 Bacteria 31635
760 Ga0495686_0003529 3300047472 Bacteria 13475
761 Ga0495686_0008633 3300047472 Bacteria 7443
762 Ga0495686_0017772 3300047472 Bacteria 4786
763 Ga0495686_0050886 3300047472 Bacteria 2601
764 Ga0495686_0141853 3300047472 Bacteria 1417
765 Ga0495593_0047038 3300047673 Bacteria 2296
766 Ga0495602_0002824 3300048088 Bacteria 17768
767 Ga0495626_0002208 3300048091 Bacteria 13956
768 Ga0495626_0002697 3300048091 Bacteria 11998
769 Ga0495626_0005609 3300048091 Bacteria 7277
770 Ga0495626_0010358 3300048091 Bacteria 4977
771 Ga0495626_0011647 3300048091 Bacteria 4642
772 Ga0495626_0017276 3300048091 Bacteria 3648
773 Ga0495626_0019649 3300048091 Bacteria 3376
774 Ga0495626_0024676 3300048091 Bacteria 2945
775 Ga0495626_0032891 3300048091 Bacteria 2487
776 Ga0495626_0112366 3300048091 Bacteria 1178
777 Ga0496107_0333256 3300048910 Bacteria 1129
778 Ga0496110_0084401 3300048913 Bacteria 2834
779 Ga0496112_0043696 3300048915 Bacteria 4388
780 Ga0496115_0000196 3300048918 Bacteria 56608
781 Ga0496115_0199741 3300048918 Bacteria 1652
782 Ga0496116_0000114 3300048919 Bacteria 174131
783 Ga0496116_0002218 3300048919 Bacteria 20659
784 Ga0496116_0017123 3300048919 Bacteria 5641
785 Ga0496116_0097036 3300048919 Bacteria 1773
786 Ga0496116_0111009 3300048919 Bacteria 1611
787 Ga0496117_0000654 3300048920 Bacteria 55492
788 Ga0496117_0001257 3300048920 Bacteria 37760
789 Ga0496117_0007831 3300048920 Bacteria 10277
790 Ga0496117_0011197 3300048920 Bacteria 8055
791 Ga0496117_0040370 3300048920 Bacteria 3432
792 Ga0496117_0115402 3300048920 Bacteria 1662
793 Ga0496117_0133402 3300048920 Bacteria 1500
794 Ga0496117_0180858 3300048920 Bacteria 1212
795 Ga0496118_0026967 3300048921 Bacteria 4875
796 Ga0496118_0029390 3300048921 Bacteria 4609
797 Ga0496118_0045743 3300048921 Bacteria 3412
798 Ga0496118_0056650 3300048921 Bacteria 2944
799 Ga0496118_0073983 3300048921 Bacteria 2437
800 Ga0496118_0118987 3300048921 Bacteria 1728
801 Ga0496119_0007077 3300048922 Bacteria 10203
802 Ga0496119_0024521 3300048922 Bacteria 4240
803 Ga0496119_0085653 3300048922 Bacteria 1803
804 Ga0496120_0005052 3300048923 Bacteria 10696
805 Ga0496120_0023266 3300048923 Bacteria 3880
806 Ga0496120_0130690 3300048923 Bacteria 1286
807 Ga0496121_0000286 3300048924 Bacteria 104838
808 Ga0496121_0027827 3300048924 Bacteria 5279
809 Ga0496121_0157549 3300048924 Bacteria 1664
810 Ga0496121_0170770 3300048924 Bacteria 1580
811 Ga0496122_0004747 3300048925 Bacteria 16654
812 Ga0496122_0006189 3300048925 Bacteria 13889
813 Ga0496122_0037766 3300048925 Bacteria 3881
814 Ga0496122_0157104 3300048925 Bacteria 1393
815 Ga0496122_0185700 3300048925 Bacteria 1233
816 Ga0496123_0000709 3300048926 Bacteria 54590
817 Ga0496123_0002397 3300048926 Bacteria 23427
818 Ga0496123_0022339 3300048926 Bacteria 4879
819 Ga0496123_0024318 3300048926 Bacteria 4607
820 Ga0496123_0026470 3300048926 Bacteria 4342
821 Ga0496123_0052966 3300048926 Bacteria 2686
822 Ga0496123_0162170 3300048926 Bacteria 1190
823 Ga0496124_0003392 3300048927 Bacteria 19563
824 Ga0496124_0024765 3300048927 Bacteria 5448
825 Ga0496124_0050291 3300048927 Bacteria 3552
826 Ga0496124_0067215 3300048927 Bacteria 2983
827 Ga0496124_0125675 3300048927 Bacteria 2043
828 Ga0496124_0166370 3300048927 Bacteria 1713
829 Ga0496125_0000266 3300048928 Bacteria 107204
830 Ga0496125_0002439 3300048928 Bacteria 24162
831 Ga0496125_0007844 3300048928 Bacteria 11282
832 Ga0496125_0007972 3300048928 Bacteria 11185
833 Ga0496125_0011480 3300048928 Bacteria 8854
834 Ga0496125_0016074 3300048928 Bacteria 7203
835 Ga0496125_0016812 3300048928 Bacteria 7012
836 Ga0496125_0054788 3300048928 Bacteria 3256
837 Ga0496125_0138126 3300048928 Bacteria 1700
838 Ga0496125_0144959 3300048928 Bacteria 1643
839 Ga0496125_0155748 3300048928 Bacteria 1561
840 Ga0496126_0015231 3300048929 Bacteria 7741
841 Ga0496126_0046630 3300048929 Bacteria 3972
842 Ga0496126_0174490 3300048929 Bacteria 1829
843 Ga0495678_000453 3300049459 Bacteria 40691
844 Ga0495678_007247 3300049459 Bacteria 5776
845 Ga0495678_008194 3300049459 Bacteria 5304
846 Ga0495678_008230 3300049459 Bacteria 5289
847 Ga0495678_040218 3300049459 Bacteria 1881
848 Ga0495678_046394 3300049459 Bacteria 1708
849 Ga0495678_082199 3300049459 Bacteria 1153
850 Ga0495682_0004703 3300049460 Bacteria 5779
851 Ga0495682_0005360 3300049460 Bacteria 5338
852 Ga0495682_0007775 3300049460 Bacteria 4246
853 Ga0495682_0015513 3300049460 Bacteria 2886
854 Ga0495682_0016621 3300049460 Bacteria 2784
855 Ga0495682_0031696 3300049460 Bacteria 1953
856 nmdc:mga0k408_1786_c1 3300050493 Bacteria 11530
857 nmdc:mga0k408_296_c1 3300050493 Bacteria 27045
858 nmdc:mga08x19_220535_c1 3300050514 Bacteria 1303
859 Ga0500641_0000076 3300053096 Bacteria 40059
860 Ga0500572_019674 3300053111 Bacteria 1766
861 Ga0500592_001686 3300053116 Bacteria 3580
862 Ga0500608_002735 3300053122 Bacteria 6488
863 Ga0500608_005577 3300053122 Bacteria 5021
864 Ga0500618_000040 3300053125 Bacteria 112548
865 Ga0500621_078893 3300053126 Bacteria 1321
866 Ga0500642_0047750 3300053130 Bacteria 1877
867 Ga0500564_053743 3300053138 Bacteria 1839
868 Ga0500622_0035466 3300053156 Bacteria 2610
869 Ga0500622_0071357 3300053156 Bacteria 1755
870 Ga0500624_000837 3300053157 Bacteria 6970
871 Ga0500634_0001078 3300053161 Bacteria 10072
872 2511248938 2511231003 Bacteria 5606035
873 2511254223 2511231004 Bacteria 6669789
874 2511267397 2511231006 Bacteria 6794709
875 2511278382 2511231008 Bacteria 6624100
876 2511292631 2511231010 Bacteria 6373152
877 2511298100 2511231011 Bacteria 6149768
878 2511300983 2511231012 Bacteria 6738011
879 2511314304 2511231014 Bacteria 6462302
880 2511318950 2511231015 Bacteria 6598026
881 2511324440 2511231016 Bacteria 6704427
882 2511330273 2511231017 Bacteria 6503007
883 2511350826 2511231020 Bacteria 6115223
884 2511367826 2511231023 Bacteria 6808468
885 2511415490 2511231031 Bacteria 6558529
886 2512325432 2512047018 Bacteria 6663241
887 2547501632 2547132130 Bacteria 4660562
888 2555670692 2554235341 Bacteria 6867980
889 2583793220 2582580891 Bacteria 6800976
890 2597864307 2597489888 Bacteria 6179543
891 2597869532 2597489889 Bacteria 6297495
892 2599357757 2599185160 Bacteria 6844013
893 2599358630 2599185161 Bacteria 6960462
894 2599365849 2599185162 Bacteria 6957254
895 2599371273 2599185163 Bacteria 6995158
896 2599382528 2599185164 Bacteria 6841688
897 2599388975 2599185165 Bacteria 6843250
898 2599390182 2599185166 Bacteria 6959206
899 2599401944 2599185167 Bacteria 6353609
900 2599402316 2599185168 Bacteria 6997636
901 2599453864 2599185179 Bacteria 6611171
902 2599463755 2599185181 Bacteria 6844519
903 2599471560 2599185182 Bacteria 6883168
904 2599476629 2599185184 Bacteria 6430550
905 2599492774 2599185186 Bacteria 6831633
906 2599510035 2599185189 Bacteria 5862825
907 2599515438 2599185190 Bacteria 6285678
908 2599521456 2599185191 Bacteria 6297582
909 2599881069 2599185288 Bacteria 6666191
910 2599884209 2599185289 Bacteria 6778765
911 2599894817 2599185290 Bacteria 6289611
912 2599899214 2599185291 Bacteria 6775623
913 2599949648 2599185303 Bacteria 6512725
914 2599958650 2599185305 Bacteria 6748700
915 2599994640 2599185311 Bacteria 6354990
916 2600003486 2599185313 Bacteria 6658188
917 2600018063 2599185315 Bacteria 6771107
918 2600022748 2599185316 Bacteria 6320029
919 2600042192 2599185319 Bacteria 6637840
920 2600052582 2599185321 Bacteria 6764560
921 2600064850 2599185323 Bacteria 6688755
922 2600069490 2599185324 Bacteria 6590677
923 2600076116 2599185325 Bacteria 6324919
924 2600216887 2599185356 Bacteria 6843884
925 2601691627 2600255296 Bacteria 5784754
926 2601777058 2600255313 Bacteria 6842543
927 2601798720 2600255318 Bacteria 6383414
928 2606077614 2603880185 Bacteria 6379190
929 2606130211 2603880199 Bacteria 6377649
930 2621300173 2619619299 Bacteria 6649820
931 2624481115 2623620443 Bacteria 6427864
932 2643871039 2643221571 Bacteria 6228673
933 2643954168 2643221589 Bacteria 6250934
934 2644022977 2643221602 Bacteria 6249926
935 2644185744 2643221633 Bacteria 6733554
936 2644622470 2643221713 Bacteria 6554480
937 2671091356 2667528170 Bacteria 6786960
938 2671096195 2667528171 Bacteria 6900659
939 2677901137 2675903420 Bacteria 6247433
940 2715750636 2713897148 Bacteria 5883533
941 2715757168 2713897149 Bacteria 6506249
942 2723248452 2721755607 Bacteria 5841722
943 2738675130 2738541265 Bacteria 6594665
944 2738753420 2738541282 Bacteria 6593925
945 2738810512 2738541294 Bacteria 6925949
946 2738862332 2738541303 Bacteria 6591772
947 2738897872 2738541309 Bacteria 6926455
948 2739257026 2738543015 Bacteria 6750701
949 2739313142 2738543025 Bacteria 6600348
950 2743738345 2740892503 Bacteria 6855563
951 2774120199 2773857670 Bacteria 6407454
952 2774134088 2773857673 Bacteria 6513460
953 2784264145 2784132063 Bacteria 6262788
954 2784311870 2784132072 Bacteria 6596533
955 2808932828 2808606377 Bacteria 6646337
956 2808954950 2808606381 Bacteria 6646461
957 2808978517 2808606385 Bacteria 6711065
958 2808993956 2808606388 Bacteria 6706662
959 2809215133 2808606445 Bacteria 6057339
960 2816518412 2816332141 Bacteria 4436036
961 2817491519 2816332298 Bacteria 6852809
962 2819658021 2818991456 Bacteria 6123676
963 2819700371 2818991464 Bacteria 6907494
964 2834033412 2834028612 Bacteria 6354979
965 2842394479 2842391507 Bacteria 4486072
966 2842827264 2842826826 Bacteria 5974129
967 2842835079 2842832357 Bacteria 5959113
968 2842841680 2842837860 Bacteria 6066181
969 2842846816 2842843487 Bacteria 6004777
970 2844671302 2844665904 Bacteria 6817974
971 2852617453 2852612431 Bacteria 6885235
972 2852625156 2852623160 Bacteria 4376875
973 2852657770 2852657418 Bacteria 6472974
974 2852672428 2852667396 Bacteria 6885555
975 2860870392 2860867994 Bacteria 5645326
976 2878033053 2878029506 Bacteria 6418441
977 2880233775 2880230671 Bacteria 6140320
978 2884934171 2884933994 Bacteria 4535041
979 2904523914 2904518522 Bacteria 6068986
980 2904552001 2904550169 Bacteria 6221258
981 2908450144 2908446538 Bacteria 6829095
982 2912967191 2912963787 Bacteria 5646108
983 2917074525 2917070673 Bacteria 6868303
984 2919067202 2919063839 Bacteria 6302690
985 2919137027 2919134579 Bacteria 4480386
986 2919390177 2919385768 Bacteria 5897293
987 2919442719 2919437846 Bacteria 6199444
988 2919460484 2919456309 Bacteria 6586567
989 2919489327 2919487758 Bacteria 5929766
990 2923157400 2923153595 Bacteria 6870622
991 2928078578 2928078545 Bacteria 6534839
992 2928151745 2928147474 Bacteria 6512076
993 2929192228 2929189879 Bacteria 5930554
994 2931370221 2931369376 Bacteria 6847892
995 2931394328 2931390751 Bacteria 6273349
996 2932084360 2932082852 Bacteria 6563563
997 2935355413 2935353572 Unclassified 6955622
998 2939642648 2939636861 Bacteria 6297853
999 2945933852 2945928738 Bacteria 6053221
1000 2945964245 2945961074 Bacteria 7342064
1001 2946030645 2946027586 Bacteria 6049274
1002 2947237451 2947233263 Bacteria 6439278
1003 2961064846 2961064222 Bacteria 4749990
1004 2969307959 2969304461 Bacteria 6601805
1005 2971404873 2971403814 Bacteria 7370929
1006 2984288735 2984286254 Bacteria 6702062
1007 2998142457 2998139840 Bacteria 6073514
1008 3007513945 3007511990 Bacteria 6481491
1009 3007616812 3007614139 Bacteria 6053559
1010 3007724260 3007718800 Bacteria 5971527
1011 3007856620 3007855910 Bacteria 5637581
1012 3007861627 3007861166 Bacteria 6045338
1013 637321042 637000220 Bacteria 7074893
1014 8015691554 8015687852 Bacteria 6613826
1015 8029998239 8029995093 Bacteria 5990776
1016 8054290704 8054285046 Bacteria 6919322
1017 8054347960 8054347763 Bacteria 5901107
1018 8054505823 8054503363 Bacteria 6101651
1019 8055774761 8055770955 Bacteria 6827675
1020 8055820457 8055817908 Bacteria 6609162
1021 8056128530 8056125926 Bacteria 6228218
1022 8056135075 8056131705 Bacteria 6107031
1023 8056149840 8056148874 Bacteria 6479865
1024 8056159169 8056155041 Bacteria 6486948
1025 8056166462 8056161164 Bacteria 6106669
1026 8056168623 8056166840 Bacteria 5820959
1027 8056173991 8056172158 Bacteria 6133900
1028 8056177880 8056177738 Bacteria 6748268
1029 8056571278 8056569372 Bacteria 5997322
1030 Ga0495679_000404
1031 MRS2a_Contig_103
1032 JGI24736J21556_1005902
1033 JGI24737J22298_10000796
1034 JGI24737J22298_10007923
1035 JGI24735J21928_10000008
1036 JGI25155J39150_1000126
1037 JGI25156J39149_1009124
1038 JGI25162J39368_1000013
1039 JGI25162J39368_1000047
1040 JGI25162J39368_1000135
1041 JGI25162J39368_1000183
1042 JGI25162J39368_1001813
1043 JGI25154J39366_1000206
1044 JGI25163J39215_1000183
1045 JGI25163J39215_1000226
1046 JGI25163J39215_1000268
1047 JGI25164J39214_1000005
1048 JGI25164J39214_1000103
1049 JGI25165J46597_1000099
1050 JGI25165J46597_1000214
1051 rootH2_10013605
1052 rootH2_10017421
1053 rootH2_10117289
1054 rootH2_10313513
1055 rootL2_10104135
1056 rootH1_10032017
1057 rootH1_10193823
1058 Ga0055538_1000075
1059 Ga0055539_1000113
1060 Ga0055533_1000120
1061 Ga0055532_1000107
1062 Ga0055525_1000158
1063 Ga0055535_1007312
1064 Ga0055536_1000021
1065 Ga0055536_1000190
1066 Ga0055530_10000002
1067 Ga0055530_10000006
1068 Ga0055530_10005998
1069 Ga0055530_10035830
1070 Ga0055540_1000009
1071 Ga0055540_1000051
1072 Ga0055540_1000490
1073 Ga0055531_10000070
1074 Ga0055541_1000076
1075 Ga0065714_10000204
1076 Ga0065714_10007643
1077 Ga0065714_10008799
1078 Ga0065714_10009693
1079 Ga0065714_10064666
1080 Ga0065714_10084335
1081 Ga0065714_10145193
1082 Ga0065712_10077106
1083 Ga0065712_10083103
1084 Ga0065715_10312309
1085 Ga0070658_10000014
1086 Ga0070658_10042733
1087 Ga0070658_10111772
1088 Ga0070658_10319766
1089 Ga0070676_10024076
1090 Ga0070670_100002833
1091 Ga0070670_100003592
1092 Ga0070680_100113689
1093 Ga0070682_100140189
1094 Ga0068868_100033977
1095 Ga0068868_100174672
1096 Ga0070660_100109575
1097 Ga0070660_100244652
1098 Ga0070661_100000025
1099 Ga0070669_100001350
1100 Ga0070669_100011648
1101 Ga0070671_100005292
1102 Ga0070659_100000148
1103 Ga0070678_100000566
1104 Ga0070662_100000054
1105 Ga0070662_100012024
1106 Ga0070681_10063938
1107 Ga0068867_100009805
1108 Ga0070679_100010692
1109 Ga0070679_100087045
1110 Ga0070684_100154977
1111 Ga0068853_100031762
1112 Ga0070665_100000010
1113 Ga0070665_100082756
1114 Ga0068855_100033283
1115 Ga0068855_100125751
1116 Ga0068855_100264905
1117 Ga0068855_100538583
1118 Ga0070664_100000019
1119 Ga0068854_100271770
1120 Ga0068854_100292771
1121 Ga0068856_100000023
1122 Ga0068856_100005294
1123 Ga0068852_100004334
1124 Ga0068866_10050089
1125 Ga0068861_100151749
1126 Ga0068851_10000374
1127 Ga0075364_10107354
1128 Ga0075366_10000507
1129 Ga0075366_10001582
1130 Ga0097621_100000247
1131 Ga0068871_100003906
1132 Ga0068865_100000076
1133 Ga0075436_100254380
1134 Ga0079104_1000081
1135 Ga0079104_1012017
1136 Ga0105251_10001274
1137 Ga0105251_10004867
1138 Ga0105251_10012899
1139 Ga0105251_10023891
1140 Ga0105251_10035947
1141 Ga0105244_10001220
1142 Ga0105244_10002515
1143 Ga0105244_10002808
1144 Ga0105244_10027155
1145 Ga0105244_10035204
1146 Ga0105244_10093060
1147 Ga0105250_10000087
1148 Ga0105250_10000267
1149 Ga0105250_10002218
1150 Ga0105250_10084611
1151 Ga0105240_10000173
1152 Ga0105240_10048462
1153 Ga0105240_10065366
1154 Ga0105240_10237399
1155 Ga0105243_10000067
1156 Ga0105243_10000337
1157 Ga0105243_10008683
1158 Ga0105243_10050347
1159 Ga0105241_10001338
1160 Ga0105241_10021419
1161 Ga0105242_10002307
1162 Ga0105242_10003180
1163 Ga0105242_10401789
1164 Ga0105237_10002438
1165 Ga0105237_10002957
1166 Ga0105237_10006614
1167 Ga0105237_10008782
1168 Ga0105237_10015332
1169 Ga0105239_10000816
1170 Ga0105239_10003173
1171 Ga0105239_10017987
1172 Ga0105239_10047642
1173 Ga0105239_10086933
1174 Ga0105239_10110143
1175 Ga0105239_10194163
1176 Ga0105246_10000469
1177 Ga0105246_10000586
1178 Ga0105246_10021731
1179 Ga0105246_10021760
1180 Ga0157345_1000289
1181 Ga0157373_10000284
1182 Ga0157373_10000746
1183 Ga0157373_10003109
1184 Ga0157373_10009443
1185 Ga0157373_10016882
1186 Ga0157373_10026359
1187 Ga0157373_10039620
1188 Ga0157373_10040884
1189 Ga0157373_10053258
1190 Ga0157373_10240657
1191 Ga0157371_10000298
1192 Ga0157371_10000308
1193 Ga0157370_10024460
1194 Ga0157370_10028024
1195 Ga0157370_10108148
1196 Ga0157369_10001344
1197 Ga0157369_10003664
1198 Ga0157369_10004545
1199 Ga0157369_10007394
1200 Ga0157369_10035679
1201 Ga0157369_10095042
1202 Ga0157374_10001476
1203 Ga0157374_10002139
1204 Ga0157374_10005179
1205 Ga0163162_10000075
1206 Ga0163162_10000082
1207 Ga0163162_10007367
1208 Ga0163162_10071839
1209 Ga0163162_10176704
1210 Ga0163162_10360378
1211 Ga0157372_10000071
1212 Ga0157372_10002043
1213 Ga0157372_10005233
1214 Ga0157372_10022369
1215 Ga0157372_10139570
1216 Ga0157375_10000312
1217 Ga0157375_10004026
1218 Ga0157375_10062535
1219 Ga0157375_10118484
1220 Ga0182008_10002137
1221 Ga0182008_10002346
1222 Ga0182008_10005700
1223 Ga0182008_10012243
1224 Ga0182008_10051361
1225 Ga0182008_10064865
1226 Ga0157376_10079089
1227 Ga0182006_1000794
1228 Ga0182006_1004990
1229 Ga0182006_1006185
1230 Ga0182006_1036177
1231 Ga0182006_1045074
1232 Ga0182006_1087605
1233 Ga0182007_10001805
1234 Ga0182007_10040970
1235 Ga0182005_1005881
1236 Ga0182005_1027507
1237 Ga0182005_1027733
1238 Ga0163161_10000167
1239 Ga0163161_10001360
1240 Ga0163161_10025013
1241 Ga0163161_10026293
1242 Ga0163161_10026513
1243 Ga0163161_10028075
1244 Ga0163161_10045106
1245 Ga0163161_10062320
1246 Ga0163161_10129330
1247 Ga0213872_10000597
1248 Ga0213872_10001019
1249 Ga0213872_10002575
1250 Ga0213872_10016991
1251 Ga0213872_10024639
1252 Ga0213872_10031662
1253 Ga0213872_10035629
1254 Ga0213872_10038438
1255 Ga0209435_100201
1256 Ga0209435_101268
1257 Ga0209760_100035
1258 Ga0209760_100923
1259 Ga0209784_100113
1260 Ga0209566_100138
1261 Ga0209674_100158
1262 Ga0209672_101444
1263 Ga0209147_100167
1264 Ga0209563_100134
1265 Ga0209563_100887
1266 Ga0207427_100015
1267 Ga0207427_100018
1268 Ga0209437_100027
1269 Ga0209437_100031
1270 Ga0209437_100089
1271 Ga0209258_101107
1272 Ga0209646_1000093
1273 Ga0209646_1002448
1274 Ga0209026_1000537
1275 Ga0209026_1002474
1276 Ga0209026_1004259
1277 Ga0209026_1006723
1278 Ga0209677_100104
1279 Ga0209759_1000248
1280 Ga0209129_1013944
1281 Ga0209233_1000012
1282 Ga0209233_1000039
1283 Ga0209233_1001941
1284 Ga0209675_1007568
1285 Ga0209676_1000002
1286 Ga0209676_1000017
1287 Ga0209676_1001754
1288 Ga0209676_1027203
1289 Ga0209050_1000006
1290 Ga0209050_1000009
1291 Ga0209050_1000062
1292 Ga0209050_1000318
1293 Ga0209051_1000001
1294 Ga0209051_1000008
1295 Ga0209051_1000060
1296 Ga0209051_1032530
1297 Ga0209257_1000171
1298 Ga0209257_1014560
1299 Ga0207696_1000002
1300 Ga0207696_1000041
1301 Ga0207696_1000948
1302 Ga0207696_1004218
1303 Ga0207655_1000137
1304 Ga0207655_1000171
1305 Ga0207655_1002517
1306 Ga0207655_1006436
1307 Ga0207655_1008643
1308 Ga0207655_1009931
1309 Ga0207655_1021409
1310 Ga0207655_1022261
1311 Ga0207713_1000281
1312 Ga0207713_1004734
1313 Ga0207713_1007192
1314 Ga0207713_1009201
1315 Ga0207713_1009264
1316 Ga0207713_1011920
1317 Ga0207713_1039843
1318 Ga0207713_1058938
1319 Ga0207642_10014697
1320 Ga0207647_10000046
1321 Ga0207647_10000154
1322 Ga0207645_10002749
1323 Ga0207705_10000107
1324 Ga0207705_10033443
1325 Ga0207705_10088234
1326 Ga0207654_10010413
1327 Ga0207707_10171326
1328 Ga0207695_10000053
1329 Ga0207695_10024070
1330 Ga0207695_10114600
1331 Ga0207671_10002724
1332 Ga0207671_10003316
1333 Ga0207671_10003530
1334 Ga0207671_10003802
1335 Ga0207671_10006180
1336 Ga0207671_10007283
1337 Ga0207657_10131011
1338 Ga0207649_10000207
1339 Ga0207652_10007878
1340 Ga0207681_10015197
1341 Ga0207650_10000516
1342 Ga0207650_10002439
1343 Ga0207644_10006244
1344 Ga0207690_10000228
1345 Ga0207706_10000669
1346 Ga0207706_10024291
1347 Ga0207686_10005287
1348 Ga0207709_10000004
1349 Ga0207709_10000663
1350 Ga0207709_10000732
1351 Ga0207709_10165528
1352 Ga0207704_10000189
1353 Ga0207711_10165588
1354 Ga0207661_10135910
1355 Ga0207679_10000045
1356 Ga0207667_10000023
1357 Ga0207667_10001774
1358 Ga0207667_10033758
1359 Ga0207667_10107432
1360 Ga0207667_10252408
1361 Ga0207668_10078689
1362 Ga0207640_10174368
1363 Ga0207639_10013514
1364 Ga0207639_10039694
1365 Ga0207639_10223629
1366 Ga0207702_10000314
1367 Ga0207702_10050863
1368 Ga0207648_10001991
1369 Ga0207683_10023135
1370 Ga0207698_10003020
1371 Ga0209281_1000055
1372 Ga0209281_1010834
1373 Ga0207428_10036462
1374 Ga0207428_10074665
1375 Ga0268266_10000032
1376 Ga0307517_10000429
1377 Ga0307515_10000427
1378 Ga0307515_10001574
1379 Ga0307511_10143773
1380 Ga0316179_1075791
1381 Ga0316178_1138348
1382 Ga0307509_10040907
1383 Ga0307408_100124995
1384 Ga0307405_10000308
1385 Ga0307412_10010738
1386 Ga0307412_10031505
1387 Ga0307409_100042340
1388 Ga0307414_10069589
1389 Ga0307414_10244540
1390 Ga0307507_10000510
1391 Ga0307510_10001152
1392 Ga0307510_10056409
1393 Ga0395899_0018418
1394 Ga0395899_0039160
1395 Ga0395900_0000194
1396 Ga0395900_0014468
1397 Ga0395900_0188256
1398 Ga0395905_0000716
1399 Ga0395905_0017061
1400 Ga0395905_0205600
1401 Ga0395901_0001250
1402 Ga0395901_0134318
1403 Ga0436361_0211220
1404 Ga0436361_0221882
1405 Ga0436361_0668973
1406 Ga0436361_0867242
1407 Ga0436361_0882838
1408 Ga0436361_0919984
1409 Ga0436361_0985195
1410 Ga0436361_1068986
1411 Ga0436361_1085609
1412 Ga0439438_001430
1413 Ga0439438_001450
1414 Ga0439438_001746
1415 Ga0439438_009993
1416 Ga0439438_017054
1417 Ga0439447_000672
1418 Ga0439447_002312
1419 Ga0439447_009750
1420 Ga0439447_009926
1421 Ga0439447_023701
1422 Ga0439466_0017383
1423 Ga0439466_0042843
1424 Ga0439466_0059429
1425 Ga0439448_0021133
1426 Ga0439432_000242
1427 Ga0439432_012783
1428 Ga0439432_065816
1429 Ga0439451_006645
1430 Ga0439452_000059
1431 Ga0439452_001296
1432 Ga0439452_005686
1433 Ga0439452_011254
1434 Ga0439452_014153
1435 Ga0439456_003923
1436 Ga0439456_013993
1437 Ga0439463_000602
1438 Ga0439463_024929
1439 Ga0450911_000021
1440 Ga0450911_001399
1441 Ga0450922_000392
1442 Ga0450923_030361
1443 Ga0450900_006012
1444 Ga0450902_012779
1445 Ga0450903_002525
1446 Ga0450903_003560
1447 Ga0450904_001682
1448 Ga0450906_000044
1449 Ga0450906_008784
1450 Ga0450907_000302
1451 Ga0450907_001596
1452 Ga0439434_0000011
1453 Ga0439460_0001823
1454 Ga0439460_0024050
1455 Ga0466966_0033277
1456 Ga0466957_0044881
1457 Ga0466958_0001201
1458 Ga0495617_000870
1459 Ga0495617_006912
1460 Ga0495617_009184
1461 Ga0495617_031806
1462 Ga0495617_034104
1463 Ga0495617_042761
1464 Ga0495617_070851
1465 Ga0495627_000472
1466 Ga0495627_004200
1467 Ga0495627_006510
1468 Ga0495627_006823
1469 Ga0495603_0010705
1470 Ga0495590_0008435
1471 Ga0495591_000296
1472 Ga0495591_000493
1473 Ga0495591_000566
1474 Ga0495591_007753
1475 Ga0495591_010894
1476 Ga0495591_011921
1477 Ga0495591_012291
1478 Ga0495591_025646
1479 Ga0495591_033584
1480 Ga0495591_036512
1481 Ga0495591_037692
1482 Ga0495591_041142
1483 Ga0495591_056310
1484 Ga0495629_0088909
1485 Ga0495638_0019149
1486 Ga0495638_0028493
1487 Ga0495638_0034052
1488 Ga0495638_0042937
1489 Ga0495638_0055596
1490 Ga0495638_0127913
1491 Ga0495653_0178097
1492 Ga0495650_0000119
1493 Ga0495650_0013035
1494 Ga0495650_0045466
1495 Ga0495650_0053869
1496 Ga0495605_0003359
1497 Ga0495605_0012032
1498 Ga0495605_0042918
1499 Ga0495605_0052042
1500 Ga0495605_0056648
1501 Ga0495605_0066601
1502 Ga0495605_0070107
1503 Ga0495639_0047506
1504 Ga0495639_0065198
1505 Ga0495584_0009110
1506 Ga0495584_0010833
1507 Ga0495584_0012379
1508 Ga0495584_0012396
1509 Ga0495584_0017553
1510 Ga0495584_0021308
1511 Ga0495584_0072448
1512 Ga0495584_0073410
1513 Ga0495585_0000173
1514 Ga0495585_0001130
1515 Ga0495585_0005932
1516 Ga0495585_0008849
1517 Ga0495585_0016170
1518 Ga0495585_0016173
1519 Ga0495585_0019074
1520 Ga0495585_0023103
1521 Ga0495585_0033080
1522 Ga0495585_0056277
1523 Ga0495585_0082991
1524 Ga0495585_0093164
1525 Ga0495594_0032406
1526 Ga0495594_0057041
1527 Ga0495596_0043823
1528 Ga0495596_0051765
1529 Ga0495607_0000583
1530 Ga0495607_0002315
1531 Ga0495607_0010286
1532 Ga0495607_0017311
1533 Ga0495607_0022056
1534 Ga0495607_0076606
1535 Ga0495607_0104827
1536 Ga0495583_0000393
1537 Ga0495583_0000565
1538 Ga0495583_0002481
1539 Ga0495583_0009025
1540 Ga0495583_0026909
1541 Ga0495583_0056226
1542 Ga0495583_0064293
1543 Ga0495606_0000008
1544 Ga0495606_0000016
1545 Ga0495606_0001301
1546 Ga0495606_0002511
1547 Ga0495606_0004228
1548 Ga0495606_0009581
1549 Ga0495606_0019691
1550 Ga0495606_0024959
1551 Ga0495606_0032541
1552 Ga0495606_0038983
1553 Ga0495606_0055845
1554 Ga0495606_0092855
1555 Ga0495606_0103677
1556 Ga0495606_0106635
1557 Ga0495610_0000950
1558 Ga0495610_0001695
1559 Ga0495610_0002038
1560 Ga0495610_0004779
1561 Ga0495610_0008698
1562 Ga0495610_0012262
1563 Ga0495610_0019310
1564 Ga0495610_0022519
1565 Ga0495610_0026020
1566 Ga0495610_0102899
1567 Ga0495616_0003965
1568 Ga0495616_0008966
1569 Ga0495616_0012363
1570 Ga0495616_0013653
1571 Ga0495616_0015329
1572 Ga0495616_0016860
1573 Ga0495616_0017236
1574 Ga0495616_0020336
1575 Ga0495616_0058784
1576 Ga0495616_0093139
1577 Ga0495620_0000374
1578 Ga0495620_0010030
1579 Ga0495620_0012437
1580 Ga0495620_0023330
1581 Ga0495620_0047075
1582 Ga0495620_0060516
1583 Ga0495631_0000355
1584 Ga0495631_0007027
1585 Ga0495631_0007788
1586 Ga0495631_0037261
1587 Ga0495631_0039200
1588 Ga0495631_0082888
1589 Ga0495632_0000922
1590 Ga0495632_0008122
1591 Ga0495632_0012089
1592 Ga0495632_0049483
1593 Ga0495632_0079952
1594 Ga0495632_0100639
1595 Ga0495637_0000912
1596 Ga0495637_0002577
1597 Ga0495637_0012131
1598 Ga0495637_0045708
1599 Ga0495637_0047666
1600 Ga0495637_0051225
1601 Ga0495637_0062588
1602 Ga0495637_0062979
1603 Ga0495637_0070523
1604 Ga0495637_0147525
1605 Ga0495643_0042789
1606 Ga0495643_0136002
1607 Ga0495643_0140189
1608 Ga0495644_0040389
1609 Ga0495644_0048255
1610 Ga0495644_0099818
1611 Ga0495648_0003303
1612 Ga0495648_0010360
1613 Ga0495648_0020119
1614 Ga0495648_0022931
1615 Ga0495648_0045334
1616 Ga0495648_0055413
1617 Ga0495648_0057911
1618 Ga0495648_0062603
1619 Ga0495648_0091771
1620 Ga0495648_0095720
1621 Ga0495648_0104585
1622 Ga0495648_0143040
1623 Ga0495648_0199712
1624 Ga0495666_0087660
1625 Ga0495642_0000008
1626 Ga0495642_0000042
1627 Ga0495654_0000247
1628 Ga0495654_0002152
1629 Ga0495654_0004247
1630 Ga0495654_0009129
1631 Ga0495654_0019471
1632 Ga0495654_0021962
1633 Ga0495654_0022389
1634 Ga0495654_0026857
1635 Ga0495654_0060686
1636 Ga0495654_0085601
1637 Ga0495654_0122186
1638 Ga0495609_0007888
1639 Ga0495609_0015803
1640 Ga0495609_0023737
1641 Ga0495609_0042536
1642 Ga0495609_0074471
1643 Ga0495609_0081176
1644 Ga0495597_0013829
1645 Ga0495597_0023378
1646 Ga0495597_0032537
1647 Ga0495597_0038539
1648 Ga0495597_0045860
1649 Ga0495622_0006105
1650 Ga0495622_0023073
1651 Ga0495622_0027135
1652 Ga0495622_0037018
1653 Ga0495633_0000072
1654 Ga0495633_0012874
1655 Ga0495633_0019024
1656 Ga0495633_0030984
1657 Ga0495633_0077716
1658 Ga0495656_0017763
1659 Ga0495668_0000009
1660 Ga0495611_0000237
1661 Ga0495611_0106621
1662 Ga0495611_0155717
1663 Ga0495625_0000017
1664 Ga0495625_0000831
1665 Ga0495625_0001531
1666 Ga0495625_0004263
1667 Ga0495625_0004710
1668 Ga0495625_0014203
1669 Ga0495625_0019811
1670 Ga0495625_0041611
1671 Ga0495625_0064010
1672 Ga0495625_0065750
1673 Ga0495625_0075780
1674 Ga0495625_0081611
1675 Ga0495625_0121051
1676 Ga0495625_0138473
1677 Ga0495625_0147148
1678 Ga0495625_0201716
1679 Ga0495625_0266612
1680 Ga0495659_0016010
1681 Ga0495659_0051133
1682 Ga0495661_0000083
1683 Ga0495661_0004073
1684 Ga0495661_0007434
1685 Ga0495661_0035519
1686 Ga0495661_0046344
1687 Ga0495661_0062988
1688 Ga0495661_0078905
1689 Ga0495661_0080558
1690 Ga0495661_0085826
1691 Ga0495661_0091530
1692 Ga0495661_0116157
1693 Ga0495661_0125569
1694 Ga0495588_0041348
1695 Ga0495588_0045254
1696 Ga0495588_0111080
1697 Ga0495588_0175823
1698 Ga0495646_0022272
1699 Ga0495658_0018289
1700 Ga0495669_0073974
1701 Ga0495613_0026066
1702 Ga0495624_0000375
1703 Ga0495670_0006113
1704 Ga0495670_0013452
1705 Ga0495670_0018020
1706 Ga0495670_0054151
1707 Ga0495670_0077162
1708 Ga0495670_0093581
1709 Ga0495670_0143613
1710 Ga0495671_0000078
1711 Ga0495671_0005595
1712 Ga0495671_0015967
1713 Ga0495671_0024323
1714 Ga0495671_0033887
1715 Ga0495671_0042385
1716 Ga0495671_0063573
1717 Ga0495671_0073070
1718 Ga0495671_0075975
1719 Ga0495671_0122729
1720 Ga0495649_0000121
1721 Ga0495649_0008007
1722 Ga0495649_0014048
1723 Ga0495649_0014159
1724 Ga0495649_0016475
1725 Ga0495649_0019747
1726 Ga0495649_0029003
1727 Ga0495649_0054483
1728 Ga0495649_0069511
1729 Ga0495649_0133836
1730 Ga0495589_0001533
1731 Ga0495589_0003419
1732 Ga0495589_0008918
1733 Ga0495589_0013295
1734 Ga0495589_0072385
1735 Ga0495589_0085637
1736 Ga0495660_0002089
1737 Ga0495660_0016523
1738 Ga0495660_0016617
1739 Ga0495660_0022892
1740 Ga0495660_0027263
1741 Ga0495660_0064559
1742 Ga0495660_0131219
1743 Ga0495604_0046135
1744 Ga0495636_0040592
1745 Ga0495672_0000899
1746 Ga0495672_0003453
1747 Ga0495672_0009377
1748 Ga0495672_0023438
1749 Ga0495672_0024411
1750 Ga0495672_0065356
1751 Ga0495672_0066594
1752 Ga0495672_0104905
1753 Ga0495672_0123492
1754 Ga0495676_0023687
1755 Ga0495680_0002703
1756 Ga0495683_0001770
1757 Ga0495683_0001796
1758 Ga0495683_0016005
1759 Ga0495683_0041954
1760 Ga0495683_0067597
1761 Ga0495683_0118944
1762 Ga0495687_000902
1763 Ga0495687_005379
1764 Ga0495687_020573
1765 Ga0495677_0006346
1766 Ga0495679_000877
1767 Ga0495679_005883
1768 Ga0495679_010191
1769 Ga0495679_027145
1770 Ga0495679_038958
1771 Ga0495679_041748
1772 Ga0495673_0001089
1773 Ga0495673_0003850
1774 Ga0495673_0025014
1775 Ga0495673_0025424
1776 Ga0495673_0030232
1777 Ga0495673_0042691
1778 Ga0495673_0047749
1779 Ga0495681_0000368
1780 Ga0495681_0013414
1781 Ga0495681_0018316
1782 Ga0495681_0024203
1783 Ga0495681_0030700
1784 Ga0495681_0055218
1785 Ga0495681_0061625
1786 Ga0495681_0093693
1787 Ga0495684_0111704
1788 Ga0495686_0001124
1789 Ga0495686_0003529
1790 Ga0495686_0008633
1791 Ga0495686_0017772
1792 Ga0495686_0050886
1793 Ga0495686_0141853
1794 Ga0495593_0047038
1795 Ga0495602_0002824
1796 Ga0495626_0002208
1797 Ga0495626_0002697
1798 Ga0495626_0005609
1799 Ga0495626_0010358
1800 Ga0495626_0011647
1801 Ga0495626_0017276
1802 Ga0495626_0019649
1803 Ga0495626_0024676
1804 Ga0495626_0032891
1805 Ga0495626_0112366
1806 Ga0496107_0333256
1807 Ga0496110_0084401
1808 Ga0496112_0043696
1809 Ga0496115_0000196
1810 Ga0496115_0199741
1811 Ga0496116_0000114
1812 Ga0496116_0002218
1813 Ga0496116_0017123
1814 Ga0496116_0097036
1815 Ga0496116_0111009
1816 Ga0496117_0000654
1817 Ga0496117_0001257
1818 Ga0496117_0007831
1819 Ga0496117_0011197
1820 Ga0496117_0040370
1821 Ga0496117_0115402
1822 Ga0496117_0133402
1823 Ga0496117_0180858
1824 Ga0496118_0026967
1825 Ga0496118_0029390
1826 Ga0496118_0045743
1827 Ga0496118_0056650
1828 Ga0496118_0073983
1829 Ga0496118_0118987
1830 Ga0496119_0007077
1831 Ga0496119_0024521
1832 Ga0496119_0085653
1833 Ga0496120_0005052
1834 Ga0496120_0023266
1835 Ga0496120_0130690
1836 Ga0496121_0000286
1837 Ga0496121_0027827
1838 Ga0496121_0157549
1839 Ga0496121_0170770
1840 Ga0496122_0004747
1841 Ga0496122_0006189
1842 Ga0496122_0037766
1843 Ga0496122_0157104
1844 Ga0496122_0185700
1845 Ga0496123_0000709
1846 Ga0496123_0002397
1847 Ga0496123_0022339
1848 Ga0496123_0024318
1849 Ga0496123_0026470
1850 Ga0496123_0052966
1851 Ga0496123_0162170
1852 Ga0496124_0003392
1853 Ga0496124_0024765
1854 Ga0496124_0050291
1855 Ga0496124_0067215
1856 Ga0496124_0125675
1857 Ga0496124_0166370
1858 Ga0496125_0000266
1859 Ga0496125_0002439
1860 Ga0496125_0007844
1861 Ga0496125_0007972
1862 Ga0496125_0011480
1863 Ga0496125_0016074
1864 Ga0496125_0016812
1865 Ga0496125_0054788
1866 Ga0496125_0138126
1867 Ga0496125_0144959
1868 Ga0496125_0155748
1869 Ga0496126_0015231
1870 Ga0496126_0046630
1871 Ga0496126_0174490
1872 Ga0495678_000453
1873 Ga0495678_007247
1874 Ga0495678_008194
1875 Ga0495678_008230
1876 Ga0495678_040218
1877 Ga0495678_046394
1878 Ga0495678_082199
1879 Ga0495682_0004703
1880 Ga0495682_0005360
1881 Ga0495682_0007775
1882 Ga0495682_0015513
1883 Ga0495682_0016621
1884 Ga0495682_0031696
1885 nmdc:mga0k408_1786_c1
1886 nmdc:mga0k408_296_c1
1887 nmdc:mga08x19_220535_c1
1888 Ga0500641_0000076
1889 Ga0500572_019674
1890 Ga0500592_001686
1891 Ga0500608_002735
1892 Ga0500608_005577
1893 Ga0500618_000040
1894 Ga0500621_078893
1895 Ga0500642_0047750
1896 Ga0500564_053743
1897 Ga0500622_0035466
1898 Ga0500622_0071357
1899 Ga0500624_000837
1900 Ga0500634_0001078
1901 2511248938
1902 2511254223
1903 2511267397
1904 2511278382
1905 2511292631
1906 2511298100
1907 2511300983
1908 2511314304
1909 2511318950
1910 2511324440
1911 2511330273
1912 2511350826
1913 2511367826
1914 2511415490
1915 2512325432
1916 2547501632
1917 2555670692
1918 2583793220
1919 2597864307
1920 2597869532
1921 2599357757
1922 2599358630
1923 2599365849
1924 2599371273
1925 2599382528
1926 2599388975
1927 2599390182
1928 2599401944
1929 2599402316
1930 2599453864
1931 2599463755
1932 2599471560
1933 2599476629
1934 2599492774
1935 2599510035
1936 2599515438
1937 2599521456
1938 2599881069
1939 2599884209
1940 2599894817
1941 2599899214
1942 2599949648
1943 2599958650
1944 2599994640
1945 2600003486
1946 2600018063
1947 2600022748
1948 2600042192
1949 2600052582
1950 2600064850
1951 2600069490
1952 2600076116
1953 2600216887
1954 2601691627
1955 2601777058
1956 2601798720
1957 2606077614
1958 2606130211
1959 2621300173
1960 2624481115
1961 2643871039
1962 2643954168
1963 2644022977
1964 2644185744
1965 2644622470
1966 2671091356
1967 2671096195
1968 2677901137
1969 2715750636
1970 2715757168
1971 2723248452
1972 2738675130
1973 2738753420
1974 2738810512
1975 2738862332
1976 2738897872
1977 2739257026
1978 2739313142
1979 2743738345
1980 2774120199
1981 2774134088
1982 2784264145
1983 2784311870
1984 2808932828
1985 2808954950
1986 2808978517
1987 2808993956
1988 2809215133
1989 2816518412
1990 2817491519
1991 2819658021
1992 2819700371
1993 2834033412
1994 2842394479
1995 2842827264
1996 2842835079
1997 2842841680
1998 2842846816
1999 2844671302
2000 2852617453
2001 2852625156
2002 2852657770
2003 2852672428
2004 2860870392
2005 2878033053
2006 2880233775
2007 2884934171
2008 2904523914
2009 2904552001
2010 2908450144
2011 2912967191
2012 2917074525
2013 2919067202
2014 2919137027
2015 2919390177
2016 2919442719
2017 2919460484
2018 2919489327
2019 2923157400
2020 2928078578
2021 2928151745
2022 2929192228
2023 2931370221
2024 2931394328
2025 2932084360
2026 2935355413
2027 2939642648
2028 2945933852
2029 2945964245
2030 2946030645
2031 2947237451
2032 2961064846
2033 2969307959
2034 2971404873
2035 2984288735
2036 2998142457
2037 3007513945
2038 3007616812
2039 3007724260
2040 3007856620
2041 3007861627
2042 637321042
2043 8015691554
2044 8029998239
2045 8054290704
2046 8054347960
2047 8054505823
2048 8055774761
2049 8055820457
2050 8056128530
2051 8056135075
2052 8056149840
2053 8056159169
2054 8056166462
2055 8056168623
2056 8056173991
2057 8056177880
2058 8056571278

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

157

280

0.98

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

29

149

0.94

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

161

344

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h6d-assembly3.cif.gz_I oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol 0.8967 4 314
1rye-assembly1.cif.gz_D crystal structure of the shifted form of the glucose-fructose oxidoreductase from zymomonas mobilis 0.893 1 314
2glx-assembly1.cif.gz_A crystal structure analysis of bacterial 1,5-af reductase 0.8908 5 314
6z3b-assembly1.cif.gz_B low resolution structure of rgnanox 0.8908 1 314
6a3i-assembly1.cif.gz_B levoglucosan dehydrogenase, complex with nadh and levoglucosan 0.8904 4 314
ID Description Score Start End Superfamily
3rbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9385 2 117 3.40.50.720
4hadB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9268 4 115 3.40.50.720
af_I1MZG8_3_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9182 2 117 3.40.50.720
af_A0A1D8PPX6_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9168 2 115 3.40.50.720
af_P77503_10_129_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9116 4 117 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A2E8HMQ9-F1-model_v4 Oxidoreductase 0.9838 1 312 GO:0000166
GO:0016491
AF-A0A1G8KK87-F1-model_v4 Predicted dehydrogenase 0.9811 1 314 GO:0000166
GO:0016491
AF-A0A7X9M2B5-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9774 2 314 GO:0000166
GO:0016491
AF-A0A1G8KK87-F1-model_v4 Predicted dehydrogenase 0.9719 1 314 GO:0000166
GO:0016491
AF-A0A2E8HMQ9-F1-model_v4 Oxidoreductase 0.9684 1 312 GO:0000166
GO:0016491

Map