F488587

General Info

Members Datasets Scaffolds Average Seq Length
1029 462 2058 118

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0740727|Ga0501039_0740727_330_722
Length 130
Sequence MKDDAIFITGLLIHAHHGVMEHESKVGQRFILDLVLSVDLDDAARSDKLADTASYAAIVECATRAFTARNHKLVESAAGMVADAILSEFTKVTAVRVTVHKPHAPIAATFADVGVTIVRYRNAFDEPSHA

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
12 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
18 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
19 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
23 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
24 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
29 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
33 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
72 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
73 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
74 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
75 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
76 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
77 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
78 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
89 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
90 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
103 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
114 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
115 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
116 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
149 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
150 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
151 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
152 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
153 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
154 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
155 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
156 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
253 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
255 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
259 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
260 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
261 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
262 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
263 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
264 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
265 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
266 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
267 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
268 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
269 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
270 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
271 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
272 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
273 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
274 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
275 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
276 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
277 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
278 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
279 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
280 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
281 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
282 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
283 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
284 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
285 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
286 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
287 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
288 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
289 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
290 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
292 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
293 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
294 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
295 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
296 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
297 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
298 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
299 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
300 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
301 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
302 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
303 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
304 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
305 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
306 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
307 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
308 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
309 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
310 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
311 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
312 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
313 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
314 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
315 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
316 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
317 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
318 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
319 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
320 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
321 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
322 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
323 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
324 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
325 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
326 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
327 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
328 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
329 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
330 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
331 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
332 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
333 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
334 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
335 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
336 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
337 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
338 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
339 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
340 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
341 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
342 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
343 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
344 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
345 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
346 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
347 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
348 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
349 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
350 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
351 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
352 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
353 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
354 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
355 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
356 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
357 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
358 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
359 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
360 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
361 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
362 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
363 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
364 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
365 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
366 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
367 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
368 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
369 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
370 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
371 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
372 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
373 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
374 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
375 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
376 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
377 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
378 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
379 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
380 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
381 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
382 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
383 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
384 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
385 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
386 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
387 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
388 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
389 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
390 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
391 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
392 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
393 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
394 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
395 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
396 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
397 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
398 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
399 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
400 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
401 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
402 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
403 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
404 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
405 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
408 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
419 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
420 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
421 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
422 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
423 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
424 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
425 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
426 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
427 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
428 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
429 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
430 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
431 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
432 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
433 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
434 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
436 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
437 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
438 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
439 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
440 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
441 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
442 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
443 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
444 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
445 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
446 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
447 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
448 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
449 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
450 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
451 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
452 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
453 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
454 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
455 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
456 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
457 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
458 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
459 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
461 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
462 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.43
Nodule 0
Rhizoplane 5.54
Rhizosphere 91.45
Stem 0
Stem Tuber 0
Unclassified 3.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0740727 3300049575 Bacteria 768
2 2214745210 2209111006 Bacteria 15141
3 ARcpr5oldR_c000144 3300000041 Bacteria 12262
4 ARSoilYngRDRAFT_c00009 3300000042 Bacteria 30468
5 ARcpr5yngRDRAFT_c000006 3300000043 Bacteria 44193
6 ARSoilOldRDRAFT_c000102 3300000044 Bacteria 16000
7 ARCol0oldRDRAFT_c01043 3300000045 Bacteria 2085
8 ARCol0yngRDRAFT_1000092 3300000652 Bacteria 16856
9 JGI24032J14994_100041 3300001430 Bacteria 4933
10 JGI24736J21556_1064614 3300001904 Bacteria 567
11 JGI24752J21851_1042901 3300001976 Bacteria 608
12 JGI24746J21847_1001712 3300001977 Bacteria 3514
13 JGI24740J21852_10011798 3300001979 Bacteria 3316
14 JGI24739J22299_10000092 3300001989 Bacteria 26283
15 JGI24737J22298_10003955 3300001990 Bacteria 5189
16 JGI24737J22298_10008311 3300001990 Bacteria 3481
17 JGI24743J22301_10030239 3300001991 Bacteria 1064
18 JGI24750J21931_1000128 3300002070 Bacteria 12041
19 JGI24745J21846_1000110 3300002073 Bacteria 6290
20 JGI24748J21848_1000158 3300002074 Bacteria 9876
21 JGI24738J21930_10000010 3300002075 Bacteria 37976
22 JGI24749J21850_1001926 3300002076 Bacteria 2933
23 JGI24749J21850_1018182 3300002076 Bacteria 992
24 JGI24744J21845_10000683 3300002077 Bacteria 6233
25 JGI24744J21845_10110869 3300002077 Bacteria 509
26 JGI24035J26624_1000002 3300002126 Bacteria 16706
27 JGI24033J26618_1002588 3300002155 Bacteria 1858
28 JGI24034J26672_10000201 3300002239 Bacteria 8012
29 JGI24742J22300_10000765 3300002244 Bacteria 4898
30 JGI24751J29686_10021731 3300002459 Bacteria 1330
31 JGI26129J50193_1007527 3300003349 Bacteria 787
32 JGI26129J50193_1015647 3300003349 Bacteria 558
33 JGI26140J50224_101872 3300003383 Bacteria 756
34 Ga0055526_1030168 3300003771 Bacteria 1588
35 JGI25405J52794_10006144 3300003911 Bacteria 2190
36 Ga0065717_1003867 3300005276 Bacteria 1160
37 Ga0065716_1002550 3300005277 Bacteria 1687
38 Ga0065704_10094385 3300005289 Bacteria 2543
39 Ga0065712_10000899 3300005290 Bacteria 8202
40 Ga0065712_10068648 3300005290 Bacteria 9527
41 Ga0065715_10000752 3300005293 Bacteria 15084
42 Ga0065715_10089173 3300005293 Bacteria 13131
43 Ga0065715_10165183 3300005293 Bacteria 1572
44 Ga0070658_10504520 3300005327 Bacteria 1045
45 Ga0070676_10000978 3300005328 Bacteria 14208
46 Ga0070676_10241875 3300005328 Bacteria 1201
47 Ga0070683_100001029 3300005329 Bacteria 20930
48 Ga0070683_100114195 3300005329 Bacteria 2549
49 Ga0070683_101456400 3300005329 Bacteria 658
50 Ga0070690_100001038 3300005330 Bacteria 14220
51 Ga0070690_100615176 3300005330 Bacteria 826
52 Ga0070670_100026956 3300005331 Bacteria 4943
53 Ga0070670_100398935 3300005331 Bacteria 1214
54 Ga0070677_10000126 3300005333 Bacteria 25482
55 Ga0070677_10285506 3300005333 Bacteria 833
56 Ga0068869_100000079 3300005334 Bacteria 44000
57 Ga0068869_100035044 3300005334 Bacteria 3555
58 Ga0068869_102041152 3300005334 Bacteria 515
59 Ga0070666_10019358 3300005335 Bacteria 4394
60 Ga0070666_10250122 3300005335 Bacteria 1255
61 Ga0070680_100002329 3300005336 Bacteria 14022
62 Ga0070680_100007030 3300005336 Bacteria 8579
63 Ga0070680_100129426 3300005336 Bacteria 2111
64 Ga0070682_100000641 3300005337 Bacteria 21233
65 Ga0070682_100663111 3300005337 Unclassified 832
66 Ga0068868_100002114 3300005338 Bacteria 13683
67 Ga0070660_100002411 3300005339 Bacteria 12843
68 Ga0070660_100019320 3300005339 Bacteria 4990
69 Ga0070660_101957305 3300005339 Bacteria 500
70 Ga0070689_100003727 3300005340 Bacteria 10202
71 Ga0070689_100021372 3300005340 Bacteria 4817
72 Ga0070691_10000161 3300005341 Bacteria 21699
73 Ga0070691_10033380 3300005341 Bacteria 2422
74 Ga0070687_100000085 3300005343 Bacteria 30647
75 Ga0070687_100013028 3300005343 Bacteria 3693
76 Ga0070687_100760099 3300005343 Bacteria 683
77 Ga0070687_100917709 3300005343 Bacteria 629
78 Ga0070661_100000307 3300005344 Bacteria 39479
79 Ga0070661_100454154 3300005344 Bacteria 1020
80 Ga0070661_100551561 3300005344 Bacteria 927
81 Ga0070661_100855173 3300005344 Bacteria 749
82 Ga0070692_10001915 3300005345 Bacteria 7857
83 Ga0070692_10048702 3300005345 Bacteria 2196
84 Ga0070668_100009110 3300005347 Bacteria 7371
85 Ga0070668_100039131 3300005347 Bacteria 3627
86 Ga0070668_102210166 3300005347 Unclassified 508
87 Ga0070669_100000571 3300005353 Bacteria 27367
88 Ga0070669_100037439 3300005353 Bacteria 3519
89 Ga0070675_100014189 3300005354 Bacteria 6280
90 Ga0070675_100075720 3300005354 Bacteria 2798
91 Ga0070675_101151216 3300005354 Unclassified 714
92 Ga0070671_100000104 3300005355 Bacteria 53922
93 Ga0070674_100000238 3300005356 Bacteria 27260
94 Ga0070674_100057646 3300005356 Bacteria 2697
95 Ga0070673_100000152 3300005364 Bacteria 33183
96 Ga0070673_101435931 3300005364 Bacteria 650
97 Ga0070688_100001552 3300005365 Bacteria 11464
98 Ga0070688_100010437 3300005365 Bacteria 5120
99 Ga0070688_100185664 3300005365 Bacteria 1445
100 Ga0070659_100000551 3300005366 Bacteria 27372
101 Ga0070659_100014072 3300005366 Bacteria 5970
102 Ga0070667_100002365 3300005367 Bacteria 16513
103 Ga0070667_100082240 3300005367 Bacteria 2757
104 Ga0070667_100126878 3300005367 Bacteria 2224
105 Ga0070703_10002446 3300005406 Bacteria 5352
106 Ga0070703_10008783 3300005406 Bacteria 2845
107 Ga0070703_10277971 3300005406 Bacteria 690
108 Ga0070714_100382247 3300005435 Bacteria 1328
109 Ga0070714_100521871 3300005435 Bacteria 1135
110 Ga0070710_10903011 3300005437 Bacteria 638
111 Ga0070701_10000674 3300005438 Bacteria 12016
112 Ga0070701_10024327 3300005438 Bacteria 2929
113 Ga0070701_10027601 3300005438 Bacteria 2783
114 Ga0070711_100898965 3300005439 Bacteria 756
115 Ga0070711_102008838 3300005439 Bacteria 509
116 Ga0070705_100000096 3300005440 Bacteria 49240
117 Ga0070705_100000148 3300005440 Bacteria 41687
118 Ga0070705_100039756 3300005440 Bacteria 2671
119 Ga0070700_100000277 3300005441 Bacteria 27391
120 Ga0070700_100004184 3300005441 Bacteria 7525
121 Ga0070700_100071695 3300005441 Bacteria 2212
122 Ga0070700_101978793 3300005441 Bacteria 505
123 Ga0070694_100009315 3300005444 Bacteria 6029
124 Ga0070694_100025210 3300005444 Bacteria 3846
125 Ga0070694_100028101 3300005444 Bacteria 3657
126 Ga0070708_100013438 3300005445 Bacteria 6704
127 Ga0070708_100080131 3300005445 Bacteria 2955
128 Ga0070663_100000522 3300005455 Bacteria 20244
129 Ga0070663_100030853 3300005455 Bacteria 3677
130 Ga0070663_100107269 3300005455 Bacteria 2093
131 Ga0070663_101465575 3300005455 Unclassified 606
132 Ga0070678_100000718 3300005456 Bacteria 16435
133 Ga0070678_102109210 3300005456 Unclassified 534
134 Ga0070662_100019850 3300005457 Bacteria 4570
135 Ga0070662_100078008 3300005457 Bacteria 2459
136 Ga0070662_100479210 3300005457 Unclassified 1036
137 Ga0070662_100815239 3300005457 Bacteria 794
138 Ga0070681_10003456 3300005458 Bacteria 14797
139 Ga0070681_10022561 3300005458 Bacteria 6322
140 Ga0070681_10064843 3300005458 Bacteria 3623
141 Ga0070681_10141932 3300005458 Bacteria 2331
142 Ga0070681_11854580 3300005458 Bacteria 530
143 Ga0068867_100004407 3300005459 Bacteria 9902
144 Ga0068867_100017974 3300005459 Bacteria 5024
145 Ga0068867_100775500 3300005459 Unclassified 853
146 Ga0070685_10012102 3300005466 Bacteria 4525
147 Ga0070706_100069484 3300005467 Bacteria 3257
148 Ga0070698_100076049 3300005471 Bacteria 3361
149 Ga0074259_11111610 3300005507 Bacteria 1435
150 Ga0070699_100000255 3300005518 Bacteria 52092
151 Ga0070699_101296327 3300005518 Bacteria 668
152 Ga0070679_100031781 3300005530 Bacteria 5219
153 Ga0070679_100031892 3300005530 Bacteria 5210
154 Ga0070679_100033806 3300005530 Bacteria 5063
155 Ga0070679_100133048 3300005530 Bacteria 2468
156 Ga0070679_101519029 3300005530 Bacteria 617
157 Ga0070684_100000894 3300005535 Bacteria 21105
158 Ga0070684_100310980 3300005535 Bacteria 1447
159 Ga0070684_100925204 3300005535 Unclassified 817
160 Ga0070697_100015667 3300005536 Bacteria 5954
161 Ga0070697_100390178 3300005536 Bacteria 1207
162 Ga0070697_100659297 3300005536 Bacteria 922
163 Ga0068853_100002891 3300005539 Bacteria 13032
164 Ga0068853_100259619 3300005539 Bacteria 1597
165 Ga0070672_100000088 3300005543 Bacteria 44394
166 Ga0070672_100091389 3300005543 Bacteria 2456
167 Ga0070672_100573416 3300005543 Bacteria 981
168 Ga0070686_100000719 3300005544 Bacteria 19252
169 Ga0070686_100032503 3300005544 Bacteria 3199
170 Ga0070695_100000248 3300005545 Bacteria 26990
171 Ga0070695_100001789 3300005545 Bacteria 12107
172 Ga0070695_100027104 3300005545 Bacteria 3547
173 Ga0070696_100000552 3300005546 Bacteria 23812
174 Ga0070696_100013552 3300005546 Bacteria 5471
175 Ga0070696_100020079 3300005546 Bacteria 4530
176 Ga0070696_100421267 3300005546 Bacteria 1048
177 Ga0070693_100000134 3300005547 Bacteria 33408
178 Ga0070693_100009572 3300005547 Bacteria 4822
179 Ga0070665_100050659 3300005548 Bacteria 4166
180 Ga0070704_100000026 3300005549 Bacteria 48700
181 Ga0070704_100011965 3300005549 Bacteria 5345
182 Ga0070704_100044802 3300005549 Bacteria 3076
183 Ga0070704_100309229 3300005549 Bacteria 1320
184 Ga0070704_100607338 3300005549 Unclassified 962
185 Ga0068855_100006834 3300005563 Bacteria 13840
186 Ga0068855_102295069 3300005563 Bacteria 540
187 Ga0068855_102355802 3300005563 Bacteria 532
188 Ga0070664_100002234 3300005564 Bacteria 15585
189 Ga0070664_100011614 3300005564 Bacteria 7146
190 Ga0070664_100179423 3300005564 Bacteria 1882
191 Ga0070664_100397929 3300005564 Unclassified 1259
192 Ga0068857_100002935 3300005577 Bacteria 14058
193 Ga0068857_100010529 3300005577 Bacteria 8039
194 Ga0068854_100000546 3300005578 Bacteria 22673
195 Ga0068854_100932240 3300005578 Unclassified 765
196 Ga0068856_100002000 3300005614 Bacteria 21261
197 Ga0068856_100541781 3300005614 Bacteria 1185
198 Ga0070702_100000245 3300005615 Bacteria 18498
199 Ga0070702_100127545 3300005615 Bacteria 1602
200 Ga0068852_100008609 3300005616 Bacteria 7533
201 Ga0068852_100091269 3300005616 Bacteria 2725
202 Ga0068852_101149115 3300005616 Unclassified 797
203 Ga0068852_101348714 3300005616 Bacteria 735
204 Ga0068852_101580847 3300005616 Unclassified 678
205 Ga0068859_100006734 3300005617 Bacteria 11674
206 Ga0068859_100026101 3300005617 Bacteria 5860
207 Ga0068859_100041857 3300005617 Bacteria 4602
208 Ga0068864_100000890 3300005618 Bacteria 25145
209 Ga0068864_100277961 3300005618 Bacteria 1562
210 Ga0068866_10000221 3300005718 Bacteria 27070
211 Ga0068861_100011785 3300005719 Bacteria 6084
212 Ga0068861_100018274 3300005719 Bacteria 4993
213 Ga0068861_100118272 3300005719 Bacteria 2134
214 Ga0068870_10003727 3300005840 Bacteria 6480
215 Ga0068870_10844419 3300005840 Bacteria 643
216 Ga0068863_100000340 3300005841 Bacteria 47641
217 Ga0068863_100056996 3300005841 Bacteria 3698
218 Ga0068863_100431802 3300005841 Bacteria 1291
219 Ga0068858_100000295 3300005842 Bacteria 53892
220 Ga0068858_100102941 3300005842 Bacteria 2663
221 Ga0068858_100150676 3300005842 Bacteria 2187
222 Ga0068860_100001285 3300005843 Bacteria 27247
223 Ga0068860_100004629 3300005843 Bacteria 14046
224 Ga0068860_100158254 3300005843 Bacteria 2183
225 Ga0068860_102061263 3300005843 Bacteria 592
226 Ga0068862_100003236 3300005844 Bacteria 14093
227 Ga0068862_100003354 3300005844 Bacteria 13821
228 Ga0068862_100063398 3300005844 Bacteria 3180
229 Ga0081455_10000007 3300005937 Bacteria 269394
230 Ga0070717_10037964 3300006028 Bacteria 3913
231 Ga0070717_10127591 3300006028 Bacteria 2185
232 Ga0075365_10358614 3300006038 Bacteria 1028
233 Ga0075363_100115462 3300006048 Bacteria 1495
234 Ga0075363_100519829 3300006048 Bacteria 708
235 Ga0075432_10027241 3300006058 Bacteria 1967
236 Ga0070715_10325721 3300006163 Bacteria 831
237 Ga0070716_100357488 3300006173 Bacteria 1036
238 Ga0070712_100000052 3300006175 Bacteria 62524
239 Ga0070712_100377819 3300006175 Bacteria 1166
240 Ga0070712_100908656 3300006175 Bacteria 759
241 Ga0075362_10188980 3300006177 Bacteria 1000
242 Ga0075362_10436132 3300006177 Bacteria 664
243 Ga0075367_10011053 3300006178 Bacteria 4761
244 Ga0075367_10394533 3300006178 Bacteria 875
245 Ga0075369_10139621 3300006186 Bacteria 1104
246 Ga0097621_100000040 3300006237 Bacteria 66339
247 Ga0075370_10374773 3300006353 Bacteria 852
248 Ga0068871_100000301 3300006358 Bacteria 34368
249 Ga0075431_100199738 3300006847 Bacteria 2046
250 Ga0075431_100269493 3300006847 Bacteria 1726
251 Ga0075431_101914954 3300006847 Unclassified 548
252 Ga0075433_10016057 3300006852 Bacteria 6160
253 Ga0075433_10067742 3300006852 Bacteria 3133
254 Ga0075434_100002477 3300006871 Bacteria 16252
255 Ga0075434_100249805 3300006871 Bacteria 1793
256 Ga0075434_100441171 3300006871 Bacteria 1323
257 Ga0068865_100000275 3300006881 Bacteria 28270
258 Ga0075436_100005032 3300006914 Bacteria 9089
259 Ga0075436_100042636 3300006914 Unclassified 3130
260 Ga0097620_100006734 3300006931 Bacteria 11674
261 Ga0097620_100026102 3300006931 Bacteria 5860
262 Ga0097620_100041858 3300006931 Bacteria 4602
263 Ga0075435_100096492 3300007076 Bacteria 2446
264 Ga0075435_100250148 3300007076 Bacteria 1509
265 Ga0075435_101291276 3300007076 Bacteria 639
266 Ga0099795_10012252 3300007788 Bacteria 2594
267 Ga0105251_10052992 3300009011 Bacteria 1930
268 Ga0105250_10011042 3300009092 Bacteria 3754
269 Ga0105250_10192936 3300009092 Unclassified 858
270 Ga0105240_10212812 3300009093 Bacteria 2257
271 Ga0105240_10367463 3300009093 Bacteria 1628
272 Ga0111539_10000394 3300009094 Bacteria 54170
273 Ga0111539_10003483 3300009094 Bacteria 20741
274 Ga0111539_10043754 3300009094 Bacteria 5367
275 Ga0105245_10000462 3300009098 Bacteria 37242
276 Ga0105245_11078352 3300009098 Bacteria 849
277 Ga0105245_11279654 3300009098 Bacteria 782
278 Ga0105247_10000442 3300009101 Bacteria 35071
279 Ga0105247_10171228 3300009101 Bacteria 1444
280 Ga0114129_10178784 3300009147 Bacteria 2889
281 Ga0114129_10905858 3300009147 Bacteria 1117
282 Ga0105243_10000282 3300009148 Bacteria 56666
283 Ga0105243_10031294 3300009148 Bacteria 4102
284 Ga0105243_10398541 3300009148 Bacteria 1278
285 Ga0105243_11105948 3300009148 Bacteria 801
286 Ga0105241_10000652 3300009174 Bacteria 26004
287 Ga0105241_10151582 3300009174 Bacteria 1897
288 Ga0105241_10642950 3300009174 Bacteria 963
289 Ga0105242_10001726 3300009176 Bacteria 17253
290 Ga0105248_10010575 3300009177 Bacteria 10168
291 Ga0105248_10023284 3300009177 Bacteria 6879
292 Ga0105248_10388826 3300009177 Bacteria 1570
293 Ga0105237_10008154 3300009545 Bacteria 11375
294 Ga0105237_10875312 3300009545 Bacteria 905
295 Ga0105238_10106046 3300009551 Bacteria 2792
296 Ga0105238_12073122 3300009551 Bacteria 603
297 Ga0105249_10001210 3300009553 Bacteria 22796
298 Ga0105249_10003736 3300009553 Bacteria 13134
299 Ga0105249_10010878 3300009553 Bacteria 7996
300 Ga0105249_10399550 3300009553 Bacteria 1404
301 Ga0099796_10006469 3300010159 Bacteria 3000
302 Ga0105239_10006303 3300010375 Bacteria 13795
303 Ga0105239_10163008 3300010375 Bacteria 2491
304 Ga0105239_10258581 3300010375 Bacteria 1956
305 Ga0105239_10282303 3300010375 Bacteria 1869
306 Ga0105239_12355476 3300010375 Bacteria 620
307 Ga0105246_10000312 3300011119 Bacteria 25800
308 Ga0105246_10078510 3300011119 Bacteria 2345
309 Ga0105246_10114945 3300011119 Bacteria 1984
310 Ga0105246_10309787 3300011119 Bacteria 1278
311 Ga0157344_1002004 3300012476 Bacteria 1038
312 Ga0157328_1013142 3300012478 Bacteria 611
313 Ga0157325_1002945 3300012485 Bacteria 907
314 Ga0157343_1003240 3300012488 Bacteria 942
315 Ga0157329_1010294 3300012491 Bacteria 731
316 Ga0157341_1004268 3300012494 Bacteria 1028
317 Ga0157313_1000657 3300012503 Bacteria 1665
318 Ga0157315_1014475 3300012508 Bacteria 756
319 Ga0157327_1031858 3300012512 Bacteria 662
320 Ga0157373_10035915 3300013100 Bacteria 3557
321 Ga0157371_10029433 3300013102 Bacteria 3972
322 Ga0157371_10457690 3300013102 Bacteria 939
323 Ga0157370_11531953 3300013104 Bacteria 599
324 Ga0157369_11568099 3300013105 Bacteria 670
325 Ga0157369_12043287 3300013105 Bacteria 581
326 Ga0157374_10001123 3300013296 Bacteria 23027
327 Ga0157374_10708914 3300013296 Bacteria 1020
328 Ga0157378_10000270 3300013297 Bacteria 50517
329 Ga0163162_10000145 3300013306 Bacteria 65191
330 Ga0163162_10021406 3300013306 Bacteria 6368
331 Ga0157372_10004025 3300013307 Bacteria 15762
332 Ga0157372_10224278 3300013307 Bacteria 2179
333 Ga0157372_11770094 3300013307 Bacteria 711
334 Ga0157372_13276400 3300013307 Unclassified 516
335 Ga0157375_10000332 3300013308 Bacteria 42513
336 Ga0157375_10106184 3300013308 Bacteria 2900
337 Ga0163163_10000865 3300014325 Bacteria 25811
338 Ga0163163_10019523 3300014325 Bacteria 6367
339 Ga0157380_10003074 3300014326 Bacteria 11374
340 Ga0157380_10090270 3300014326 Bacteria 2527
341 Ga0157377_10000137 3300014745 Bacteria 46698
342 Ga0157379_10001761 3300014968 Bacteria 17895
343 Ga0157379_10034305 3300014968 Bacteria 4524
344 Ga0157376_10000088 3300014969 Bacteria 70084
345 Ga0182006_1105742 3300015261 Bacteria 993
346 Ga0163161_10000144 3300017792 Bacteria 64771
347 Ga0197907_10831634 3300020069 Bacteria 525
348 Ga0207666_1000048 3300025271 Bacteria 23535
349 Ga0207666_1000232 3300025271 Bacteria 8175
350 Ga0207673_1000013 3300025290 Bacteria 13878
351 Ga0209564_1002100 3300025295 Bacteria 17043
352 Ga0207697_10000136 3300025315 Bacteria 35274
353 Ga0207697_10006414 3300025315 Bacteria 5326
354 Ga0207713_1063062 3300025735 Bacteria 1401
355 Ga0207653_10001370 3300025885 Bacteria 7928
356 Ga0207653_10002887 3300025885 Bacteria 5457
357 Ga0207682_10000006 3300025893 Bacteria 94953
358 Ga0207682_10243760 3300025893 Bacteria 836
359 Ga0207692_10226829 3300025898 Bacteria 1110
360 Ga0207642_10003385 3300025899 Bacteria 5030
361 Ga0207710_10001915 3300025900 Bacteria 9975
362 Ga0207710_10018748 3300025900 Bacteria 2946
363 Ga0207688_10000027 3300025901 Bacteria 48448
364 Ga0207688_10013378 3300025901 Bacteria 4458
365 Ga0207647_10005467 3300025904 Bacteria 9310
366 Ga0207647_10014058 3300025904 Bacteria 5533
367 Ga0207685_10255435 3300025905 Bacteria 849
368 Ga0207699_10089456 3300025906 Bacteria 1930
369 Ga0207645_10000100 3300025907 Bacteria 64057
370 Ga0207643_10000007 3300025908 Bacteria 171706
371 Ga0207643_10566913 3300025908 Bacteria 729
372 Ga0207684_11610847 3300025910 Bacteria 525
373 Ga0207654_10000314 3300025911 Bacteria 29106
374 Ga0207654_10654077 3300025911 Bacteria 753
375 Ga0207707_10003030 3300025912 Bacteria 14935
376 Ga0207707_10003553 3300025912 Bacteria 13808
377 Ga0207707_10334681 3300025912 Bacteria 1306
378 Ga0207707_10649541 3300025912 Bacteria 889
379 Ga0207707_10961805 3300025912 Bacteria 703
380 Ga0207695_10031101 3300025913 Bacteria 5862
381 Ga0207671_10029994 3300025914 Bacteria 4058
382 Ga0207671_10040362 3300025914 Bacteria 3455
383 Ga0207671_11033306 3300025914 Bacteria 647
384 Ga0207693_10000835 3300025915 Bacteria 27434
385 Ga0207693_10451262 3300025915 Bacteria 1005
386 Ga0207693_10766771 3300025915 Bacteria 745
387 Ga0207663_10263165 3300025916 Bacteria 1274
388 Ga0207663_10310252 3300025916 Bacteria 1182
389 Ga0207660_10000041 3300025917 Bacteria 63485
390 Ga0207660_10030841 3300025917 Bacteria 3687
391 Ga0207660_10063155 3300025917 Bacteria 2669
392 Ga0207660_10468332 3300025917 Bacteria 1020
393 Ga0207660_10956360 3300025917 Bacteria 699
394 Ga0207660_11187095 3300025917 Bacteria 621
395 Ga0207662_10000282 3300025918 Bacteria 23540
396 Ga0207662_10012555 3300025918 Bacteria 4720
397 Ga0207662_10554950 3300025918 Bacteria 796
398 Ga0207657_10003933 3300025919 Bacteria 15773
399 Ga0207657_10024595 3300025919 Bacteria 5572
400 Ga0207649_10002204 3300025920 Bacteria 11011
401 Ga0207649_10629545 3300025920 Bacteria 827
402 Ga0207652_10006361 3300025921 Bacteria 9537
403 Ga0207652_10041684 3300025921 Bacteria 3904
404 Ga0207652_10052780 3300025921 Bacteria 3491
405 Ga0207646_10925371 3300025922 Bacteria 773
406 Ga0207681_10000100 3300025923 Bacteria 72913
407 Ga0207681_10035203 3300025923 Bacteria 3298
408 Ga0207694_10058343 3300025924 Bacteria 3002
409 Ga0207694_11157445 3300025924 Bacteria 655
410 Ga0207650_10031197 3300025925 Bacteria 3846
411 Ga0207659_10000044 3300025926 Bacteria 88759
412 Ga0207659_10356560 3300025926 Bacteria 1214
413 Ga0207687_10000072 3300025927 Bacteria 76222
414 Ga0207664_10474955 3300025929 Bacteria 1118
415 Ga0207644_10007313 3300025931 Bacteria 7187
416 Ga0207690_10000140 3300025932 Bacteria 58923
417 Ga0207690_10045487 3300025932 Bacteria 2900
418 Ga0207690_10416557 3300025932 Bacteria 1074
419 Ga0207706_10003180 3300025933 Bacteria 15778
420 Ga0207706_10023633 3300025933 Bacteria 5519
421 Ga0207706_10088083 3300025933 Bacteria 2730
422 Ga0207706_10107818 3300025933 Bacteria 2451
423 Ga0207706_10606124 3300025933 Bacteria 940
424 Ga0207686_10018123 3300025934 Bacteria 3980
425 Ga0207686_11120960 3300025934 Bacteria 642
426 Ga0207709_10000154 3300025935 Bacteria 93456
427 Ga0207709_10007823 3300025935 Bacteria 5925
428 Ga0207709_10682084 3300025935 Bacteria 821
429 Ga0207670_10000444 3300025936 Bacteria 23206
430 Ga0207670_10468651 3300025936 Bacteria 1018
431 Ga0207670_10818838 3300025936 Bacteria 776
432 Ga0207670_10857592 3300025936 Unclassified 759
433 Ga0207669_10000176 3300025937 Bacteria 29979
434 Ga0207669_10026689 3300025937 Bacteria 3147
435 Ga0207704_10000086 3300025938 Bacteria 54866
436 Ga0207704_10033653 3300025938 Bacteria 2917
437 Ga0207704_10220588 3300025938 Unclassified 1403
438 Ga0207665_10132210 3300025939 Bacteria 1773
439 Ga0207665_10242924 3300025939 Bacteria 1327
440 Ga0207691_10000214 3300025940 Bacteria 56205
441 Ga0207691_10059545 3300025940 Bacteria 3472
442 Ga0207711_10001773 3300025941 Bacteria 19760
443 Ga0207711_10014174 3300025941 Bacteria 6621
444 Ga0207689_10000366 3300025942 Bacteria 42711
445 Ga0207689_10062365 3300025942 Bacteria 3065
446 Ga0207689_11612069 3300025942 Bacteria 540
447 Ga0207661_10000087 3300025944 Bacteria 63263
448 Ga0207661_10604003 3300025944 Bacteria 1007
449 Ga0207679_10000029 3300025945 Bacteria 183002
450 Ga0207679_10008732 3300025945 Bacteria 6463
451 Ga0207679_10269457 3300025945 Bacteria 1456
452 Ga0207667_10022798 3300025949 Bacteria 6906
453 Ga0207667_10834510 3300025949 Bacteria 916
454 Ga0207651_10000264 3300025960 Bacteria 22299
455 Ga0207651_10735947 3300025960 Bacteria 871
456 Ga0207712_10000129 3300025961 Bacteria 79246
457 Ga0207712_10002495 3300025961 Bacteria 11837
458 Ga0207712_10008947 3300025961 Bacteria 6333
459 Ga0207668_10000100 3300025972 Bacteria 60574
460 Ga0207668_10248086 3300025972 Bacteria 1444
461 Ga0207668_10707679 3300025972 Bacteria 886
462 Ga0207668_11724260 3300025972 Unclassified 565
463 Ga0207640_10001860 3300025981 Bacteria 11310
464 Ga0207640_10683863 3300025981 Unclassified 878
465 Ga0207658_10011163 3300025986 Bacteria 6117
466 Ga0207658_10110125 3300025986 Bacteria 2175
467 Ga0207658_10425745 3300025986 Bacteria 1171
468 Ga0207677_10006287 3300026023 Bacteria 6500
469 Ga0207703_10006917 3300026035 Bacteria 9029
470 Ga0207703_10042113 3300026035 Bacteria 3661
471 Ga0207703_10899707 3300026035 Bacteria 847
472 Ga0207639_10002204 3300026041 Bacteria 13124
473 Ga0207639_10025420 3300026041 Bacteria 4294
474 Ga0207639_10661600 3300026041 Bacteria 967
475 Ga0207678_10002814 3300026067 Bacteria 15778
476 Ga0207678_10004143 3300026067 Bacteria 13031
477 Ga0207678_10139405 3300026067 Bacteria 2069
478 Ga0207708_10001802 3300026075 Bacteria 15778
479 Ga0207708_10002366 3300026075 Bacteria 13852
480 Ga0207708_10004097 3300026075 Bacteria 10724
481 Ga0207702_10001819 3300026078 Bacteria 20980
482 Ga0207702_10309599 3300026078 Bacteria 1501
483 Ga0207641_10000476 3300026088 Bacteria 45413
484 Ga0207641_10039915 3300026088 Bacteria 3927
485 Ga0207641_10182723 3300026088 Bacteria 1922
486 Ga0207648_10000072 3300026089 Bacteria 94957
487 Ga0207648_10074884 3300026089 Bacteria 2951
488 Ga0207676_10000512 3300026095 Bacteria 32630
489 Ga0207676_10145923 3300026095 Bacteria 2032
490 Ga0207676_10153966 3300026095 Bacteria 1983
491 Ga0207674_10000697 3300026116 Bacteria 43729
492 Ga0207674_10003652 3300026116 Bacteria 18763
493 Ga0207675_100002384 3300026118 Bacteria 18614
494 Ga0207675_100026129 3300026118 Bacteria 5435
495 Ga0207675_100082231 3300026118 Bacteria 3020
496 Ga0207683_10000029 3300026121 Bacteria 109665
497 Ga0207698_10000523 3300026142 Bacteria 22323
498 Ga0207698_10066725 3300026142 Bacteria 2834
499 Ga0209973_1007912 3300027252 Bacteria 1199
500 Ga0209967_1008658 3300027364 Bacteria 1403
501 Ga0209967_1020422 3300027364 Bacteria 965
502 Ga0209984_1008235 3300027424 Bacteria 1309
503 Ga0209968_1019510 3300027526 Bacteria 1092
504 Ga0209999_1006967 3300027543 Bacteria 2033
505 Ga0209982_1015508 3300027552 Bacteria 1157
506 Ga0210002_1000381 3300027617 Bacteria 6055
507 Ga0209983_1009047 3300027665 Bacteria 2035
508 Ga0209966_1001626 3300027695 Bacteria 3839
509 Ga0209966_1010167 3300027695 Bacteria 1692
510 Ga0209966_1094199 3300027695 Bacteria 673
511 Ga0209998_10003967 3300027717 Bacteria 3182
512 Ga0209998_10006957 3300027717 Bacteria 2346
513 Ga0209998_10112281 3300027717 Bacteria 681
514 Ga0209813_10001957 3300027866 Bacteria 4658
515 Ga0209974_10028078 3300027876 Bacteria 1863
516 Ga0209974_10047690 3300027876 Bacteria 1435
517 Ga0207428_10000100 3300027907 Bacteria 119495
518 Ga0207428_10000228 3300027907 Bacteria 77812
519 Ga0207428_10250934 3300027907 Unclassified 1319
520 Ga0268266_10026692 3300028379 Bacteria 4914
521 Ga0268265_10001240 3300028380 Bacteria 22083
522 Ga0268265_10002707 3300028380 Bacteria 13120
523 Ga0268265_10635181 3300028380 Bacteria 1024
524 Ga0268264_10006796 3300028381 Bacteria 9610
525 Ga0268264_10023946 3300028381 Bacteria 4981
526 Ga0268264_10086087 3300028381 Bacteria 2699
527 Ga0268264_11821256 3300028381 Bacteria 619
528 Ga0265332_10001262 3300031238 Bacteria 14505
529 Ga0265325_10035258 3300031241 Bacteria 2658
530 Ga0265329_10007990 3300031242 Bacteria 4049
531 Ga0265340_10010191 3300031247 Bacteria 5033
532 Ga0265340_10050420 3300031247 Bacteria 2019
533 Ga0265340_10187919 3300031247 Bacteria 932
534 Ga0265316_10737023 3300031344 Bacteria 693
535 Ga0307408_100226002 3300031548 Bacteria 1530
536 Ga0316579_10196012 3300031691 Bacteria 976
537 Ga0265342_10000069 3300031712 Bacteria 110550
538 Ga0316576_10108378 3300031727 Bacteria 2081
539 Ga0316578_10010476 3300031728 Bacteria 4813
540 Ga0307405_10373372 3300031731 Bacteria 1108
541 Ga0307413_10368925 3300031824 Bacteria 1114
542 Ga0307410_10149906 3300031852 Bacteria 1735
543 Ga0307406_10883851 3300031901 Bacteria 760
544 Ga0307412_10542996 3300031911 Bacteria 975
545 Ga0307412_11539426 3300031911 Bacteria 606
546 Ga0307409_100175231 3300031995 Bacteria 1892
547 Ga0307409_100461723 3300031995 Bacteria 1228
548 Ga0307411_10032708 3300032005 Bacteria 3217
549 Ga0307411_10947454 3300032005 Bacteria 768
550 Ga0307415_100620440 3300032126 Bacteria 965
551 Ga0316583_10018501 3300032133 Bacteria 2501
552 Ga0373930_0000036 3300034816 Bacteria 11808
553 Ga0373948_0001276 3300034817 Bacteria 3442
554 Ga0373950_0000274 3300034818 Bacteria 6492
555 Ga0373950_0006173 3300034818 Bacteria 1818
556 Ga0373958_0000036 3300034819 Bacteria 13507
557 Ga0373958_0000512 3300034819 Bacteria 4815
558 Ga0373959_0001045 3300034820 Bacteria 4542
559 Ga0373959_0074521 3300034820 Bacteria 772
560 Ga0373938_0000752 3300034957 Bacteria 5239
561 Ga0373938_0001980 3300034957 Bacteria 3283
562 Ga0373928_0000727 3300035084 Bacteria 6461
563 Ga0373928_0002885 3300035084 Bacteria 3313
564 Ga0373929_0000805 3300035085 Bacteria 6102
565 Ga0373934_0088515 3300035086 Bacteria 1247
566 Ga0373940_0000107 3300035088 Bacteria 10202
567 Ga0373940_0005262 3300035088 Bacteria 2791
568 Ga0373949_0000284 3300035090 Bacteria 18664
569 Ga0373949_0001237 3300035090 Bacteria 7538
570 Ga0373951_0000560 3300035091 Bacteria 10396
571 Ga0373951_0004835 3300035091 Bacteria 3170
572 Ga0373952_0000135 3300035092 Bacteria 10680
573 Ga0373952_0000152 3300035092 Bacteria 10287
574 Ga0373952_0203300 3300035092 Unclassified 581
575 Ga0373923_0005530 3300035111 Bacteria 4296
576 Ga0373932_0000172 3300035112 Bacteria 18943
577 Ga0373932_0002592 3300035112 Bacteria 4511
578 Ga0373936_0012581 3300035113 Bacteria 3221
579 Ga0373936_0012931 3300035113 Bacteria 3183
580 Ga0373939_0007160 3300035114 Bacteria 2704
581 Ga0373939_0011782 3300035114 Bacteria 2215
582 Ga0373941_0000081 3300035115 Bacteria 15592
583 Ga0373941_0000225 3300035115 Bacteria 10871
584 Ga0373941_0002269 3300035115 Bacteria 4208
585 Ga0373941_0121660 3300035115 Bacteria 931
586 Ga0373945_0040392 3300035116 Bacteria 1684
587 Ga0373945_0083557 3300035116 Bacteria 1227
588 Ga0373953_0002122 3300035117 Bacteria 5929
589 Ga0373953_0075559 3300035117 Bacteria 1395
590 Ga0373954_0002543 3300035118 Bacteria 7653
591 Ga0373954_0014017 3300035118 Bacteria 3573
592 Ga0373956_0060477 3300035119 Bacteria 1715
593 Ga0373957_0012970 3300035120 Bacteria 2818
594 Ga0373957_0014625 3300035120 Bacteria 2686
595 Ga0373960_0001550 3300035121 Bacteria 5123
596 Ga0373960_0003760 3300035121 Bacteria 3450
597 Ga0373943_0005071 3300035170 Bacteria 5939
598 Ga0373946_0000195 3300035171 Bacteria 18740
599 Ga0373955_0000728 3300035172 Bacteria 14088
600 Ga0373955_0003373 3300035172 Bacteria 7021
601 Ga0373942_0000173 3300035207 Bacteria 16049
602 Ga0373942_0065726 3300035207 Bacteria 1048
603 Ga0373961_0000196 3300035241 Bacteria 28662
604 Ga0373961_0003123 3300035241 Bacteria 4151
605 Ga0373962_0000151 3300035242 Bacteria 14355
606 Ga0373962_0000452 3300035242 Bacteria 9022
607 Ga0316574_0025731 3300035398 Bacteria 3534
608 Ga0373924_0000908 3300035410 Bacteria 9373
609 Ga0373924_0014025 3300035410 Bacteria 3022
610 Ga0373931_0001253 3300035691 Bacteria 10836
611 Ga0373931_0002490 3300035691 Bacteria 8167
612 Ga0373931_0324267 3300035691 Bacteria 957
613 Ga0373931_1030836 3300035691 Bacteria 558
614 Ga0373935_0000192 3300035692 Bacteria 29081
615 Ga0373927_0324268 3300035695 Bacteria 1014
616 Ga0373927_0351808 3300035695 Bacteria 971
617 Ga0373927_0822081 3300035695 Bacteria 613
618 Ga0373933_0004316 3300035724 Bacteria 7806
619 Ga0373933_0006946 3300035724 Bacteria 6170
620 Ga0373933_0388058 3300035724 Bacteria 910
621 Ga0373947_0002278 3300035725 Bacteria 11598
622 Ga0373947_0021129 3300035725 Bacteria 3766
623 Ga0373947_0026478 3300035725 Bacteria 3390
624 Ga0373937_0000018 3300036401 Bacteria 144056
625 Ga0373937_0738293 3300036401 Bacteria 932
626 Ga0316582_0076318 3300036647 Bacteria 2179
627 Ga0316584_0073155 3300036712 Bacteria 2568
628 Ga0373925_0000055 3300037068 Bacteria 123638
629 Ga0373925_0056277 3300037068 Bacteria 2946
630 Ga0373925_0345257 3300037068 Bacteria 1208
631 Ga0395898_0119462 3300037466 Bacteria 2525
632 Ga0242420_003017 3300038996 Bacteria 2460
633 Ga0436361_0155875 3300039447 Bacteria 855
634 Ga0439441_172451 3300042001 Bacteria 517
635 Ga0439450_090220 3300042008 Bacteria 769
636 Ga0439455_0040110 3300042012 Bacteria 1196
637 Ga0439463_200409 3300042016 Bacteria 518
638 Ga0439458_0070207 3300042157 Bacteria 884
639 Ga0439444_0123655 3300042437 Bacteria 606
640 Ga0439464_0042609 3300042439 Bacteria 1296
641 Ga0439464_0142683 3300042439 Bacteria 746
642 Ga0439460_0095645 3300042461 Bacteria 949
643 Ga0451577_0327081 3300042876 Bacteria 1390
644 Ga0466972_0019709 3300044658 Bacteria 3373
645 Ga0466972_0033799 3300044658 Bacteria 2508
646 Ga0466965_0020059 3300044683 Bacteria 3211
647 Ga0466965_0024731 3300044683 Bacteria 2906
648 Ga0466961_0016205 3300044693 Bacteria 4786
649 Ga0466964_0017573 3300044706 Bacteria 2737
650 Ga0453684_0171995 3300044712 Bacteria 2552
651 Ga0466971_0020441 3300044719 Bacteria 2943
652 Ga0466970_0009267 3300044765 Bacteria 4969
653 Ga0466970_0121027 3300044765 Bacteria 1434
654 Ga0466957_0011379 3300044842 Bacteria 5131
655 Ga0466957_0064591 3300044842 Bacteria 2252
656 Ga0466960_0077820 3300044901 Bacteria 1664
657 Ga0466960_0831607 3300044901 Bacteria 560
658 Ga0451576_0041638 3300045051 Bacteria 4855
659 Ga0466958_0036691 3300045836 Bacteria 2935
660 Ga0466967_0025379 3300045976 Bacteria 4886
661 Ga0466967_0119885 3300045976 Bacteria 2429
662 Ga0466967_0524362 3300045976 Bacteria 1164
663 Ga0466967_0627373 3300045976 Bacteria 1062
664 Ga0495592_0000235 3300046454 Bacteria 47623
665 Ga0495592_0093466 3300046454 Bacteria 2154
666 Ga0495590_0052060 3300046457 Bacteria 1430
667 Ga0495629_0002430 3300046459 Bacteria 14300
668 Ga0495638_0271792 3300046460 Bacteria 925
669 Ga0495651_0000516 3300046462 Bacteria 30037
670 Ga0495651_0390249 3300046462 Bacteria 911
671 Ga0495653_0000003 3300046463 Bacteria 377892
672 Ga0495653_0418520 3300046463 Bacteria 848
673 Ga0495582_0034749 3300046473 Bacteria 2771
674 Ga0495662_0011854 3300046476 Bacteria 4261
675 Ga0495664_0000001 3300046477 Bacteria 757730
676 Ga0495608_0000033 3300046511 Bacteria 141349
677 Ga0495608_0045528 3300046511 Bacteria 2923
678 Ga0495608_0154901 3300046511 Bacteria 1459
679 Ga0495618_0000012 3300046514 Bacteria 170881
680 Ga0495628_0000003 3300046516 Bacteria 470339
681 Ga0495630_0004336 3300046517 Bacteria 9954
682 Ga0495630_0325694 3300046517 Bacteria 1175
683 Ga0495637_0290906 3300046520 Bacteria 581
684 Ga0495642_0289634 3300046528 Bacteria 717
685 Ga0495652_0000001 3300046529 Bacteria 1045081
686 Ga0495652_0082958 3300046529 Bacteria 2640
687 Ga0495652_0592264 3300046529 Bacteria 757
688 Ga0495640_0000012 3300046533 Bacteria 194692
689 Ga0495640_0698415 3300046533 Bacteria 609
690 Ga0495587_0000003 3300046536 Bacteria 424188
691 Ga0495587_0031814 3300046536 Bacteria 3192
692 Ga0495587_0271814 3300046536 Bacteria 951
693 Ga0495609_0124607 3300046538 Bacteria 1106
694 Ga0495645_0000004 3300046543 Bacteria 532661
695 Ga0495667_0000001 3300046559 Bacteria 834831
696 Ga0495667_0032697 3300046559 Bacteria 3484
697 Ga0495634_0000163 3300046642 Bacteria 60720
698 Ga0495635_0000015 3300046663 Bacteria 215468
699 Ga0495635_0229038 3300046663 Bacteria 1256
700 Ga0495635_0845041 3300046663 Bacteria 588
701 Ga0495657_0000061 3300046675 Bacteria 96199
702 Ga0495657_0028219 3300046675 Bacteria 3951
703 Ga0495599_0000004 3300046678 Bacteria 316231
704 Ga0495623_0000020 3300046679 Bacteria 100523
705 Ga0495623_0041069 3300046679 Bacteria 2952
706 Ga0495623_0387829 3300046679 Bacteria 754
707 Ga0495646_0000006 3300046680 Bacteria 258496
708 Ga0495646_0355101 3300046680 Bacteria 767
709 Ga0495647_0478379 3300046681 Bacteria 578
710 Ga0495658_0030078 3300046683 Bacteria 2946
711 Ga0495613_0002383 3300046689 Bacteria 14238
712 Ga0495613_0147438 3300046689 Bacteria 1679
713 Ga0495624_0012717 3300046690 Bacteria 5747
714 Ga0495624_0340139 3300046690 Bacteria 903
715 Ga0495600_0000029 3300046809 Bacteria 89914
716 Ga0495581_0001267 3300047315 Bacteria 13913
717 Ga0495604_0000018 3300047317 Bacteria 181417
718 Ga0495604_0199106 3300047317 Bacteria 1391
719 Ga0495674_0000001 3300047319 Bacteria 778665
720 Ga0495674_0053333 3300047319 Bacteria 3555
721 Ga0495674_0178558 3300047319 Bacteria 1769
722 Ga0495672_0124293 3300047320 Bacteria 1367
723 Ga0495672_0279408 3300047320 Bacteria 799
724 Ga0495680_0000147 3300047322 Bacteria 70915
725 Ga0495680_0005610 3300047322 Bacteria 11761
726 Ga0495675_0000034 3300047444 Bacteria 97963
727 Ga0495684_0000005 3300047471 Bacteria 291932
728 Ga0495684_0502670 3300047471 Bacteria 833
729 Ga0495593_0002540 3300047673 Bacteria 10956
730 Ga0495602_0000002 3300048088 Bacteria 422216
731 Ga0495602_0260578 3300048088 Bacteria 1286
732 Ga0495602_0383473 3300048088 Bacteria 1006
733 Ga0496100_0000530 3300048903 Bacteria 18154
734 Ga0496100_0129276 3300048903 Bacteria 1777
735 Ga0496100_0459229 3300048903 Bacteria 977
736 Ga0496101_0000189 3300048904 Bacteria 48416
737 Ga0496101_0067265 3300048904 Bacteria 2616
738 Ga0496101_0181949 3300048904 Bacteria 1619
739 Ga0496101_0255871 3300048904 Bacteria 1365
740 Ga0496102_0001085 3300048905 Bacteria 25158
741 Ga0496102_0026992 3300048905 Bacteria 5127
742 Ga0496102_0053152 3300048905 Bacteria 3693
743 Ga0496102_1405045 3300048905 Bacteria 617
744 Ga0496103_0020763 3300048906 Bacteria 3948
745 Ga0496103_0399992 3300048906 Bacteria 882
746 Ga0496104_0004877 3300048907 Bacteria 11694
747 Ga0496104_0076771 3300048907 Bacteria 3182
748 Ga0496104_0102063 3300048907 Bacteria 2747
749 Ga0496104_0590549 3300048907 Unclassified 1021
750 Ga0496104_0937430 3300048907 Bacteria 770
751 Ga0496105_0007511 3300048908 Bacteria 8445
752 Ga0496105_0329944 3300048908 Bacteria 1221
753 Ga0496105_0642762 3300048908 Bacteria 819
754 Ga0496106_0002185 3300048909 Bacteria 14611
755 Ga0496106_0004993 3300048909 Bacteria 9819
756 Ga0496106_0040009 3300048909 Bacteria 3510
757 Ga0496106_0110134 3300048909 Bacteria 2143
758 Ga0496106_0195661 3300048909 Bacteria 1608
759 Ga0496106_0465257 3300048909 Bacteria 1016
760 Ga0496106_0537812 3300048909 Bacteria 938
761 Ga0496107_0003085 3300048910 Bacteria 11063
762 Ga0496107_0006647 3300048910 Bacteria 7961
763 Ga0496107_0121975 3300048910 Bacteria 1920
764 Ga0496107_0295133 3300048910 Bacteria 1206
765 Ga0496108_0002465 3300048911 Bacteria 14815
766 Ga0496108_0011168 3300048911 Bacteria 7296
767 Ga0496108_0502321 3300048911 Unclassified 1059
768 Ga0496109_0000488 3300048912 Bacteria 33914
769 Ga0496109_0006884 3300048912 Bacteria 9588
770 Ga0496109_0084382 3300048912 Bacteria 2931
771 Ga0496109_0173976 3300048912 Bacteria 2021
772 Ga0496109_0784305 3300048912 Unclassified 891
773 Ga0496110_0069646 3300048913 Bacteria 3116
774 Ga0496110_0111002 3300048913 Bacteria 2464
775 Ga0496110_0526456 3300048913 Bacteria 1075
776 Ga0496111_0098927 3300048914 Bacteria 2142
777 Ga0496111_0140843 3300048914 Bacteria 1787
778 Ga0496111_0436514 3300048914 Bacteria 967
779 Ga0496112_0030833 3300048915 Bacteria 5194
780 Ga0496112_0184312 3300048915 Bacteria 2051
781 Ga0496113_0021686 3300048916 Bacteria 4534
782 Ga0496113_0037283 3300048916 Bacteria 3566
783 Ga0496113_0055553 3300048916 Bacteria 2968
784 Ga0496113_0500650 3300048916 Unclassified 975
785 Ga0496114_0001960 3300048917 Bacteria 15650
786 Ga0496114_0318888 3300048917 Bacteria 1373
787 Ga0496115_0002442 3300048918 Bacteria 13349
788 Ga0496115_0095823 3300048918 Bacteria 2429
789 Ga0496115_0293453 3300048918 Bacteria 1333
790 Ga0496121_0656819 3300048924 Bacteria 638
791 Ga0496122_0179782 3300048925 Bacteria 1263
792 Ga0496123_0028949 3300048926 Bacteria 4089
793 Ga0496124_0594816 3300048927 Bacteria 721
794 Ga0496125_0289770 3300048928 Bacteria 1009
795 Ga0496126_0652286 3300048929 Bacteria 823
796 Ga0501031_0008966 3300049568 Bacteria 6506
797 Ga0501031_0048550 3300049568 Bacteria 2766
798 Ga0501031_0075381 3300049568 Bacteria 2196
799 Ga0501032_0032190 3300049569 Bacteria 3593
800 Ga0501032_0053337 3300049569 Bacteria 2723
801 Ga0501032_0122015 3300049569 Bacteria 1722
802 Ga0501032_0251647 3300049569 Bacteria 1147
803 Ga0501032_0339287 3300049569 Bacteria 968
804 Ga0501032_0633903 3300049569 Bacteria 679
805 Ga0501033_0127784 3300049570 Bacteria 1842
806 Ga0501033_0153285 3300049570 Bacteria 1661
807 Ga0501033_0158723 3300049570 Bacteria 1628
808 Ga0501033_0278704 3300049570 Bacteria 1180
809 Ga0501033_0804144 3300049570 Bacteria 635
810 Ga0501034_0000616 3300049571 Bacteria 55864
811 Ga0501034_0000850 3300049571 Bacteria 45243
812 Ga0501034_0016718 3300049571 Bacteria 7522
813 Ga0501034_0023602 3300049571 Bacteria 6266
814 Ga0501034_0071171 3300049571 Bacteria 3488
815 Ga0501034_0076450 3300049571 Bacteria 3354
816 Ga0501034_0118117 3300049571 Bacteria 2639
817 Ga0501034_0420067 3300049571 Bacteria 1258
818 Ga0501034_0427856 3300049571 Bacteria 1244
819 Ga0501034_0963848 3300049571 Bacteria 738
820 Ga0501034_1042437 3300049571 Bacteria 700
821 Ga0501034_1064263 3300049571 Unclassified 691
822 Ga0501036_0000547 3300049572 Bacteria 26976
823 Ga0501036_0034721 3300049572 Bacteria 4266
824 Ga0501036_0038602 3300049572 Bacteria 4041
825 Ga0501036_0065268 3300049572 Bacteria 3081
826 Ga0501036_0073228 3300049572 Bacteria 2896
827 Ga0501036_0352825 3300049572 Bacteria 1228
828 Ga0501036_0796033 3300049572 Bacteria 778
829 Ga0501037_0001864 3300049573 Bacteria 15310
830 Ga0501037_0055103 3300049573 Bacteria 2907
831 Ga0501037_0079089 3300049573 Bacteria 2386
832 Ga0501037_0131522 3300049573 Bacteria 1794
833 Ga0501037_0199016 3300049573 Bacteria 1416
834 Ga0501037_0656609 3300049573 Bacteria 700
835 Ga0501038_0011775 3300049574 Bacteria 7979
836 Ga0501038_0093671 3300049574 Bacteria 2512
837 Ga0501038_0167015 3300049574 Bacteria 1784
838 Ga0501038_0172863 3300049574 Bacteria 1747
839 Ga0501038_0352777 3300049574 Bacteria 1145
840 Ga0501038_0544194 3300049574 Bacteria 883
841 Ga0501039_0009820 3300049575 Bacteria 7293
842 Ga0501039_0054526 3300049575 Bacteria 3094
843 Ga0501039_0129166 3300049575 Bacteria 1983
844 Ga0501040_0082795 3300049576 Bacteria 2225
845 Ga0501040_0820205 3300049576 Unclassified 673
846 Ga0501042_1029229 3300049578 Unclassified 600
847 Ga0501043_0001850 3300049579 Bacteria 18123
848 Ga0501043_0012323 3300049579 Bacteria 6685
849 Ga0501043_0065891 3300049579 Bacteria 2844
850 Ga0501043_0117371 3300049579 Bacteria 2088
851 Ga0501043_0117907 3300049579 Unclassified 2082
852 Ga0501043_0118826 3300049579 Bacteria 2073
853 Ga0501043_0169344 3300049579 Bacteria 1704
854 Ga0501043_0389891 3300049579 Bacteria 1053
855 Ga0501046_0011532 3300049580 Bacteria 7558
856 Ga0501046_0049782 3300049580 Bacteria 3313
857 Ga0501046_0076847 3300049580 Bacteria 2586
858 Ga0501046_0084305 3300049580 Bacteria 2451
859 Ga0501046_0485179 3300049580 Bacteria 886
860 Ga0501047_0000455 3300049581 Bacteria 45200
861 Ga0501047_0004194 3300049581 Bacteria 13570
862 Ga0501047_0189989 3300049581 Bacteria 1917
863 Ga0501047_0253119 3300049581 Bacteria 1609
864 Ga0501047_0316763 3300049581 Bacteria 1400
865 Ga0501047_0343734 3300049581 Bacteria 1329
866 Ga0501047_0429194 3300049581 Bacteria 1152
867 Ga0501047_0504463 3300049581 Bacteria 1036
868 Ga0501047_0807331 3300049581 Bacteria 753
869 Ga0501047_0954825 3300049581 Bacteria 670
870 Ga0501048_0001113 3300049582 Bacteria 20168
871 Ga0501048_0074084 3300049582 Bacteria 2402
872 Ga0501048_0078673 3300049582 Bacteria 2327
873 Ga0501048_0328389 3300049582 Bacteria 1090
874 Ga0501048_1046248 3300049582 Bacteria 587
875 Ga0501067_0017220 3300049583 Bacteria 3994
876 Ga0501068_0014384 3300049584 Bacteria 4522
877 Ga0501068_0060046 3300049584 Bacteria 2308
878 Ga0501068_0111176 3300049584 Bacteria 1703
879 Ga0501068_0561863 3300049584 Bacteria 742
880 Ga0501068_0890866 3300049584 Bacteria 585
881 Ga0501069_0037404 3300049585 Bacteria 2678
882 Ga0501069_0061150 3300049585 Bacteria 2102
883 Ga0501069_0156637 3300049585 Bacteria 1310
884 Ga0501069_0166813 3300049585 Bacteria 1269
885 Ga0501069_0194151 3300049585 Bacteria 1175
886 Ga0501069_0421308 3300049585 Bacteria 791
887 Ga0501070_0003292 3300049586 Bacteria 14019
888 Ga0501070_0005448 3300049586 Bacteria 10863
889 Ga0501070_0017466 3300049586 Bacteria 6024
890 Ga0501070_0048170 3300049586 Bacteria 3540
891 Ga0501070_0052248 3300049586 Bacteria 3392
892 Ga0501070_0077534 3300049586 Bacteria 2750
893 Ga0501070_0085866 3300049586 Bacteria 2605
894 Ga0501070_0086430 3300049586 Bacteria 2596
895 Ga0501070_0167163 3300049586 Bacteria 1812
896 Ga0501070_0233512 3300049586 Bacteria 1507
897 Ga0501070_0305835 3300049586 Bacteria 1294
898 Ga0501070_0334427 3300049586 Bacteria 1230
899 Ga0501070_0335000 3300049586 Bacteria 1229
900 Ga0501070_0378459 3300049586 Bacteria 1147
901 Ga0501070_0488873 3300049586 Bacteria 989
902 Ga0501070_1199378 3300049586 Bacteria 582
903 Ga0501071_0026287 3300049587 Bacteria 4084
904 Ga0501071_0032614 3300049587 Bacteria 3700
905 Ga0501072_0042458 3300049588 Bacteria 3572
906 Ga0501072_0150085 3300049588 Bacteria 1858
907 Ga0501072_0163577 3300049588 Bacteria 1775
908 Ga0501072_0605319 3300049588 Unclassified 864
909 Ga0501072_1078776 3300049588 Unclassified 625
910 Ga0501073_0023747 3300049589 Bacteria 4402
911 Ga0501073_0142005 3300049589 Bacteria 1664
912 Ga0501073_0317161 3300049589 Bacteria 1075
913 Ga0501074_0006027 3300049590 Bacteria 8750
914 Ga0501074_0010081 3300049590 Bacteria 6860
915 Ga0501074_0090880 3300049590 Bacteria 2186
916 Ga0501074_0266623 3300049590 Bacteria 1217
917 Ga0501074_0501960 3300049590 Unclassified 859
918 Ga0501075_0090438 3300049591 Bacteria 2322
919 Ga0501075_0252633 3300049591 Bacteria 1344
920 Ga0501075_0312204 3300049591 Bacteria 1198
921 Ga0501076_0156240 3300049592 Bacteria 1857
922 Ga0501077_0131914 3300049593 Bacteria 1584
923 Ga0501077_0542348 3300049593 Bacteria 746
924 Ga0501079_0014949 3300049741 Bacteria 5916
925 Ga0501079_0039132 3300049741 Bacteria 3657
926 Ga0501079_0056857 3300049741 Bacteria 3019
927 Ga0501079_0728916 3300049741 Bacteria 780
928 Ga0501079_1676934 3300049741 Unclassified 500
929 Ga0501080_0005235 3300049742 Bacteria 11555
930 Ga0501080_0006633 3300049742 Bacteria 10411
931 Ga0501080_0023839 3300049742 Bacteria 5672
932 Ga0501080_0272356 3300049742 Bacteria 1541
933 Ga0501080_0577445 3300049742 Bacteria 999
934 Ga0501080_0684720 3300049742 Bacteria 905
935 Ga0501080_0765243 3300049742 Bacteria 848
936 Ga0501081_0204727 3300049743 Bacteria 1432
937 Ga0501081_0799210 3300049743 Bacteria 710
938 Ga0501083_0000437 3300049744 Bacteria 26753
939 Ga0501083_0056364 3300049744 Bacteria 2633
940 Ga0501083_0076461 3300049744 Bacteria 2222
941 Ga0501083_0120344 3300049744 Bacteria 1722
942 Ga0501083_0218872 3300049744 Bacteria 1241
943 Ga0501083_0231490 3300049744 Bacteria 1203
944 Ga0501083_0441481 3300049744 Bacteria 847
945 Ga0501035_0000837 3300049822 Bacteria 32871
946 Ga0501035_0046997 3300049822 Bacteria 3878
947 Ga0501035_0052690 3300049822 Bacteria 3640
948 Ga0501035_0063205 3300049822 Bacteria 3293
949 Ga0501035_0077206 3300049822 Bacteria 2943
950 Ga0501035_0177704 3300049822 Bacteria 1835
951 Ga0501035_0200239 3300049822 Bacteria 1713
952 Ga0501035_0230125 3300049822 Bacteria 1580
953 Ga0501035_0591901 3300049822 Bacteria 905
954 Ga0501035_1271270 3300049822 Unclassified 568
955 Ga0501044_0015432 3300049823 Bacteria 8227
956 Ga0501044_0015853 3300049823 Bacteria 8108
957 Ga0501044_0035180 3300049823 Bacteria 5246
958 Ga0501044_0058058 3300049823 Bacteria 3969
959 Ga0501044_0065969 3300049823 Bacteria 3691
960 Ga0501044_0085528 3300049823 Bacteria 3186
961 Ga0501044_0112301 3300049823 Bacteria 2732
962 Ga0501044_0281194 3300049823 Bacteria 1597
963 Ga0501044_0372002 3300049823 Bacteria 1345
964 Ga0501044_0475287 3300049823 Bacteria 1153
965 Ga0501044_0482396 3300049823 Bacteria 1143
966 Ga0501044_0899510 3300049823 Bacteria 760
967 Ga0501044_0958332 3300049823 Bacteria 728
968 Ga0501045_0130953 3300049824 Bacteria 1865
969 Ga0501045_0276003 3300049824 Bacteria 1251
970 nmdc:mga03683_306883_c1 3300050489 Bacteria 745
971 nmdc:mga03n38_364009_c1 3300050490 Bacteria 789
972 nmdc:mga00v17_326156_c1 3300050491 Bacteria 998
973 nmdc:mga06z11_11012_c1 3300050494 Bacteria 3880
974 nmdc:mga06z11_310787_c1 3300050494 Bacteria 939
975 nmdc:mga04h51_1452_c1 3300050495 Bacteria 5485
976 nmdc:mga07m45_342931_c1 3300050496 Bacteria 868
977 nmdc:mga07m45_452579_c1 3300050496 Bacteria 744
978 nmdc:mga05p37_306787_c1 3300050507 Bacteria 1883
979 nmdc:mga09592_1462109_c1 3300050508 Unclassified 557
980 nmdc:mga06r32_106007_c1 3300050510 Bacteria 2761
981 nmdc:mga06r32_1123471_c1 3300050510 Bacteria 734
982 nmdc:mga06r32_2052604_c1 3300050510 Unclassified 505
983 nmdc:mga06r32_545779_c1 3300050510 Bacteria 1133
984 nmdc:mga08y16_1045_c1 3300050511 Bacteria 27157
985 nmdc:mga08y16_11105_c1 3300050511 Bacteria 9458
986 nmdc:mga08y16_84627_c1 3300050511 Bacteria 3306
987 nmdc:mga0n895_1396109_c1 3300050512 Bacteria 669
988 nmdc:mga0n895_206826_c1 3300050512 Bacteria 1993
989 nmdc:mga0n895_239240_c1 3300050512 Unclassified 1842
990 nmdc:mga0n895_242719_c1 3300050512 Bacteria 1828
991 nmdc:mga0n895_6556_c1 3300050512 Bacteria 9906
992 nmdc:mga0n895_749056_c1 3300050512 Bacteria 970
993 nmdc:mga0n895_82905_c1 3300050512 Bacteria 3197
994 nmdc:mga0rr50_1209514_c1 3300050513 Bacteria 642
995 nmdc:mga0rr50_174817_c1 3300050513 Bacteria 1752
996 nmdc:mga0rr50_179658_c1 3300050513 Bacteria 1729
997 nmdc:mga08x19_3619_c1 3300050514 Bacteria 9202
998 nmdc:mga08x19_45947_c1 3300050514 Unclassified 2791
999 nmdc:mga0a205_1492_c1 3300050515 Bacteria 19963
1000 nmdc:mga0a205_30267_c1 3300050515 Bacteria 5182
1001 nmdc:mga0sz30_235576_c1 3300050516 Bacteria 815
1002 Ga0495601_0000003 3300053077 Bacteria 493642
1003 Ga0495601_0004661 3300053077 Bacteria 7935
1004 Ga0495601_0060828 3300053077 Bacteria 2397
1005 Ga0495612_0000007 3300053078 Bacteria 253300
1006 Ga0495612_0081412 3300053078 Bacteria 1361
1007 Ga0495595_0000018 3300053084 Bacteria 126874
1008 Ga0495595_0044171 3300053084 Bacteria 2046
1009 Ga0495595_0246404 3300053084 Bacteria 894
1010 Ga0495619_0000009 3300053085 Bacteria 305595
1011 Ga0495619_0141403 3300053085 Bacteria 1657
1012 Ga0495619_0184650 3300053085 Bacteria 1443
1013 Ga0500641_0007998 3300053096 Bacteria 3768
1014 Ga0500641_0057847 3300053096 Bacteria 1609
1015 Ga0500652_000080 3300053131 Bacteria 42009
1016 Ga0500636_0040041 3300053177 Bacteria 2772
1017 Ga0501084_0068797 3300054114 Bacteria 2964
1018 Ga0501084_0239755 3300054114 Bacteria 1531
1019 Ga0501084_0266357 3300054114 Bacteria 1447
1020 Ga0501084_1731539 3300054114 Bacteria 522
1021 Ga0587092_149011 3300059512 Bacteria 521
1022 Ga0501082_0105643 3300060353 Bacteria 2436
1023 Ga0501082_0146392 3300060353 Bacteria 2051
1024 Ga0501082_0334620 3300060353 Bacteria 1319
1025 Ga0501082_0351801 3300060353 Bacteria 1284
1026 Ga0501082_0428464 3300060353 Bacteria 1155
1027 Ga0466962_0031835 3300061719 Bacteria 2525
1028 Ga0530510_0147766 3300061734 Bacteria 1734
1029 Ga0530510_0806643 3300061734 Bacteria 716
1030 Ga0501039_0740727
1031 2214745210
1032 ARcpr5oldR_c000144
1033 ARSoilYngRDRAFT_c00009
1034 ARcpr5yngRDRAFT_c000006
1035 ARSoilOldRDRAFT_c000102
1036 ARCol0oldRDRAFT_c01043
1037 ARCol0yngRDRAFT_1000092
1038 JGI24032J14994_100041
1039 JGI24736J21556_1064614
1040 JGI24752J21851_1042901
1041 JGI24746J21847_1001712
1042 JGI24740J21852_10011798
1043 JGI24739J22299_10000092
1044 JGI24737J22298_10003955
1045 JGI24737J22298_10008311
1046 JGI24743J22301_10030239
1047 JGI24750J21931_1000128
1048 JGI24745J21846_1000110
1049 JGI24748J21848_1000158
1050 JGI24738J21930_10000010
1051 JGI24749J21850_1001926
1052 JGI24749J21850_1018182
1053 JGI24744J21845_10000683
1054 JGI24744J21845_10110869
1055 JGI24035J26624_1000002
1056 JGI24033J26618_1002588
1057 JGI24034J26672_10000201
1058 JGI24742J22300_10000765
1059 JGI24751J29686_10021731
1060 JGI26129J50193_1007527
1061 JGI26129J50193_1015647
1062 JGI26140J50224_101872
1063 Ga0055526_1030168
1064 JGI25405J52794_10006144
1065 Ga0065717_1003867
1066 Ga0065716_1002550
1067 Ga0065704_10094385
1068 Ga0065712_10000899
1069 Ga0065712_10068648
1070 Ga0065715_10000752
1071 Ga0065715_10089173
1072 Ga0065715_10165183
1073 Ga0070658_10504520
1074 Ga0070676_10000978
1075 Ga0070676_10241875
1076 Ga0070683_100001029
1077 Ga0070683_100114195
1078 Ga0070683_101456400
1079 Ga0070690_100001038
1080 Ga0070690_100615176
1081 Ga0070670_100026956
1082 Ga0070670_100398935
1083 Ga0070677_10000126
1084 Ga0070677_10285506
1085 Ga0068869_100000079
1086 Ga0068869_100035044
1087 Ga0068869_102041152
1088 Ga0070666_10019358
1089 Ga0070666_10250122
1090 Ga0070680_100002329
1091 Ga0070680_100007030
1092 Ga0070680_100129426
1093 Ga0070682_100000641
1094 Ga0070682_100663111
1095 Ga0068868_100002114
1096 Ga0070660_100002411
1097 Ga0070660_100019320
1098 Ga0070660_101957305
1099 Ga0070689_100003727
1100 Ga0070689_100021372
1101 Ga0070691_10000161
1102 Ga0070691_10033380
1103 Ga0070687_100000085
1104 Ga0070687_100013028
1105 Ga0070687_100760099
1106 Ga0070687_100917709
1107 Ga0070661_100000307
1108 Ga0070661_100454154
1109 Ga0070661_100551561
1110 Ga0070661_100855173
1111 Ga0070692_10001915
1112 Ga0070692_10048702
1113 Ga0070668_100009110
1114 Ga0070668_100039131
1115 Ga0070668_102210166
1116 Ga0070669_100000571
1117 Ga0070669_100037439
1118 Ga0070675_100014189
1119 Ga0070675_100075720
1120 Ga0070675_101151216
1121 Ga0070671_100000104
1122 Ga0070674_100000238
1123 Ga0070674_100057646
1124 Ga0070673_100000152
1125 Ga0070673_101435931
1126 Ga0070688_100001552
1127 Ga0070688_100010437
1128 Ga0070688_100185664
1129 Ga0070659_100000551
1130 Ga0070659_100014072
1131 Ga0070667_100002365
1132 Ga0070667_100082240
1133 Ga0070667_100126878
1134 Ga0070703_10002446
1135 Ga0070703_10008783
1136 Ga0070703_10277971
1137 Ga0070714_100382247
1138 Ga0070714_100521871
1139 Ga0070710_10903011
1140 Ga0070701_10000674
1141 Ga0070701_10024327
1142 Ga0070701_10027601
1143 Ga0070711_100898965
1144 Ga0070711_102008838
1145 Ga0070705_100000096
1146 Ga0070705_100000148
1147 Ga0070705_100039756
1148 Ga0070700_100000277
1149 Ga0070700_100004184
1150 Ga0070700_100071695
1151 Ga0070700_101978793
1152 Ga0070694_100009315
1153 Ga0070694_100025210
1154 Ga0070694_100028101
1155 Ga0070708_100013438
1156 Ga0070708_100080131
1157 Ga0070663_100000522
1158 Ga0070663_100030853
1159 Ga0070663_100107269
1160 Ga0070663_101465575
1161 Ga0070678_100000718
1162 Ga0070678_102109210
1163 Ga0070662_100019850
1164 Ga0070662_100078008
1165 Ga0070662_100479210
1166 Ga0070662_100815239
1167 Ga0070681_10003456
1168 Ga0070681_10022561
1169 Ga0070681_10064843
1170 Ga0070681_10141932
1171 Ga0070681_11854580
1172 Ga0068867_100004407
1173 Ga0068867_100017974
1174 Ga0068867_100775500
1175 Ga0070685_10012102
1176 Ga0070706_100069484
1177 Ga0070698_100076049
1178 Ga0074259_11111610
1179 Ga0070699_100000255
1180 Ga0070699_101296327
1181 Ga0070679_100031781
1182 Ga0070679_100031892
1183 Ga0070679_100033806
1184 Ga0070679_100133048
1185 Ga0070679_101519029
1186 Ga0070684_100000894
1187 Ga0070684_100310980
1188 Ga0070684_100925204
1189 Ga0070697_100015667
1190 Ga0070697_100390178
1191 Ga0070697_100659297
1192 Ga0068853_100002891
1193 Ga0068853_100259619
1194 Ga0070672_100000088
1195 Ga0070672_100091389
1196 Ga0070672_100573416
1197 Ga0070686_100000719
1198 Ga0070686_100032503
1199 Ga0070695_100000248
1200 Ga0070695_100001789
1201 Ga0070695_100027104
1202 Ga0070696_100000552
1203 Ga0070696_100013552
1204 Ga0070696_100020079
1205 Ga0070696_100421267
1206 Ga0070693_100000134
1207 Ga0070693_100009572
1208 Ga0070665_100050659
1209 Ga0070704_100000026
1210 Ga0070704_100011965
1211 Ga0070704_100044802
1212 Ga0070704_100309229
1213 Ga0070704_100607338
1214 Ga0068855_100006834
1215 Ga0068855_102295069
1216 Ga0068855_102355802
1217 Ga0070664_100002234
1218 Ga0070664_100011614
1219 Ga0070664_100179423
1220 Ga0070664_100397929
1221 Ga0068857_100002935
1222 Ga0068857_100010529
1223 Ga0068854_100000546
1224 Ga0068854_100932240
1225 Ga0068856_100002000
1226 Ga0068856_100541781
1227 Ga0070702_100000245
1228 Ga0070702_100127545
1229 Ga0068852_100008609
1230 Ga0068852_100091269
1231 Ga0068852_101149115
1232 Ga0068852_101348714
1233 Ga0068852_101580847
1234 Ga0068859_100006734
1235 Ga0068859_100026101
1236 Ga0068859_100041857
1237 Ga0068864_100000890
1238 Ga0068864_100277961
1239 Ga0068866_10000221
1240 Ga0068861_100011785
1241 Ga0068861_100018274
1242 Ga0068861_100118272
1243 Ga0068870_10003727
1244 Ga0068870_10844419
1245 Ga0068863_100000340
1246 Ga0068863_100056996
1247 Ga0068863_100431802
1248 Ga0068858_100000295
1249 Ga0068858_100102941
1250 Ga0068858_100150676
1251 Ga0068860_100001285
1252 Ga0068860_100004629
1253 Ga0068860_100158254
1254 Ga0068860_102061263
1255 Ga0068862_100003236
1256 Ga0068862_100003354
1257 Ga0068862_100063398
1258 Ga0081455_10000007
1259 Ga0070717_10037964
1260 Ga0070717_10127591
1261 Ga0075365_10358614
1262 Ga0075363_100115462
1263 Ga0075363_100519829
1264 Ga0075432_10027241
1265 Ga0070715_10325721
1266 Ga0070716_100357488
1267 Ga0070712_100000052
1268 Ga0070712_100377819
1269 Ga0070712_100908656
1270 Ga0075362_10188980
1271 Ga0075362_10436132
1272 Ga0075367_10011053
1273 Ga0075367_10394533
1274 Ga0075369_10139621
1275 Ga0097621_100000040
1276 Ga0075370_10374773
1277 Ga0068871_100000301
1278 Ga0075431_100199738
1279 Ga0075431_100269493
1280 Ga0075431_101914954
1281 Ga0075433_10016057
1282 Ga0075433_10067742
1283 Ga0075434_100002477
1284 Ga0075434_100249805
1285 Ga0075434_100441171
1286 Ga0068865_100000275
1287 Ga0075436_100005032
1288 Ga0075436_100042636
1289 Ga0097620_100006734
1290 Ga0097620_100026102
1291 Ga0097620_100041858
1292 Ga0075435_100096492
1293 Ga0075435_100250148
1294 Ga0075435_101291276
1295 Ga0099795_10012252
1296 Ga0105251_10052992
1297 Ga0105250_10011042
1298 Ga0105250_10192936
1299 Ga0105240_10212812
1300 Ga0105240_10367463
1301 Ga0111539_10000394
1302 Ga0111539_10003483
1303 Ga0111539_10043754
1304 Ga0105245_10000462
1305 Ga0105245_11078352
1306 Ga0105245_11279654
1307 Ga0105247_10000442
1308 Ga0105247_10171228
1309 Ga0114129_10178784
1310 Ga0114129_10905858
1311 Ga0105243_10000282
1312 Ga0105243_10031294
1313 Ga0105243_10398541
1314 Ga0105243_11105948
1315 Ga0105241_10000652
1316 Ga0105241_10151582
1317 Ga0105241_10642950
1318 Ga0105242_10001726
1319 Ga0105248_10010575
1320 Ga0105248_10023284
1321 Ga0105248_10388826
1322 Ga0105237_10008154
1323 Ga0105237_10875312
1324 Ga0105238_10106046
1325 Ga0105238_12073122
1326 Ga0105249_10001210
1327 Ga0105249_10003736
1328 Ga0105249_10010878
1329 Ga0105249_10399550
1330 Ga0099796_10006469
1331 Ga0105239_10006303
1332 Ga0105239_10163008
1333 Ga0105239_10258581
1334 Ga0105239_10282303
1335 Ga0105239_12355476
1336 Ga0105246_10000312
1337 Ga0105246_10078510
1338 Ga0105246_10114945
1339 Ga0105246_10309787
1340 Ga0157344_1002004
1341 Ga0157328_1013142
1342 Ga0157325_1002945
1343 Ga0157343_1003240
1344 Ga0157329_1010294
1345 Ga0157341_1004268
1346 Ga0157313_1000657
1347 Ga0157315_1014475
1348 Ga0157327_1031858
1349 Ga0157373_10035915
1350 Ga0157371_10029433
1351 Ga0157371_10457690
1352 Ga0157370_11531953
1353 Ga0157369_11568099
1354 Ga0157369_12043287
1355 Ga0157374_10001123
1356 Ga0157374_10708914
1357 Ga0157378_10000270
1358 Ga0163162_10000145
1359 Ga0163162_10021406
1360 Ga0157372_10004025
1361 Ga0157372_10224278
1362 Ga0157372_11770094
1363 Ga0157372_13276400
1364 Ga0157375_10000332
1365 Ga0157375_10106184
1366 Ga0163163_10000865
1367 Ga0163163_10019523
1368 Ga0157380_10003074
1369 Ga0157380_10090270
1370 Ga0157377_10000137
1371 Ga0157379_10001761
1372 Ga0157379_10034305
1373 Ga0157376_10000088
1374 Ga0182006_1105742
1375 Ga0163161_10000144
1376 Ga0197907_10831634
1377 Ga0207666_1000048
1378 Ga0207666_1000232
1379 Ga0207673_1000013
1380 Ga0209564_1002100
1381 Ga0207697_10000136
1382 Ga0207697_10006414
1383 Ga0207713_1063062
1384 Ga0207653_10001370
1385 Ga0207653_10002887
1386 Ga0207682_10000006
1387 Ga0207682_10243760
1388 Ga0207692_10226829
1389 Ga0207642_10003385
1390 Ga0207710_10001915
1391 Ga0207710_10018748
1392 Ga0207688_10000027
1393 Ga0207688_10013378
1394 Ga0207647_10005467
1395 Ga0207647_10014058
1396 Ga0207685_10255435
1397 Ga0207699_10089456
1398 Ga0207645_10000100
1399 Ga0207643_10000007
1400 Ga0207643_10566913
1401 Ga0207684_11610847
1402 Ga0207654_10000314
1403 Ga0207654_10654077
1404 Ga0207707_10003030
1405 Ga0207707_10003553
1406 Ga0207707_10334681
1407 Ga0207707_10649541
1408 Ga0207707_10961805
1409 Ga0207695_10031101
1410 Ga0207671_10029994
1411 Ga0207671_10040362
1412 Ga0207671_11033306
1413 Ga0207693_10000835
1414 Ga0207693_10451262
1415 Ga0207693_10766771
1416 Ga0207663_10263165
1417 Ga0207663_10310252
1418 Ga0207660_10000041
1419 Ga0207660_10030841
1420 Ga0207660_10063155
1421 Ga0207660_10468332
1422 Ga0207660_10956360
1423 Ga0207660_11187095
1424 Ga0207662_10000282
1425 Ga0207662_10012555
1426 Ga0207662_10554950
1427 Ga0207657_10003933
1428 Ga0207657_10024595
1429 Ga0207649_10002204
1430 Ga0207649_10629545
1431 Ga0207652_10006361
1432 Ga0207652_10041684
1433 Ga0207652_10052780
1434 Ga0207646_10925371
1435 Ga0207681_10000100
1436 Ga0207681_10035203
1437 Ga0207694_10058343
1438 Ga0207694_11157445
1439 Ga0207650_10031197
1440 Ga0207659_10000044
1441 Ga0207659_10356560
1442 Ga0207687_10000072
1443 Ga0207664_10474955
1444 Ga0207644_10007313
1445 Ga0207690_10000140
1446 Ga0207690_10045487
1447 Ga0207690_10416557
1448 Ga0207706_10003180
1449 Ga0207706_10023633
1450 Ga0207706_10088083
1451 Ga0207706_10107818
1452 Ga0207706_10606124
1453 Ga0207686_10018123
1454 Ga0207686_11120960
1455 Ga0207709_10000154
1456 Ga0207709_10007823
1457 Ga0207709_10682084
1458 Ga0207670_10000444
1459 Ga0207670_10468651
1460 Ga0207670_10818838
1461 Ga0207670_10857592
1462 Ga0207669_10000176
1463 Ga0207669_10026689
1464 Ga0207704_10000086
1465 Ga0207704_10033653
1466 Ga0207704_10220588
1467 Ga0207665_10132210
1468 Ga0207665_10242924
1469 Ga0207691_10000214
1470 Ga0207691_10059545
1471 Ga0207711_10001773
1472 Ga0207711_10014174
1473 Ga0207689_10000366
1474 Ga0207689_10062365
1475 Ga0207689_11612069
1476 Ga0207661_10000087
1477 Ga0207661_10604003
1478 Ga0207679_10000029
1479 Ga0207679_10008732
1480 Ga0207679_10269457
1481 Ga0207667_10022798
1482 Ga0207667_10834510
1483 Ga0207651_10000264
1484 Ga0207651_10735947
1485 Ga0207712_10000129
1486 Ga0207712_10002495
1487 Ga0207712_10008947
1488 Ga0207668_10000100
1489 Ga0207668_10248086
1490 Ga0207668_10707679
1491 Ga0207668_11724260
1492 Ga0207640_10001860
1493 Ga0207640_10683863
1494 Ga0207658_10011163
1495 Ga0207658_10110125
1496 Ga0207658_10425745
1497 Ga0207677_10006287
1498 Ga0207703_10006917
1499 Ga0207703_10042113
1500 Ga0207703_10899707
1501 Ga0207639_10002204
1502 Ga0207639_10025420
1503 Ga0207639_10661600
1504 Ga0207678_10002814
1505 Ga0207678_10004143
1506 Ga0207678_10139405
1507 Ga0207708_10001802
1508 Ga0207708_10002366
1509 Ga0207708_10004097
1510 Ga0207702_10001819
1511 Ga0207702_10309599
1512 Ga0207641_10000476
1513 Ga0207641_10039915
1514 Ga0207641_10182723
1515 Ga0207648_10000072
1516 Ga0207648_10074884
1517 Ga0207676_10000512
1518 Ga0207676_10145923
1519 Ga0207676_10153966
1520 Ga0207674_10000697
1521 Ga0207674_10003652
1522 Ga0207675_100002384
1523 Ga0207675_100026129
1524 Ga0207675_100082231
1525 Ga0207683_10000029
1526 Ga0207698_10000523
1527 Ga0207698_10066725
1528 Ga0209973_1007912
1529 Ga0209967_1008658
1530 Ga0209967_1020422
1531 Ga0209984_1008235
1532 Ga0209968_1019510
1533 Ga0209999_1006967
1534 Ga0209982_1015508
1535 Ga0210002_1000381
1536 Ga0209983_1009047
1537 Ga0209966_1001626
1538 Ga0209966_1010167
1539 Ga0209966_1094199
1540 Ga0209998_10003967
1541 Ga0209998_10006957
1542 Ga0209998_10112281
1543 Ga0209813_10001957
1544 Ga0209974_10028078
1545 Ga0209974_10047690
1546 Ga0207428_10000100
1547 Ga0207428_10000228
1548 Ga0207428_10250934
1549 Ga0268266_10026692
1550 Ga0268265_10001240
1551 Ga0268265_10002707
1552 Ga0268265_10635181
1553 Ga0268264_10006796
1554 Ga0268264_10023946
1555 Ga0268264_10086087
1556 Ga0268264_11821256
1557 Ga0265332_10001262
1558 Ga0265325_10035258
1559 Ga0265329_10007990
1560 Ga0265340_10010191
1561 Ga0265340_10050420
1562 Ga0265340_10187919
1563 Ga0265316_10737023
1564 Ga0307408_100226002
1565 Ga0316579_10196012
1566 Ga0265342_10000069
1567 Ga0316576_10108378
1568 Ga0316578_10010476
1569 Ga0307405_10373372
1570 Ga0307413_10368925
1571 Ga0307410_10149906
1572 Ga0307406_10883851
1573 Ga0307412_10542996
1574 Ga0307412_11539426
1575 Ga0307409_100175231
1576 Ga0307409_100461723
1577 Ga0307411_10032708
1578 Ga0307411_10947454
1579 Ga0307415_100620440
1580 Ga0316583_10018501
1581 Ga0373930_0000036
1582 Ga0373948_0001276
1583 Ga0373950_0000274
1584 Ga0373950_0006173
1585 Ga0373958_0000036
1586 Ga0373958_0000512
1587 Ga0373959_0001045
1588 Ga0373959_0074521
1589 Ga0373938_0000752
1590 Ga0373938_0001980
1591 Ga0373928_0000727
1592 Ga0373928_0002885
1593 Ga0373929_0000805
1594 Ga0373934_0088515
1595 Ga0373940_0000107
1596 Ga0373940_0005262
1597 Ga0373949_0000284
1598 Ga0373949_0001237
1599 Ga0373951_0000560
1600 Ga0373951_0004835
1601 Ga0373952_0000135
1602 Ga0373952_0000152
1603 Ga0373952_0203300
1604 Ga0373923_0005530
1605 Ga0373932_0000172
1606 Ga0373932_0002592
1607 Ga0373936_0012581
1608 Ga0373936_0012931
1609 Ga0373939_0007160
1610 Ga0373939_0011782
1611 Ga0373941_0000081
1612 Ga0373941_0000225
1613 Ga0373941_0002269
1614 Ga0373941_0121660
1615 Ga0373945_0040392
1616 Ga0373945_0083557
1617 Ga0373953_0002122
1618 Ga0373953_0075559
1619 Ga0373954_0002543
1620 Ga0373954_0014017
1621 Ga0373956_0060477
1622 Ga0373957_0012970
1623 Ga0373957_0014625
1624 Ga0373960_0001550
1625 Ga0373960_0003760
1626 Ga0373943_0005071
1627 Ga0373946_0000195
1628 Ga0373955_0000728
1629 Ga0373955_0003373
1630 Ga0373942_0000173
1631 Ga0373942_0065726
1632 Ga0373961_0000196
1633 Ga0373961_0003123
1634 Ga0373962_0000151
1635 Ga0373962_0000452
1636 Ga0316574_0025731
1637 Ga0373924_0000908
1638 Ga0373924_0014025
1639 Ga0373931_0001253
1640 Ga0373931_0002490
1641 Ga0373931_0324267
1642 Ga0373931_1030836
1643 Ga0373935_0000192
1644 Ga0373927_0324268
1645 Ga0373927_0351808
1646 Ga0373927_0822081
1647 Ga0373933_0004316
1648 Ga0373933_0006946
1649 Ga0373933_0388058
1650 Ga0373947_0002278
1651 Ga0373947_0021129
1652 Ga0373947_0026478
1653 Ga0373937_0000018
1654 Ga0373937_0738293
1655 Ga0316582_0076318
1656 Ga0316584_0073155
1657 Ga0373925_0000055
1658 Ga0373925_0056277
1659 Ga0373925_0345257
1660 Ga0395898_0119462
1661 Ga0242420_003017
1662 Ga0436361_0155875
1663 Ga0439441_172451
1664 Ga0439450_090220
1665 Ga0439455_0040110
1666 Ga0439463_200409
1667 Ga0439458_0070207
1668 Ga0439444_0123655
1669 Ga0439464_0042609
1670 Ga0439464_0142683
1671 Ga0439460_0095645
1672 Ga0451577_0327081
1673 Ga0466972_0019709
1674 Ga0466972_0033799
1675 Ga0466965_0020059
1676 Ga0466965_0024731
1677 Ga0466961_0016205
1678 Ga0466964_0017573
1679 Ga0453684_0171995
1680 Ga0466971_0020441
1681 Ga0466970_0009267
1682 Ga0466970_0121027
1683 Ga0466957_0011379
1684 Ga0466957_0064591
1685 Ga0466960_0077820
1686 Ga0466960_0831607
1687 Ga0451576_0041638
1688 Ga0466958_0036691
1689 Ga0466967_0025379
1690 Ga0466967_0119885
1691 Ga0466967_0524362
1692 Ga0466967_0627373
1693 Ga0495592_0000235
1694 Ga0495592_0093466
1695 Ga0495590_0052060
1696 Ga0495629_0002430
1697 Ga0495638_0271792
1698 Ga0495651_0000516
1699 Ga0495651_0390249
1700 Ga0495653_0000003
1701 Ga0495653_0418520
1702 Ga0495582_0034749
1703 Ga0495662_0011854
1704 Ga0495664_0000001
1705 Ga0495608_0000033
1706 Ga0495608_0045528
1707 Ga0495608_0154901
1708 Ga0495618_0000012
1709 Ga0495628_0000003
1710 Ga0495630_0004336
1711 Ga0495630_0325694
1712 Ga0495637_0290906
1713 Ga0495642_0289634
1714 Ga0495652_0000001
1715 Ga0495652_0082958
1716 Ga0495652_0592264
1717 Ga0495640_0000012
1718 Ga0495640_0698415
1719 Ga0495587_0000003
1720 Ga0495587_0031814
1721 Ga0495587_0271814
1722 Ga0495609_0124607
1723 Ga0495645_0000004
1724 Ga0495667_0000001
1725 Ga0495667_0032697
1726 Ga0495634_0000163
1727 Ga0495635_0000015
1728 Ga0495635_0229038
1729 Ga0495635_0845041
1730 Ga0495657_0000061
1731 Ga0495657_0028219
1732 Ga0495599_0000004
1733 Ga0495623_0000020
1734 Ga0495623_0041069
1735 Ga0495623_0387829
1736 Ga0495646_0000006
1737 Ga0495646_0355101
1738 Ga0495647_0478379
1739 Ga0495658_0030078
1740 Ga0495613_0002383
1741 Ga0495613_0147438
1742 Ga0495624_0012717
1743 Ga0495624_0340139
1744 Ga0495600_0000029
1745 Ga0495581_0001267
1746 Ga0495604_0000018
1747 Ga0495604_0199106
1748 Ga0495674_0000001
1749 Ga0495674_0053333
1750 Ga0495674_0178558
1751 Ga0495672_0124293
1752 Ga0495672_0279408
1753 Ga0495680_0000147
1754 Ga0495680_0005610
1755 Ga0495675_0000034
1756 Ga0495684_0000005
1757 Ga0495684_0502670
1758 Ga0495593_0002540
1759 Ga0495602_0000002
1760 Ga0495602_0260578
1761 Ga0495602_0383473
1762 Ga0496100_0000530
1763 Ga0496100_0129276
1764 Ga0496100_0459229
1765 Ga0496101_0000189
1766 Ga0496101_0067265
1767 Ga0496101_0181949
1768 Ga0496101_0255871
1769 Ga0496102_0001085
1770 Ga0496102_0026992
1771 Ga0496102_0053152
1772 Ga0496102_1405045
1773 Ga0496103_0020763
1774 Ga0496103_0399992
1775 Ga0496104_0004877
1776 Ga0496104_0076771
1777 Ga0496104_0102063
1778 Ga0496104_0590549
1779 Ga0496104_0937430
1780 Ga0496105_0007511
1781 Ga0496105_0329944
1782 Ga0496105_0642762
1783 Ga0496106_0002185
1784 Ga0496106_0004993
1785 Ga0496106_0040009
1786 Ga0496106_0110134
1787 Ga0496106_0195661
1788 Ga0496106_0465257
1789 Ga0496106_0537812
1790 Ga0496107_0003085
1791 Ga0496107_0006647
1792 Ga0496107_0121975
1793 Ga0496107_0295133
1794 Ga0496108_0002465
1795 Ga0496108_0011168
1796 Ga0496108_0502321
1797 Ga0496109_0000488
1798 Ga0496109_0006884
1799 Ga0496109_0084382
1800 Ga0496109_0173976
1801 Ga0496109_0784305
1802 Ga0496110_0069646
1803 Ga0496110_0111002
1804 Ga0496110_0526456
1805 Ga0496111_0098927
1806 Ga0496111_0140843
1807 Ga0496111_0436514
1808 Ga0496112_0030833
1809 Ga0496112_0184312
1810 Ga0496113_0021686
1811 Ga0496113_0037283
1812 Ga0496113_0055553
1813 Ga0496113_0500650
1814 Ga0496114_0001960
1815 Ga0496114_0318888
1816 Ga0496115_0002442
1817 Ga0496115_0095823
1818 Ga0496115_0293453
1819 Ga0496121_0656819
1820 Ga0496122_0179782
1821 Ga0496123_0028949
1822 Ga0496124_0594816
1823 Ga0496125_0289770
1824 Ga0496126_0652286
1825 Ga0501031_0008966
1826 Ga0501031_0048550
1827 Ga0501031_0075381
1828 Ga0501032_0032190
1829 Ga0501032_0053337
1830 Ga0501032_0122015
1831 Ga0501032_0251647
1832 Ga0501032_0339287
1833 Ga0501032_0633903
1834 Ga0501033_0127784
1835 Ga0501033_0153285
1836 Ga0501033_0158723
1837 Ga0501033_0278704
1838 Ga0501033_0804144
1839 Ga0501034_0000616
1840 Ga0501034_0000850
1841 Ga0501034_0016718
1842 Ga0501034_0023602
1843 Ga0501034_0071171
1844 Ga0501034_0076450
1845 Ga0501034_0118117
1846 Ga0501034_0420067
1847 Ga0501034_0427856
1848 Ga0501034_0963848
1849 Ga0501034_1042437
1850 Ga0501034_1064263
1851 Ga0501036_0000547
1852 Ga0501036_0034721
1853 Ga0501036_0038602
1854 Ga0501036_0065268
1855 Ga0501036_0073228
1856 Ga0501036_0352825
1857 Ga0501036_0796033
1858 Ga0501037_0001864
1859 Ga0501037_0055103
1860 Ga0501037_0079089
1861 Ga0501037_0131522
1862 Ga0501037_0199016
1863 Ga0501037_0656609
1864 Ga0501038_0011775
1865 Ga0501038_0093671
1866 Ga0501038_0167015
1867 Ga0501038_0172863
1868 Ga0501038_0352777
1869 Ga0501038_0544194
1870 Ga0501039_0009820
1871 Ga0501039_0054526
1872 Ga0501039_0129166
1873 Ga0501040_0082795
1874 Ga0501040_0820205
1875 Ga0501042_1029229
1876 Ga0501043_0001850
1877 Ga0501043_0012323
1878 Ga0501043_0065891
1879 Ga0501043_0117371
1880 Ga0501043_0117907
1881 Ga0501043_0118826
1882 Ga0501043_0169344
1883 Ga0501043_0389891
1884 Ga0501046_0011532
1885 Ga0501046_0049782
1886 Ga0501046_0076847
1887 Ga0501046_0084305
1888 Ga0501046_0485179
1889 Ga0501047_0000455
1890 Ga0501047_0004194
1891 Ga0501047_0189989
1892 Ga0501047_0253119
1893 Ga0501047_0316763
1894 Ga0501047_0343734
1895 Ga0501047_0429194
1896 Ga0501047_0504463
1897 Ga0501047_0807331
1898 Ga0501047_0954825
1899 Ga0501048_0001113
1900 Ga0501048_0074084
1901 Ga0501048_0078673
1902 Ga0501048_0328389
1903 Ga0501048_1046248
1904 Ga0501067_0017220
1905 Ga0501068_0014384
1906 Ga0501068_0060046
1907 Ga0501068_0111176
1908 Ga0501068_0561863
1909 Ga0501068_0890866
1910 Ga0501069_0037404
1911 Ga0501069_0061150
1912 Ga0501069_0156637
1913 Ga0501069_0166813
1914 Ga0501069_0194151
1915 Ga0501069_0421308
1916 Ga0501070_0003292
1917 Ga0501070_0005448
1918 Ga0501070_0017466
1919 Ga0501070_0048170
1920 Ga0501070_0052248
1921 Ga0501070_0077534
1922 Ga0501070_0085866
1923 Ga0501070_0086430
1924 Ga0501070_0167163
1925 Ga0501070_0233512
1926 Ga0501070_0305835
1927 Ga0501070_0334427
1928 Ga0501070_0335000
1929 Ga0501070_0378459
1930 Ga0501070_0488873
1931 Ga0501070_1199378
1932 Ga0501071_0026287
1933 Ga0501071_0032614
1934 Ga0501072_0042458
1935 Ga0501072_0150085
1936 Ga0501072_0163577
1937 Ga0501072_0605319
1938 Ga0501072_1078776
1939 Ga0501073_0023747
1940 Ga0501073_0142005
1941 Ga0501073_0317161
1942 Ga0501074_0006027
1943 Ga0501074_0010081
1944 Ga0501074_0090880
1945 Ga0501074_0266623
1946 Ga0501074_0501960
1947 Ga0501075_0090438
1948 Ga0501075_0252633
1949 Ga0501075_0312204
1950 Ga0501076_0156240
1951 Ga0501077_0131914
1952 Ga0501077_0542348
1953 Ga0501079_0014949
1954 Ga0501079_0039132
1955 Ga0501079_0056857
1956 Ga0501079_0728916
1957 Ga0501079_1676934
1958 Ga0501080_0005235
1959 Ga0501080_0006633
1960 Ga0501080_0023839
1961 Ga0501080_0272356
1962 Ga0501080_0577445
1963 Ga0501080_0684720
1964 Ga0501080_0765243
1965 Ga0501081_0204727
1966 Ga0501081_0799210
1967 Ga0501083_0000437
1968 Ga0501083_0056364
1969 Ga0501083_0076461
1970 Ga0501083_0120344
1971 Ga0501083_0218872
1972 Ga0501083_0231490
1973 Ga0501083_0441481
1974 Ga0501035_0000837
1975 Ga0501035_0046997
1976 Ga0501035_0052690
1977 Ga0501035_0063205
1978 Ga0501035_0077206
1979 Ga0501035_0177704
1980 Ga0501035_0200239
1981 Ga0501035_0230125
1982 Ga0501035_0591901
1983 Ga0501035_1271270
1984 Ga0501044_0015432
1985 Ga0501044_0015853
1986 Ga0501044_0035180
1987 Ga0501044_0058058
1988 Ga0501044_0065969
1989 Ga0501044_0085528
1990 Ga0501044_0112301
1991 Ga0501044_0281194
1992 Ga0501044_0372002
1993 Ga0501044_0475287
1994 Ga0501044_0482396
1995 Ga0501044_0899510
1996 Ga0501044_0958332
1997 Ga0501045_0130953
1998 Ga0501045_0276003
1999 nmdc:mga03683_306883_c1
2000 nmdc:mga03n38_364009_c1
2001 nmdc:mga00v17_326156_c1
2002 nmdc:mga06z11_11012_c1
2003 nmdc:mga06z11_310787_c1
2004 nmdc:mga04h51_1452_c1
2005 nmdc:mga07m45_342931_c1
2006 nmdc:mga07m45_452579_c1
2007 nmdc:mga05p37_306787_c1
2008 nmdc:mga09592_1462109_c1
2009 nmdc:mga06r32_106007_c1
2010 nmdc:mga06r32_1123471_c1
2011 nmdc:mga06r32_2052604_c1
2012 nmdc:mga06r32_545779_c1
2013 nmdc:mga08y16_1045_c1
2014 nmdc:mga08y16_11105_c1
2015 nmdc:mga08y16_84627_c1
2016 nmdc:mga0n895_1396109_c1
2017 nmdc:mga0n895_206826_c1
2018 nmdc:mga0n895_239240_c1
2019 nmdc:mga0n895_242719_c1
2020 nmdc:mga0n895_6556_c1
2021 nmdc:mga0n895_749056_c1
2022 nmdc:mga0n895_82905_c1
2023 nmdc:mga0rr50_1209514_c1
2024 nmdc:mga0rr50_174817_c1
2025 nmdc:mga0rr50_179658_c1
2026 nmdc:mga08x19_3619_c1
2027 nmdc:mga08x19_45947_c1
2028 nmdc:mga0a205_1492_c1
2029 nmdc:mga0a205_30267_c1
2030 nmdc:mga0sz30_235576_c1
2031 Ga0495601_0000003
2032 Ga0495601_0004661
2033 Ga0495601_0060828
2034 Ga0495612_0000007
2035 Ga0495612_0081412
2036 Ga0495595_0000018
2037 Ga0495595_0044171
2038 Ga0495595_0246404
2039 Ga0495619_0000009
2040 Ga0495619_0141403
2041 Ga0495619_0184650
2042 Ga0500641_0007998
2043 Ga0500641_0057847
2044 Ga0500652_000080
2045 Ga0500636_0040041
2046 Ga0501084_0068797
2047 Ga0501084_0239755
2048 Ga0501084_0266357
2049 Ga0501084_1731539
2050 Ga0587092_149011
2051 Ga0501082_0105643
2052 Ga0501082_0146392
2053 Ga0501082_0334620
2054 Ga0501082_0351801
2055 Ga0501082_0428464
2056 Ga0466962_0031835
2057 Ga0530510_0147766
2058 Ga0530510_0806643

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02152

FolB

Dihydroneopterin aldolase

6

118

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7su6-assembly1.cif.gz_C dihydroneopterin aldolase (dhna) lys98ala from yersinia pestis co-crystallized with 7,8-dihydroneopterin 0.8489 1 112
1nbu-assembly1.cif.gz_D 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis 0.8466 2 112
2cg8-assembly1.cif.gz_C-2 the bifunctional dihydroneopterin aldolase 6-hydroxymethyl-7,8- dihydropterin synthase from streptococcus pneumoniae 0.8452 3 111
1nbu-assembly1.cif.gz_G 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis 0.8444 2 112
5f3m-assembly1.cif.gz_A crystal structure of dihydroneopterin aldolase from bacillus anthracis complexed with l-neopterin at 1.5 angstroms resolution . 0.8444 3 112
ID Description Score Start End Superfamily
2nm2B00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8631 1 111 3.30.1130.10
af_A0A0R0J0C6_26_148_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8452 3 113 3.30.1130.10
5farH00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.836 3 112 3.30.1130.10
2nm2B00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8358 1 111 3.30.1130.10
2o9mC00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8231 3 111 3.30.1130.10
ID Description Score Start End GO Terms
AF-U7KYL6-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8951 1 112 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A259ZZX0-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8881 2 112 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A7R9TAB4-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.887 3 114 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-D7W9Z0-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8852 1 112 GO:0004150
GO:0005737
GO:0046654
GO:0046656
AF-A0A661ZHN2-F1-model_v4 7,8-dihydroneopterin aldolase (EC 4.1.2.25) 0.8822 3 90 GO:0004150
GO:0005737
GO:0046654
GO:0046656

Map