F488588
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1029 | 500 | 2058 | 349 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2513237166|2514046283 |
| Length | 397 |
| Sequence | MRGVFRLANWPNGQVSPSDRAAIMSFSPLRAAPLRGFCLLPMRFDLERPLQSATAHRVAVLLINLGTPDAPTPRAVRRYLAQFLSDPRVVEIPAFVWQIILRLFILPFRGVASAKKYASVWMPEGSPLRVHTQKQVEGLRHLLHLNDYTVIVDYAMRYGTPDIPAMLNQLKLAGAERILLMPMYPQYSSSTTATAFDDAFAALKRMRNQPEIRTVRQYADHPAYIAALAAQVNHYWHTHGRPDFAAGDKLVLSFHGVPKRTLDLGDPYHDQCQQTASLLMHALGLTSVECRVTFQSRFGKAEWLQPYTAPTLKELGAAGVHRADVFCPGFTADCLETIEEIGMEVRDEFVHAGGKVFHAIPCLNAAPAWIAALGEIVAQHLQGWPVQAVAPQSASVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 17 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 36 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 66 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 90 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 155 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 156 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 157 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 158 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 159 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 165 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 169 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 177 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 184 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 185 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 186 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 187 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 188 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 189 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 190 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 191 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 192 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 193 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 194 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 195 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 196 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 197 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 198 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 199 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 200 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 201 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 202 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 203 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 204 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 205 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 206 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 207 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 218 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 219 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 311 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 312 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 313 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 314 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 317 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 318 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 319 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 320 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 321 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 322 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 323 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 324 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 325 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 326 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 327 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 328 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 329 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 330 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 331 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 335 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 337 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 338 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 339 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 340 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 346 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 347 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 348 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 349 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 351 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 352 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 353 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 354 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 355 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 358 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 360 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 362 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 363 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 365 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 366 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 368 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 369 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 370 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 371 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 372 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 373 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 374 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 375 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 376 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 377 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 378 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 379 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 380 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 381 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 382 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 383 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 384 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 385 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 386 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 387 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 388 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 389 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 390 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 391 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 392 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 393 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 394 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 395 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 396 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 397 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 398 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 399 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 400 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 401 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 402 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 403 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 404 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 405 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 406 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 407 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 408 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 409 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 410 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 411 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 412 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 413 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 414 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 415 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 416 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 417 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 418 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 419 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 420 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 421 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 422 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 423 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 424 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 425 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 426 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 427 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 428 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 429 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 430 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 431 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 432 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 433 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 434 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 435 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 436 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 437 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 438 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 439 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 440 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 441 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 442 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 443 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 444 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 445 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 446 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 447 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 448 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 449 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 450 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 451 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 452 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 453 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 454 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 455 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 456 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 457 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 458 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 459 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 460 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 461 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 462 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 463 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 464 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 465 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 466 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 467 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 468 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 469 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 470 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 471 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 472 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 473 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 474 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 475 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 476 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 477 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 478 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 479 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 480 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 481 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 482 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 483 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 484 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 485 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 486 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 487 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 488 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 489 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 490 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 491 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 492 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 493 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 494 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 495 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 496 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 497 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 498 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 499 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 500 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.69 |
| Metatranscriptomes | 0.58 |
| Isolates | 12.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.16 |
| Nodule | 2.24 |
| Rhizoplane | 5.15 |
| Rhizosphere | 58.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003397 | 3300001979 | Bacteria | 7006 |
| 2 | JGI24740J21852_10007221 | 3300001979 | Bacteria | 4529 |
| 3 | JGI24739J22299_10002664 | 3300001989 | Bacteria | 6874 |
| 4 | JGI24739J22299_10005575 | 3300001989 | Bacteria | 4773 |
| 5 | JGI24739J22299_10035620 | 3300001989 | Bacteria | 1686 |
| 6 | JGI24737J22298_10023739 | 3300001990 | Bacteria | 1944 |
| 7 | JGI24735J21928_10002378 | 3300002067 | Bacteria | 6546 |
| 8 | JGI24735J21928_10049111 | 3300002067 | Bacteria | 1220 |
| 9 | JGI24738J21930_10001505 | 3300002075 | Bacteria | 6459 |
| 10 | JGI25155J39150_1000724 | 3300002704 | Bacteria | 5734 |
| 11 | JGI25156J39149_1000504 | 3300002705 | Bacteria | 22869 |
| 12 | JGI25156J39149_1000735 | 3300002705 | Bacteria | 17392 |
| 13 | JGI25156J39149_1002542 | 3300002705 | Bacteria | 6479 |
| 14 | JGI25152J39213_1000915 | 3300002773 | Bacteria | 14469 |
| 15 | JGI25152J39213_1001246 | 3300002773 | Bacteria | 11617 |
| 16 | JGI25150J39212_1000991 | 3300002774 | Bacteria | 8877 |
| 17 | JGI25150J39212_1002008 | 3300002774 | Bacteria | 5305 |
| 18 | JGI25159J45721_1001447 | 3300002987 | Bacteria | 9805 |
| 19 | JGI25151J46595_10002025 | 3300003187 | Bacteria | 12673 |
| 20 | JGI25151J46595_10002925 | 3300003187 | Bacteria | 9778 |
| 21 | JGI25151J46595_10003922 | 3300003187 | Bacteria | 8027 |
| 22 | JGI25151J46595_10008898 | 3300003187 | Bacteria | 4792 |
| 23 | JGI25165J46597_1001196 | 3300003214 | Bacteria | 15743 |
| 24 | JGI25153J46596_10001486 | 3300003215 | Bacteria | 13976 |
| 25 | JGI25153J46596_10004452 | 3300003215 | Bacteria | 7551 |
| 26 | rootL2_10002479 | 3300003322 | Bacteria | 16465 |
| 27 | rootL2_10084409 | 3300003322 | Bacteria | 1779 |
| 28 | JGI25160J50197_1000171 | 3300003354 | Bacteria | 55915 |
| 29 | JGI25160J50197_1001502 | 3300003354 | Bacteria | 11587 |
| 30 | JGI25160J50197_1006483 | 3300003354 | Bacteria | 4729 |
| 31 | JGI25161J50226_1001006 | 3300003374 | Bacteria | 9840 |
| 32 | JGI25161J50226_1002287 | 3300003374 | Bacteria | 5010 |
| 33 | Ga0006562J51391_1095652 | 3300003578 | Bacteria | 5267 |
| 34 | Ga0006562J51391_1095654 | 3300003578 | Bacteria | 2270 |
| 35 | Ga0055533_1000292 | 3300003756 | Bacteria | 25514 |
| 36 | Ga0055532_1000001 | 3300003758 | Bacteria | 1119836 |
| 37 | Ga0055532_1002025 | 3300003758 | Bacteria | 4653 |
| 38 | Ga0055532_1002081 | 3300003758 | Bacteria | 4552 |
| 39 | Ga0055532_1002399 | 3300003758 | Bacteria | 3929 |
| 40 | Ga0055527_1000014 | 3300003760 | Bacteria | 289449 |
| 41 | Ga0055527_1001374 | 3300003760 | Bacteria | 5199 |
| 42 | Ga0055535_1000001 | 3300003761 | Bacteria | 1119836 |
| 43 | Ga0055535_1000998 | 3300003761 | Bacteria | 18248 |
| 44 | Ga0055535_1002924 | 3300003761 | Bacteria | 5304 |
| 45 | Ga0055535_1002982 | 3300003761 | Bacteria | 5199 |
| 46 | Ga0055542_1000001 | 3300003762 | Bacteria | 1119836 |
| 47 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 48 | Ga0055542_1001017 | 3300003762 | Bacteria | 17787 |
| 49 | Ga0055542_1002094 | 3300003762 | Bacteria | 7418 |
| 50 | Ga0055529_1000001 | 3300003763 | Bacteria | 826680 |
| 51 | Ga0055529_1001769 | 3300003763 | Bacteria | 5337 |
| 52 | Ga0055526_1000649 | 3300003771 | Bacteria | 26986 |
| 53 | Ga0055526_1002772 | 3300003771 | Bacteria | 11617 |
| 54 | Ga0055526_1004608 | 3300003771 | Bacteria | 8220 |
| 55 | Ga0055537_1000390 | 3300003773 | Bacteria | 29440 |
| 56 | Ga0055537_1001113 | 3300003773 | Bacteria | 11617 |
| 57 | Ga0055524_1001840 | 3300003775 | Bacteria | 11617 |
| 58 | Ga0055536_1001135 | 3300003781 | Bacteria | 16683 |
| 59 | Ga0055536_1001267 | 3300003781 | Bacteria | 15565 |
| 60 | Ga0055536_1002880 | 3300003781 | Bacteria | 9461 |
| 61 | Ga0055534_1000349 | 3300003784 | Bacteria | 29554 |
| 62 | Ga0055534_1001367 | 3300003784 | Bacteria | 9769 |
| 63 | Ga0055534_1006607 | 3300003784 | Bacteria | 2895 |
| 64 | Ga0055528_1000914 | 3300003790 | Bacteria | 19888 |
| 65 | Ga0055528_1002082 | 3300003790 | Bacteria | 11117 |
| 66 | Ga0055530_10001555 | 3300003791 | Bacteria | 16471 |
| 67 | Ga0055540_1000996 | 3300003792 | Bacteria | 18262 |
| 68 | Ga0055540_1003629 | 3300003792 | Bacteria | 7362 |
| 69 | Ga0055540_1003698 | 3300003792 | Bacteria | 7248 |
| 70 | Ga0055540_1004049 | 3300003792 | Bacteria | 6808 |
| 71 | Ga0055540_1008591 | 3300003792 | Bacteria | 3661 |
| 72 | Ga0055531_10001175 | 3300003794 | Bacteria | 20153 |
| 73 | Ga0055531_10004876 | 3300003794 | Bacteria | 7995 |
| 74 | Ga0055531_10021333 | 3300003794 | Bacteria | 2516 |
| 75 | Ga0058692_1002599 | 3300003856 | Bacteria | 5962 |
| 76 | Ga0055543_1002168 | 3300004625 | Bacteria | 6752 |
| 77 | Ga0055543_1002259 | 3300004625 | Bacteria | 6516 |
| 78 | Ga0065165_1001193 | 3300005262 | Bacteria | 30041 |
| 79 | Ga0065165_1003400 | 3300005262 | Bacteria | 11243 |
| 80 | Ga0065714_10008370 | 3300005288 | Bacteria | 2574 |
| 81 | Ga0065704_10072545 | 3300005289 | Bacteria | 8347 |
| 82 | Ga0070658_10002647 | 3300005327 | Bacteria | 14905 |
| 83 | Ga0070658_10014898 | 3300005327 | Bacteria | 6228 |
| 84 | Ga0070658_10265732 | 3300005327 | Bacteria | 1458 |
| 85 | Ga0070666_10057749 | 3300005335 | Bacteria | 2623 |
| 86 | Ga0068868_100081982 | 3300005338 | Bacteria | 2587 |
| 87 | Ga0070660_100000032 | 3300005339 | Bacteria | 85304 |
| 88 | Ga0070660_100002402 | 3300005339 | Bacteria | 12862 |
| 89 | Ga0070661_100237510 | 3300005344 | Bacteria | 1402 |
| 90 | Ga0070659_100000355 | 3300005366 | Bacteria | 34908 |
| 91 | Ga0070659_100304392 | 3300005366 | Bacteria | 1330 |
| 92 | Ga0070667_100050240 | 3300005367 | Bacteria | 3514 |
| 93 | Ga0070663_100009295 | 3300005455 | Bacteria | 6083 |
| 94 | Ga0070678_100084625 | 3300005456 | Bacteria | 2415 |
| 95 | Ga0070678_100109415 | 3300005456 | Bacteria | 2159 |
| 96 | Ga0070678_100142288 | 3300005456 | Bacteria | 1921 |
| 97 | Ga0070662_100017863 | 3300005457 | Bacteria | 4787 |
| 98 | Ga0070662_100267055 | 3300005457 | Bacteria | 1380 |
| 99 | Ga0068853_100020864 | 3300005539 | Bacteria | 5450 |
| 100 | Ga0068853_100081717 | 3300005539 | Bacteria | 2830 |
| 101 | Ga0070665_100385058 | 3300005548 | Bacteria | 1410 |
| 102 | Ga0068855_100009319 | 3300005563 | Bacteria | 11857 |
| 103 | Ga0068855_100022698 | 3300005563 | Bacteria | 7520 |
| 104 | Ga0068855_100424737 | 3300005563 | Bacteria | 1453 |
| 105 | Ga0070664_100029930 | 3300005564 | Bacteria | 4540 |
| 106 | Ga0068852_100003043 | 3300005616 | Bacteria | 11665 |
| 107 | Ga0068852_100136933 | 3300005616 | Bacteria | 2261 |
| 108 | Ga0068859_100253636 | 3300005617 | Bacteria | 1850 |
| 109 | Ga0068862_100153601 | 3300005844 | Bacteria | 2050 |
| 110 | Ga0075368_10007239 | 3300006042 | Bacteria | 3911 |
| 111 | Ga0075363_100020228 | 3300006048 | Bacteria | 3336 |
| 112 | Ga0075363_100033095 | 3300006048 | Bacteria | 2690 |
| 113 | Ga0075363_100182109 | 3300006048 | Bacteria | 1196 |
| 114 | Ga0075364_10008450 | 3300006051 | Bacteria | 6154 |
| 115 | Ga0075364_10133357 | 3300006051 | Bacteria | 1668 |
| 116 | Ga0075362_10007125 | 3300006177 | Bacteria | 4212 |
| 117 | Ga0075362_10030423 | 3300006177 | Bacteria | 2331 |
| 118 | Ga0075362_10031860 | 3300006177 | Bacteria | 2284 |
| 119 | Ga0075362_10033809 | 3300006177 | Bacteria | 2225 |
| 120 | Ga0075362_10078284 | 3300006177 | Bacteria | 1520 |
| 121 | Ga0075367_10023801 | 3300006178 | Bacteria | 3450 |
| 122 | Ga0075369_10048964 | 3300006186 | Bacteria | 1824 |
| 123 | Ga0075369_10069478 | 3300006186 | Bacteria | 1549 |
| 124 | Ga0075366_10003695 | 3300006195 | Bacteria | 8120 |
| 125 | Ga0075366_10006163 | 3300006195 | Bacteria | 6542 |
| 126 | Ga0075366_10087818 | 3300006195 | Bacteria | 1862 |
| 127 | Ga0075370_10001351 | 3300006353 | Bacteria | 10561 |
| 128 | Ga0075370_10001937 | 3300006353 | Bacteria | 9340 |
| 129 | Ga0075370_10031089 | 3300006353 | Bacteria | 2980 |
| 130 | Ga0075370_10040569 | 3300006353 | Bacteria | 2626 |
| 131 | Ga0075370_10128971 | 3300006353 | Bacteria | 1475 |
| 132 | Ga0068871_100223272 | 3300006358 | Bacteria | 1633 |
| 133 | Ga0097620_100253623 | 3300006931 | Bacteria | 1850 |
| 134 | Ga0099826_10030220 | 3300006948 | Bacteria | 3939 |
| 135 | Ga0105251_10000097 | 3300009011 | Bacteria | 85550 |
| 136 | Ga0105251_10004896 | 3300009011 | Bacteria | 8933 |
| 137 | Ga0105251_10076755 | 3300009011 | Bacteria | 1550 |
| 138 | Ga0105244_10001759 | 3300009036 | Bacteria | 17026 |
| 139 | Ga0105244_10050125 | 3300009036 | Bacteria | 2130 |
| 140 | Ga0105250_10006717 | 3300009092 | Bacteria | 4998 |
| 141 | Ga0105240_10000656 | 3300009093 | Bacteria | 63756 |
| 142 | Ga0105240_10008487 | 3300009093 | Bacteria | 14693 |
| 143 | Ga0105240_10045631 | 3300009093 | Bacteria | 5558 |
| 144 | Ga0105240_10081746 | 3300009093 | Bacteria | 3969 |
| 145 | Ga0105240_10089914 | 3300009093 | Bacteria | 3754 |
| 146 | Ga0105240_10345382 | 3300009093 | Bacteria | 1689 |
| 147 | Ga0105243_10002439 | 3300009148 | Bacteria | 15527 |
| 148 | Ga0105243_10004361 | 3300009148 | Bacteria | 11207 |
| 149 | Ga0105243_10347035 | 3300009148 | Bacteria | 1362 |
| 150 | Ga0105241_10129036 | 3300009174 | Bacteria | 2045 |
| 151 | Ga0105242_10127949 | 3300009176 | Bacteria | 2188 |
| 152 | Ga0105248_10036706 | 3300009177 | Bacteria | 5481 |
| 153 | Ga0105248_10177643 | 3300009177 | Bacteria | 2399 |
| 154 | Ga0105248_10179120 | 3300009177 | Bacteria | 2389 |
| 155 | Ga0105237_10013204 | 3300009545 | Bacteria | 8665 |
| 156 | Ga0105237_10057546 | 3300009545 | Bacteria | 3890 |
| 157 | Ga0105237_10063269 | 3300009545 | Bacteria | 3698 |
| 158 | Ga0105238_10037100 | 3300009551 | Bacteria | 4956 |
| 159 | Ga0105238_10070714 | 3300009551 | Bacteria | 3488 |
| 160 | Ga0105238_10244627 | 3300009551 | Bacteria | 1772 |
| 161 | Ga0105239_10007406 | 3300010375 | Bacteria | 12591 |
| 162 | Ga0105239_10036412 | 3300010375 | Bacteria | 5402 |
| 163 | Ga0105246_10061294 | 3300011119 | Bacteria | 2617 |
| 164 | Ga0105246_10352220 | 3300011119 | Bacteria | 1207 |
| 165 | Ga0157373_10003547 | 3300013100 | Bacteria | 11784 |
| 166 | Ga0157373_10053204 | 3300013100 | Bacteria | 2879 |
| 167 | Ga0157371_10027247 | 3300013102 | Bacteria | 4147 |
| 168 | Ga0157370_10000328 | 3300013104 | Bacteria | 59681 |
| 169 | Ga0157370_10001149 | 3300013104 | Bacteria | 32991 |
| 170 | Ga0157370_10055529 | 3300013104 | Bacteria | 3772 |
| 171 | Ga0157370_10186502 | 3300013104 | Bacteria | 1926 |
| 172 | Ga0157370_10193324 | 3300013104 | Bacteria | 1889 |
| 173 | Ga0157369_10000206 | 3300013105 | Bacteria | 81958 |
| 174 | Ga0157369_10000556 | 3300013105 | Bacteria | 49013 |
| 175 | Ga0157369_10000953 | 3300013105 | Bacteria | 36714 |
| 176 | Ga0157369_10387518 | 3300013105 | Bacteria | 1450 |
| 177 | Ga0157374_10000370 | 3300013296 | Bacteria | 41402 |
| 178 | Ga0163162_10010310 | 3300013306 | Bacteria | 9081 |
| 179 | Ga0163162_10047011 | 3300013306 | Bacteria | 4326 |
| 180 | Ga0157372_10003805 | 3300013307 | Bacteria | 16207 |
| 181 | Ga0157372_10019343 | 3300013307 | Bacteria | 7336 |
| 182 | Ga0182008_10001707 | 3300014497 | Bacteria | 14407 |
| 183 | Ga0182008_10029056 | 3300014497 | Bacteria | 2794 |
| 184 | Ga0157379_10120360 | 3300014968 | Bacteria | 2361 |
| 185 | Ga0182006_1000990 | 3300015261 | Bacteria | 18649 |
| 186 | Ga0182006_1030114 | 3300015261 | Bacteria | 2196 |
| 187 | Ga0182007_10000150 | 3300015262 | Bacteria | 47210 |
| 188 | Ga0182007_10000673 | 3300015262 | Bacteria | 19643 |
| 189 | Ga0182007_10005814 | 3300015262 | Bacteria | 5362 |
| 190 | Ga0182007_10016384 | 3300015262 | Bacteria | 2736 |
| 191 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 192 | Ga0183361_10012 | 3300016635 | Bacteria | 203395 |
| 193 | Ga0163161_10000743 | 3300017792 | Bacteria | 25623 |
| 194 | Ga0163161_10005081 | 3300017792 | Bacteria | 9158 |
| 195 | Ga0163161_10011455 | 3300017792 | Bacteria | 6153 |
| 196 | Ga0163161_10016751 | 3300017792 | Bacteria | 5122 |
| 197 | Ga0197907_10707312 | 3300020069 | Bacteria | 4514 |
| 198 | Ga0206354_11366513 | 3300020081 | Bacteria | 2607 |
| 199 | Ga0206353_11314560 | 3300020082 | Bacteria | 2421 |
| 200 | Ga0224712_10000022 | 3300022467 | Bacteria | 23225 |
| 201 | Ga0209436_103577 | 3300025208 | Bacteria | 4075 |
| 202 | Ga0209436_108792 | 3300025208 | Bacteria | 1976 |
| 203 | Ga0209566_100216 | 3300025225 | Bacteria | 57945 |
| 204 | Ga0209674_100005 | 3300025226 | Bacteria | 1708125 |
| 205 | Ga0209674_100092 | 3300025226 | Bacteria | 172272 |
| 206 | Ga0209674_101735 | 3300025226 | Bacteria | 5354 |
| 207 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 208 | Ga0209672_100028 | 3300025228 | Bacteria | 341962 |
| 209 | Ga0209672_100038 | 3300025228 | Bacteria | 286731 |
| 210 | Ga0209672_101148 | 3300025228 | Bacteria | 10893 |
| 211 | Ga0209672_101654 | 3300025228 | Bacteria | 7273 |
| 212 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 213 | Ga0209147_100112 | 3300025229 | Bacteria | 145046 |
| 214 | Ga0209147_100163 | 3300025229 | Bacteria | 90494 |
| 215 | Ga0209147_100686 | 3300025229 | Bacteria | 17369 |
| 216 | Ga0209147_102613 | 3300025229 | Bacteria | 4260 |
| 217 | Ga0209563_104011 | 3300025230 | Bacteria | 2900 |
| 218 | Ga0207427_103987 | 3300025231 | Bacteria | 2703 |
| 219 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 220 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 221 | Ga0209258_100109 | 3300025242 | Bacteria | 203881 |
| 222 | Ga0209258_100112 | 3300025242 | Bacteria | 192884 |
| 223 | Ga0207425_1000199 | 3300025245 | Bacteria | 48186 |
| 224 | Ga0207425_1000595 | 3300025245 | Bacteria | 21041 |
| 225 | Ga0207425_1002925 | 3300025245 | Bacteria | 5720 |
| 226 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 227 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 228 | Ga0209148_1000081 | 3300025254 | Bacteria | 273676 |
| 229 | Ga0209148_1000997 | 3300025254 | Bacteria | 18101 |
| 230 | Ga0209759_1000053 | 3300025256 | Bacteria | 212789 |
| 231 | Ga0209759_1000074 | 3300025256 | Bacteria | 177152 |
| 232 | Ga0209759_1000601 | 3300025256 | Bacteria | 34849 |
| 233 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 234 | Ga0209129_1000089 | 3300025258 | Bacteria | 177344 |
| 235 | Ga0209129_1001975 | 3300025258 | Bacteria | 10674 |
| 236 | Ga0209233_1000016 | 3300025261 | Bacteria | 907830 |
| 237 | Ga0209565_1000288 | 3300025263 | Bacteria | 49295 |
| 238 | Ga0209565_1000293 | 3300025263 | Bacteria | 48108 |
| 239 | Ga0209565_1001947 | 3300025263 | Bacteria | 8104 |
| 240 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 241 | Ga0209455_1000050 | 3300025272 | Bacteria | 373239 |
| 242 | Ga0209455_1014935 | 3300025272 | Bacteria | 1732 |
| 243 | Ga0209673_1000038 | 3300025273 | Bacteria | 312957 |
| 244 | Ga0209673_1000265 | 3300025273 | Bacteria | 98501 |
| 245 | Ga0209673_1000838 | 3300025273 | Bacteria | 40184 |
| 246 | Ga0209673_1001258 | 3300025273 | Bacteria | 26126 |
| 247 | Ga0209130_1000113 | 3300025284 | Bacteria | 130804 |
| 248 | Ga0209130_1001550 | 3300025284 | Bacteria | 14636 |
| 249 | Ga0209130_1004836 | 3300025284 | Bacteria | 4931 |
| 250 | Ga0209675_1000127 | 3300025291 | Bacteria | 104257 |
| 251 | Ga0209675_1000276 | 3300025291 | Bacteria | 49295 |
| 252 | Ga0209675_1000887 | 3300025291 | Bacteria | 19242 |
| 253 | Ga0209675_1002155 | 3300025291 | Bacteria | 10373 |
| 254 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 255 | Ga0209676_1001480 | 3300025292 | Bacteria | 21721 |
| 256 | Ga0209676_1003545 | 3300025292 | Bacteria | 9484 |
| 257 | Ga0209676_1004910 | 3300025292 | Bacteria | 7202 |
| 258 | Ga0209676_1009073 | 3300025292 | Bacteria | 4340 |
| 259 | Ga0209676_1017071 | 3300025292 | Bacteria | 2586 |
| 260 | Ga0209025_1000134 | 3300025294 | Bacteria | 194505 |
| 261 | Ga0209025_1000484 | 3300025294 | Bacteria | 76831 |
| 262 | Ga0209025_1001331 | 3300025294 | Bacteria | 33405 |
| 263 | Ga0209025_1002208 | 3300025294 | Bacteria | 21511 |
| 264 | Ga0209025_1009028 | 3300025294 | Bacteria | 7034 |
| 265 | Ga0209564_1000053 | 3300025295 | Bacteria | 351452 |
| 266 | Ga0209564_1000394 | 3300025295 | Bacteria | 78197 |
| 267 | Ga0209564_1000698 | 3300025295 | Bacteria | 49135 |
| 268 | Ga0209564_1006730 | 3300025295 | Bacteria | 6108 |
| 269 | Ga0209564_1027441 | 3300025295 | Bacteria | 1849 |
| 270 | Ga0209758_1000064 | 3300025297 | Bacteria | 311812 |
| 271 | Ga0209758_1000622 | 3300025297 | Bacteria | 54385 |
| 272 | Ga0209758_1014045 | 3300025297 | Bacteria | 4303 |
| 273 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 274 | Ga0209050_1001433 | 3300025298 | Bacteria | 25685 |
| 275 | Ga0209050_1011252 | 3300025298 | Bacteria | 4274 |
| 276 | Ga0209256_1000115 | 3300025299 | Bacteria | 173607 |
| 277 | Ga0209256_1000864 | 3300025299 | Bacteria | 37672 |
| 278 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 279 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 280 | Ga0207426_1000037 | 3300025302 | Bacteria | 442735 |
| 281 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 282 | Ga0209051_1000385 | 3300025303 | Bacteria | 62270 |
| 283 | Ga0209051_1000781 | 3300025303 | Bacteria | 33617 |
| 284 | Ga0209051_1001504 | 3300025303 | Bacteria | 19477 |
| 285 | Ga0209051_1002109 | 3300025303 | Bacteria | 14875 |
| 286 | Ga0209051_1002621 | 3300025303 | Bacteria | 12630 |
| 287 | Ga0209051_1019996 | 3300025303 | Bacteria | 2903 |
| 288 | Ga0209051_1053265 | 3300025303 | Bacteria | 1330 |
| 289 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 290 | Ga0209257_1001057 | 3300025304 | Bacteria | 36450 |
| 291 | Ga0209257_1003120 | 3300025304 | Bacteria | 14812 |
| 292 | Ga0209257_1005156 | 3300025304 | Bacteria | 9429 |
| 293 | Ga0207655_1013658 | 3300025728 | Bacteria | 4646 |
| 294 | Ga0207713_1000305 | 3300025735 | Bacteria | 56170 |
| 295 | Ga0207682_10034113 | 3300025893 | Bacteria | 2051 |
| 296 | Ga0207680_10008834 | 3300025903 | Bacteria | 4966 |
| 297 | Ga0207647_10000268 | 3300025904 | Bacteria | 42845 |
| 298 | Ga0207647_10004135 | 3300025904 | Bacteria | 10770 |
| 299 | Ga0207647_10008546 | 3300025904 | Bacteria | 7332 |
| 300 | Ga0207647_10019591 | 3300025904 | Bacteria | 4548 |
| 301 | Ga0207647_10027493 | 3300025904 | Bacteria | 3708 |
| 302 | Ga0207647_10043031 | 3300025904 | Bacteria | 2828 |
| 303 | Ga0207705_10000708 | 3300025909 | Bacteria | 27547 |
| 304 | Ga0207705_10134982 | 3300025909 | Bacteria | 1839 |
| 305 | Ga0207695_10005102 | 3300025913 | Bacteria | 17594 |
| 306 | Ga0207695_10018782 | 3300025913 | Bacteria | 7979 |
| 307 | Ga0207695_10099910 | 3300025913 | Bacteria | 2898 |
| 308 | Ga0207695_10188464 | 3300025913 | Bacteria | 1981 |
| 309 | Ga0207695_10373598 | 3300025913 | Bacteria | 1312 |
| 310 | Ga0207671_10026696 | 3300025914 | Bacteria | 4323 |
| 311 | Ga0207671_10059100 | 3300025914 | Bacteria | 2842 |
| 312 | Ga0207671_10103198 | 3300025914 | Bacteria | 2162 |
| 313 | Ga0207657_10000051 | 3300025919 | Bacteria | 109129 |
| 314 | Ga0207657_10000131 | 3300025919 | Bacteria | 75479 |
| 315 | Ga0207694_10019539 | 3300025924 | Bacteria | 5122 |
| 316 | Ga0207694_10065076 | 3300025924 | Bacteria | 2842 |
| 317 | Ga0207690_10000034 | 3300025932 | Bacteria | 149574 |
| 318 | Ga0207709_10001032 | 3300025935 | Bacteria | 20578 |
| 319 | Ga0207709_10001454 | 3300025935 | Bacteria | 16482 |
| 320 | Ga0207711_10026135 | 3300025941 | Bacteria | 4897 |
| 321 | Ga0207711_10031612 | 3300025941 | Bacteria | 4469 |
| 322 | Ga0207711_10228248 | 3300025941 | Bacteria | 1705 |
| 323 | Ga0207679_10015470 | 3300025945 | Bacteria | 5043 |
| 324 | Ga0207667_10003149 | 3300025949 | Bacteria | 20416 |
| 325 | Ga0207667_10009431 | 3300025949 | Bacteria | 11496 |
| 326 | Ga0207667_10113941 | 3300025949 | Bacteria | 2787 |
| 327 | Ga0207667_10202305 | 3300025949 | Bacteria | 2037 |
| 328 | Ga0207640_10215795 | 3300025981 | Bacteria | 1465 |
| 329 | Ga0207658_10047893 | 3300025986 | Bacteria | 3131 |
| 330 | Ga0207658_10057051 | 3300025986 | Bacteria | 2901 |
| 331 | Ga0207639_10007462 | 3300026041 | Bacteria | 7459 |
| 332 | Ga0207639_10065918 | 3300026041 | Bacteria | 2812 |
| 333 | Ga0207678_10002721 | 3300026067 | Bacteria | 16032 |
| 334 | Ga0207678_10037514 | 3300026067 | Bacteria | 4214 |
| 335 | Ga0207678_10262867 | 3300026067 | Bacteria | 1479 |
| 336 | Ga0207674_10198781 | 3300026116 | Bacteria | 1954 |
| 337 | Ga0207674_10369757 | 3300026116 | Bacteria | 1386 |
| 338 | Ga0207683_10014003 | 3300026121 | Bacteria | 6839 |
| 339 | Ga0207683_10056358 | 3300026121 | Bacteria | 3447 |
| 340 | Ga0207698_10010500 | 3300026142 | Bacteria | 5958 |
| 341 | Ga0207698_10111986 | 3300026142 | Bacteria | 2290 |
| 342 | Ga0209371_1000090 | 3300027312 | Bacteria | 173119 |
| 343 | Ga0209371_1001109 | 3300027312 | Bacteria | 19951 |
| 344 | Ga0209282_1000334 | 3300027666 | Bacteria | 23330 |
| 345 | Ga0207428_10351654 | 3300027907 | Bacteria | 1084 |
| 346 | Ga0268266_10240987 | 3300028379 | Bacteria | 1669 |
| 347 | Ga0268266_10335955 | 3300028379 | Bacteria | 1417 |
| 348 | Ga0268265_10118263 | 3300028380 | Bacteria | 2178 |
| 349 | Ga0268264_10171693 | 3300028381 | Bacteria | 1962 |
| 350 | Ga0307515_10000028 | 3300028794 | Bacteria | 368467 |
| 351 | Ga0307515_10024629 | 3300028794 | Bacteria | 10474 |
| 352 | Ga0265338_10000113 | 3300028800 | Bacteria | 150993 |
| 353 | Ga0268256_1000115 | 3300030500 | Bacteria | 116918 |
| 354 | Ga0268256_1000921 | 3300030500 | Bacteria | 20306 |
| 355 | Ga0307511_10000025 | 3300030521 | Bacteria | 112344 |
| 356 | Ga0316177_1029429 | 3300030731 | Bacteria | 3928 |
| 357 | Ga0316176_1080864 | 3300030732 | Bacteria | 2014 |
| 358 | Ga0314311_1124028 | 3300030733 | Bacteria | 3356 |
| 359 | Ga0316180_1012367 | 3300030736 | Bacteria | 2491 |
| 360 | Ga0316182_1325098 | 3300030745 | Bacteria | 2859 |
| 361 | Ga0265332_10000013 | 3300031238 | Bacteria | 250095 |
| 362 | Ga0265325_10000262 | 3300031241 | Bacteria | 37299 |
| 363 | Ga0265327_10000722 | 3300031251 | Bacteria | 51801 |
| 364 | Ga0265327_10015860 | 3300031251 | Bacteria | 4831 |
| 365 | Ga0265316_10000299 | 3300031344 | Bacteria | 55433 |
| 366 | Ga0265316_10089534 | 3300031344 | Bacteria | 2348 |
| 367 | Ga0307513_10116636 | 3300031456 | Bacteria | 2649 |
| 368 | Ga0307509_10000006 | 3300031507 | Bacteria | 421538 |
| 369 | Ga0307408_100002431 | 3300031548 | Bacteria | 13091 |
| 370 | Ga0307408_100024541 | 3300031548 | Bacteria | 4118 |
| 371 | Ga0307408_100114667 | 3300031548 | Bacteria | 2076 |
| 372 | Ga0307408_100157292 | 3300031548 | Bacteria | 1801 |
| 373 | Ga0307508_10059988 | 3300031616 | Bacteria | 3365 |
| 374 | Ga0307514_10005152 | 3300031649 | Bacteria | 11799 |
| 375 | Ga0307516_10003171 | 3300031730 | Bacteria | 21396 |
| 376 | Ga0307405_10002949 | 3300031731 | Bacteria | 7680 |
| 377 | Ga0307406_10001482 | 3300031901 | Bacteria | 12962 |
| 378 | Ga0307406_10033625 | 3300031901 | Bacteria | 3140 |
| 379 | Ga0307412_10000051 | 3300031911 | Bacteria | 150433 |
| 380 | Ga0307412_10061531 | 3300031911 | Bacteria | 2524 |
| 381 | Ga0307412_10194031 | 3300031911 | Bacteria | 1537 |
| 382 | Ga0307416_100023777 | 3300032002 | Bacteria | 4456 |
| 383 | Ga0307416_100462395 | 3300032002 | Bacteria | 1324 |
| 384 | Ga0307414_10071445 | 3300032004 | Bacteria | 2503 |
| 385 | Ga0307411_10020506 | 3300032005 | Bacteria | 3846 |
| 386 | Ga0307411_10118497 | 3300032005 | Bacteria | 1910 |
| 387 | Ga0307411_10207668 | 3300032005 | Bacteria | 1509 |
| 388 | Ga0316583_10029627 | 3300032133 | Bacteria | 1951 |
| 389 | Ga0307507_10088851 | 3300033179 | Bacteria | 2663 |
| 390 | Ga0395899_0000008 | 3300037312 | Bacteria | 567572 |
| 391 | Ga0395900_0000055 | 3300037418 | Bacteria | 219875 |
| 392 | Ga0395900_0002303 | 3300037418 | Bacteria | 21211 |
| 393 | Ga0395900_0007321 | 3300037418 | Bacteria | 11416 |
| 394 | Ga0395900_0028412 | 3300037418 | Bacteria | 5728 |
| 395 | Ga0395900_0134985 | 3300037418 | Bacteria | 2528 |
| 396 | Ga0395900_0138938 | 3300037418 | Bacteria | 2489 |
| 397 | Ga0395900_0250241 | 3300037418 | Bacteria | 1774 |
| 398 | Ga0395898_0000119 | 3300037466 | Bacteria | 209937 |
| 399 | Ga0395898_0001260 | 3300037466 | Bacteria | 37617 |
| 400 | Ga0395898_0032722 | 3300037466 | Bacteria | 5191 |
| 401 | Ga0395905_0000168 | 3300037471 | Bacteria | 107034 |
| 402 | Ga0395905_0075175 | 3300037471 | Bacteria | 3166 |
| 403 | Ga0395901_0000003 | 3300038443 | Bacteria | 701538 |
| 404 | Ga0395901_0010491 | 3300038443 | Bacteria | 9383 |
| 405 | Ga0395901_0019159 | 3300038443 | Bacteria | 6996 |
| 406 | Ga0395901_0170239 | 3300038443 | Bacteria | 2285 |
| 407 | Ga0395901_0194691 | 3300038443 | Bacteria | 2125 |
| 408 | Ga0436361_0131139 | 3300039447 | Bacteria | 6535 |
| 409 | Ga0439436_0000470 | 3300041404 | Bacteria | 10385 |
| 410 | Ga0439436_0002954 | 3300041404 | Bacteria | 5157 |
| 411 | Ga0439439_0002400 | 3300041406 | Bacteria | 3974 |
| 412 | Ga0439447_002633 | 3300041407 | Bacteria | 6511 |
| 413 | Ga0439447_012795 | 3300041407 | Bacteria | 2399 |
| 414 | Ga0439461_0018568 | 3300041410 | Bacteria | 1362 |
| 415 | Ga0439466_0003460 | 3300041411 | Bacteria | 6117 |
| 416 | Ga0439465_0000108 | 3300041413 | Bacteria | 19156 |
| 417 | Ga0439465_0007545 | 3300041413 | Bacteria | 3454 |
| 418 | Ga0451853_4091276 | 3300041512 | Bacteria | 1447 |
| 419 | Ga0439431_0004413 | 3300041997 | Bacteria | 3092 |
| 420 | Ga0439433_0000895 | 3300041999 | Bacteria | 5940 |
| 421 | Ga0439442_004394 | 3300042002 | Bacteria | 2799 |
| 422 | Ga0439445_0001046 | 3300042004 | Bacteria | 5909 |
| 423 | Ga0439445_0008898 | 3300042004 | Bacteria | 2358 |
| 424 | Ga0439448_0001330 | 3300042005 | Bacteria | 6326 |
| 425 | Ga0439432_003819 | 3300042006 | Bacteria | 5559 |
| 426 | Ga0439432_010034 | 3300042006 | Bacteria | 3293 |
| 427 | Ga0439449_0000245 | 3300042007 | Bacteria | 19553 |
| 428 | Ga0439449_0001647 | 3300042007 | Bacteria | 8764 |
| 429 | Ga0439449_0003981 | 3300042007 | Bacteria | 5711 |
| 430 | Ga0439449_0004140 | 3300042007 | Bacteria | 5609 |
| 431 | Ga0439452_000792 | 3300042010 | Bacteria | 14976 |
| 432 | Ga0439452_005772 | 3300042010 | Bacteria | 3955 |
| 433 | Ga0439457_001278 | 3300042014 | Bacteria | 7554 |
| 434 | Ga0439457_029009 | 3300042014 | Bacteria | 1226 |
| 435 | Ga0439462_0017172 | 3300042015 | Bacteria | 1874 |
| 436 | Ga0450894_003722 | 3300042131 | Bacteria | 1992 |
| 437 | Ga0450906_001265 | 3300042145 | Bacteria | 5568 |
| 438 | Ga0450907_010923 | 3300042146 | Bacteria | 1509 |
| 439 | Ga0439446_0010238 | 3300042156 | Bacteria | 2524 |
| 440 | Ga0450908_000841 | 3300042184 | Bacteria | 5923 |
| 441 | Ga0450909_003757 | 3300042185 | Bacteria | 2156 |
| 442 | Ga0439434_0001099 | 3300042435 | Bacteria | 7827 |
| 443 | Ga0439434_0006472 | 3300042435 | Bacteria | 3423 |
| 444 | Ga0451577_0003100 | 3300042876 | Bacteria | 18746 |
| 445 | Ga0451577_0025039 | 3300042876 | Bacteria | 5418 |
| 446 | Ga0451577_0072441 | 3300042876 | Bacteria | 3073 |
| 447 | Ga0451577_0078031 | 3300042876 | Bacteria | 2953 |
| 448 | Ga0451577_0091835 | 3300042876 | Bacteria | 2711 |
| 449 | Ga0466969_0002847 | 3300044656 | Bacteria | 9244 |
| 450 | Ga0466969_0004757 | 3300044656 | Bacteria | 7223 |
| 451 | Ga0466973_0009139 | 3300044659 | Bacteria | 9055 |
| 452 | Ga0453683_0156859 | 3300044673 | Bacteria | 1439 |
| 453 | Ga0466965_0001211 | 3300044683 | Bacteria | 10198 |
| 454 | Ga0466965_0001863 | 3300044683 | Bacteria | 8779 |
| 455 | Ga0466965_0032927 | 3300044683 | Bacteria | 2532 |
| 456 | Ga0466966_0000032 | 3300044684 | Bacteria | 102181 |
| 457 | Ga0466966_0002909 | 3300044684 | Bacteria | 11277 |
| 458 | Ga0466966_0016532 | 3300044684 | Bacteria | 4872 |
| 459 | Ga0466966_0063721 | 3300044684 | Bacteria | 2322 |
| 460 | Ga0466961_0004925 | 3300044693 | Bacteria | 8398 |
| 461 | Ga0466961_0116424 | 3300044693 | Bacteria | 1679 |
| 462 | Ga0466963_0001953 | 3300044694 | Bacteria | 11306 |
| 463 | Ga0466963_0015153 | 3300044694 | Bacteria | 4768 |
| 464 | Ga0466964_0002026 | 3300044706 | Bacteria | 7123 |
| 465 | Ga0466964_0039190 | 3300044706 | Bacteria | 1908 |
| 466 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 467 | Ga0453684_0000583 | 3300044712 | Bacteria | 135940 |
| 468 | Ga0453684_0004902 | 3300044712 | Bacteria | 27396 |
| 469 | Ga0453684_0005751 | 3300044712 | Bacteria | 24224 |
| 470 | Ga0453684_0008183 | 3300044712 | Bacteria | 18861 |
| 471 | Ga0453684_0116937 | 3300044712 | Bacteria | 3227 |
| 472 | Ga0453684_0524355 | 3300044712 | Bacteria | 1308 |
| 473 | Ga0466968_0005823 | 3300044735 | Bacteria | 4626 |
| 474 | Ga0466970_0026347 | 3300044765 | Bacteria | 3047 |
| 475 | Ga0466970_0091606 | 3300044765 | Bacteria | 1650 |
| 476 | Ga0466957_0015351 | 3300044842 | Bacteria | 4474 |
| 477 | Ga0466957_0047793 | 3300044842 | Bacteria | 2600 |
| 478 | Ga0466957_0097795 | 3300044842 | Bacteria | 1846 |
| 479 | Ga0466960_0010342 | 3300044901 | Bacteria | 3872 |
| 480 | Ga0466959_0010040 | 3300045049 | Bacteria | 6747 |
| 481 | Ga0466959_0014675 | 3300045049 | Bacteria | 5701 |
| 482 | Ga0466959_0222376 | 3300045049 | Bacteria | 1309 |
| 483 | Ga0451576_0000137 | 3300045051 | Bacteria | 185212 |
| 484 | Ga0451576_0000738 | 3300045051 | Bacteria | 65424 |
| 485 | Ga0451576_0001961 | 3300045051 | Bacteria | 32770 |
| 486 | Ga0451576_0012728 | 3300045051 | Bacteria | 9445 |
| 487 | Ga0451576_0052917 | 3300045051 | Bacteria | 4254 |
| 488 | Ga0451576_0145389 | 3300045051 | Bacteria | 2472 |
| 489 | Ga0466958_0001759 | 3300045836 | Bacteria | 10489 |
| 490 | Ga0466958_0005164 | 3300045836 | Bacteria | 6984 |
| 491 | Ga0466958_0009785 | 3300045836 | Bacteria | 5349 |
| 492 | Ga0466958_0021413 | 3300045836 | Bacteria | 3778 |
| 493 | Ga0466967_0343404 | 3300045976 | Bacteria | 1444 |
| 494 | Ga0495627_007509 | 3300046453 | Bacteria | 4167 |
| 495 | Ga0495592_0040557 | 3300046454 | Bacteria | 3494 |
| 496 | Ga0495592_0052099 | 3300046454 | Bacteria | 3039 |
| 497 | Ga0495592_0197290 | 3300046454 | Bacteria | 1360 |
| 498 | Ga0495603_0001297 | 3300046455 | Bacteria | 14577 |
| 499 | Ga0495603_0007952 | 3300046455 | Bacteria | 6400 |
| 500 | Ga0495603_0009400 | 3300046455 | Bacteria | 5907 |
| 501 | Ga0495590_0001947 | 3300046457 | Bacteria | 8729 |
| 502 | Ga0495590_0060794 | 3300046457 | Bacteria | 1323 |
| 503 | Ga0495591_006781 | 3300046458 | Bacteria | 4985 |
| 504 | Ga0495629_0000369 | 3300046459 | Bacteria | 38164 |
| 505 | Ga0495629_0004351 | 3300046459 | Bacteria | 10617 |
| 506 | Ga0495629_0005165 | 3300046459 | Bacteria | 9767 |
| 507 | Ga0495629_0014711 | 3300046459 | Bacteria | 5628 |
| 508 | Ga0495629_0041923 | 3300046459 | Bacteria | 3217 |
| 509 | Ga0495629_0049525 | 3300046459 | Bacteria | 2944 |
| 510 | Ga0495638_0028169 | 3300046460 | Bacteria | 3630 |
| 511 | Ga0495638_0074310 | 3300046460 | Bacteria | 2073 |
| 512 | Ga0495641_0003603 | 3300046461 | Bacteria | 11474 |
| 513 | Ga0495651_0009952 | 3300046462 | Bacteria | 7311 |
| 514 | Ga0495651_0023058 | 3300046462 | Bacteria | 4841 |
| 515 | Ga0495651_0196935 | 3300046462 | Bacteria | 1413 |
| 516 | Ga0495651_0218439 | 3300046462 | Bacteria | 1321 |
| 517 | Ga0495653_0006567 | 3300046463 | Bacteria | 9545 |
| 518 | Ga0495653_0018833 | 3300046463 | Bacteria | 5601 |
| 519 | Ga0495653_0023696 | 3300046463 | Bacteria | 4955 |
| 520 | Ga0495653_0037748 | 3300046463 | Bacteria | 3793 |
| 521 | Ga0495653_0092915 | 3300046463 | Bacteria | 2202 |
| 522 | Ga0495653_0175644 | 3300046463 | Bacteria | 1474 |
| 523 | Ga0495650_0004632 | 3300046471 | Bacteria | 9321 |
| 524 | Ga0495650_0014058 | 3300046471 | Bacteria | 4192 |
| 525 | Ga0495650_0017226 | 3300046471 | Bacteria | 3627 |
| 526 | Ga0495650_0019000 | 3300046471 | Bacteria | 3399 |
| 527 | Ga0495650_0027417 | 3300046471 | Bacteria | 2632 |
| 528 | Ga0495580_0002054 | 3300046472 | Bacteria | 17674 |
| 529 | Ga0495580_0005418 | 3300046472 | Bacteria | 10546 |
| 530 | Ga0495580_0023500 | 3300046472 | Bacteria | 4525 |
| 531 | Ga0495580_0070077 | 3300046472 | Bacteria | 2449 |
| 532 | Ga0495580_0113459 | 3300046472 | Bacteria | 1882 |
| 533 | Ga0495580_0149687 | 3300046472 | Bacteria | 1617 |
| 534 | Ga0495580_0159856 | 3300046472 | Bacteria | 1559 |
| 535 | Ga0495582_0002285 | 3300046473 | Bacteria | 10726 |
| 536 | Ga0495582_0052398 | 3300046473 | Bacteria | 2250 |
| 537 | Ga0495605_0002196 | 3300046474 | Bacteria | 12190 |
| 538 | Ga0495605_0004899 | 3300046474 | Bacteria | 7821 |
| 539 | Ga0495605_0010712 | 3300046474 | Bacteria | 5124 |
| 540 | Ga0495605_0016596 | 3300046474 | Bacteria | 3984 |
| 541 | Ga0495639_0009089 | 3300046475 | Bacteria | 4260 |
| 542 | Ga0495662_0024751 | 3300046476 | Bacteria | 2897 |
| 543 | Ga0495662_0077914 | 3300046476 | Bacteria | 1610 |
| 544 | Ga0495664_0001019 | 3300046477 | Bacteria | 14491 |
| 545 | Ga0495664_0015601 | 3300046477 | Bacteria | 4320 |
| 546 | Ga0495664_0083586 | 3300046477 | Bacteria | 1916 |
| 547 | Ga0495596_0005025 | 3300046500 | Bacteria | 6324 |
| 548 | Ga0495596_0039764 | 3300046500 | Bacteria | 1857 |
| 549 | Ga0495596_0073211 | 3300046500 | Bacteria | 1330 |
| 550 | Ga0495583_0003894 | 3300046506 | Bacteria | 11050 |
| 551 | Ga0495583_0006862 | 3300046506 | Bacteria | 7331 |
| 552 | Ga0495583_0013530 | 3300046506 | Bacteria | 4547 |
| 553 | Ga0495606_0012257 | 3300046507 | Bacteria | 6896 |
| 554 | Ga0495606_0039182 | 3300046507 | Bacteria | 3197 |
| 555 | Ga0495606_0072098 | 3300046507 | Bacteria | 2172 |
| 556 | Ga0495606_0083444 | 3300046507 | Bacteria | 1981 |
| 557 | Ga0495606_0099160 | 3300046507 | Bacteria | 1776 |
| 558 | Ga0495606_0138973 | 3300046507 | Bacteria | 1436 |
| 559 | Ga0495608_0007446 | 3300046511 | Bacteria | 7734 |
| 560 | Ga0495608_0042458 | 3300046511 | Bacteria | 3041 |
| 561 | Ga0495610_0019946 | 3300046512 | Bacteria | 3735 |
| 562 | Ga0495616_0002124 | 3300046513 | Bacteria | 13283 |
| 563 | Ga0495616_0073811 | 3300046513 | Bacteria | 1645 |
| 564 | Ga0495618_0001663 | 3300046514 | Bacteria | 14785 |
| 565 | Ga0495618_0011271 | 3300046514 | Bacteria | 5417 |
| 566 | Ga0495618_0014447 | 3300046514 | Bacteria | 4811 |
| 567 | Ga0495620_0011576 | 3300046515 | Bacteria | 4597 |
| 568 | Ga0495620_0036745 | 3300046515 | Bacteria | 2189 |
| 569 | Ga0495628_0002617 | 3300046516 | Bacteria | 16154 |
| 570 | Ga0495628_0027908 | 3300046516 | Bacteria | 4589 |
| 571 | Ga0495628_0033448 | 3300046516 | Bacteria | 4145 |
| 572 | Ga0495628_0037443 | 3300046516 | Bacteria | 3889 |
| 573 | Ga0495628_0049906 | 3300046516 | Bacteria | 3311 |
| 574 | Ga0495628_0174155 | 3300046516 | Bacteria | 1630 |
| 575 | Ga0495630_0020532 | 3300046517 | Bacteria | 4870 |
| 576 | Ga0495630_0044761 | 3300046517 | Bacteria | 3307 |
| 577 | Ga0495630_0235052 | 3300046517 | Bacteria | 1400 |
| 578 | Ga0495631_0001388 | 3300046518 | Bacteria | 14713 |
| 579 | Ga0495637_0007495 | 3300046520 | Bacteria | 5402 |
| 580 | Ga0495648_0012380 | 3300046524 | Bacteria | 6371 |
| 581 | Ga0495648_0021277 | 3300046524 | Bacteria | 4496 |
| 582 | Ga0495648_0022600 | 3300046524 | Bacteria | 4324 |
| 583 | Ga0495648_0044551 | 3300046524 | Bacteria | 2768 |
| 584 | Ga0495648_0142954 | 3300046524 | Bacteria | 1257 |
| 585 | Ga0495663_0002160 | 3300046525 | Bacteria | 5990 |
| 586 | Ga0495666_0004704 | 3300046526 | Bacteria | 6903 |
| 587 | Ga0495666_0005594 | 3300046526 | Bacteria | 6331 |
| 588 | Ga0495666_0006495 | 3300046526 | Bacteria | 5887 |
| 589 | Ga0495642_0006746 | 3300046528 | Bacteria | 4401 |
| 590 | Ga0495642_0021025 | 3300046528 | Bacteria | 2565 |
| 591 | Ga0495652_0029140 | 3300046529 | Bacteria | 4850 |
| 592 | Ga0495652_0033248 | 3300046529 | Bacteria | 4504 |
| 593 | Ga0495654_0018415 | 3300046530 | Bacteria | 3661 |
| 594 | Ga0495654_0028146 | 3300046530 | Bacteria | 2875 |
| 595 | Ga0495654_0081073 | 3300046530 | Bacteria | 1521 |
| 596 | Ga0495665_0005886 | 3300046531 | Bacteria | 6604 |
| 597 | Ga0495665_0021328 | 3300046531 | Bacteria | 3480 |
| 598 | Ga0495665_0025686 | 3300046531 | Bacteria | 3163 |
| 599 | Ga0495640_0002933 | 3300046533 | Bacteria | 13734 |
| 600 | Ga0495640_0005861 | 3300046533 | Bacteria | 9748 |
| 601 | Ga0495640_0026287 | 3300046533 | Bacteria | 4208 |
| 602 | Ga0495640_0113370 | 3300046533 | Bacteria | 1769 |
| 603 | Ga0495586_0000633 | 3300046535 | Bacteria | 20275 |
| 604 | Ga0495586_0031997 | 3300046535 | Bacteria | 2820 |
| 605 | Ga0495586_0092520 | 3300046535 | Bacteria | 1672 |
| 606 | Ga0495587_0018778 | 3300046536 | Bacteria | 4287 |
| 607 | Ga0495621_0009096 | 3300046539 | Bacteria | 3004 |
| 608 | Ga0495597_0002648 | 3300046542 | Bacteria | 11102 |
| 609 | Ga0495597_0016569 | 3300046542 | Bacteria | 3480 |
| 610 | Ga0495597_0044837 | 3300046542 | Bacteria | 1965 |
| 611 | Ga0495645_0003050 | 3300046543 | Bacteria | 11342 |
| 612 | Ga0495645_0011091 | 3300046543 | Bacteria | 6336 |
| 613 | Ga0495645_0045339 | 3300046543 | Bacteria | 3207 |
| 614 | Ga0495645_0122181 | 3300046543 | Bacteria | 1832 |
| 615 | Ga0495622_0004831 | 3300046557 | Bacteria | 6242 |
| 616 | Ga0495622_0016921 | 3300046557 | Bacteria | 3394 |
| 617 | Ga0495667_0017947 | 3300046559 | Bacteria | 4779 |
| 618 | Ga0495667_0022585 | 3300046559 | Bacteria | 4239 |
| 619 | Ga0495668_0011933 | 3300046616 | Bacteria | 5174 |
| 620 | Ga0495668_0041562 | 3300046616 | Bacteria | 2561 |
| 621 | Ga0495634_0009735 | 3300046642 | Bacteria | 7071 |
| 622 | Ga0495634_0011188 | 3300046642 | Bacteria | 6543 |
| 623 | Ga0495634_0022513 | 3300046642 | Bacteria | 4439 |
| 624 | Ga0495625_0000279 | 3300046660 | Bacteria | 79498 |
| 625 | Ga0495625_0147991 | 3300046660 | Bacteria | 1580 |
| 626 | Ga0495625_0155597 | 3300046660 | Bacteria | 1534 |
| 627 | Ga0495635_0013627 | 3300046663 | Bacteria | 5690 |
| 628 | Ga0495635_0034889 | 3300046663 | Bacteria | 3489 |
| 629 | Ga0495635_0040500 | 3300046663 | Bacteria | 3219 |
| 630 | Ga0495635_0102843 | 3300046663 | Bacteria | 1952 |
| 631 | Ga0495661_0005519 | 3300046665 | Bacteria | 8973 |
| 632 | Ga0495661_0010232 | 3300046665 | Bacteria | 6410 |
| 633 | Ga0495588_0008649 | 3300046674 | Bacteria | 4678 |
| 634 | Ga0495588_0025253 | 3300046674 | Bacteria | 2959 |
| 635 | Ga0495588_0035503 | 3300046674 | Bacteria | 2526 |
| 636 | Ga0495599_0015425 | 3300046678 | Bacteria | 4741 |
| 637 | Ga0495599_0023267 | 3300046678 | Bacteria | 3871 |
| 638 | Ga0495599_0032828 | 3300046678 | Bacteria | 3259 |
| 639 | Ga0495599_0048735 | 3300046678 | Bacteria | 2655 |
| 640 | Ga0495599_0131437 | 3300046678 | Bacteria | 1555 |
| 641 | Ga0495623_0007011 | 3300046679 | Bacteria | 7325 |
| 642 | Ga0495623_0010956 | 3300046679 | Bacteria | 5867 |
| 643 | Ga0495623_0021667 | 3300046679 | Bacteria | 4150 |
| 644 | Ga0495623_0135016 | 3300046679 | Bacteria | 1473 |
| 645 | Ga0495646_0001320 | 3300046680 | Bacteria | 14655 |
| 646 | Ga0495646_0011483 | 3300046680 | Bacteria | 5622 |
| 647 | Ga0495646_0021365 | 3300046680 | Bacteria | 4088 |
| 648 | Ga0495646_0023967 | 3300046680 | Bacteria | 3842 |
| 649 | Ga0495646_0034617 | 3300046680 | Bacteria | 3136 |
| 650 | Ga0495646_0053517 | 3300046680 | Bacteria | 2433 |
| 651 | Ga0495646_0076910 | 3300046680 | Bacteria | 1953 |
| 652 | Ga0495658_0132556 | 3300046683 | Bacteria | 1518 |
| 653 | Ga0495669_0035962 | 3300046684 | Bacteria | 2188 |
| 654 | Ga0495669_0084553 | 3300046684 | Bacteria | 1459 |
| 655 | Ga0495669_0102943 | 3300046684 | Bacteria | 1327 |
| 656 | Ga0495613_0002624 | 3300046689 | Bacteria | 13515 |
| 657 | Ga0495613_0010806 | 3300046689 | Bacteria | 6773 |
| 658 | Ga0495624_0009914 | 3300046690 | Bacteria | 6585 |
| 659 | Ga0495624_0010314 | 3300046690 | Bacteria | 6437 |
| 660 | Ga0495624_0016074 | 3300046690 | Bacteria | 5038 |
| 661 | Ga0495624_0016284 | 3300046690 | Bacteria | 5005 |
| 662 | Ga0495624_0017769 | 3300046690 | Bacteria | 4767 |
| 663 | Ga0495624_0053963 | 3300046690 | Bacteria | 2536 |
| 664 | Ga0495624_0121640 | 3300046690 | Bacteria | 1602 |
| 665 | Ga0495624_0179046 | 3300046690 | Bacteria | 1292 |
| 666 | Ga0495670_0064305 | 3300046691 | Bacteria | 1848 |
| 667 | Ga0495670_0089064 | 3300046691 | Bacteria | 1578 |
| 668 | Ga0495671_0002320 | 3300046692 | Bacteria | 12088 |
| 669 | Ga0495671_0016957 | 3300046692 | Bacteria | 3881 |
| 670 | Ga0495671_0038591 | 3300046692 | Bacteria | 2413 |
| 671 | Ga0495671_0076100 | 3300046692 | Bacteria | 1646 |
| 672 | Ga0495649_0001567 | 3300046694 | Bacteria | 17157 |
| 673 | Ga0495649_0004421 | 3300046694 | Bacteria | 9188 |
| 674 | Ga0495649_0068416 | 3300046694 | Bacteria | 1905 |
| 675 | Ga0495649_0079163 | 3300046694 | Bacteria | 1758 |
| 676 | Ga0495649_0083897 | 3300046694 | Bacteria | 1702 |
| 677 | Ga0495589_0005849 | 3300046794 | Bacteria | 6492 |
| 678 | Ga0495589_0010940 | 3300046794 | Bacteria | 4712 |
| 679 | Ga0495589_0082331 | 3300046794 | Bacteria | 1565 |
| 680 | Ga0495600_0013215 | 3300046809 | Bacteria | 5183 |
| 681 | Ga0495600_0032687 | 3300046809 | Bacteria | 3376 |
| 682 | Ga0495600_0044562 | 3300046809 | Bacteria | 2894 |
| 683 | Ga0495600_0143413 | 3300046809 | Bacteria | 1549 |
| 684 | Ga0495660_0138054 | 3300046810 | Bacteria | 1216 |
| 685 | Ga0495581_0005698 | 3300047315 | Bacteria | 7224 |
| 686 | Ga0495581_0006202 | 3300047315 | Bacteria | 6934 |
| 687 | Ga0495581_0006589 | 3300047315 | Bacteria | 6728 |
| 688 | Ga0495581_0023067 | 3300047315 | Bacteria | 3606 |
| 689 | Ga0495604_0005007 | 3300047317 | Bacteria | 10494 |
| 690 | Ga0495604_0036700 | 3300047317 | Bacteria | 3864 |
| 691 | Ga0495604_0037578 | 3300047317 | Bacteria | 3812 |
| 692 | Ga0495604_0126928 | 3300047317 | Bacteria | 1838 |
| 693 | Ga0495674_0022004 | 3300047319 | Bacteria | 5885 |
| 694 | Ga0495674_0023710 | 3300047319 | Bacteria | 5651 |
| 695 | Ga0495674_0036272 | 3300047319 | Bacteria | 4439 |
| 696 | Ga0495674_0045553 | 3300047319 | Bacteria | 3894 |
| 697 | Ga0495674_0082240 | 3300047319 | Bacteria | 2761 |
| 698 | Ga0495674_0094523 | 3300047319 | Bacteria | 2549 |
| 699 | Ga0495674_0294906 | 3300047319 | Bacteria | 1325 |
| 700 | Ga0495672_0003028 | 3300047320 | Bacteria | 14773 |
| 701 | Ga0495676_0017431 | 3300047321 | Bacteria | 6351 |
| 702 | Ga0495676_0038899 | 3300047321 | Bacteria | 3946 |
| 703 | Ga0495676_0046582 | 3300047321 | Bacteria | 3517 |
| 704 | Ga0495676_0105211 | 3300047321 | Bacteria | 2081 |
| 705 | Ga0495680_0007394 | 3300047322 | Bacteria | 10075 |
| 706 | Ga0495680_0021369 | 3300047322 | Bacteria | 5419 |
| 707 | Ga0495680_0035715 | 3300047322 | Bacteria | 4000 |
| 708 | Ga0495680_0086575 | 3300047322 | Bacteria | 2357 |
| 709 | Ga0495683_0002898 | 3300047323 | Bacteria | 10143 |
| 710 | Ga0495683_0006607 | 3300047323 | Bacteria | 6323 |
| 711 | Ga0495683_0075182 | 3300047323 | Bacteria | 1654 |
| 712 | Ga0495683_0084673 | 3300047323 | Bacteria | 1542 |
| 713 | Ga0495687_000011 | 3300047443 | Bacteria | 397225 |
| 714 | Ga0495687_006437 | 3300047443 | Bacteria | 7197 |
| 715 | Ga0495687_017752 | 3300047443 | Bacteria | 3535 |
| 716 | Ga0495687_060421 | 3300047443 | Bacteria | 1563 |
| 717 | Ga0495675_0003779 | 3300047444 | Bacteria | 9156 |
| 718 | Ga0495675_0024722 | 3300047444 | Bacteria | 3831 |
| 719 | Ga0495675_0036826 | 3300047444 | Bacteria | 3119 |
| 720 | Ga0495675_0132796 | 3300047444 | Bacteria | 1546 |
| 721 | Ga0495679_000109 | 3300047446 | Bacteria | 74134 |
| 722 | Ga0495679_003488 | 3300047446 | Bacteria | 7534 |
| 723 | Ga0495673_0040365 | 3300047469 | Bacteria | 2109 |
| 724 | Ga0495673_0051646 | 3300047469 | Bacteria | 1799 |
| 725 | Ga0495673_0096997 | 3300047469 | Bacteria | 1197 |
| 726 | Ga0495684_0110236 | 3300047471 | Bacteria | 2078 |
| 727 | Ga0495684_0132016 | 3300047471 | Bacteria | 1875 |
| 728 | Ga0495686_0000014 | 3300047472 | Bacteria | 474014 |
| 729 | Ga0495686_0014261 | 3300047472 | Bacteria | 5475 |
| 730 | Ga0495593_0001995 | 3300047673 | Bacteria | 12169 |
| 731 | Ga0495593_0004554 | 3300047673 | Bacteria | 8236 |
| 732 | Ga0495593_0006696 | 3300047673 | Bacteria | 6745 |
| 733 | Ga0495593_0010859 | 3300047673 | Bacteria | 5250 |
| 734 | Ga0495593_0018130 | 3300047673 | Bacteria | 3958 |
| 735 | Ga0495593_0025266 | 3300047673 | Bacteria | 3287 |
| 736 | Ga0495602_0019497 | 3300048088 | Bacteria | 6730 |
| 737 | Ga0495602_0027611 | 3300048088 | Bacteria | 5452 |
| 738 | Ga0495614_0000770 | 3300048089 | Bacteria | 13577 |
| 739 | Ga0495614_0006640 | 3300048089 | Bacteria | 5181 |
| 740 | Ga0495614_0082923 | 3300048089 | Bacteria | 1390 |
| 741 | Ga0495626_0017922 | 3300048091 | Bacteria | 3569 |
| 742 | Ga0495626_0021549 | 3300048091 | Bacteria | 3197 |
| 743 | Ga0495626_0049299 | 3300048091 | Bacteria | 1950 |
| 744 | Ga0496100_0003845 | 3300048903 | Bacteria | 7874 |
| 745 | Ga0496100_0009676 | 3300048903 | Bacteria | 5422 |
| 746 | Ga0496100_0018508 | 3300048903 | Bacteria | 4133 |
| 747 | Ga0496100_0039852 | 3300048903 | Bacteria | 2985 |
| 748 | Ga0496100_0136746 | 3300048903 | Bacteria | 1732 |
| 749 | Ga0496101_0006420 | 3300048904 | Bacteria | 7564 |
| 750 | Ga0496101_0128488 | 3300048904 | Bacteria | 1922 |
| 751 | Ga0496102_0001889 | 3300048905 | Bacteria | 18052 |
| 752 | Ga0496102_0003852 | 3300048905 | Bacteria | 12706 |
| 753 | Ga0496102_0021914 | 3300048905 | Bacteria | 5657 |
| 754 | Ga0496102_0035899 | 3300048905 | Bacteria | 4464 |
| 755 | Ga0496102_0048343 | 3300048905 | Bacteria | 3868 |
| 756 | Ga0496102_0269160 | 3300048905 | Bacteria | 1606 |
| 757 | Ga0496103_0006863 | 3300048906 | Bacteria | 6798 |
| 758 | Ga0496103_0011673 | 3300048906 | Bacteria | 5211 |
| 759 | Ga0496103_0019064 | 3300048906 | Bacteria | 4120 |
| 760 | Ga0496103_0040992 | 3300048906 | Bacteria | 2846 |
| 761 | Ga0496104_0028881 | 3300048907 | Bacteria | 5142 |
| 762 | Ga0496104_0054037 | 3300048907 | Bacteria | 3796 |
| 763 | Ga0496105_0008551 | 3300048908 | Bacteria | 7952 |
| 764 | Ga0496105_0052227 | 3300048908 | Bacteria | 3375 |
| 765 | Ga0496105_0107959 | 3300048908 | Bacteria | 2298 |
| 766 | Ga0496105_0171307 | 3300048908 | Bacteria | 1779 |
| 767 | Ga0496105_0173630 | 3300048908 | Bacteria | 1766 |
| 768 | Ga0496105_0208750 | 3300048908 | Bacteria | 1592 |
| 769 | Ga0496106_0000031 | 3300048909 | Bacteria | 135370 |
| 770 | Ga0496106_0019590 | 3300048909 | Bacteria | 5019 |
| 771 | Ga0496106_0089452 | 3300048909 | Bacteria | 2374 |
| 772 | Ga0496107_0023185 | 3300048910 | Bacteria | 4388 |
| 773 | Ga0496107_0085859 | 3300048910 | Bacteria | 2296 |
| 774 | Ga0496107_0116962 | 3300048910 | Bacteria | 1963 |
| 775 | Ga0496108_0232750 | 3300048911 | Bacteria | 1602 |
| 776 | Ga0496109_0240207 | 3300048912 | Bacteria | 1705 |
| 777 | Ga0496109_0281411 | 3300048912 | Bacteria | 1568 |
| 778 | Ga0496110_0026740 | 3300048913 | Bacteria | 4941 |
| 779 | Ga0496110_0156871 | 3300048913 | Bacteria | 2062 |
| 780 | Ga0496111_0060199 | 3300048914 | Bacteria | 2752 |
| 781 | Ga0496112_0008182 | 3300048915 | Bacteria | 9348 |
| 782 | Ga0496112_0041577 | 3300048915 | Bacteria | 4498 |
| 783 | Ga0496113_0011230 | 3300048916 | Bacteria | 5964 |
| 784 | Ga0496113_0256718 | 3300048916 | Bacteria | 1396 |
| 785 | Ga0496114_0001502 | 3300048917 | Bacteria | 17697 |
| 786 | Ga0496114_0275292 | 3300048917 | Bacteria | 1483 |
| 787 | Ga0496114_0318659 | 3300048917 | Bacteria | 1374 |
| 788 | Ga0496115_0113660 | 3300048918 | Bacteria | 2225 |
| 789 | Ga0496116_0012792 | 3300048919 | Bacteria | 6818 |
| 790 | Ga0496116_0066210 | 3300048919 | Bacteria | 2313 |
| 791 | Ga0496116_0104757 | 3300048919 | Bacteria | 1680 |
| 792 | Ga0496117_0004561 | 3300048920 | Bacteria | 15167 |
| 793 | Ga0496117_0008670 | 3300048920 | Bacteria | 9612 |
| 794 | Ga0496117_0010958 | 3300048920 | Bacteria | 8171 |
| 795 | Ga0496117_0011477 | 3300048920 | Bacteria | 7934 |
| 796 | Ga0496117_0017799 | 3300048920 | Bacteria | 5923 |
| 797 | Ga0496117_0064264 | 3300048920 | Bacteria | 2503 |
| 798 | Ga0496118_0001983 | 3300048921 | Bacteria | 29083 |
| 799 | Ga0496118_0002651 | 3300048921 | Bacteria | 23694 |
| 800 | Ga0496118_0013236 | 3300048921 | Bacteria | 7825 |
| 801 | Ga0496118_0017009 | 3300048921 | Bacteria | 6642 |
| 802 | Ga0496118_0020524 | 3300048921 | Bacteria | 5854 |
| 803 | Ga0496118_0022762 | 3300048921 | Bacteria | 5463 |
| 804 | Ga0496118_0027358 | 3300048921 | Bacteria | 4828 |
| 805 | Ga0496118_0043345 | 3300048921 | Bacteria | 3538 |
| 806 | Ga0496118_0056034 | 3300048921 | Bacteria | 2967 |
| 807 | Ga0496118_0104184 | 3300048921 | Bacteria | 1905 |
| 808 | Ga0496118_0131107 | 3300048921 | Bacteria | 1610 |
| 809 | Ga0496121_0000305 | 3300048924 | Bacteria | 102256 |
| 810 | Ga0496121_0006229 | 3300048924 | Bacteria | 14945 |
| 811 | Ga0496121_0028228 | 3300048924 | Bacteria | 5228 |
| 812 | Ga0496121_0074371 | 3300048924 | Bacteria | 2718 |
| 813 | Ga0496121_0082136 | 3300048924 | Bacteria | 2548 |
| 814 | Ga0496121_0156425 | 3300048924 | Bacteria | 1672 |
| 815 | Ga0496122_0000217 | 3300048925 | Bacteria | 128502 |
| 816 | Ga0496122_0026227 | 3300048925 | Bacteria | 5032 |
| 817 | Ga0496123_0000057 | 3300048926 | Bacteria | 228608 |
| 818 | Ga0496123_0028101 | 3300048926 | Bacteria | 4172 |
| 819 | Ga0496123_0028452 | 3300048926 | Bacteria | 4137 |
| 820 | Ga0496123_0126072 | 3300048926 | Bacteria | 1429 |
| 821 | Ga0496124_0026584 | 3300048927 | Bacteria | 5215 |
| 822 | Ga0496124_0031416 | 3300048927 | Bacteria | 4701 |
| 823 | Ga0496124_0054648 | 3300048927 | Bacteria | 3379 |
| 824 | Ga0496125_0032287 | 3300048928 | Bacteria | 4652 |
| 825 | Ga0496126_0001240 | 3300048929 | Bacteria | 41387 |
| 826 | Ga0496126_0003440 | 3300048929 | Bacteria | 19979 |
| 827 | Ga0496126_0003523 | 3300048929 | Bacteria | 19696 |
| 828 | Ga0496126_0016774 | 3300048929 | Bacteria | 7314 |
| 829 | Ga0496126_0198119 | 3300048929 | Bacteria | 1697 |
| 830 | Ga0496126_0244826 | 3300048929 | Bacteria | 1496 |
| 831 | Ga0496126_0315125 | 3300048929 | Bacteria | 1287 |
| 832 | Ga0495678_017996 | 3300049459 | Bacteria | 3186 |
| 833 | Ga0495678_051418 | 3300049459 | Bacteria | 1593 |
| 834 | Ga0495678_058272 | 3300049459 | Bacteria | 1460 |
| 835 | Ga0495682_0007262 | 3300049460 | Bacteria | 4423 |
| 836 | Ga0495682_0015318 | 3300049460 | Bacteria | 2905 |
| 837 | Ga0495682_0060012 | 3300049460 | Bacteria | 1374 |
| 838 | Ga0501225_0002703 | 3300049705 | Bacteria | 5446 |
| 839 | Ga0501280_000651 | 3300049776 | Bacteria | 7785 |
| 840 | nmdc:mga03683_11163_c1 | 3300050489 | Bacteria | 3242 |
| 841 | nmdc:mga03683_25651_c1 | 3300050489 | Bacteria | 2318 |
| 842 | nmdc:mga03683_45642_c1 | 3300050489 | Bacteria | 1814 |
| 843 | nmdc:mga03683_51169_c1 | 3300050489 | Bacteria | 1723 |
| 844 | nmdc:mga03683_53022_c1 | 3300050489 | Bacteria | 1697 |
| 845 | nmdc:mga03683_80225_c1 | 3300050489 | Bacteria | 1408 |
| 846 | nmdc:mga03n38_21763_c1 | 3300050490 | Bacteria | 2585 |
| 847 | nmdc:mga03n38_24136_c1 | 3300050490 | Bacteria | 2483 |
| 848 | nmdc:mga03n38_49718_c1 | 3300050490 | Bacteria | 1865 |
| 849 | nmdc:mga00v17_126852_c1 | 3300050491 | Bacteria | 1629 |
| 850 | nmdc:mga00v17_190727_c1 | 3300050491 | Bacteria | 1324 |
| 851 | nmdc:mga0yw44_16735_c1 | 3300050492 | Bacteria | 3971 |
| 852 | nmdc:mga0k408_116628_c1 | 3300050493 | Bacteria | 1580 |
| 853 | nmdc:mga0k408_196920_c1 | 3300050493 | Bacteria | 1202 |
| 854 | nmdc:mga0k408_61213_c1 | 3300050493 | Bacteria | 2188 |
| 855 | nmdc:mga06z11_44049_c1 | 3300050494 | Bacteria | 2248 |
| 856 | nmdc:mga04h51_31327_c1 | 3300050495 | Bacteria | 1680 |
| 857 | nmdc:mga07m45_113912_c1 | 3300050496 | Bacteria | 1559 |
| 858 | nmdc:mga07m45_143028_c1 | 3300050496 | Bacteria | 1386 |
| 859 | nmdc:mga07m45_34458_c1 | 3300050496 | Bacteria | 2814 |
| 860 | nmdc:mga07m45_356_c1 | 3300050496 | Bacteria | 18703 |
| 861 | nmdc:mga07m45_8280_c1 | 3300050496 | Bacteria | 5336 |
| 862 | nmdc:mga07m45_89697_c1 | 3300050496 | Bacteria | 1761 |
| 863 | nmdc:mga0sz30_34877_c1 | 3300050516 | Bacteria | 2097 |
| 864 | Ga0500610_0000451 | 3300053079 | Bacteria | 12670 |
| 865 | Ga0500610_0001074 | 3300053079 | Bacteria | 8980 |
| 866 | Ga0500643_001718 | 3300053087 | Bacteria | 12168 |
| 867 | Ga0500583_0002376 | 3300053092 | Bacteria | 5640 |
| 868 | Ga0500651_0000642 | 3300053093 | Bacteria | 17399 |
| 869 | Ga0500569_023454 | 3300053109 | Bacteria | 1659 |
| 870 | Ga0500571_000477 | 3300053110 | Bacteria | 16305 |
| 871 | Ga0500592_003170 | 3300053116 | Bacteria | 2630 |
| 872 | Ga0500593_000735 | 3300053117 | Bacteria | 12377 |
| 873 | Ga0500594_0007251 | 3300053118 | Bacteria | 2506 |
| 874 | Ga0500597_019885 | 3300053120 | Bacteria | 2627 |
| 875 | Ga0500607_003250 | 3300053121 | Bacteria | 12002 |
| 876 | Ga0500607_010629 | 3300053121 | Bacteria | 5468 |
| 877 | Ga0500608_003396 | 3300053122 | Bacteria | 5963 |
| 878 | Ga0500608_080724 | 3300053122 | Bacteria | 1535 |
| 879 | Ga0500618_001179 | 3300053125 | Bacteria | 12614 |
| 880 | Ga0500655_000925 | 3300053133 | Bacteria | 5678 |
| 881 | Ga0500658_0000263 | 3300053134 | Bacteria | 24167 |
| 882 | Ga0500658_0001281 | 3300053134 | Bacteria | 10197 |
| 883 | Ga0500559_0001594 | 3300053136 | Bacteria | 12620 |
| 884 | Ga0500559_0002800 | 3300053136 | Bacteria | 8815 |
| 885 | Ga0500564_013191 | 3300053138 | Bacteria | 3693 |
| 886 | Ga0500568_0001164 | 3300053139 | Bacteria | 17590 |
| 887 | Ga0500568_0001787 | 3300053139 | Bacteria | 13260 |
| 888 | Ga0500574_039308 | 3300053141 | Bacteria | 1313 |
| 889 | Ga0500604_0000752 | 3300053151 | Bacteria | 8867 |
| 890 | Ga0500616_0011322 | 3300053153 | Bacteria | 5277 |
| 891 | Ga0500624_003981 | 3300053157 | Bacteria | 1939 |
| 892 | Ga0500627_0004123 | 3300053158 | Bacteria | 4613 |
| 893 | Ga0500634_0002263 | 3300053161 | Bacteria | 8034 |
| 894 | Ga0500636_0015064 | 3300053177 | Bacteria | 4552 |
| 895 | Ga0466962_0008411 | 3300061719 | Bacteria | 4944 |
| 896 | Ga0466962_0016712 | 3300061719 | Bacteria | 3538 |
| 897 | Ga0466962_0061442 | 3300061719 | Bacteria | 1793 |
| 898 | Ga0466962_0070809 | 3300061719 | Bacteria | 1666 |
| 899 | 2514046283 | 2513237166 | Bacteria | 10373764 |
| 900 | 2501071009 | 2501025501 | Bacteria | 7768574 |
| 901 | 2501078836 | 2501025502 | Bacteria | 9641094 |
| 902 | 2501413839 | 2501025504 | Bacteria | 8008976 |
| 903 | 2509129383 | 2508501125 | Bacteria | 7208311 |
| 904 | 2510249971 | 2510065045 | Bacteria | 7761063 |
| 905 | 2511089475 | 2510917013 | Bacteria | 9951648 |
| 906 | 2511094892 | 2510917014 | Bacteria | 8296963 |
| 907 | 2511104551 | 2510917015 | Bacteria | 7950052 |
| 908 | 2512347518 | 2512047030 | Bacteria | 9031815 |
| 909 | 2513227435 | 2513020051 | Bacteria | 6053213 |
| 910 | 2513551591 | 2513237082 | Bacteria | 8640282 |
| 911 | 2513560242 | 2513237083 | Bacteria | 8410967 |
| 912 | 2513962461 | 2513237151 | Bacteria | 6309801 |
| 913 | 2515679422 | 2515154122 | Bacteria | 8609520 |
| 914 | 2515690480 | 2515154123 | Bacteria | 6387382 |
| 915 | 2516016996 | 2515154189 | Bacteria | 9629850 |
| 916 | 2519457891 | 2519103095 | Bacteria | 6629912 |
| 917 | 2527079139 | 2526164713 | Bacteria | 6780608 |
| 918 | 2548846186 | 2547132512 | Bacteria | 3416496 |
| 919 | 2563061899 | 2562617112 | Bacteria | 10918404 |
| 920 | 2585295192 | 2582581311 | Bacteria | 6763856 |
| 921 | 2599624543 | 2599185214 | Bacteria | 8209958 |
| 922 | 2599672595 | 2599185226 | Bacteria | 8233575 |
| 923 | 2599683595 | 2599185227 | Bacteria | 8246414 |
| 924 | 2599694204 | 2599185229 | Bacteria | 8216126 |
| 925 | 2599737023 | 2599185239 | Bacteria | 8686614 |
| 926 | 2599742865 | 2599185240 | Bacteria | 7968121 |
| 927 | 2600204983 | 2599185355 | Bacteria | 7968906 |
| 928 | 2600814623 | 2600255067 | Bacteria | 6795583 |
| 929 | 2643975203 | 2643221593 | Bacteria | 6296053 |
| 930 | 2644163141 | 2643221628 | Bacteria | 5745828 |
| 931 | 2644328106 | 2643221658 | Bacteria | 6064537 |
| 932 | 2644398585 | 2643221672 | Bacteria | 6322190 |
| 933 | 2644468670 | 2643221683 | Bacteria | 5749203 |
| 934 | 2676741972 | 2675903129 | Bacteria | 7964495 |
| 935 | 2713478265 | 2711768613 | Bacteria | 11048459 |
| 936 | 2719639129 | 2718217991 | Bacteria | 7829542 |
| 937 | 2735816181 | 2734482258 | Unclassified | 2930739 |
| 938 | 2738720157 | 2738541277 | Bacteria | 7458140 |
| 939 | 2738820116 | 2738541296 | Bacteria | 7285013 |
| 940 | 2738832596 | 2738541298 | Bacteria | 7286732 |
| 941 | 2738874123 | 2738541306 | Bacteria | 7284992 |
| 942 | 2738881701 | 2738541307 | Bacteria | 8606193 |
| 943 | 2739185753 | 2738543002 | Bacteria | 7284546 |
| 944 | 2739220721 | 2738543008 | Bacteria | 7282815 |
| 945 | 2739279356 | 2738543019 | Bacteria | 7459457 |
| 946 | 2746092230 | 2744054900 | Bacteria | 8399525 |
| 947 | 2746095271 | 2744054901 | Bacteria | 8397047 |
| 948 | 2753568824 | 2751185846 | Bacteria | 7242164 |
| 949 | 2792833011 | 2791355137 | Bacteria | 9654227 |
| 950 | 2808971581 | 2808606384 | Bacteria | 8474373 |
| 951 | 2809006410 | 2808606390 | Bacteria | 8476311 |
| 952 | 2809013672 | 2808606391 | Bacteria | 8308166 |
| 953 | 2817260070 | 2816332253 | Bacteria | 6764532 |
| 954 | 2817277734 | 2816332256 | Bacteria | 6891714 |
| 955 | 2817456853 | 2816332286 | Bacteria | 6853759 |
| 956 | 2819595955 | 2818991446 | Bacteria | 7757362 |
| 957 | 2819620873 | 2818991450 | Bacteria | 6962147 |
| 958 | 2819632525 | 2818991452 | Bacteria | 8442785 |
| 959 | 2831266895 | 2831265667 | Bacteria | 7184833 |
| 960 | 2838056954 | 2838054893 | Bacteria | 7451788 |
| 961 | 2842331332 | 2842324504 | Bacteria | 9364110 |
| 962 | 2842355672 | 2842348783 | Bacteria | 9002918 |
| 963 | 2842462024 | 2842454564 | Bacteria | 8730687 |
| 964 | 2842678772 | 2842677519 | Bacteria | 5615038 |
| 965 | 2842735573 | 2842733646 | Bacteria | 5716726 |
| 966 | 2842751331 | 2842747753 | Bacteria | 5578255 |
| 967 | 2856289142 | 2856287931 | Bacteria | 7223934 |
| 968 | 2857363488 | 2857357740 | Bacteria | 9937880 |
| 969 | 2863421566 | 2863421361 | Bacteria | 7300805 |
| 970 | 2870069008 | 2870068957 | Bacteria | 8925310 |
| 971 | 2881105141 | 2881101125 | Bacteria | 4590519 |
| 972 | 2883094751 | 2883087390 | Bacteria | 9532701 |
| 973 | 2885192875 | 2885192300 | Bacteria | 5882526 |
| 974 | 2885199050 | 2885198086 | Bacteria | 7212419 |
| 975 | 2885212687 | 2885211737 | Bacteria | 7212420 |
| 976 | 2885277302 | 2885270888 | Bacteria | 9831543 |
| 977 | 2891634731 | 2891633521 | Bacteria | 4602265 |
| 978 | 2899925304 | 2899924645 | Bacteria | 7487985 |
| 979 | 2900636243 | 2900634093 | Bacteria | 10263517 |
| 980 | 2902683440 | 2902682994 | Bacteria | 8951596 |
| 981 | 2904456458 | 2904449895 | Bacteria | 6927402 |
| 982 | 2904460679 | 2904456579 | Bacteria | 6819253 |
| 983 | 2904483966 | 2904483920 | Bacteria | 7545285 |
| 984 | 2904548408 | 2904541872 | Bacteria | 8915136 |
| 985 | 2904565747 | 2904564687 | Bacteria | 7609577 |
| 986 | 2904572790 | 2904571731 | Bacteria | 7608790 |
| 987 | 2904618883 | 2904615490 | Bacteria | 10047340 |
| 988 | 2919464400 | 2919462493 | Bacteria | 5817112 |
| 989 | 2919529914 | 2919527303 | Bacteria | 7718827 |
| 990 | 2921643715 | 2921643360 | Bacteria | 11448031 |
| 991 | 2928038574 | 2928037797 | Bacteria | 7273642 |
| 992 | 2928045821 | 2928044640 | Bacteria | 7271509 |
| 993 | 2928053438 | 2928051484 | Bacteria | 7773759 |
| 994 | 2928067043 | 2928064002 | Bacteria | 7419480 |
| 995 | 2928071057 | 2928070936 | Bacteria | 8062541 |
| 996 | 2928085001 | 2928084124 | Bacteria | 7159212 |
| 997 | 2928109675 | 2928108538 | Bacteria | 7360024 |
| 998 | 2928136871 | 2928135762 | Bacteria | 7259641 |
| 999 | 2928159856 | 2928157003 | Bacteria | 7522202 |
| 1000 | 2928164104 | 2928163908 | Bacteria | 7561269 |
| 1001 | 2928173367 | 2928170801 | Bacteria | 8785406 |
| 1002 | 2928506399 | 2928503688 | Bacteria | 7268108 |
| 1003 | 2928538687 | 2928536128 | Bacteria | 7657547 |
| 1004 | 2929163805 | 2929160207 | Bacteria | 9075316 |
| 1005 | 2929524888 | 2929520902 | Bacteria | 6765052 |
| 1006 | 2945912459 | 2945909444 | Bacteria | 7065066 |
| 1007 | 2945935425 | 2945934425 | Bacteria | 7444609 |
| 1008 | 2945947233 | 2945945610 | Bacteria | 5951079 |
| 1009 | 2945976991 | 2945972063 | Bacteria | 6086495 |
| 1010 | 2945985222 | 2945984333 | Bacteria | 7358892 |
| 1011 | 2954771966 | 2954767861 | Bacteria | 5535784 |
| 1012 | 2981994294 | 2981990288 | Bacteria | 7590678 |
| 1013 | 2990704026 | 2990703756 | Bacteria | 7715990 |
| 1014 | 642422183 | 641736151 | Bacteria | 7477263 |
| 1015 | 642417462 | 641736154 | Bacteria | 7689995 |
| 1016 | 642594292 | 642555112 | Bacteria | 8676562 |
| 1017 | 642620297 | 642555113 | Bacteria | 8214658 |
| 1018 | 8003957509 | 8003955200 | Bacteria | 8601927 |
| 1019 | 8018848983 | 8018845410 | Bacteria | 8933938 |
| 1020 | 8020813039 | 8020807995 | Bacteria | 6801506 |
| 1021 | 8020944843 | 8020938398 | Bacteria | 7472757 |
| 1022 | 8020949716 | 8020945358 | Bacteria | 8467355 |
| 1023 | 8020959928 | 8020953355 | Bacteria | 7439080 |
| 1024 | 8021126730 | 8021120328 | Bacteria | 8782274 |
| 1025 | 8039099204 | 8039098773 | Bacteria | 6602928 |
| 1026 | 8040172292 | 8040167225 | Bacteria | 6542727 |
| 1027 | 8040175757 | 8040173305 | Bacteria | 6827067 |
| 1028 | 8055266704 | 8055266321 | Bacteria | 7999742 |
| 1029 | 8055303920 | 8055301274 | Bacteria | 8587385 |
| 1030 | JGI24740J21852_10003397 | |||
| 1031 | JGI24740J21852_10007221 | |||
| 1032 | JGI24739J22299_10002664 | |||
| 1033 | JGI24739J22299_10005575 | |||
| 1034 | JGI24739J22299_10035620 | |||
| 1035 | JGI24737J22298_10023739 | |||
| 1036 | JGI24735J21928_10002378 | |||
| 1037 | JGI24735J21928_10049111 | |||
| 1038 | JGI24738J21930_10001505 | |||
| 1039 | JGI25155J39150_1000724 | |||
| 1040 | JGI25156J39149_1000504 | |||
| 1041 | JGI25156J39149_1000735 | |||
| 1042 | JGI25156J39149_1002542 | |||
| 1043 | JGI25152J39213_1000915 | |||
| 1044 | JGI25152J39213_1001246 | |||
| 1045 | JGI25150J39212_1000991 | |||
| 1046 | JGI25150J39212_1002008 | |||
| 1047 | JGI25159J45721_1001447 | |||
| 1048 | JGI25151J46595_10002025 | |||
| 1049 | JGI25151J46595_10002925 | |||
| 1050 | JGI25151J46595_10003922 | |||
| 1051 | JGI25151J46595_10008898 | |||
| 1052 | JGI25165J46597_1001196 | |||
| 1053 | JGI25153J46596_10001486 | |||
| 1054 | JGI25153J46596_10004452 | |||
| 1055 | rootL2_10002479 | |||
| 1056 | rootL2_10084409 | |||
| 1057 | JGI25160J50197_1000171 | |||
| 1058 | JGI25160J50197_1001502 | |||
| 1059 | JGI25160J50197_1006483 | |||
| 1060 | JGI25161J50226_1001006 | |||
| 1061 | JGI25161J50226_1002287 | |||
| 1062 | Ga0006562J51391_1095652 | |||
| 1063 | Ga0006562J51391_1095654 | |||
| 1064 | Ga0055533_1000292 | |||
| 1065 | Ga0055532_1000001 | |||
| 1066 | Ga0055532_1002025 | |||
| 1067 | Ga0055532_1002081 | |||
| 1068 | Ga0055532_1002399 | |||
| 1069 | Ga0055527_1000014 | |||
| 1070 | Ga0055527_1001374 | |||
| 1071 | Ga0055535_1000001 | |||
| 1072 | Ga0055535_1000998 | |||
| 1073 | Ga0055535_1002924 | |||
| 1074 | Ga0055535_1002982 | |||
| 1075 | Ga0055542_1000001 | |||
| 1076 | Ga0055542_1000004 | |||
| 1077 | Ga0055542_1001017 | |||
| 1078 | Ga0055542_1002094 | |||
| 1079 | Ga0055529_1000001 | |||
| 1080 | Ga0055529_1001769 | |||
| 1081 | Ga0055526_1000649 | |||
| 1082 | Ga0055526_1002772 | |||
| 1083 | Ga0055526_1004608 | |||
| 1084 | Ga0055537_1000390 | |||
| 1085 | Ga0055537_1001113 | |||
| 1086 | Ga0055524_1001840 | |||
| 1087 | Ga0055536_1001135 | |||
| 1088 | Ga0055536_1001267 | |||
| 1089 | Ga0055536_1002880 | |||
| 1090 | Ga0055534_1000349 | |||
| 1091 | Ga0055534_1001367 | |||
| 1092 | Ga0055534_1006607 | |||
| 1093 | Ga0055528_1000914 | |||
| 1094 | Ga0055528_1002082 | |||
| 1095 | Ga0055530_10001555 | |||
| 1096 | Ga0055540_1000996 | |||
| 1097 | Ga0055540_1003629 | |||
| 1098 | Ga0055540_1003698 | |||
| 1099 | Ga0055540_1004049 | |||
| 1100 | Ga0055540_1008591 | |||
| 1101 | Ga0055531_10001175 | |||
| 1102 | Ga0055531_10004876 | |||
| 1103 | Ga0055531_10021333 | |||
| 1104 | Ga0058692_1002599 | |||
| 1105 | Ga0055543_1002168 | |||
| 1106 | Ga0055543_1002259 | |||
| 1107 | Ga0065165_1001193 | |||
| 1108 | Ga0065165_1003400 | |||
| 1109 | Ga0065714_10008370 | |||
| 1110 | Ga0065704_10072545 | |||
| 1111 | Ga0070658_10002647 | |||
| 1112 | Ga0070658_10014898 | |||
| 1113 | Ga0070658_10265732 | |||
| 1114 | Ga0070666_10057749 | |||
| 1115 | Ga0068868_100081982 | |||
| 1116 | Ga0070660_100000032 | |||
| 1117 | Ga0070660_100002402 | |||
| 1118 | Ga0070661_100237510 | |||
| 1119 | Ga0070659_100000355 | |||
| 1120 | Ga0070659_100304392 | |||
| 1121 | Ga0070667_100050240 | |||
| 1122 | Ga0070663_100009295 | |||
| 1123 | Ga0070678_100084625 | |||
| 1124 | Ga0070678_100109415 | |||
| 1125 | Ga0070678_100142288 | |||
| 1126 | Ga0070662_100017863 | |||
| 1127 | Ga0070662_100267055 | |||
| 1128 | Ga0068853_100020864 | |||
| 1129 | Ga0068853_100081717 | |||
| 1130 | Ga0070665_100385058 | |||
| 1131 | Ga0068855_100009319 | |||
| 1132 | Ga0068855_100022698 | |||
| 1133 | Ga0068855_100424737 | |||
| 1134 | Ga0070664_100029930 | |||
| 1135 | Ga0068852_100003043 | |||
| 1136 | Ga0068852_100136933 | |||
| 1137 | Ga0068859_100253636 | |||
| 1138 | Ga0068862_100153601 | |||
| 1139 | Ga0075368_10007239 | |||
| 1140 | Ga0075363_100020228 | |||
| 1141 | Ga0075363_100033095 | |||
| 1142 | Ga0075363_100182109 | |||
| 1143 | Ga0075364_10008450 | |||
| 1144 | Ga0075364_10133357 | |||
| 1145 | Ga0075362_10007125 | |||
| 1146 | Ga0075362_10030423 | |||
| 1147 | Ga0075362_10031860 | |||
| 1148 | Ga0075362_10033809 | |||
| 1149 | Ga0075362_10078284 | |||
| 1150 | Ga0075367_10023801 | |||
| 1151 | Ga0075369_10048964 | |||
| 1152 | Ga0075369_10069478 | |||
| 1153 | Ga0075366_10003695 | |||
| 1154 | Ga0075366_10006163 | |||
| 1155 | Ga0075366_10087818 | |||
| 1156 | Ga0075370_10001351 | |||
| 1157 | Ga0075370_10001937 | |||
| 1158 | Ga0075370_10031089 | |||
| 1159 | Ga0075370_10040569 | |||
| 1160 | Ga0075370_10128971 | |||
| 1161 | Ga0068871_100223272 | |||
| 1162 | Ga0097620_100253623 | |||
| 1163 | Ga0099826_10030220 | |||
| 1164 | Ga0105251_10000097 | |||
| 1165 | Ga0105251_10004896 | |||
| 1166 | Ga0105251_10076755 | |||
| 1167 | Ga0105244_10001759 | |||
| 1168 | Ga0105244_10050125 | |||
| 1169 | Ga0105250_10006717 | |||
| 1170 | Ga0105240_10000656 | |||
| 1171 | Ga0105240_10008487 | |||
| 1172 | Ga0105240_10045631 | |||
| 1173 | Ga0105240_10081746 | |||
| 1174 | Ga0105240_10089914 | |||
| 1175 | Ga0105240_10345382 | |||
| 1176 | Ga0105243_10002439 | |||
| 1177 | Ga0105243_10004361 | |||
| 1178 | Ga0105243_10347035 | |||
| 1179 | Ga0105241_10129036 | |||
| 1180 | Ga0105242_10127949 | |||
| 1181 | Ga0105248_10036706 | |||
| 1182 | Ga0105248_10177643 | |||
| 1183 | Ga0105248_10179120 | |||
| 1184 | Ga0105237_10013204 | |||
| 1185 | Ga0105237_10057546 | |||
| 1186 | Ga0105237_10063269 | |||
| 1187 | Ga0105238_10037100 | |||
| 1188 | Ga0105238_10070714 | |||
| 1189 | Ga0105238_10244627 | |||
| 1190 | Ga0105239_10007406 | |||
| 1191 | Ga0105239_10036412 | |||
| 1192 | Ga0105246_10061294 | |||
| 1193 | Ga0105246_10352220 | |||
| 1194 | Ga0157373_10003547 | |||
| 1195 | Ga0157373_10053204 | |||
| 1196 | Ga0157371_10027247 | |||
| 1197 | Ga0157370_10000328 | |||
| 1198 | Ga0157370_10001149 | |||
| 1199 | Ga0157370_10055529 | |||
| 1200 | Ga0157370_10186502 | |||
| 1201 | Ga0157370_10193324 | |||
| 1202 | Ga0157369_10000206 | |||
| 1203 | Ga0157369_10000556 | |||
| 1204 | Ga0157369_10000953 | |||
| 1205 | Ga0157369_10387518 | |||
| 1206 | Ga0157374_10000370 | |||
| 1207 | Ga0163162_10010310 | |||
| 1208 | Ga0163162_10047011 | |||
| 1209 | Ga0157372_10003805 | |||
| 1210 | Ga0157372_10019343 | |||
| 1211 | Ga0182008_10001707 | |||
| 1212 | Ga0182008_10029056 | |||
| 1213 | Ga0157379_10120360 | |||
| 1214 | Ga0182006_1000990 | |||
| 1215 | Ga0182006_1030114 | |||
| 1216 | Ga0182007_10000150 | |||
| 1217 | Ga0182007_10000673 | |||
| 1218 | Ga0182007_10005814 | |||
| 1219 | Ga0182007_10016384 | |||
| 1220 | Ga0183362_10001 | |||
| 1221 | Ga0183361_10012 | |||
| 1222 | Ga0163161_10000743 | |||
| 1223 | Ga0163161_10005081 | |||
| 1224 | Ga0163161_10011455 | |||
| 1225 | Ga0163161_10016751 | |||
| 1226 | Ga0197907_10707312 | |||
| 1227 | Ga0206354_11366513 | |||
| 1228 | Ga0206353_11314560 | |||
| 1229 | Ga0224712_10000022 | |||
| 1230 | Ga0209436_103577 | |||
| 1231 | Ga0209436_108792 | |||
| 1232 | Ga0209566_100216 | |||
| 1233 | Ga0209674_100005 | |||
| 1234 | Ga0209674_100092 | |||
| 1235 | Ga0209674_101735 | |||
| 1236 | Ga0209672_100001 | |||
| 1237 | Ga0209672_100028 | |||
| 1238 | Ga0209672_100038 | |||
| 1239 | Ga0209672_101148 | |||
| 1240 | Ga0209672_101654 | |||
| 1241 | Ga0209147_100001 | |||
| 1242 | Ga0209147_100112 | |||
| 1243 | Ga0209147_100163 | |||
| 1244 | Ga0209147_100686 | |||
| 1245 | Ga0209147_102613 | |||
| 1246 | Ga0209563_104011 | |||
| 1247 | Ga0207427_103987 | |||
| 1248 | Ga0209258_100001 | |||
| 1249 | Ga0209258_100022 | |||
| 1250 | Ga0209258_100109 | |||
| 1251 | Ga0209258_100112 | |||
| 1252 | Ga0207425_1000199 | |||
| 1253 | Ga0207425_1000595 | |||
| 1254 | Ga0207425_1002925 | |||
| 1255 | Ga0209148_1000003 | |||
| 1256 | Ga0209148_1000034 | |||
| 1257 | Ga0209148_1000081 | |||
| 1258 | Ga0209148_1000997 | |||
| 1259 | Ga0209759_1000053 | |||
| 1260 | Ga0209759_1000074 | |||
| 1261 | Ga0209759_1000601 | |||
| 1262 | Ga0209129_1000023 | |||
| 1263 | Ga0209129_1000089 | |||
| 1264 | Ga0209129_1001975 | |||
| 1265 | Ga0209233_1000016 | |||
| 1266 | Ga0209565_1000288 | |||
| 1267 | Ga0209565_1000293 | |||
| 1268 | Ga0209565_1001947 | |||
| 1269 | Ga0209455_1000001 | |||
| 1270 | Ga0209455_1000050 | |||
| 1271 | Ga0209455_1014935 | |||
| 1272 | Ga0209673_1000038 | |||
| 1273 | Ga0209673_1000265 | |||
| 1274 | Ga0209673_1000838 | |||
| 1275 | Ga0209673_1001258 | |||
| 1276 | Ga0209130_1000113 | |||
| 1277 | Ga0209130_1001550 | |||
| 1278 | Ga0209130_1004836 | |||
| 1279 | Ga0209675_1000127 | |||
| 1280 | Ga0209675_1000276 | |||
| 1281 | Ga0209675_1000887 | |||
| 1282 | Ga0209675_1002155 | |||
| 1283 | Ga0209676_1000005 | |||
| 1284 | Ga0209676_1001480 | |||
| 1285 | Ga0209676_1003545 | |||
| 1286 | Ga0209676_1004910 | |||
| 1287 | Ga0209676_1009073 | |||
| 1288 | Ga0209676_1017071 | |||
| 1289 | Ga0209025_1000134 | |||
| 1290 | Ga0209025_1000484 | |||
| 1291 | Ga0209025_1001331 | |||
| 1292 | Ga0209025_1002208 | |||
| 1293 | Ga0209025_1009028 | |||
| 1294 | Ga0209564_1000053 | |||
| 1295 | Ga0209564_1000394 | |||
| 1296 | Ga0209564_1000698 | |||
| 1297 | Ga0209564_1006730 | |||
| 1298 | Ga0209564_1027441 | |||
| 1299 | Ga0209758_1000064 | |||
| 1300 | Ga0209758_1000622 | |||
| 1301 | Ga0209758_1014045 | |||
| 1302 | Ga0209050_1000007 | |||
| 1303 | Ga0209050_1001433 | |||
| 1304 | Ga0209050_1011252 | |||
| 1305 | Ga0209256_1000115 | |||
| 1306 | Ga0209256_1000864 | |||
| 1307 | Ga0207426_1000001 | |||
| 1308 | Ga0207426_1000031 | |||
| 1309 | Ga0207426_1000037 | |||
| 1310 | Ga0209051_1000009 | |||
| 1311 | Ga0209051_1000385 | |||
| 1312 | Ga0209051_1000781 | |||
| 1313 | Ga0209051_1001504 | |||
| 1314 | Ga0209051_1002109 | |||
| 1315 | Ga0209051_1002621 | |||
| 1316 | Ga0209051_1019996 | |||
| 1317 | Ga0209051_1053265 | |||
| 1318 | Ga0209257_1000011 | |||
| 1319 | Ga0209257_1001057 | |||
| 1320 | Ga0209257_1003120 | |||
| 1321 | Ga0209257_1005156 | |||
| 1322 | Ga0207655_1013658 | |||
| 1323 | Ga0207713_1000305 | |||
| 1324 | Ga0207682_10034113 | |||
| 1325 | Ga0207680_10008834 | |||
| 1326 | Ga0207647_10000268 | |||
| 1327 | Ga0207647_10004135 | |||
| 1328 | Ga0207647_10008546 | |||
| 1329 | Ga0207647_10019591 | |||
| 1330 | Ga0207647_10027493 | |||
| 1331 | Ga0207647_10043031 | |||
| 1332 | Ga0207705_10000708 | |||
| 1333 | Ga0207705_10134982 | |||
| 1334 | Ga0207695_10005102 | |||
| 1335 | Ga0207695_10018782 | |||
| 1336 | Ga0207695_10099910 | |||
| 1337 | Ga0207695_10188464 | |||
| 1338 | Ga0207695_10373598 | |||
| 1339 | Ga0207671_10026696 | |||
| 1340 | Ga0207671_10059100 | |||
| 1341 | Ga0207671_10103198 | |||
| 1342 | Ga0207657_10000051 | |||
| 1343 | Ga0207657_10000131 | |||
| 1344 | Ga0207694_10019539 | |||
| 1345 | Ga0207694_10065076 | |||
| 1346 | Ga0207690_10000034 | |||
| 1347 | Ga0207709_10001032 | |||
| 1348 | Ga0207709_10001454 | |||
| 1349 | Ga0207711_10026135 | |||
| 1350 | Ga0207711_10031612 | |||
| 1351 | Ga0207711_10228248 | |||
| 1352 | Ga0207679_10015470 | |||
| 1353 | Ga0207667_10003149 | |||
| 1354 | Ga0207667_10009431 | |||
| 1355 | Ga0207667_10113941 | |||
| 1356 | Ga0207667_10202305 | |||
| 1357 | Ga0207640_10215795 | |||
| 1358 | Ga0207658_10047893 | |||
| 1359 | Ga0207658_10057051 | |||
| 1360 | Ga0207639_10007462 | |||
| 1361 | Ga0207639_10065918 | |||
| 1362 | Ga0207678_10002721 | |||
| 1363 | Ga0207678_10037514 | |||
| 1364 | Ga0207678_10262867 | |||
| 1365 | Ga0207674_10198781 | |||
| 1366 | Ga0207674_10369757 | |||
| 1367 | Ga0207683_10014003 | |||
| 1368 | Ga0207683_10056358 | |||
| 1369 | Ga0207698_10010500 | |||
| 1370 | Ga0207698_10111986 | |||
| 1371 | Ga0209371_1000090 | |||
| 1372 | Ga0209371_1001109 | |||
| 1373 | Ga0209282_1000334 | |||
| 1374 | Ga0207428_10351654 | |||
| 1375 | Ga0268266_10240987 | |||
| 1376 | Ga0268266_10335955 | |||
| 1377 | Ga0268265_10118263 | |||
| 1378 | Ga0268264_10171693 | |||
| 1379 | Ga0307515_10000028 | |||
| 1380 | Ga0307515_10024629 | |||
| 1381 | Ga0265338_10000113 | |||
| 1382 | Ga0268256_1000115 | |||
| 1383 | Ga0268256_1000921 | |||
| 1384 | Ga0307511_10000025 | |||
| 1385 | Ga0316177_1029429 | |||
| 1386 | Ga0316176_1080864 | |||
| 1387 | Ga0314311_1124028 | |||
| 1388 | Ga0316180_1012367 | |||
| 1389 | Ga0316182_1325098 | |||
| 1390 | Ga0265332_10000013 | |||
| 1391 | Ga0265325_10000262 | |||
| 1392 | Ga0265327_10000722 | |||
| 1393 | Ga0265327_10015860 | |||
| 1394 | Ga0265316_10000299 | |||
| 1395 | Ga0265316_10089534 | |||
| 1396 | Ga0307513_10116636 | |||
| 1397 | Ga0307509_10000006 | |||
| 1398 | Ga0307408_100002431 | |||
| 1399 | Ga0307408_100024541 | |||
| 1400 | Ga0307408_100114667 | |||
| 1401 | Ga0307408_100157292 | |||
| 1402 | Ga0307508_10059988 | |||
| 1403 | Ga0307514_10005152 | |||
| 1404 | Ga0307516_10003171 | |||
| 1405 | Ga0307405_10002949 | |||
| 1406 | Ga0307406_10001482 | |||
| 1407 | Ga0307406_10033625 | |||
| 1408 | Ga0307412_10000051 | |||
| 1409 | Ga0307412_10061531 | |||
| 1410 | Ga0307412_10194031 | |||
| 1411 | Ga0307416_100023777 | |||
| 1412 | Ga0307416_100462395 | |||
| 1413 | Ga0307414_10071445 | |||
| 1414 | Ga0307411_10020506 | |||
| 1415 | Ga0307411_10118497 | |||
| 1416 | Ga0307411_10207668 | |||
| 1417 | Ga0316583_10029627 | |||
| 1418 | Ga0307507_10088851 | |||
| 1419 | Ga0395899_0000008 | |||
| 1420 | Ga0395900_0000055 | |||
| 1421 | Ga0395900_0002303 | |||
| 1422 | Ga0395900_0007321 | |||
| 1423 | Ga0395900_0028412 | |||
| 1424 | Ga0395900_0134985 | |||
| 1425 | Ga0395900_0138938 | |||
| 1426 | Ga0395900_0250241 | |||
| 1427 | Ga0395898_0000119 | |||
| 1428 | Ga0395898_0001260 | |||
| 1429 | Ga0395898_0032722 | |||
| 1430 | Ga0395905_0000168 | |||
| 1431 | Ga0395905_0075175 | |||
| 1432 | Ga0395901_0000003 | |||
| 1433 | Ga0395901_0010491 | |||
| 1434 | Ga0395901_0019159 | |||
| 1435 | Ga0395901_0170239 | |||
| 1436 | Ga0395901_0194691 | |||
| 1437 | Ga0436361_0131139 | |||
| 1438 | Ga0439436_0000470 | |||
| 1439 | Ga0439436_0002954 | |||
| 1440 | Ga0439439_0002400 | |||
| 1441 | Ga0439447_002633 | |||
| 1442 | Ga0439447_012795 | |||
| 1443 | Ga0439461_0018568 | |||
| 1444 | Ga0439466_0003460 | |||
| 1445 | Ga0439465_0000108 | |||
| 1446 | Ga0439465_0007545 | |||
| 1447 | Ga0451853_4091276 | |||
| 1448 | Ga0439431_0004413 | |||
| 1449 | Ga0439433_0000895 | |||
| 1450 | Ga0439442_004394 | |||
| 1451 | Ga0439445_0001046 | |||
| 1452 | Ga0439445_0008898 | |||
| 1453 | Ga0439448_0001330 | |||
| 1454 | Ga0439432_003819 | |||
| 1455 | Ga0439432_010034 | |||
| 1456 | Ga0439449_0000245 | |||
| 1457 | Ga0439449_0001647 | |||
| 1458 | Ga0439449_0003981 | |||
| 1459 | Ga0439449_0004140 | |||
| 1460 | Ga0439452_000792 | |||
| 1461 | Ga0439452_005772 | |||
| 1462 | Ga0439457_001278 | |||
| 1463 | Ga0439457_029009 | |||
| 1464 | Ga0439462_0017172 | |||
| 1465 | Ga0450894_003722 | |||
| 1466 | Ga0450906_001265 | |||
| 1467 | Ga0450907_010923 | |||
| 1468 | Ga0439446_0010238 | |||
| 1469 | Ga0450908_000841 | |||
| 1470 | Ga0450909_003757 | |||
| 1471 | Ga0439434_0001099 | |||
| 1472 | Ga0439434_0006472 | |||
| 1473 | Ga0451577_0003100 | |||
| 1474 | Ga0451577_0025039 | |||
| 1475 | Ga0451577_0072441 | |||
| 1476 | Ga0451577_0078031 | |||
| 1477 | Ga0451577_0091835 | |||
| 1478 | Ga0466969_0002847 | |||
| 1479 | Ga0466969_0004757 | |||
| 1480 | Ga0466973_0009139 | |||
| 1481 | Ga0453683_0156859 | |||
| 1482 | Ga0466965_0001211 | |||
| 1483 | Ga0466965_0001863 | |||
| 1484 | Ga0466965_0032927 | |||
| 1485 | Ga0466966_0000032 | |||
| 1486 | Ga0466966_0002909 | |||
| 1487 | Ga0466966_0016532 | |||
| 1488 | Ga0466966_0063721 | |||
| 1489 | Ga0466961_0004925 | |||
| 1490 | Ga0466961_0116424 | |||
| 1491 | Ga0466963_0001953 | |||
| 1492 | Ga0466963_0015153 | |||
| 1493 | Ga0466964_0002026 | |||
| 1494 | Ga0466964_0039190 | |||
| 1495 | Ga0453684_0000005 | |||
| 1496 | Ga0453684_0000583 | |||
| 1497 | Ga0453684_0004902 | |||
| 1498 | Ga0453684_0005751 | |||
| 1499 | Ga0453684_0008183 | |||
| 1500 | Ga0453684_0116937 | |||
| 1501 | Ga0453684_0524355 | |||
| 1502 | Ga0466968_0005823 | |||
| 1503 | Ga0466970_0026347 | |||
| 1504 | Ga0466970_0091606 | |||
| 1505 | Ga0466957_0015351 | |||
| 1506 | Ga0466957_0047793 | |||
| 1507 | Ga0466957_0097795 | |||
| 1508 | Ga0466960_0010342 | |||
| 1509 | Ga0466959_0010040 | |||
| 1510 | Ga0466959_0014675 | |||
| 1511 | Ga0466959_0222376 | |||
| 1512 | Ga0451576_0000137 | |||
| 1513 | Ga0451576_0000738 | |||
| 1514 | Ga0451576_0001961 | |||
| 1515 | Ga0451576_0012728 | |||
| 1516 | Ga0451576_0052917 | |||
| 1517 | Ga0451576_0145389 | |||
| 1518 | Ga0466958_0001759 | |||
| 1519 | Ga0466958_0005164 | |||
| 1520 | Ga0466958_0009785 | |||
| 1521 | Ga0466958_0021413 | |||
| 1522 | Ga0466967_0343404 | |||
| 1523 | Ga0495627_007509 | |||
| 1524 | Ga0495592_0040557 | |||
| 1525 | Ga0495592_0052099 | |||
| 1526 | Ga0495592_0197290 | |||
| 1527 | Ga0495603_0001297 | |||
| 1528 | Ga0495603_0007952 | |||
| 1529 | Ga0495603_0009400 | |||
| 1530 | Ga0495590_0001947 | |||
| 1531 | Ga0495590_0060794 | |||
| 1532 | Ga0495591_006781 | |||
| 1533 | Ga0495629_0000369 | |||
| 1534 | Ga0495629_0004351 | |||
| 1535 | Ga0495629_0005165 | |||
| 1536 | Ga0495629_0014711 | |||
| 1537 | Ga0495629_0041923 | |||
| 1538 | Ga0495629_0049525 | |||
| 1539 | Ga0495638_0028169 | |||
| 1540 | Ga0495638_0074310 | |||
| 1541 | Ga0495641_0003603 | |||
| 1542 | Ga0495651_0009952 | |||
| 1543 | Ga0495651_0023058 | |||
| 1544 | Ga0495651_0196935 | |||
| 1545 | Ga0495651_0218439 | |||
| 1546 | Ga0495653_0006567 | |||
| 1547 | Ga0495653_0018833 | |||
| 1548 | Ga0495653_0023696 | |||
| 1549 | Ga0495653_0037748 | |||
| 1550 | Ga0495653_0092915 | |||
| 1551 | Ga0495653_0175644 | |||
| 1552 | Ga0495650_0004632 | |||
| 1553 | Ga0495650_0014058 | |||
| 1554 | Ga0495650_0017226 | |||
| 1555 | Ga0495650_0019000 | |||
| 1556 | Ga0495650_0027417 | |||
| 1557 | Ga0495580_0002054 | |||
| 1558 | Ga0495580_0005418 | |||
| 1559 | Ga0495580_0023500 | |||
| 1560 | Ga0495580_0070077 | |||
| 1561 | Ga0495580_0113459 | |||
| 1562 | Ga0495580_0149687 | |||
| 1563 | Ga0495580_0159856 | |||
| 1564 | Ga0495582_0002285 | |||
| 1565 | Ga0495582_0052398 | |||
| 1566 | Ga0495605_0002196 | |||
| 1567 | Ga0495605_0004899 | |||
| 1568 | Ga0495605_0010712 | |||
| 1569 | Ga0495605_0016596 | |||
| 1570 | Ga0495639_0009089 | |||
| 1571 | Ga0495662_0024751 | |||
| 1572 | Ga0495662_0077914 | |||
| 1573 | Ga0495664_0001019 | |||
| 1574 | Ga0495664_0015601 | |||
| 1575 | Ga0495664_0083586 | |||
| 1576 | Ga0495596_0005025 | |||
| 1577 | Ga0495596_0039764 | |||
| 1578 | Ga0495596_0073211 | |||
| 1579 | Ga0495583_0003894 | |||
| 1580 | Ga0495583_0006862 | |||
| 1581 | Ga0495583_0013530 | |||
| 1582 | Ga0495606_0012257 | |||
| 1583 | Ga0495606_0039182 | |||
| 1584 | Ga0495606_0072098 | |||
| 1585 | Ga0495606_0083444 | |||
| 1586 | Ga0495606_0099160 | |||
| 1587 | Ga0495606_0138973 | |||
| 1588 | Ga0495608_0007446 | |||
| 1589 | Ga0495608_0042458 | |||
| 1590 | Ga0495610_0019946 | |||
| 1591 | Ga0495616_0002124 | |||
| 1592 | Ga0495616_0073811 | |||
| 1593 | Ga0495618_0001663 | |||
| 1594 | Ga0495618_0011271 | |||
| 1595 | Ga0495618_0014447 | |||
| 1596 | Ga0495620_0011576 | |||
| 1597 | Ga0495620_0036745 | |||
| 1598 | Ga0495628_0002617 | |||
| 1599 | Ga0495628_0027908 | |||
| 1600 | Ga0495628_0033448 | |||
| 1601 | Ga0495628_0037443 | |||
| 1602 | Ga0495628_0049906 | |||
| 1603 | Ga0495628_0174155 | |||
| 1604 | Ga0495630_0020532 | |||
| 1605 | Ga0495630_0044761 | |||
| 1606 | Ga0495630_0235052 | |||
| 1607 | Ga0495631_0001388 | |||
| 1608 | Ga0495637_0007495 | |||
| 1609 | Ga0495648_0012380 | |||
| 1610 | Ga0495648_0021277 | |||
| 1611 | Ga0495648_0022600 | |||
| 1612 | Ga0495648_0044551 | |||
| 1613 | Ga0495648_0142954 | |||
| 1614 | Ga0495663_0002160 | |||
| 1615 | Ga0495666_0004704 | |||
| 1616 | Ga0495666_0005594 | |||
| 1617 | Ga0495666_0006495 | |||
| 1618 | Ga0495642_0006746 | |||
| 1619 | Ga0495642_0021025 | |||
| 1620 | Ga0495652_0029140 | |||
| 1621 | Ga0495652_0033248 | |||
| 1622 | Ga0495654_0018415 | |||
| 1623 | Ga0495654_0028146 | |||
| 1624 | Ga0495654_0081073 | |||
| 1625 | Ga0495665_0005886 | |||
| 1626 | Ga0495665_0021328 | |||
| 1627 | Ga0495665_0025686 | |||
| 1628 | Ga0495640_0002933 | |||
| 1629 | Ga0495640_0005861 | |||
| 1630 | Ga0495640_0026287 | |||
| 1631 | Ga0495640_0113370 | |||
| 1632 | Ga0495586_0000633 | |||
| 1633 | Ga0495586_0031997 | |||
| 1634 | Ga0495586_0092520 | |||
| 1635 | Ga0495587_0018778 | |||
| 1636 | Ga0495621_0009096 | |||
| 1637 | Ga0495597_0002648 | |||
| 1638 | Ga0495597_0016569 | |||
| 1639 | Ga0495597_0044837 | |||
| 1640 | Ga0495645_0003050 | |||
| 1641 | Ga0495645_0011091 | |||
| 1642 | Ga0495645_0045339 | |||
| 1643 | Ga0495645_0122181 | |||
| 1644 | Ga0495622_0004831 | |||
| 1645 | Ga0495622_0016921 | |||
| 1646 | Ga0495667_0017947 | |||
| 1647 | Ga0495667_0022585 | |||
| 1648 | Ga0495668_0011933 | |||
| 1649 | Ga0495668_0041562 | |||
| 1650 | Ga0495634_0009735 | |||
| 1651 | Ga0495634_0011188 | |||
| 1652 | Ga0495634_0022513 | |||
| 1653 | Ga0495625_0000279 | |||
| 1654 | Ga0495625_0147991 | |||
| 1655 | Ga0495625_0155597 | |||
| 1656 | Ga0495635_0013627 | |||
| 1657 | Ga0495635_0034889 | |||
| 1658 | Ga0495635_0040500 | |||
| 1659 | Ga0495635_0102843 | |||
| 1660 | Ga0495661_0005519 | |||
| 1661 | Ga0495661_0010232 | |||
| 1662 | Ga0495588_0008649 | |||
| 1663 | Ga0495588_0025253 | |||
| 1664 | Ga0495588_0035503 | |||
| 1665 | Ga0495599_0015425 | |||
| 1666 | Ga0495599_0023267 | |||
| 1667 | Ga0495599_0032828 | |||
| 1668 | Ga0495599_0048735 | |||
| 1669 | Ga0495599_0131437 | |||
| 1670 | Ga0495623_0007011 | |||
| 1671 | Ga0495623_0010956 | |||
| 1672 | Ga0495623_0021667 | |||
| 1673 | Ga0495623_0135016 | |||
| 1674 | Ga0495646_0001320 | |||
| 1675 | Ga0495646_0011483 | |||
| 1676 | Ga0495646_0021365 | |||
| 1677 | Ga0495646_0023967 | |||
| 1678 | Ga0495646_0034617 | |||
| 1679 | Ga0495646_0053517 | |||
| 1680 | Ga0495646_0076910 | |||
| 1681 | Ga0495658_0132556 | |||
| 1682 | Ga0495669_0035962 | |||
| 1683 | Ga0495669_0084553 | |||
| 1684 | Ga0495669_0102943 | |||
| 1685 | Ga0495613_0002624 | |||
| 1686 | Ga0495613_0010806 | |||
| 1687 | Ga0495624_0009914 | |||
| 1688 | Ga0495624_0010314 | |||
| 1689 | Ga0495624_0016074 | |||
| 1690 | Ga0495624_0016284 | |||
| 1691 | Ga0495624_0017769 | |||
| 1692 | Ga0495624_0053963 | |||
| 1693 | Ga0495624_0121640 | |||
| 1694 | Ga0495624_0179046 | |||
| 1695 | Ga0495670_0064305 | |||
| 1696 | Ga0495670_0089064 | |||
| 1697 | Ga0495671_0002320 | |||
| 1698 | Ga0495671_0016957 | |||
| 1699 | Ga0495671_0038591 | |||
| 1700 | Ga0495671_0076100 | |||
| 1701 | Ga0495649_0001567 | |||
| 1702 | Ga0495649_0004421 | |||
| 1703 | Ga0495649_0068416 | |||
| 1704 | Ga0495649_0079163 | |||
| 1705 | Ga0495649_0083897 | |||
| 1706 | Ga0495589_0005849 | |||
| 1707 | Ga0495589_0010940 | |||
| 1708 | Ga0495589_0082331 | |||
| 1709 | Ga0495600_0013215 | |||
| 1710 | Ga0495600_0032687 | |||
| 1711 | Ga0495600_0044562 | |||
| 1712 | Ga0495600_0143413 | |||
| 1713 | Ga0495660_0138054 | |||
| 1714 | Ga0495581_0005698 | |||
| 1715 | Ga0495581_0006202 | |||
| 1716 | Ga0495581_0006589 | |||
| 1717 | Ga0495581_0023067 | |||
| 1718 | Ga0495604_0005007 | |||
| 1719 | Ga0495604_0036700 | |||
| 1720 | Ga0495604_0037578 | |||
| 1721 | Ga0495604_0126928 | |||
| 1722 | Ga0495674_0022004 | |||
| 1723 | Ga0495674_0023710 | |||
| 1724 | Ga0495674_0036272 | |||
| 1725 | Ga0495674_0045553 | |||
| 1726 | Ga0495674_0082240 | |||
| 1727 | Ga0495674_0094523 | |||
| 1728 | Ga0495674_0294906 | |||
| 1729 | Ga0495672_0003028 | |||
| 1730 | Ga0495676_0017431 | |||
| 1731 | Ga0495676_0038899 | |||
| 1732 | Ga0495676_0046582 | |||
| 1733 | Ga0495676_0105211 | |||
| 1734 | Ga0495680_0007394 | |||
| 1735 | Ga0495680_0021369 | |||
| 1736 | Ga0495680_0035715 | |||
| 1737 | Ga0495680_0086575 | |||
| 1738 | Ga0495683_0002898 | |||
| 1739 | Ga0495683_0006607 | |||
| 1740 | Ga0495683_0075182 | |||
| 1741 | Ga0495683_0084673 | |||
| 1742 | Ga0495687_000011 | |||
| 1743 | Ga0495687_006437 | |||
| 1744 | Ga0495687_017752 | |||
| 1745 | Ga0495687_060421 | |||
| 1746 | Ga0495675_0003779 | |||
| 1747 | Ga0495675_0024722 | |||
| 1748 | Ga0495675_0036826 | |||
| 1749 | Ga0495675_0132796 | |||
| 1750 | Ga0495679_000109 | |||
| 1751 | Ga0495679_003488 | |||
| 1752 | Ga0495673_0040365 | |||
| 1753 | Ga0495673_0051646 | |||
| 1754 | Ga0495673_0096997 | |||
| 1755 | Ga0495684_0110236 | |||
| 1756 | Ga0495684_0132016 | |||
| 1757 | Ga0495686_0000014 | |||
| 1758 | Ga0495686_0014261 | |||
| 1759 | Ga0495593_0001995 | |||
| 1760 | Ga0495593_0004554 | |||
| 1761 | Ga0495593_0006696 | |||
| 1762 | Ga0495593_0010859 | |||
| 1763 | Ga0495593_0018130 | |||
| 1764 | Ga0495593_0025266 | |||
| 1765 | Ga0495602_0019497 | |||
| 1766 | Ga0495602_0027611 | |||
| 1767 | Ga0495614_0000770 | |||
| 1768 | Ga0495614_0006640 | |||
| 1769 | Ga0495614_0082923 | |||
| 1770 | Ga0495626_0017922 | |||
| 1771 | Ga0495626_0021549 | |||
| 1772 | Ga0495626_0049299 | |||
| 1773 | Ga0496100_0003845 | |||
| 1774 | Ga0496100_0009676 | |||
| 1775 | Ga0496100_0018508 | |||
| 1776 | Ga0496100_0039852 | |||
| 1777 | Ga0496100_0136746 | |||
| 1778 | Ga0496101_0006420 | |||
| 1779 | Ga0496101_0128488 | |||
| 1780 | Ga0496102_0001889 | |||
| 1781 | Ga0496102_0003852 | |||
| 1782 | Ga0496102_0021914 | |||
| 1783 | Ga0496102_0035899 | |||
| 1784 | Ga0496102_0048343 | |||
| 1785 | Ga0496102_0269160 | |||
| 1786 | Ga0496103_0006863 | |||
| 1787 | Ga0496103_0011673 | |||
| 1788 | Ga0496103_0019064 | |||
| 1789 | Ga0496103_0040992 | |||
| 1790 | Ga0496104_0028881 | |||
| 1791 | Ga0496104_0054037 | |||
| 1792 | Ga0496105_0008551 | |||
| 1793 | Ga0496105_0052227 | |||
| 1794 | Ga0496105_0107959 | |||
| 1795 | Ga0496105_0171307 | |||
| 1796 | Ga0496105_0173630 | |||
| 1797 | Ga0496105_0208750 | |||
| 1798 | Ga0496106_0000031 | |||
| 1799 | Ga0496106_0019590 | |||
| 1800 | Ga0496106_0089452 | |||
| 1801 | Ga0496107_0023185 | |||
| 1802 | Ga0496107_0085859 | |||
| 1803 | Ga0496107_0116962 | |||
| 1804 | Ga0496108_0232750 | |||
| 1805 | Ga0496109_0240207 | |||
| 1806 | Ga0496109_0281411 | |||
| 1807 | Ga0496110_0026740 | |||
| 1808 | Ga0496110_0156871 | |||
| 1809 | Ga0496111_0060199 | |||
| 1810 | Ga0496112_0008182 | |||
| 1811 | Ga0496112_0041577 | |||
| 1812 | Ga0496113_0011230 | |||
| 1813 | Ga0496113_0256718 | |||
| 1814 | Ga0496114_0001502 | |||
| 1815 | Ga0496114_0275292 | |||
| 1816 | Ga0496114_0318659 | |||
| 1817 | Ga0496115_0113660 | |||
| 1818 | Ga0496116_0012792 | |||
| 1819 | Ga0496116_0066210 | |||
| 1820 | Ga0496116_0104757 | |||
| 1821 | Ga0496117_0004561 | |||
| 1822 | Ga0496117_0008670 | |||
| 1823 | Ga0496117_0010958 | |||
| 1824 | Ga0496117_0011477 | |||
| 1825 | Ga0496117_0017799 | |||
| 1826 | Ga0496117_0064264 | |||
| 1827 | Ga0496118_0001983 | |||
| 1828 | Ga0496118_0002651 | |||
| 1829 | Ga0496118_0013236 | |||
| 1830 | Ga0496118_0017009 | |||
| 1831 | Ga0496118_0020524 | |||
| 1832 | Ga0496118_0022762 | |||
| 1833 | Ga0496118_0027358 | |||
| 1834 | Ga0496118_0043345 | |||
| 1835 | Ga0496118_0056034 | |||
| 1836 | Ga0496118_0104184 | |||
| 1837 | Ga0496118_0131107 | |||
| 1838 | Ga0496121_0000305 | |||
| 1839 | Ga0496121_0006229 | |||
| 1840 | Ga0496121_0028228 | |||
| 1841 | Ga0496121_0074371 | |||
| 1842 | Ga0496121_0082136 | |||
| 1843 | Ga0496121_0156425 | |||
| 1844 | Ga0496122_0000217 | |||
| 1845 | Ga0496122_0026227 | |||
| 1846 | Ga0496123_0000057 | |||
| 1847 | Ga0496123_0028101 | |||
| 1848 | Ga0496123_0028452 | |||
| 1849 | Ga0496123_0126072 | |||
| 1850 | Ga0496124_0026584 | |||
| 1851 | Ga0496124_0031416 | |||
| 1852 | Ga0496124_0054648 | |||
| 1853 | Ga0496125_0032287 | |||
| 1854 | Ga0496126_0001240 | |||
| 1855 | Ga0496126_0003440 | |||
| 1856 | Ga0496126_0003523 | |||
| 1857 | Ga0496126_0016774 | |||
| 1858 | Ga0496126_0198119 | |||
| 1859 | Ga0496126_0244826 | |||
| 1860 | Ga0496126_0315125 | |||
| 1861 | Ga0495678_017996 | |||
| 1862 | Ga0495678_051418 | |||
| 1863 | Ga0495678_058272 | |||
| 1864 | Ga0495682_0007262 | |||
| 1865 | Ga0495682_0015318 | |||
| 1866 | Ga0495682_0060012 | |||
| 1867 | Ga0501225_0002703 | |||
| 1868 | Ga0501280_000651 | |||
| 1869 | nmdc:mga03683_11163_c1 | |||
| 1870 | nmdc:mga03683_25651_c1 | |||
| 1871 | nmdc:mga03683_45642_c1 | |||
| 1872 | nmdc:mga03683_51169_c1 | |||
| 1873 | nmdc:mga03683_53022_c1 | |||
| 1874 | nmdc:mga03683_80225_c1 | |||
| 1875 | nmdc:mga03n38_21763_c1 | |||
| 1876 | nmdc:mga03n38_24136_c1 | |||
| 1877 | nmdc:mga03n38_49718_c1 | |||
| 1878 | nmdc:mga00v17_126852_c1 | |||
| 1879 | nmdc:mga00v17_190727_c1 | |||
| 1880 | nmdc:mga0yw44_16735_c1 | |||
| 1881 | nmdc:mga0k408_116628_c1 | |||
| 1882 | nmdc:mga0k408_196920_c1 | |||
| 1883 | nmdc:mga0k408_61213_c1 | |||
| 1884 | nmdc:mga06z11_44049_c1 | |||
| 1885 | nmdc:mga04h51_31327_c1 | |||
| 1886 | nmdc:mga07m45_113912_c1 | |||
| 1887 | nmdc:mga07m45_143028_c1 | |||
| 1888 | nmdc:mga07m45_34458_c1 | |||
| 1889 | nmdc:mga07m45_356_c1 | |||
| 1890 | nmdc:mga07m45_8280_c1 | |||
| 1891 | nmdc:mga07m45_89697_c1 | |||
| 1892 | nmdc:mga0sz30_34877_c1 | |||
| 1893 | Ga0500610_0000451 | |||
| 1894 | Ga0500610_0001074 | |||
| 1895 | Ga0500643_001718 | |||
| 1896 | Ga0500583_0002376 | |||
| 1897 | Ga0500651_0000642 | |||
| 1898 | Ga0500569_023454 | |||
| 1899 | Ga0500571_000477 | |||
| 1900 | Ga0500592_003170 | |||
| 1901 | Ga0500593_000735 | |||
| 1902 | Ga0500594_0007251 | |||
| 1903 | Ga0500597_019885 | |||
| 1904 | Ga0500607_003250 | |||
| 1905 | Ga0500607_010629 | |||
| 1906 | Ga0500608_003396 | |||
| 1907 | Ga0500608_080724 | |||
| 1908 | Ga0500618_001179 | |||
| 1909 | Ga0500655_000925 | |||
| 1910 | Ga0500658_0000263 | |||
| 1911 | Ga0500658_0001281 | |||
| 1912 | Ga0500559_0001594 | |||
| 1913 | Ga0500559_0002800 | |||
| 1914 | Ga0500564_013191 | |||
| 1915 | Ga0500568_0001164 | |||
| 1916 | Ga0500568_0001787 | |||
| 1917 | Ga0500574_039308 | |||
| 1918 | Ga0500604_0000752 | |||
| 1919 | Ga0500616_0011322 | |||
| 1920 | Ga0500624_003981 | |||
| 1921 | Ga0500627_0004123 | |||
| 1922 | Ga0500634_0002263 | |||
| 1923 | Ga0500636_0015064 | |||
| 1924 | Ga0466962_0008411 | |||
| 1925 | Ga0466962_0016712 | |||
| 1926 | Ga0466962_0061442 | |||
| 1927 | Ga0466962_0070809 | |||
| 1928 | 2514046283 | |||
| 1929 | 2501071009 | |||
| 1930 | 2501078836 | |||
| 1931 | 2501413839 | |||
| 1932 | 2509129383 | |||
| 1933 | 2510249971 | |||
| 1934 | 2511089475 | |||
| 1935 | 2511094892 | |||
| 1936 | 2511104551 | |||
| 1937 | 2512347518 | |||
| 1938 | 2513227435 | |||
| 1939 | 2513551591 | |||
| 1940 | 2513560242 | |||
| 1941 | 2513962461 | |||
| 1942 | 2515679422 | |||
| 1943 | 2515690480 | |||
| 1944 | 2516016996 | |||
| 1945 | 2519457891 | |||
| 1946 | 2527079139 | |||
| 1947 | 2548846186 | |||
| 1948 | 2563061899 | |||
| 1949 | 2585295192 | |||
| 1950 | 2599624543 | |||
| 1951 | 2599672595 | |||
| 1952 | 2599683595 | |||
| 1953 | 2599694204 | |||
| 1954 | 2599737023 | |||
| 1955 | 2599742865 | |||
| 1956 | 2600204983 | |||
| 1957 | 2600814623 | |||
| 1958 | 2643975203 | |||
| 1959 | 2644163141 | |||
| 1960 | 2644328106 | |||
| 1961 | 2644398585 | |||
| 1962 | 2644468670 | |||
| 1963 | 2676741972 | |||
| 1964 | 2713478265 | |||
| 1965 | 2719639129 | |||
| 1966 | 2735816181 | |||
| 1967 | 2738720157 | |||
| 1968 | 2738820116 | |||
| 1969 | 2738832596 | |||
| 1970 | 2738874123 | |||
| 1971 | 2738881701 | |||
| 1972 | 2739185753 | |||
| 1973 | 2739220721 | |||
| 1974 | 2739279356 | |||
| 1975 | 2746092230 | |||
| 1976 | 2746095271 | |||
| 1977 | 2753568824 | |||
| 1978 | 2792833011 | |||
| 1979 | 2808971581 | |||
| 1980 | 2809006410 | |||
| 1981 | 2809013672 | |||
| 1982 | 2817260070 | |||
| 1983 | 2817277734 | |||
| 1984 | 2817456853 | |||
| 1985 | 2819595955 | |||
| 1986 | 2819620873 | |||
| 1987 | 2819632525 | |||
| 1988 | 2831266895 | |||
| 1989 | 2838056954 | |||
| 1990 | 2842331332 | |||
| 1991 | 2842355672 | |||
| 1992 | 2842462024 | |||
| 1993 | 2842678772 | |||
| 1994 | 2842735573 | |||
| 1995 | 2842751331 | |||
| 1996 | 2856289142 | |||
| 1997 | 2857363488 | |||
| 1998 | 2863421566 | |||
| 1999 | 2870069008 | |||
| 2000 | 2881105141 | |||
| 2001 | 2883094751 | |||
| 2002 | 2885192875 | |||
| 2003 | 2885199050 | |||
| 2004 | 2885212687 | |||
| 2005 | 2885277302 | |||
| 2006 | 2891634731 | |||
| 2007 | 2899925304 | |||
| 2008 | 2900636243 | |||
| 2009 | 2902683440 | |||
| 2010 | 2904456458 | |||
| 2011 | 2904460679 | |||
| 2012 | 2904483966 | |||
| 2013 | 2904548408 | |||
| 2014 | 2904565747 | |||
| 2015 | 2904572790 | |||
| 2016 | 2904618883 | |||
| 2017 | 2919464400 | |||
| 2018 | 2919529914 | |||
| 2019 | 2921643715 | |||
| 2020 | 2928038574 | |||
| 2021 | 2928045821 | |||
| 2022 | 2928053438 | |||
| 2023 | 2928067043 | |||
| 2024 | 2928071057 | |||
| 2025 | 2928085001 | |||
| 2026 | 2928109675 | |||
| 2027 | 2928136871 | |||
| 2028 | 2928159856 | |||
| 2029 | 2928164104 | |||
| 2030 | 2928173367 | |||
| 2031 | 2928506399 | |||
| 2032 | 2928538687 | |||
| 2033 | 2929163805 | |||
| 2034 | 2929524888 | |||
| 2035 | 2945912459 | |||
| 2036 | 2945935425 | |||
| 2037 | 2945947233 | |||
| 2038 | 2945976991 | |||
| 2039 | 2945985222 | |||
| 2040 | 2954771966 | |||
| 2041 | 2981994294 | |||
| 2042 | 2990704026 | |||
| 2043 | 642422183 | |||
| 2044 | 642417462 | |||
| 2045 | 642594292 | |||
| 2046 | 642620297 | |||
| 2047 | 8003957509 | |||
| 2048 | 8018848983 | |||
| 2049 | 8020813039 | |||
| 2050 | 8020944843 | |||
| 2051 | 8020949716 | |||
| 2052 | 8020959928 | |||
| 2053 | 8021126730 | |||
| 2054 | 8039099204 | |||
| 2055 | 8040172292 | |||
| 2056 | 8040175757 | |||
| 2057 | 8055266704 | |||
| 2058 | 8055303920 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4klc-assembly1.cif.gz_B | e343d/f110a double mutant of human ferrochelatase | 0.9106 | 16 | 341 |
| 2pnj-assembly1.cif.gz_A | crystal structure of human ferrochelatase mutant with phe 337 replaced by ala | 0.9092 | 14 | 341 |
| 2pnj-assembly1.cif.gz_B | crystal structure of human ferrochelatase mutant with phe 337 replaced by ala | 0.9062 | 16 | 341 |
| 3aqi-assembly1.cif.gz_B | h240a variant of human ferrochelatase | 0.8989 | 14 | 341 |
| 2po7-assembly1.cif.gz_B | crystal structure of human ferrochelatase mutant with his 341 replaced by cys | 0.8981 | 14 | 341 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P23871_188_298_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9849 | 209 | 317 | 3.40.50.1400 |
| af_P23871_6_161_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9793 | 18 | 176 | 3.40.50.1400 |
| af_P23871_6_250_3.40.605.10 | Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 | 0.977 | 18 | 269 | 3.40.605.10 |
| af_P23871_6_161_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.967 | 18 | 176 | 3.40.50.1400 |
| af_Q8ID58_27_285_3.40.50.1400 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9656 | 18 | 278 | 3.40.50.1400 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P2EL70-F1-model_v4 | Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) | 0.9922 | 20 | 347 |
GO:0004325
GO:0005737 GO:0006783 GO:0046872 |
| AF-A0A0G4JB43-F1-model_v4 | Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) | 0.9919 | 1 | 348 |
GO:0004325
GO:0005737 GO:0006783 GO:0046872 |
| AF-A0A2M7FPN8-F1-model_v4 | Ferrochelatase (EC 4.98.1.1) | 0.9908 | 42 | 347 |
GO:0004325
GO:0005737 GO:0006783 |
| AF-A0A259PFH2-F1-model_v4 | coproporphyrin ferrochelatase (EC 4.99.1.9) | 0.9894 | 90 | 346 |
GO:0004325
GO:0006783 |
| AF-A0A537GB29-F1-model_v4 | Ferrochelatase | 0.9876 | 18 | 121 |
GO:0004325
GO:0006783 |