F488588

General Info

Members Datasets Scaffolds Average Seq Length
1029 500 2058 349

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237166|2514046283
Length 397
Sequence MRGVFRLANWPNGQVSPSDRAAIMSFSPLRAAPLRGFCLLPMRFDLERPLQSATAHRVAVLLINLGTPDAPTPRAVRRYLAQFLSDPRVVEIPAFVWQIILRLFILPFRGVASAKKYASVWMPEGSPLRVHTQKQVEGLRHLLHLNDYTVIVDYAMRYGTPDIPAMLNQLKLAGAERILLMPMYPQYSSSTTATAFDDAFAALKRMRNQPEIRTVRQYADHPAYIAALAAQVNHYWHTHGRPDFAAGDKLVLSFHGVPKRTLDLGDPYHDQCQQTASLLMHALGLTSVECRVTFQSRFGKAEWLQPYTAPTLKELGAAGVHRADVFCPGFTADCLETIEEIGMEVRDEFVHAGGKVFHAIPCLNAAPAWIAALGEIVAQHLQGWPVQAVAPQSASVA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
31 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
90 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
154 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
155 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
156 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
157 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
158 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
159 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
185 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
186 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
187 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
188 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
193 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
194 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
199 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
200 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
201 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
202 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
203 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
206 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
230 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
266 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
282 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
283 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
296 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
299 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
300 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
301 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
302 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
305 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
311 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
312 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
313 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
314 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
317 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
318 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
319 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
332 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
333 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
334 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
335 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
336 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
337 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
345 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
346 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
347 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
348 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
349 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
350 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
351 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
352 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
353 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
354 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
355 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
356 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
357 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
358 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
359 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
360 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
361 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
362 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
363 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
364 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
365 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
366 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
367 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
368 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
369 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
370 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
371 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
372 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
373 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
374 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
375 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
376 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
377 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
378 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
379 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
380 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
381 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
382 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
383 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
384 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
385 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
386 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
387 2519103095 Burkholderia sp. KJ006 Isolate Nodule
388 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
389 2547132512 Azospira oryzae 6a3 Isolate Unclassified
390 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
391 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
392 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
393 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
394 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
395 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
396 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
397 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
398 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
399 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
400 2643221593 Lysobacter sp. Root690 Isolate Unclassified
401 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
402 2643221658 Variovorax sp. Root411 Isolate Unclassified
403 2643221672 Variovorax sp. Root434 Isolate Unclassified
404 2643221683 Variovorax sp. Root473 Isolate Unclassified
405 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
406 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
407 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
408 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
409 2738541277 Variovorax sp. GV051 Isolate Unclassified
410 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
411 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
412 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
413 2738541307 Variovorax sp. GV008 Isolate Unclassified
414 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
415 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
416 2738543019 Variovorax sp. GV040 Isolate Unclassified
417 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
418 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
419 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
420 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
421 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
422 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
423 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
424 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
425 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
426 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
427 2818991446 Variovorax sp. 1180 Isolate Unclassified
428 2818991450 Burkholderia sp. 604 Isolate Unclassified
429 2818991452 Burkholderia cepacia 561 Isolate Unclassified
430 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
431 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
432 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
433 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
434 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
435 2842677519 Variovorax sp. R-72495 Isolate Unclassified
436 2842733646 Variovorax sp. R-72446 Isolate Unclassified
437 2842747753 Variovorax sp. R-72060 Isolate Unclassified
438 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
439 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
440 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
441 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
442 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
443 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
444 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
445 2885198086 Variovorax sp. 679 Isolate Unclassified
446 2885211737 Variovorax sp. 553 Isolate Unclassified
447 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
448 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
449 2899924645 Variovorax sp. 369 Isolate Unclassified
450 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
451 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
452 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
453 2904456579 Variovorax sp. 2002 Isolate Unclassified
454 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
455 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
456 2904564687 Burkholderia sp. 571 Isolate Unclassified
457 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
458 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
459 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
460 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
461 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
462 2928037797 Variovorax sp. 1126 Isolate Unclassified
463 2928044640 Variovorax sp. 1128 Isolate Unclassified
464 2928051484 Variovorax sp. 1133 Isolate Unclassified
465 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
466 2928070936 Variovorax gossypii 1167 Isolate Unclassified
467 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
468 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
469 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
470 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
471 2928163908 Burkholderia sp. 567 Isolate Unclassified
472 2928170801 Burkholderia sp. 572 Isolate Unclassified
473 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
474 2928536128 Burkholderia sola 565 Isolate Unclassified
475 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
476 2929520902 Variovorax beijingensis 502 Isolate Unclassified
477 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
478 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
479 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
480 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
481 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
482 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
483 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
484 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
485 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
486 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
487 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
488 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
489 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
490 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
491 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
492 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
493 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
494 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
495 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
496 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
497 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
498 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
499 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
500 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.69
Metatranscriptomes 0.58
Isolates 12.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.16
Nodule 2.24
Rhizoplane 5.15
Rhizosphere 58.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003397 3300001979 Bacteria 7006
2 JGI24740J21852_10007221 3300001979 Bacteria 4529
3 JGI24739J22299_10002664 3300001989 Bacteria 6874
4 JGI24739J22299_10005575 3300001989 Bacteria 4773
5 JGI24739J22299_10035620 3300001989 Bacteria 1686
6 JGI24737J22298_10023739 3300001990 Bacteria 1944
7 JGI24735J21928_10002378 3300002067 Bacteria 6546
8 JGI24735J21928_10049111 3300002067 Bacteria 1220
9 JGI24738J21930_10001505 3300002075 Bacteria 6459
10 JGI25155J39150_1000724 3300002704 Bacteria 5734
11 JGI25156J39149_1000504 3300002705 Bacteria 22869
12 JGI25156J39149_1000735 3300002705 Bacteria 17392
13 JGI25156J39149_1002542 3300002705 Bacteria 6479
14 JGI25152J39213_1000915 3300002773 Bacteria 14469
15 JGI25152J39213_1001246 3300002773 Bacteria 11617
16 JGI25150J39212_1000991 3300002774 Bacteria 8877
17 JGI25150J39212_1002008 3300002774 Bacteria 5305
18 JGI25159J45721_1001447 3300002987 Bacteria 9805
19 JGI25151J46595_10002025 3300003187 Bacteria 12673
20 JGI25151J46595_10002925 3300003187 Bacteria 9778
21 JGI25151J46595_10003922 3300003187 Bacteria 8027
22 JGI25151J46595_10008898 3300003187 Bacteria 4792
23 JGI25165J46597_1001196 3300003214 Bacteria 15743
24 JGI25153J46596_10001486 3300003215 Bacteria 13976
25 JGI25153J46596_10004452 3300003215 Bacteria 7551
26 rootL2_10002479 3300003322 Bacteria 16465
27 rootL2_10084409 3300003322 Bacteria 1779
28 JGI25160J50197_1000171 3300003354 Bacteria 55915
29 JGI25160J50197_1001502 3300003354 Bacteria 11587
30 JGI25160J50197_1006483 3300003354 Bacteria 4729
31 JGI25161J50226_1001006 3300003374 Bacteria 9840
32 JGI25161J50226_1002287 3300003374 Bacteria 5010
33 Ga0006562J51391_1095652 3300003578 Bacteria 5267
34 Ga0006562J51391_1095654 3300003578 Bacteria 2270
35 Ga0055533_1000292 3300003756 Bacteria 25514
36 Ga0055532_1000001 3300003758 Bacteria 1119836
37 Ga0055532_1002025 3300003758 Bacteria 4653
38 Ga0055532_1002081 3300003758 Bacteria 4552
39 Ga0055532_1002399 3300003758 Bacteria 3929
40 Ga0055527_1000014 3300003760 Bacteria 289449
41 Ga0055527_1001374 3300003760 Bacteria 5199
42 Ga0055535_1000001 3300003761 Bacteria 1119836
43 Ga0055535_1000998 3300003761 Bacteria 18248
44 Ga0055535_1002924 3300003761 Bacteria 5304
45 Ga0055535_1002982 3300003761 Bacteria 5199
46 Ga0055542_1000001 3300003762 Bacteria 1119836
47 Ga0055542_1000004 3300003762 Bacteria 553532
48 Ga0055542_1001017 3300003762 Bacteria 17787
49 Ga0055542_1002094 3300003762 Bacteria 7418
50 Ga0055529_1000001 3300003763 Bacteria 826680
51 Ga0055529_1001769 3300003763 Bacteria 5337
52 Ga0055526_1000649 3300003771 Bacteria 26986
53 Ga0055526_1002772 3300003771 Bacteria 11617
54 Ga0055526_1004608 3300003771 Bacteria 8220
55 Ga0055537_1000390 3300003773 Bacteria 29440
56 Ga0055537_1001113 3300003773 Bacteria 11617
57 Ga0055524_1001840 3300003775 Bacteria 11617
58 Ga0055536_1001135 3300003781 Bacteria 16683
59 Ga0055536_1001267 3300003781 Bacteria 15565
60 Ga0055536_1002880 3300003781 Bacteria 9461
61 Ga0055534_1000349 3300003784 Bacteria 29554
62 Ga0055534_1001367 3300003784 Bacteria 9769
63 Ga0055534_1006607 3300003784 Bacteria 2895
64 Ga0055528_1000914 3300003790 Bacteria 19888
65 Ga0055528_1002082 3300003790 Bacteria 11117
66 Ga0055530_10001555 3300003791 Bacteria 16471
67 Ga0055540_1000996 3300003792 Bacteria 18262
68 Ga0055540_1003629 3300003792 Bacteria 7362
69 Ga0055540_1003698 3300003792 Bacteria 7248
70 Ga0055540_1004049 3300003792 Bacteria 6808
71 Ga0055540_1008591 3300003792 Bacteria 3661
72 Ga0055531_10001175 3300003794 Bacteria 20153
73 Ga0055531_10004876 3300003794 Bacteria 7995
74 Ga0055531_10021333 3300003794 Bacteria 2516
75 Ga0058692_1002599 3300003856 Bacteria 5962
76 Ga0055543_1002168 3300004625 Bacteria 6752
77 Ga0055543_1002259 3300004625 Bacteria 6516
78 Ga0065165_1001193 3300005262 Bacteria 30041
79 Ga0065165_1003400 3300005262 Bacteria 11243
80 Ga0065714_10008370 3300005288 Bacteria 2574
81 Ga0065704_10072545 3300005289 Bacteria 8347
82 Ga0070658_10002647 3300005327 Bacteria 14905
83 Ga0070658_10014898 3300005327 Bacteria 6228
84 Ga0070658_10265732 3300005327 Bacteria 1458
85 Ga0070666_10057749 3300005335 Bacteria 2623
86 Ga0068868_100081982 3300005338 Bacteria 2587
87 Ga0070660_100000032 3300005339 Bacteria 85304
88 Ga0070660_100002402 3300005339 Bacteria 12862
89 Ga0070661_100237510 3300005344 Bacteria 1402
90 Ga0070659_100000355 3300005366 Bacteria 34908
91 Ga0070659_100304392 3300005366 Bacteria 1330
92 Ga0070667_100050240 3300005367 Bacteria 3514
93 Ga0070663_100009295 3300005455 Bacteria 6083
94 Ga0070678_100084625 3300005456 Bacteria 2415
95 Ga0070678_100109415 3300005456 Bacteria 2159
96 Ga0070678_100142288 3300005456 Bacteria 1921
97 Ga0070662_100017863 3300005457 Bacteria 4787
98 Ga0070662_100267055 3300005457 Bacteria 1380
99 Ga0068853_100020864 3300005539 Bacteria 5450
100 Ga0068853_100081717 3300005539 Bacteria 2830
101 Ga0070665_100385058 3300005548 Bacteria 1410
102 Ga0068855_100009319 3300005563 Bacteria 11857
103 Ga0068855_100022698 3300005563 Bacteria 7520
104 Ga0068855_100424737 3300005563 Bacteria 1453
105 Ga0070664_100029930 3300005564 Bacteria 4540
106 Ga0068852_100003043 3300005616 Bacteria 11665
107 Ga0068852_100136933 3300005616 Bacteria 2261
108 Ga0068859_100253636 3300005617 Bacteria 1850
109 Ga0068862_100153601 3300005844 Bacteria 2050
110 Ga0075368_10007239 3300006042 Bacteria 3911
111 Ga0075363_100020228 3300006048 Bacteria 3336
112 Ga0075363_100033095 3300006048 Bacteria 2690
113 Ga0075363_100182109 3300006048 Bacteria 1196
114 Ga0075364_10008450 3300006051 Bacteria 6154
115 Ga0075364_10133357 3300006051 Bacteria 1668
116 Ga0075362_10007125 3300006177 Bacteria 4212
117 Ga0075362_10030423 3300006177 Bacteria 2331
118 Ga0075362_10031860 3300006177 Bacteria 2284
119 Ga0075362_10033809 3300006177 Bacteria 2225
120 Ga0075362_10078284 3300006177 Bacteria 1520
121 Ga0075367_10023801 3300006178 Bacteria 3450
122 Ga0075369_10048964 3300006186 Bacteria 1824
123 Ga0075369_10069478 3300006186 Bacteria 1549
124 Ga0075366_10003695 3300006195 Bacteria 8120
125 Ga0075366_10006163 3300006195 Bacteria 6542
126 Ga0075366_10087818 3300006195 Bacteria 1862
127 Ga0075370_10001351 3300006353 Bacteria 10561
128 Ga0075370_10001937 3300006353 Bacteria 9340
129 Ga0075370_10031089 3300006353 Bacteria 2980
130 Ga0075370_10040569 3300006353 Bacteria 2626
131 Ga0075370_10128971 3300006353 Bacteria 1475
132 Ga0068871_100223272 3300006358 Bacteria 1633
133 Ga0097620_100253623 3300006931 Bacteria 1850
134 Ga0099826_10030220 3300006948 Bacteria 3939
135 Ga0105251_10000097 3300009011 Bacteria 85550
136 Ga0105251_10004896 3300009011 Bacteria 8933
137 Ga0105251_10076755 3300009011 Bacteria 1550
138 Ga0105244_10001759 3300009036 Bacteria 17026
139 Ga0105244_10050125 3300009036 Bacteria 2130
140 Ga0105250_10006717 3300009092 Bacteria 4998
141 Ga0105240_10000656 3300009093 Bacteria 63756
142 Ga0105240_10008487 3300009093 Bacteria 14693
143 Ga0105240_10045631 3300009093 Bacteria 5558
144 Ga0105240_10081746 3300009093 Bacteria 3969
145 Ga0105240_10089914 3300009093 Bacteria 3754
146 Ga0105240_10345382 3300009093 Bacteria 1689
147 Ga0105243_10002439 3300009148 Bacteria 15527
148 Ga0105243_10004361 3300009148 Bacteria 11207
149 Ga0105243_10347035 3300009148 Bacteria 1362
150 Ga0105241_10129036 3300009174 Bacteria 2045
151 Ga0105242_10127949 3300009176 Bacteria 2188
152 Ga0105248_10036706 3300009177 Bacteria 5481
153 Ga0105248_10177643 3300009177 Bacteria 2399
154 Ga0105248_10179120 3300009177 Bacteria 2389
155 Ga0105237_10013204 3300009545 Bacteria 8665
156 Ga0105237_10057546 3300009545 Bacteria 3890
157 Ga0105237_10063269 3300009545 Bacteria 3698
158 Ga0105238_10037100 3300009551 Bacteria 4956
159 Ga0105238_10070714 3300009551 Bacteria 3488
160 Ga0105238_10244627 3300009551 Bacteria 1772
161 Ga0105239_10007406 3300010375 Bacteria 12591
162 Ga0105239_10036412 3300010375 Bacteria 5402
163 Ga0105246_10061294 3300011119 Bacteria 2617
164 Ga0105246_10352220 3300011119 Bacteria 1207
165 Ga0157373_10003547 3300013100 Bacteria 11784
166 Ga0157373_10053204 3300013100 Bacteria 2879
167 Ga0157371_10027247 3300013102 Bacteria 4147
168 Ga0157370_10000328 3300013104 Bacteria 59681
169 Ga0157370_10001149 3300013104 Bacteria 32991
170 Ga0157370_10055529 3300013104 Bacteria 3772
171 Ga0157370_10186502 3300013104 Bacteria 1926
172 Ga0157370_10193324 3300013104 Bacteria 1889
173 Ga0157369_10000206 3300013105 Bacteria 81958
174 Ga0157369_10000556 3300013105 Bacteria 49013
175 Ga0157369_10000953 3300013105 Bacteria 36714
176 Ga0157369_10387518 3300013105 Bacteria 1450
177 Ga0157374_10000370 3300013296 Bacteria 41402
178 Ga0163162_10010310 3300013306 Bacteria 9081
179 Ga0163162_10047011 3300013306 Bacteria 4326
180 Ga0157372_10003805 3300013307 Bacteria 16207
181 Ga0157372_10019343 3300013307 Bacteria 7336
182 Ga0182008_10001707 3300014497 Bacteria 14407
183 Ga0182008_10029056 3300014497 Bacteria 2794
184 Ga0157379_10120360 3300014968 Bacteria 2361
185 Ga0182006_1000990 3300015261 Bacteria 18649
186 Ga0182006_1030114 3300015261 Bacteria 2196
187 Ga0182007_10000150 3300015262 Bacteria 47210
188 Ga0182007_10000673 3300015262 Bacteria 19643
189 Ga0182007_10005814 3300015262 Bacteria 5362
190 Ga0182007_10016384 3300015262 Bacteria 2736
191 Ga0183362_10001 3300015683 Bacteria 2046624
192 Ga0183361_10012 3300016635 Bacteria 203395
193 Ga0163161_10000743 3300017792 Bacteria 25623
194 Ga0163161_10005081 3300017792 Bacteria 9158
195 Ga0163161_10011455 3300017792 Bacteria 6153
196 Ga0163161_10016751 3300017792 Bacteria 5122
197 Ga0197907_10707312 3300020069 Bacteria 4514
198 Ga0206354_11366513 3300020081 Bacteria 2607
199 Ga0206353_11314560 3300020082 Bacteria 2421
200 Ga0224712_10000022 3300022467 Bacteria 23225
201 Ga0209436_103577 3300025208 Bacteria 4075
202 Ga0209436_108792 3300025208 Bacteria 1976
203 Ga0209566_100216 3300025225 Bacteria 57945
204 Ga0209674_100005 3300025226 Bacteria 1708125
205 Ga0209674_100092 3300025226 Bacteria 172272
206 Ga0209674_101735 3300025226 Bacteria 5354
207 Ga0209672_100001 3300025228 Bacteria 2828210
208 Ga0209672_100028 3300025228 Bacteria 341962
209 Ga0209672_100038 3300025228 Bacteria 286731
210 Ga0209672_101148 3300025228 Bacteria 10893
211 Ga0209672_101654 3300025228 Bacteria 7273
212 Ga0209147_100001 3300025229 Bacteria 2384371
213 Ga0209147_100112 3300025229 Bacteria 145046
214 Ga0209147_100163 3300025229 Bacteria 90494
215 Ga0209147_100686 3300025229 Bacteria 17369
216 Ga0209147_102613 3300025229 Bacteria 4260
217 Ga0209563_104011 3300025230 Bacteria 2900
218 Ga0207427_103987 3300025231 Bacteria 2703
219 Ga0209258_100001 3300025242 Bacteria 2384269
220 Ga0209258_100022 3300025242 Bacteria 553584
221 Ga0209258_100109 3300025242 Bacteria 203881
222 Ga0209258_100112 3300025242 Bacteria 192884
223 Ga0207425_1000199 3300025245 Bacteria 48186
224 Ga0207425_1000595 3300025245 Bacteria 21041
225 Ga0207425_1002925 3300025245 Bacteria 5720
226 Ga0209148_1000003 3300025254 Bacteria 2384288
227 Ga0209148_1000034 3300025254 Bacteria 553584
228 Ga0209148_1000081 3300025254 Bacteria 273676
229 Ga0209148_1000997 3300025254 Bacteria 18101
230 Ga0209759_1000053 3300025256 Bacteria 212789
231 Ga0209759_1000074 3300025256 Bacteria 177152
232 Ga0209759_1000601 3300025256 Bacteria 34849
233 Ga0209129_1000023 3300025258 Bacteria 420646
234 Ga0209129_1000089 3300025258 Bacteria 177344
235 Ga0209129_1001975 3300025258 Bacteria 10674
236 Ga0209233_1000016 3300025261 Bacteria 907830
237 Ga0209565_1000288 3300025263 Bacteria 49295
238 Ga0209565_1000293 3300025263 Bacteria 48108
239 Ga0209565_1001947 3300025263 Bacteria 8104
240 Ga0209455_1000001 3300025272 Bacteria 2384278
241 Ga0209455_1000050 3300025272 Bacteria 373239
242 Ga0209455_1014935 3300025272 Bacteria 1732
243 Ga0209673_1000038 3300025273 Bacteria 312957
244 Ga0209673_1000265 3300025273 Bacteria 98501
245 Ga0209673_1000838 3300025273 Bacteria 40184
246 Ga0209673_1001258 3300025273 Bacteria 26126
247 Ga0209130_1000113 3300025284 Bacteria 130804
248 Ga0209130_1001550 3300025284 Bacteria 14636
249 Ga0209130_1004836 3300025284 Bacteria 4931
250 Ga0209675_1000127 3300025291 Bacteria 104257
251 Ga0209675_1000276 3300025291 Bacteria 49295
252 Ga0209675_1000887 3300025291 Bacteria 19242
253 Ga0209675_1002155 3300025291 Bacteria 10373
254 Ga0209676_1000005 3300025292 Bacteria 1076001
255 Ga0209676_1001480 3300025292 Bacteria 21721
256 Ga0209676_1003545 3300025292 Bacteria 9484
257 Ga0209676_1004910 3300025292 Bacteria 7202
258 Ga0209676_1009073 3300025292 Bacteria 4340
259 Ga0209676_1017071 3300025292 Bacteria 2586
260 Ga0209025_1000134 3300025294 Bacteria 194505
261 Ga0209025_1000484 3300025294 Bacteria 76831
262 Ga0209025_1001331 3300025294 Bacteria 33405
263 Ga0209025_1002208 3300025294 Bacteria 21511
264 Ga0209025_1009028 3300025294 Bacteria 7034
265 Ga0209564_1000053 3300025295 Bacteria 351452
266 Ga0209564_1000394 3300025295 Bacteria 78197
267 Ga0209564_1000698 3300025295 Bacteria 49135
268 Ga0209564_1006730 3300025295 Bacteria 6108
269 Ga0209564_1027441 3300025295 Bacteria 1849
270 Ga0209758_1000064 3300025297 Bacteria 311812
271 Ga0209758_1000622 3300025297 Bacteria 54385
272 Ga0209758_1014045 3300025297 Bacteria 4303
273 Ga0209050_1000007 3300025298 Bacteria 1187891
274 Ga0209050_1001433 3300025298 Bacteria 25685
275 Ga0209050_1011252 3300025298 Bacteria 4274
276 Ga0209256_1000115 3300025299 Bacteria 173607
277 Ga0209256_1000864 3300025299 Bacteria 37672
278 Ga0207426_1000001 3300025302 Bacteria 1341301
279 Ga0207426_1000031 3300025302 Bacteria 460699
280 Ga0207426_1000037 3300025302 Bacteria 442735
281 Ga0209051_1000009 3300025303 Bacteria 706778
282 Ga0209051_1000385 3300025303 Bacteria 62270
283 Ga0209051_1000781 3300025303 Bacteria 33617
284 Ga0209051_1001504 3300025303 Bacteria 19477
285 Ga0209051_1002109 3300025303 Bacteria 14875
286 Ga0209051_1002621 3300025303 Bacteria 12630
287 Ga0209051_1019996 3300025303 Bacteria 2903
288 Ga0209051_1053265 3300025303 Bacteria 1330
289 Ga0209257_1000011 3300025304 Bacteria 1112630
290 Ga0209257_1001057 3300025304 Bacteria 36450
291 Ga0209257_1003120 3300025304 Bacteria 14812
292 Ga0209257_1005156 3300025304 Bacteria 9429
293 Ga0207655_1013658 3300025728 Bacteria 4646
294 Ga0207713_1000305 3300025735 Bacteria 56170
295 Ga0207682_10034113 3300025893 Bacteria 2051
296 Ga0207680_10008834 3300025903 Bacteria 4966
297 Ga0207647_10000268 3300025904 Bacteria 42845
298 Ga0207647_10004135 3300025904 Bacteria 10770
299 Ga0207647_10008546 3300025904 Bacteria 7332
300 Ga0207647_10019591 3300025904 Bacteria 4548
301 Ga0207647_10027493 3300025904 Bacteria 3708
302 Ga0207647_10043031 3300025904 Bacteria 2828
303 Ga0207705_10000708 3300025909 Bacteria 27547
304 Ga0207705_10134982 3300025909 Bacteria 1839
305 Ga0207695_10005102 3300025913 Bacteria 17594
306 Ga0207695_10018782 3300025913 Bacteria 7979
307 Ga0207695_10099910 3300025913 Bacteria 2898
308 Ga0207695_10188464 3300025913 Bacteria 1981
309 Ga0207695_10373598 3300025913 Bacteria 1312
310 Ga0207671_10026696 3300025914 Bacteria 4323
311 Ga0207671_10059100 3300025914 Bacteria 2842
312 Ga0207671_10103198 3300025914 Bacteria 2162
313 Ga0207657_10000051 3300025919 Bacteria 109129
314 Ga0207657_10000131 3300025919 Bacteria 75479
315 Ga0207694_10019539 3300025924 Bacteria 5122
316 Ga0207694_10065076 3300025924 Bacteria 2842
317 Ga0207690_10000034 3300025932 Bacteria 149574
318 Ga0207709_10001032 3300025935 Bacteria 20578
319 Ga0207709_10001454 3300025935 Bacteria 16482
320 Ga0207711_10026135 3300025941 Bacteria 4897
321 Ga0207711_10031612 3300025941 Bacteria 4469
322 Ga0207711_10228248 3300025941 Bacteria 1705
323 Ga0207679_10015470 3300025945 Bacteria 5043
324 Ga0207667_10003149 3300025949 Bacteria 20416
325 Ga0207667_10009431 3300025949 Bacteria 11496
326 Ga0207667_10113941 3300025949 Bacteria 2787
327 Ga0207667_10202305 3300025949 Bacteria 2037
328 Ga0207640_10215795 3300025981 Bacteria 1465
329 Ga0207658_10047893 3300025986 Bacteria 3131
330 Ga0207658_10057051 3300025986 Bacteria 2901
331 Ga0207639_10007462 3300026041 Bacteria 7459
332 Ga0207639_10065918 3300026041 Bacteria 2812
333 Ga0207678_10002721 3300026067 Bacteria 16032
334 Ga0207678_10037514 3300026067 Bacteria 4214
335 Ga0207678_10262867 3300026067 Bacteria 1479
336 Ga0207674_10198781 3300026116 Bacteria 1954
337 Ga0207674_10369757 3300026116 Bacteria 1386
338 Ga0207683_10014003 3300026121 Bacteria 6839
339 Ga0207683_10056358 3300026121 Bacteria 3447
340 Ga0207698_10010500 3300026142 Bacteria 5958
341 Ga0207698_10111986 3300026142 Bacteria 2290
342 Ga0209371_1000090 3300027312 Bacteria 173119
343 Ga0209371_1001109 3300027312 Bacteria 19951
344 Ga0209282_1000334 3300027666 Bacteria 23330
345 Ga0207428_10351654 3300027907 Bacteria 1084
346 Ga0268266_10240987 3300028379 Bacteria 1669
347 Ga0268266_10335955 3300028379 Bacteria 1417
348 Ga0268265_10118263 3300028380 Bacteria 2178
349 Ga0268264_10171693 3300028381 Bacteria 1962
350 Ga0307515_10000028 3300028794 Bacteria 368467
351 Ga0307515_10024629 3300028794 Bacteria 10474
352 Ga0265338_10000113 3300028800 Bacteria 150993
353 Ga0268256_1000115 3300030500 Bacteria 116918
354 Ga0268256_1000921 3300030500 Bacteria 20306
355 Ga0307511_10000025 3300030521 Bacteria 112344
356 Ga0316177_1029429 3300030731 Bacteria 3928
357 Ga0316176_1080864 3300030732 Bacteria 2014
358 Ga0314311_1124028 3300030733 Bacteria 3356
359 Ga0316180_1012367 3300030736 Bacteria 2491
360 Ga0316182_1325098 3300030745 Bacteria 2859
361 Ga0265332_10000013 3300031238 Bacteria 250095
362 Ga0265325_10000262 3300031241 Bacteria 37299
363 Ga0265327_10000722 3300031251 Bacteria 51801
364 Ga0265327_10015860 3300031251 Bacteria 4831
365 Ga0265316_10000299 3300031344 Bacteria 55433
366 Ga0265316_10089534 3300031344 Bacteria 2348
367 Ga0307513_10116636 3300031456 Bacteria 2649
368 Ga0307509_10000006 3300031507 Bacteria 421538
369 Ga0307408_100002431 3300031548 Bacteria 13091
370 Ga0307408_100024541 3300031548 Bacteria 4118
371 Ga0307408_100114667 3300031548 Bacteria 2076
372 Ga0307408_100157292 3300031548 Bacteria 1801
373 Ga0307508_10059988 3300031616 Bacteria 3365
374 Ga0307514_10005152 3300031649 Bacteria 11799
375 Ga0307516_10003171 3300031730 Bacteria 21396
376 Ga0307405_10002949 3300031731 Bacteria 7680
377 Ga0307406_10001482 3300031901 Bacteria 12962
378 Ga0307406_10033625 3300031901 Bacteria 3140
379 Ga0307412_10000051 3300031911 Bacteria 150433
380 Ga0307412_10061531 3300031911 Bacteria 2524
381 Ga0307412_10194031 3300031911 Bacteria 1537
382 Ga0307416_100023777 3300032002 Bacteria 4456
383 Ga0307416_100462395 3300032002 Bacteria 1324
384 Ga0307414_10071445 3300032004 Bacteria 2503
385 Ga0307411_10020506 3300032005 Bacteria 3846
386 Ga0307411_10118497 3300032005 Bacteria 1910
387 Ga0307411_10207668 3300032005 Bacteria 1509
388 Ga0316583_10029627 3300032133 Bacteria 1951
389 Ga0307507_10088851 3300033179 Bacteria 2663
390 Ga0395899_0000008 3300037312 Bacteria 567572
391 Ga0395900_0000055 3300037418 Bacteria 219875
392 Ga0395900_0002303 3300037418 Bacteria 21211
393 Ga0395900_0007321 3300037418 Bacteria 11416
394 Ga0395900_0028412 3300037418 Bacteria 5728
395 Ga0395900_0134985 3300037418 Bacteria 2528
396 Ga0395900_0138938 3300037418 Bacteria 2489
397 Ga0395900_0250241 3300037418 Bacteria 1774
398 Ga0395898_0000119 3300037466 Bacteria 209937
399 Ga0395898_0001260 3300037466 Bacteria 37617
400 Ga0395898_0032722 3300037466 Bacteria 5191
401 Ga0395905_0000168 3300037471 Bacteria 107034
402 Ga0395905_0075175 3300037471 Bacteria 3166
403 Ga0395901_0000003 3300038443 Bacteria 701538
404 Ga0395901_0010491 3300038443 Bacteria 9383
405 Ga0395901_0019159 3300038443 Bacteria 6996
406 Ga0395901_0170239 3300038443 Bacteria 2285
407 Ga0395901_0194691 3300038443 Bacteria 2125
408 Ga0436361_0131139 3300039447 Bacteria 6535
409 Ga0439436_0000470 3300041404 Bacteria 10385
410 Ga0439436_0002954 3300041404 Bacteria 5157
411 Ga0439439_0002400 3300041406 Bacteria 3974
412 Ga0439447_002633 3300041407 Bacteria 6511
413 Ga0439447_012795 3300041407 Bacteria 2399
414 Ga0439461_0018568 3300041410 Bacteria 1362
415 Ga0439466_0003460 3300041411 Bacteria 6117
416 Ga0439465_0000108 3300041413 Bacteria 19156
417 Ga0439465_0007545 3300041413 Bacteria 3454
418 Ga0451853_4091276 3300041512 Bacteria 1447
419 Ga0439431_0004413 3300041997 Bacteria 3092
420 Ga0439433_0000895 3300041999 Bacteria 5940
421 Ga0439442_004394 3300042002 Bacteria 2799
422 Ga0439445_0001046 3300042004 Bacteria 5909
423 Ga0439445_0008898 3300042004 Bacteria 2358
424 Ga0439448_0001330 3300042005 Bacteria 6326
425 Ga0439432_003819 3300042006 Bacteria 5559
426 Ga0439432_010034 3300042006 Bacteria 3293
427 Ga0439449_0000245 3300042007 Bacteria 19553
428 Ga0439449_0001647 3300042007 Bacteria 8764
429 Ga0439449_0003981 3300042007 Bacteria 5711
430 Ga0439449_0004140 3300042007 Bacteria 5609
431 Ga0439452_000792 3300042010 Bacteria 14976
432 Ga0439452_005772 3300042010 Bacteria 3955
433 Ga0439457_001278 3300042014 Bacteria 7554
434 Ga0439457_029009 3300042014 Bacteria 1226
435 Ga0439462_0017172 3300042015 Bacteria 1874
436 Ga0450894_003722 3300042131 Bacteria 1992
437 Ga0450906_001265 3300042145 Bacteria 5568
438 Ga0450907_010923 3300042146 Bacteria 1509
439 Ga0439446_0010238 3300042156 Bacteria 2524
440 Ga0450908_000841 3300042184 Bacteria 5923
441 Ga0450909_003757 3300042185 Bacteria 2156
442 Ga0439434_0001099 3300042435 Bacteria 7827
443 Ga0439434_0006472 3300042435 Bacteria 3423
444 Ga0451577_0003100 3300042876 Bacteria 18746
445 Ga0451577_0025039 3300042876 Bacteria 5418
446 Ga0451577_0072441 3300042876 Bacteria 3073
447 Ga0451577_0078031 3300042876 Bacteria 2953
448 Ga0451577_0091835 3300042876 Bacteria 2711
449 Ga0466969_0002847 3300044656 Bacteria 9244
450 Ga0466969_0004757 3300044656 Bacteria 7223
451 Ga0466973_0009139 3300044659 Bacteria 9055
452 Ga0453683_0156859 3300044673 Bacteria 1439
453 Ga0466965_0001211 3300044683 Bacteria 10198
454 Ga0466965_0001863 3300044683 Bacteria 8779
455 Ga0466965_0032927 3300044683 Bacteria 2532
456 Ga0466966_0000032 3300044684 Bacteria 102181
457 Ga0466966_0002909 3300044684 Bacteria 11277
458 Ga0466966_0016532 3300044684 Bacteria 4872
459 Ga0466966_0063721 3300044684 Bacteria 2322
460 Ga0466961_0004925 3300044693 Bacteria 8398
461 Ga0466961_0116424 3300044693 Bacteria 1679
462 Ga0466963_0001953 3300044694 Bacteria 11306
463 Ga0466963_0015153 3300044694 Bacteria 4768
464 Ga0466964_0002026 3300044706 Bacteria 7123
465 Ga0466964_0039190 3300044706 Bacteria 1908
466 Ga0453684_0000005 3300044712 Bacteria 1431632
467 Ga0453684_0000583 3300044712 Bacteria 135940
468 Ga0453684_0004902 3300044712 Bacteria 27396
469 Ga0453684_0005751 3300044712 Bacteria 24224
470 Ga0453684_0008183 3300044712 Bacteria 18861
471 Ga0453684_0116937 3300044712 Bacteria 3227
472 Ga0453684_0524355 3300044712 Bacteria 1308
473 Ga0466968_0005823 3300044735 Bacteria 4626
474 Ga0466970_0026347 3300044765 Bacteria 3047
475 Ga0466970_0091606 3300044765 Bacteria 1650
476 Ga0466957_0015351 3300044842 Bacteria 4474
477 Ga0466957_0047793 3300044842 Bacteria 2600
478 Ga0466957_0097795 3300044842 Bacteria 1846
479 Ga0466960_0010342 3300044901 Bacteria 3872
480 Ga0466959_0010040 3300045049 Bacteria 6747
481 Ga0466959_0014675 3300045049 Bacteria 5701
482 Ga0466959_0222376 3300045049 Bacteria 1309
483 Ga0451576_0000137 3300045051 Bacteria 185212
484 Ga0451576_0000738 3300045051 Bacteria 65424
485 Ga0451576_0001961 3300045051 Bacteria 32770
486 Ga0451576_0012728 3300045051 Bacteria 9445
487 Ga0451576_0052917 3300045051 Bacteria 4254
488 Ga0451576_0145389 3300045051 Bacteria 2472
489 Ga0466958_0001759 3300045836 Bacteria 10489
490 Ga0466958_0005164 3300045836 Bacteria 6984
491 Ga0466958_0009785 3300045836 Bacteria 5349
492 Ga0466958_0021413 3300045836 Bacteria 3778
493 Ga0466967_0343404 3300045976 Bacteria 1444
494 Ga0495627_007509 3300046453 Bacteria 4167
495 Ga0495592_0040557 3300046454 Bacteria 3494
496 Ga0495592_0052099 3300046454 Bacteria 3039
497 Ga0495592_0197290 3300046454 Bacteria 1360
498 Ga0495603_0001297 3300046455 Bacteria 14577
499 Ga0495603_0007952 3300046455 Bacteria 6400
500 Ga0495603_0009400 3300046455 Bacteria 5907
501 Ga0495590_0001947 3300046457 Bacteria 8729
502 Ga0495590_0060794 3300046457 Bacteria 1323
503 Ga0495591_006781 3300046458 Bacteria 4985
504 Ga0495629_0000369 3300046459 Bacteria 38164
505 Ga0495629_0004351 3300046459 Bacteria 10617
506 Ga0495629_0005165 3300046459 Bacteria 9767
507 Ga0495629_0014711 3300046459 Bacteria 5628
508 Ga0495629_0041923 3300046459 Bacteria 3217
509 Ga0495629_0049525 3300046459 Bacteria 2944
510 Ga0495638_0028169 3300046460 Bacteria 3630
511 Ga0495638_0074310 3300046460 Bacteria 2073
512 Ga0495641_0003603 3300046461 Bacteria 11474
513 Ga0495651_0009952 3300046462 Bacteria 7311
514 Ga0495651_0023058 3300046462 Bacteria 4841
515 Ga0495651_0196935 3300046462 Bacteria 1413
516 Ga0495651_0218439 3300046462 Bacteria 1321
517 Ga0495653_0006567 3300046463 Bacteria 9545
518 Ga0495653_0018833 3300046463 Bacteria 5601
519 Ga0495653_0023696 3300046463 Bacteria 4955
520 Ga0495653_0037748 3300046463 Bacteria 3793
521 Ga0495653_0092915 3300046463 Bacteria 2202
522 Ga0495653_0175644 3300046463 Bacteria 1474
523 Ga0495650_0004632 3300046471 Bacteria 9321
524 Ga0495650_0014058 3300046471 Bacteria 4192
525 Ga0495650_0017226 3300046471 Bacteria 3627
526 Ga0495650_0019000 3300046471 Bacteria 3399
527 Ga0495650_0027417 3300046471 Bacteria 2632
528 Ga0495580_0002054 3300046472 Bacteria 17674
529 Ga0495580_0005418 3300046472 Bacteria 10546
530 Ga0495580_0023500 3300046472 Bacteria 4525
531 Ga0495580_0070077 3300046472 Bacteria 2449
532 Ga0495580_0113459 3300046472 Bacteria 1882
533 Ga0495580_0149687 3300046472 Bacteria 1617
534 Ga0495580_0159856 3300046472 Bacteria 1559
535 Ga0495582_0002285 3300046473 Bacteria 10726
536 Ga0495582_0052398 3300046473 Bacteria 2250
537 Ga0495605_0002196 3300046474 Bacteria 12190
538 Ga0495605_0004899 3300046474 Bacteria 7821
539 Ga0495605_0010712 3300046474 Bacteria 5124
540 Ga0495605_0016596 3300046474 Bacteria 3984
541 Ga0495639_0009089 3300046475 Bacteria 4260
542 Ga0495662_0024751 3300046476 Bacteria 2897
543 Ga0495662_0077914 3300046476 Bacteria 1610
544 Ga0495664_0001019 3300046477 Bacteria 14491
545 Ga0495664_0015601 3300046477 Bacteria 4320
546 Ga0495664_0083586 3300046477 Bacteria 1916
547 Ga0495596_0005025 3300046500 Bacteria 6324
548 Ga0495596_0039764 3300046500 Bacteria 1857
549 Ga0495596_0073211 3300046500 Bacteria 1330
550 Ga0495583_0003894 3300046506 Bacteria 11050
551 Ga0495583_0006862 3300046506 Bacteria 7331
552 Ga0495583_0013530 3300046506 Bacteria 4547
553 Ga0495606_0012257 3300046507 Bacteria 6896
554 Ga0495606_0039182 3300046507 Bacteria 3197
555 Ga0495606_0072098 3300046507 Bacteria 2172
556 Ga0495606_0083444 3300046507 Bacteria 1981
557 Ga0495606_0099160 3300046507 Bacteria 1776
558 Ga0495606_0138973 3300046507 Bacteria 1436
559 Ga0495608_0007446 3300046511 Bacteria 7734
560 Ga0495608_0042458 3300046511 Bacteria 3041
561 Ga0495610_0019946 3300046512 Bacteria 3735
562 Ga0495616_0002124 3300046513 Bacteria 13283
563 Ga0495616_0073811 3300046513 Bacteria 1645
564 Ga0495618_0001663 3300046514 Bacteria 14785
565 Ga0495618_0011271 3300046514 Bacteria 5417
566 Ga0495618_0014447 3300046514 Bacteria 4811
567 Ga0495620_0011576 3300046515 Bacteria 4597
568 Ga0495620_0036745 3300046515 Bacteria 2189
569 Ga0495628_0002617 3300046516 Bacteria 16154
570 Ga0495628_0027908 3300046516 Bacteria 4589
571 Ga0495628_0033448 3300046516 Bacteria 4145
572 Ga0495628_0037443 3300046516 Bacteria 3889
573 Ga0495628_0049906 3300046516 Bacteria 3311
574 Ga0495628_0174155 3300046516 Bacteria 1630
575 Ga0495630_0020532 3300046517 Bacteria 4870
576 Ga0495630_0044761 3300046517 Bacteria 3307
577 Ga0495630_0235052 3300046517 Bacteria 1400
578 Ga0495631_0001388 3300046518 Bacteria 14713
579 Ga0495637_0007495 3300046520 Bacteria 5402
580 Ga0495648_0012380 3300046524 Bacteria 6371
581 Ga0495648_0021277 3300046524 Bacteria 4496
582 Ga0495648_0022600 3300046524 Bacteria 4324
583 Ga0495648_0044551 3300046524 Bacteria 2768
584 Ga0495648_0142954 3300046524 Bacteria 1257
585 Ga0495663_0002160 3300046525 Bacteria 5990
586 Ga0495666_0004704 3300046526 Bacteria 6903
587 Ga0495666_0005594 3300046526 Bacteria 6331
588 Ga0495666_0006495 3300046526 Bacteria 5887
589 Ga0495642_0006746 3300046528 Bacteria 4401
590 Ga0495642_0021025 3300046528 Bacteria 2565
591 Ga0495652_0029140 3300046529 Bacteria 4850
592 Ga0495652_0033248 3300046529 Bacteria 4504
593 Ga0495654_0018415 3300046530 Bacteria 3661
594 Ga0495654_0028146 3300046530 Bacteria 2875
595 Ga0495654_0081073 3300046530 Bacteria 1521
596 Ga0495665_0005886 3300046531 Bacteria 6604
597 Ga0495665_0021328 3300046531 Bacteria 3480
598 Ga0495665_0025686 3300046531 Bacteria 3163
599 Ga0495640_0002933 3300046533 Bacteria 13734
600 Ga0495640_0005861 3300046533 Bacteria 9748
601 Ga0495640_0026287 3300046533 Bacteria 4208
602 Ga0495640_0113370 3300046533 Bacteria 1769
603 Ga0495586_0000633 3300046535 Bacteria 20275
604 Ga0495586_0031997 3300046535 Bacteria 2820
605 Ga0495586_0092520 3300046535 Bacteria 1672
606 Ga0495587_0018778 3300046536 Bacteria 4287
607 Ga0495621_0009096 3300046539 Bacteria 3004
608 Ga0495597_0002648 3300046542 Bacteria 11102
609 Ga0495597_0016569 3300046542 Bacteria 3480
610 Ga0495597_0044837 3300046542 Bacteria 1965
611 Ga0495645_0003050 3300046543 Bacteria 11342
612 Ga0495645_0011091 3300046543 Bacteria 6336
613 Ga0495645_0045339 3300046543 Bacteria 3207
614 Ga0495645_0122181 3300046543 Bacteria 1832
615 Ga0495622_0004831 3300046557 Bacteria 6242
616 Ga0495622_0016921 3300046557 Bacteria 3394
617 Ga0495667_0017947 3300046559 Bacteria 4779
618 Ga0495667_0022585 3300046559 Bacteria 4239
619 Ga0495668_0011933 3300046616 Bacteria 5174
620 Ga0495668_0041562 3300046616 Bacteria 2561
621 Ga0495634_0009735 3300046642 Bacteria 7071
622 Ga0495634_0011188 3300046642 Bacteria 6543
623 Ga0495634_0022513 3300046642 Bacteria 4439
624 Ga0495625_0000279 3300046660 Bacteria 79498
625 Ga0495625_0147991 3300046660 Bacteria 1580
626 Ga0495625_0155597 3300046660 Bacteria 1534
627 Ga0495635_0013627 3300046663 Bacteria 5690
628 Ga0495635_0034889 3300046663 Bacteria 3489
629 Ga0495635_0040500 3300046663 Bacteria 3219
630 Ga0495635_0102843 3300046663 Bacteria 1952
631 Ga0495661_0005519 3300046665 Bacteria 8973
632 Ga0495661_0010232 3300046665 Bacteria 6410
633 Ga0495588_0008649 3300046674 Bacteria 4678
634 Ga0495588_0025253 3300046674 Bacteria 2959
635 Ga0495588_0035503 3300046674 Bacteria 2526
636 Ga0495599_0015425 3300046678 Bacteria 4741
637 Ga0495599_0023267 3300046678 Bacteria 3871
638 Ga0495599_0032828 3300046678 Bacteria 3259
639 Ga0495599_0048735 3300046678 Bacteria 2655
640 Ga0495599_0131437 3300046678 Bacteria 1555
641 Ga0495623_0007011 3300046679 Bacteria 7325
642 Ga0495623_0010956 3300046679 Bacteria 5867
643 Ga0495623_0021667 3300046679 Bacteria 4150
644 Ga0495623_0135016 3300046679 Bacteria 1473
645 Ga0495646_0001320 3300046680 Bacteria 14655
646 Ga0495646_0011483 3300046680 Bacteria 5622
647 Ga0495646_0021365 3300046680 Bacteria 4088
648 Ga0495646_0023967 3300046680 Bacteria 3842
649 Ga0495646_0034617 3300046680 Bacteria 3136
650 Ga0495646_0053517 3300046680 Bacteria 2433
651 Ga0495646_0076910 3300046680 Bacteria 1953
652 Ga0495658_0132556 3300046683 Bacteria 1518
653 Ga0495669_0035962 3300046684 Bacteria 2188
654 Ga0495669_0084553 3300046684 Bacteria 1459
655 Ga0495669_0102943 3300046684 Bacteria 1327
656 Ga0495613_0002624 3300046689 Bacteria 13515
657 Ga0495613_0010806 3300046689 Bacteria 6773
658 Ga0495624_0009914 3300046690 Bacteria 6585
659 Ga0495624_0010314 3300046690 Bacteria 6437
660 Ga0495624_0016074 3300046690 Bacteria 5038
661 Ga0495624_0016284 3300046690 Bacteria 5005
662 Ga0495624_0017769 3300046690 Bacteria 4767
663 Ga0495624_0053963 3300046690 Bacteria 2536
664 Ga0495624_0121640 3300046690 Bacteria 1602
665 Ga0495624_0179046 3300046690 Bacteria 1292
666 Ga0495670_0064305 3300046691 Bacteria 1848
667 Ga0495670_0089064 3300046691 Bacteria 1578
668 Ga0495671_0002320 3300046692 Bacteria 12088
669 Ga0495671_0016957 3300046692 Bacteria 3881
670 Ga0495671_0038591 3300046692 Bacteria 2413
671 Ga0495671_0076100 3300046692 Bacteria 1646
672 Ga0495649_0001567 3300046694 Bacteria 17157
673 Ga0495649_0004421 3300046694 Bacteria 9188
674 Ga0495649_0068416 3300046694 Bacteria 1905
675 Ga0495649_0079163 3300046694 Bacteria 1758
676 Ga0495649_0083897 3300046694 Bacteria 1702
677 Ga0495589_0005849 3300046794 Bacteria 6492
678 Ga0495589_0010940 3300046794 Bacteria 4712
679 Ga0495589_0082331 3300046794 Bacteria 1565
680 Ga0495600_0013215 3300046809 Bacteria 5183
681 Ga0495600_0032687 3300046809 Bacteria 3376
682 Ga0495600_0044562 3300046809 Bacteria 2894
683 Ga0495600_0143413 3300046809 Bacteria 1549
684 Ga0495660_0138054 3300046810 Bacteria 1216
685 Ga0495581_0005698 3300047315 Bacteria 7224
686 Ga0495581_0006202 3300047315 Bacteria 6934
687 Ga0495581_0006589 3300047315 Bacteria 6728
688 Ga0495581_0023067 3300047315 Bacteria 3606
689 Ga0495604_0005007 3300047317 Bacteria 10494
690 Ga0495604_0036700 3300047317 Bacteria 3864
691 Ga0495604_0037578 3300047317 Bacteria 3812
692 Ga0495604_0126928 3300047317 Bacteria 1838
693 Ga0495674_0022004 3300047319 Bacteria 5885
694 Ga0495674_0023710 3300047319 Bacteria 5651
695 Ga0495674_0036272 3300047319 Bacteria 4439
696 Ga0495674_0045553 3300047319 Bacteria 3894
697 Ga0495674_0082240 3300047319 Bacteria 2761
698 Ga0495674_0094523 3300047319 Bacteria 2549
699 Ga0495674_0294906 3300047319 Bacteria 1325
700 Ga0495672_0003028 3300047320 Bacteria 14773
701 Ga0495676_0017431 3300047321 Bacteria 6351
702 Ga0495676_0038899 3300047321 Bacteria 3946
703 Ga0495676_0046582 3300047321 Bacteria 3517
704 Ga0495676_0105211 3300047321 Bacteria 2081
705 Ga0495680_0007394 3300047322 Bacteria 10075
706 Ga0495680_0021369 3300047322 Bacteria 5419
707 Ga0495680_0035715 3300047322 Bacteria 4000
708 Ga0495680_0086575 3300047322 Bacteria 2357
709 Ga0495683_0002898 3300047323 Bacteria 10143
710 Ga0495683_0006607 3300047323 Bacteria 6323
711 Ga0495683_0075182 3300047323 Bacteria 1654
712 Ga0495683_0084673 3300047323 Bacteria 1542
713 Ga0495687_000011 3300047443 Bacteria 397225
714 Ga0495687_006437 3300047443 Bacteria 7197
715 Ga0495687_017752 3300047443 Bacteria 3535
716 Ga0495687_060421 3300047443 Bacteria 1563
717 Ga0495675_0003779 3300047444 Bacteria 9156
718 Ga0495675_0024722 3300047444 Bacteria 3831
719 Ga0495675_0036826 3300047444 Bacteria 3119
720 Ga0495675_0132796 3300047444 Bacteria 1546
721 Ga0495679_000109 3300047446 Bacteria 74134
722 Ga0495679_003488 3300047446 Bacteria 7534
723 Ga0495673_0040365 3300047469 Bacteria 2109
724 Ga0495673_0051646 3300047469 Bacteria 1799
725 Ga0495673_0096997 3300047469 Bacteria 1197
726 Ga0495684_0110236 3300047471 Bacteria 2078
727 Ga0495684_0132016 3300047471 Bacteria 1875
728 Ga0495686_0000014 3300047472 Bacteria 474014
729 Ga0495686_0014261 3300047472 Bacteria 5475
730 Ga0495593_0001995 3300047673 Bacteria 12169
731 Ga0495593_0004554 3300047673 Bacteria 8236
732 Ga0495593_0006696 3300047673 Bacteria 6745
733 Ga0495593_0010859 3300047673 Bacteria 5250
734 Ga0495593_0018130 3300047673 Bacteria 3958
735 Ga0495593_0025266 3300047673 Bacteria 3287
736 Ga0495602_0019497 3300048088 Bacteria 6730
737 Ga0495602_0027611 3300048088 Bacteria 5452
738 Ga0495614_0000770 3300048089 Bacteria 13577
739 Ga0495614_0006640 3300048089 Bacteria 5181
740 Ga0495614_0082923 3300048089 Bacteria 1390
741 Ga0495626_0017922 3300048091 Bacteria 3569
742 Ga0495626_0021549 3300048091 Bacteria 3197
743 Ga0495626_0049299 3300048091 Bacteria 1950
744 Ga0496100_0003845 3300048903 Bacteria 7874
745 Ga0496100_0009676 3300048903 Bacteria 5422
746 Ga0496100_0018508 3300048903 Bacteria 4133
747 Ga0496100_0039852 3300048903 Bacteria 2985
748 Ga0496100_0136746 3300048903 Bacteria 1732
749 Ga0496101_0006420 3300048904 Bacteria 7564
750 Ga0496101_0128488 3300048904 Bacteria 1922
751 Ga0496102_0001889 3300048905 Bacteria 18052
752 Ga0496102_0003852 3300048905 Bacteria 12706
753 Ga0496102_0021914 3300048905 Bacteria 5657
754 Ga0496102_0035899 3300048905 Bacteria 4464
755 Ga0496102_0048343 3300048905 Bacteria 3868
756 Ga0496102_0269160 3300048905 Bacteria 1606
757 Ga0496103_0006863 3300048906 Bacteria 6798
758 Ga0496103_0011673 3300048906 Bacteria 5211
759 Ga0496103_0019064 3300048906 Bacteria 4120
760 Ga0496103_0040992 3300048906 Bacteria 2846
761 Ga0496104_0028881 3300048907 Bacteria 5142
762 Ga0496104_0054037 3300048907 Bacteria 3796
763 Ga0496105_0008551 3300048908 Bacteria 7952
764 Ga0496105_0052227 3300048908 Bacteria 3375
765 Ga0496105_0107959 3300048908 Bacteria 2298
766 Ga0496105_0171307 3300048908 Bacteria 1779
767 Ga0496105_0173630 3300048908 Bacteria 1766
768 Ga0496105_0208750 3300048908 Bacteria 1592
769 Ga0496106_0000031 3300048909 Bacteria 135370
770 Ga0496106_0019590 3300048909 Bacteria 5019
771 Ga0496106_0089452 3300048909 Bacteria 2374
772 Ga0496107_0023185 3300048910 Bacteria 4388
773 Ga0496107_0085859 3300048910 Bacteria 2296
774 Ga0496107_0116962 3300048910 Bacteria 1963
775 Ga0496108_0232750 3300048911 Bacteria 1602
776 Ga0496109_0240207 3300048912 Bacteria 1705
777 Ga0496109_0281411 3300048912 Bacteria 1568
778 Ga0496110_0026740 3300048913 Bacteria 4941
779 Ga0496110_0156871 3300048913 Bacteria 2062
780 Ga0496111_0060199 3300048914 Bacteria 2752
781 Ga0496112_0008182 3300048915 Bacteria 9348
782 Ga0496112_0041577 3300048915 Bacteria 4498
783 Ga0496113_0011230 3300048916 Bacteria 5964
784 Ga0496113_0256718 3300048916 Bacteria 1396
785 Ga0496114_0001502 3300048917 Bacteria 17697
786 Ga0496114_0275292 3300048917 Bacteria 1483
787 Ga0496114_0318659 3300048917 Bacteria 1374
788 Ga0496115_0113660 3300048918 Bacteria 2225
789 Ga0496116_0012792 3300048919 Bacteria 6818
790 Ga0496116_0066210 3300048919 Bacteria 2313
791 Ga0496116_0104757 3300048919 Bacteria 1680
792 Ga0496117_0004561 3300048920 Bacteria 15167
793 Ga0496117_0008670 3300048920 Bacteria 9612
794 Ga0496117_0010958 3300048920 Bacteria 8171
795 Ga0496117_0011477 3300048920 Bacteria 7934
796 Ga0496117_0017799 3300048920 Bacteria 5923
797 Ga0496117_0064264 3300048920 Bacteria 2503
798 Ga0496118_0001983 3300048921 Bacteria 29083
799 Ga0496118_0002651 3300048921 Bacteria 23694
800 Ga0496118_0013236 3300048921 Bacteria 7825
801 Ga0496118_0017009 3300048921 Bacteria 6642
802 Ga0496118_0020524 3300048921 Bacteria 5854
803 Ga0496118_0022762 3300048921 Bacteria 5463
804 Ga0496118_0027358 3300048921 Bacteria 4828
805 Ga0496118_0043345 3300048921 Bacteria 3538
806 Ga0496118_0056034 3300048921 Bacteria 2967
807 Ga0496118_0104184 3300048921 Bacteria 1905
808 Ga0496118_0131107 3300048921 Bacteria 1610
809 Ga0496121_0000305 3300048924 Bacteria 102256
810 Ga0496121_0006229 3300048924 Bacteria 14945
811 Ga0496121_0028228 3300048924 Bacteria 5228
812 Ga0496121_0074371 3300048924 Bacteria 2718
813 Ga0496121_0082136 3300048924 Bacteria 2548
814 Ga0496121_0156425 3300048924 Bacteria 1672
815 Ga0496122_0000217 3300048925 Bacteria 128502
816 Ga0496122_0026227 3300048925 Bacteria 5032
817 Ga0496123_0000057 3300048926 Bacteria 228608
818 Ga0496123_0028101 3300048926 Bacteria 4172
819 Ga0496123_0028452 3300048926 Bacteria 4137
820 Ga0496123_0126072 3300048926 Bacteria 1429
821 Ga0496124_0026584 3300048927 Bacteria 5215
822 Ga0496124_0031416 3300048927 Bacteria 4701
823 Ga0496124_0054648 3300048927 Bacteria 3379
824 Ga0496125_0032287 3300048928 Bacteria 4652
825 Ga0496126_0001240 3300048929 Bacteria 41387
826 Ga0496126_0003440 3300048929 Bacteria 19979
827 Ga0496126_0003523 3300048929 Bacteria 19696
828 Ga0496126_0016774 3300048929 Bacteria 7314
829 Ga0496126_0198119 3300048929 Bacteria 1697
830 Ga0496126_0244826 3300048929 Bacteria 1496
831 Ga0496126_0315125 3300048929 Bacteria 1287
832 Ga0495678_017996 3300049459 Bacteria 3186
833 Ga0495678_051418 3300049459 Bacteria 1593
834 Ga0495678_058272 3300049459 Bacteria 1460
835 Ga0495682_0007262 3300049460 Bacteria 4423
836 Ga0495682_0015318 3300049460 Bacteria 2905
837 Ga0495682_0060012 3300049460 Bacteria 1374
838 Ga0501225_0002703 3300049705 Bacteria 5446
839 Ga0501280_000651 3300049776 Bacteria 7785
840 nmdc:mga03683_11163_c1 3300050489 Bacteria 3242
841 nmdc:mga03683_25651_c1 3300050489 Bacteria 2318
842 nmdc:mga03683_45642_c1 3300050489 Bacteria 1814
843 nmdc:mga03683_51169_c1 3300050489 Bacteria 1723
844 nmdc:mga03683_53022_c1 3300050489 Bacteria 1697
845 nmdc:mga03683_80225_c1 3300050489 Bacteria 1408
846 nmdc:mga03n38_21763_c1 3300050490 Bacteria 2585
847 nmdc:mga03n38_24136_c1 3300050490 Bacteria 2483
848 nmdc:mga03n38_49718_c1 3300050490 Bacteria 1865
849 nmdc:mga00v17_126852_c1 3300050491 Bacteria 1629
850 nmdc:mga00v17_190727_c1 3300050491 Bacteria 1324
851 nmdc:mga0yw44_16735_c1 3300050492 Bacteria 3971
852 nmdc:mga0k408_116628_c1 3300050493 Bacteria 1580
853 nmdc:mga0k408_196920_c1 3300050493 Bacteria 1202
854 nmdc:mga0k408_61213_c1 3300050493 Bacteria 2188
855 nmdc:mga06z11_44049_c1 3300050494 Bacteria 2248
856 nmdc:mga04h51_31327_c1 3300050495 Bacteria 1680
857 nmdc:mga07m45_113912_c1 3300050496 Bacteria 1559
858 nmdc:mga07m45_143028_c1 3300050496 Bacteria 1386
859 nmdc:mga07m45_34458_c1 3300050496 Bacteria 2814
860 nmdc:mga07m45_356_c1 3300050496 Bacteria 18703
861 nmdc:mga07m45_8280_c1 3300050496 Bacteria 5336
862 nmdc:mga07m45_89697_c1 3300050496 Bacteria 1761
863 nmdc:mga0sz30_34877_c1 3300050516 Bacteria 2097
864 Ga0500610_0000451 3300053079 Bacteria 12670
865 Ga0500610_0001074 3300053079 Bacteria 8980
866 Ga0500643_001718 3300053087 Bacteria 12168
867 Ga0500583_0002376 3300053092 Bacteria 5640
868 Ga0500651_0000642 3300053093 Bacteria 17399
869 Ga0500569_023454 3300053109 Bacteria 1659
870 Ga0500571_000477 3300053110 Bacteria 16305
871 Ga0500592_003170 3300053116 Bacteria 2630
872 Ga0500593_000735 3300053117 Bacteria 12377
873 Ga0500594_0007251 3300053118 Bacteria 2506
874 Ga0500597_019885 3300053120 Bacteria 2627
875 Ga0500607_003250 3300053121 Bacteria 12002
876 Ga0500607_010629 3300053121 Bacteria 5468
877 Ga0500608_003396 3300053122 Bacteria 5963
878 Ga0500608_080724 3300053122 Bacteria 1535
879 Ga0500618_001179 3300053125 Bacteria 12614
880 Ga0500655_000925 3300053133 Bacteria 5678
881 Ga0500658_0000263 3300053134 Bacteria 24167
882 Ga0500658_0001281 3300053134 Bacteria 10197
883 Ga0500559_0001594 3300053136 Bacteria 12620
884 Ga0500559_0002800 3300053136 Bacteria 8815
885 Ga0500564_013191 3300053138 Bacteria 3693
886 Ga0500568_0001164 3300053139 Bacteria 17590
887 Ga0500568_0001787 3300053139 Bacteria 13260
888 Ga0500574_039308 3300053141 Bacteria 1313
889 Ga0500604_0000752 3300053151 Bacteria 8867
890 Ga0500616_0011322 3300053153 Bacteria 5277
891 Ga0500624_003981 3300053157 Bacteria 1939
892 Ga0500627_0004123 3300053158 Bacteria 4613
893 Ga0500634_0002263 3300053161 Bacteria 8034
894 Ga0500636_0015064 3300053177 Bacteria 4552
895 Ga0466962_0008411 3300061719 Bacteria 4944
896 Ga0466962_0016712 3300061719 Bacteria 3538
897 Ga0466962_0061442 3300061719 Bacteria 1793
898 Ga0466962_0070809 3300061719 Bacteria 1666
899 2514046283 2513237166 Bacteria 10373764
900 2501071009 2501025501 Bacteria 7768574
901 2501078836 2501025502 Bacteria 9641094
902 2501413839 2501025504 Bacteria 8008976
903 2509129383 2508501125 Bacteria 7208311
904 2510249971 2510065045 Bacteria 7761063
905 2511089475 2510917013 Bacteria 9951648
906 2511094892 2510917014 Bacteria 8296963
907 2511104551 2510917015 Bacteria 7950052
908 2512347518 2512047030 Bacteria 9031815
909 2513227435 2513020051 Bacteria 6053213
910 2513551591 2513237082 Bacteria 8640282
911 2513560242 2513237083 Bacteria 8410967
912 2513962461 2513237151 Bacteria 6309801
913 2515679422 2515154122 Bacteria 8609520
914 2515690480 2515154123 Bacteria 6387382
915 2516016996 2515154189 Bacteria 9629850
916 2519457891 2519103095 Bacteria 6629912
917 2527079139 2526164713 Bacteria 6780608
918 2548846186 2547132512 Bacteria 3416496
919 2563061899 2562617112 Bacteria 10918404
920 2585295192 2582581311 Bacteria 6763856
921 2599624543 2599185214 Bacteria 8209958
922 2599672595 2599185226 Bacteria 8233575
923 2599683595 2599185227 Bacteria 8246414
924 2599694204 2599185229 Bacteria 8216126
925 2599737023 2599185239 Bacteria 8686614
926 2599742865 2599185240 Bacteria 7968121
927 2600204983 2599185355 Bacteria 7968906
928 2600814623 2600255067 Bacteria 6795583
929 2643975203 2643221593 Bacteria 6296053
930 2644163141 2643221628 Bacteria 5745828
931 2644328106 2643221658 Bacteria 6064537
932 2644398585 2643221672 Bacteria 6322190
933 2644468670 2643221683 Bacteria 5749203
934 2676741972 2675903129 Bacteria 7964495
935 2713478265 2711768613 Bacteria 11048459
936 2719639129 2718217991 Bacteria 7829542
937 2735816181 2734482258 Unclassified 2930739
938 2738720157 2738541277 Bacteria 7458140
939 2738820116 2738541296 Bacteria 7285013
940 2738832596 2738541298 Bacteria 7286732
941 2738874123 2738541306 Bacteria 7284992
942 2738881701 2738541307 Bacteria 8606193
943 2739185753 2738543002 Bacteria 7284546
944 2739220721 2738543008 Bacteria 7282815
945 2739279356 2738543019 Bacteria 7459457
946 2746092230 2744054900 Bacteria 8399525
947 2746095271 2744054901 Bacteria 8397047
948 2753568824 2751185846 Bacteria 7242164
949 2792833011 2791355137 Bacteria 9654227
950 2808971581 2808606384 Bacteria 8474373
951 2809006410 2808606390 Bacteria 8476311
952 2809013672 2808606391 Bacteria 8308166
953 2817260070 2816332253 Bacteria 6764532
954 2817277734 2816332256 Bacteria 6891714
955 2817456853 2816332286 Bacteria 6853759
956 2819595955 2818991446 Bacteria 7757362
957 2819620873 2818991450 Bacteria 6962147
958 2819632525 2818991452 Bacteria 8442785
959 2831266895 2831265667 Bacteria 7184833
960 2838056954 2838054893 Bacteria 7451788
961 2842331332 2842324504 Bacteria 9364110
962 2842355672 2842348783 Bacteria 9002918
963 2842462024 2842454564 Bacteria 8730687
964 2842678772 2842677519 Bacteria 5615038
965 2842735573 2842733646 Bacteria 5716726
966 2842751331 2842747753 Bacteria 5578255
967 2856289142 2856287931 Bacteria 7223934
968 2857363488 2857357740 Bacteria 9937880
969 2863421566 2863421361 Bacteria 7300805
970 2870069008 2870068957 Bacteria 8925310
971 2881105141 2881101125 Bacteria 4590519
972 2883094751 2883087390 Bacteria 9532701
973 2885192875 2885192300 Bacteria 5882526
974 2885199050 2885198086 Bacteria 7212419
975 2885212687 2885211737 Bacteria 7212420
976 2885277302 2885270888 Bacteria 9831543
977 2891634731 2891633521 Bacteria 4602265
978 2899925304 2899924645 Bacteria 7487985
979 2900636243 2900634093 Bacteria 10263517
980 2902683440 2902682994 Bacteria 8951596
981 2904456458 2904449895 Bacteria 6927402
982 2904460679 2904456579 Bacteria 6819253
983 2904483966 2904483920 Bacteria 7545285
984 2904548408 2904541872 Bacteria 8915136
985 2904565747 2904564687 Bacteria 7609577
986 2904572790 2904571731 Bacteria 7608790
987 2904618883 2904615490 Bacteria 10047340
988 2919464400 2919462493 Bacteria 5817112
989 2919529914 2919527303 Bacteria 7718827
990 2921643715 2921643360 Bacteria 11448031
991 2928038574 2928037797 Bacteria 7273642
992 2928045821 2928044640 Bacteria 7271509
993 2928053438 2928051484 Bacteria 7773759
994 2928067043 2928064002 Bacteria 7419480
995 2928071057 2928070936 Bacteria 8062541
996 2928085001 2928084124 Bacteria 7159212
997 2928109675 2928108538 Bacteria 7360024
998 2928136871 2928135762 Bacteria 7259641
999 2928159856 2928157003 Bacteria 7522202
1000 2928164104 2928163908 Bacteria 7561269
1001 2928173367 2928170801 Bacteria 8785406
1002 2928506399 2928503688 Bacteria 7268108
1003 2928538687 2928536128 Bacteria 7657547
1004 2929163805 2929160207 Bacteria 9075316
1005 2929524888 2929520902 Bacteria 6765052
1006 2945912459 2945909444 Bacteria 7065066
1007 2945935425 2945934425 Bacteria 7444609
1008 2945947233 2945945610 Bacteria 5951079
1009 2945976991 2945972063 Bacteria 6086495
1010 2945985222 2945984333 Bacteria 7358892
1011 2954771966 2954767861 Bacteria 5535784
1012 2981994294 2981990288 Bacteria 7590678
1013 2990704026 2990703756 Bacteria 7715990
1014 642422183 641736151 Bacteria 7477263
1015 642417462 641736154 Bacteria 7689995
1016 642594292 642555112 Bacteria 8676562
1017 642620297 642555113 Bacteria 8214658
1018 8003957509 8003955200 Bacteria 8601927
1019 8018848983 8018845410 Bacteria 8933938
1020 8020813039 8020807995 Bacteria 6801506
1021 8020944843 8020938398 Bacteria 7472757
1022 8020949716 8020945358 Bacteria 8467355
1023 8020959928 8020953355 Bacteria 7439080
1024 8021126730 8021120328 Bacteria 8782274
1025 8039099204 8039098773 Bacteria 6602928
1026 8040172292 8040167225 Bacteria 6542727
1027 8040175757 8040173305 Bacteria 6827067
1028 8055266704 8055266321 Bacteria 7999742
1029 8055303920 8055301274 Bacteria 8587385
1030 JGI24740J21852_10003397
1031 JGI24740J21852_10007221
1032 JGI24739J22299_10002664
1033 JGI24739J22299_10005575
1034 JGI24739J22299_10035620
1035 JGI24737J22298_10023739
1036 JGI24735J21928_10002378
1037 JGI24735J21928_10049111
1038 JGI24738J21930_10001505
1039 JGI25155J39150_1000724
1040 JGI25156J39149_1000504
1041 JGI25156J39149_1000735
1042 JGI25156J39149_1002542
1043 JGI25152J39213_1000915
1044 JGI25152J39213_1001246
1045 JGI25150J39212_1000991
1046 JGI25150J39212_1002008
1047 JGI25159J45721_1001447
1048 JGI25151J46595_10002025
1049 JGI25151J46595_10002925
1050 JGI25151J46595_10003922
1051 JGI25151J46595_10008898
1052 JGI25165J46597_1001196
1053 JGI25153J46596_10001486
1054 JGI25153J46596_10004452
1055 rootL2_10002479
1056 rootL2_10084409
1057 JGI25160J50197_1000171
1058 JGI25160J50197_1001502
1059 JGI25160J50197_1006483
1060 JGI25161J50226_1001006
1061 JGI25161J50226_1002287
1062 Ga0006562J51391_1095652
1063 Ga0006562J51391_1095654
1064 Ga0055533_1000292
1065 Ga0055532_1000001
1066 Ga0055532_1002025
1067 Ga0055532_1002081
1068 Ga0055532_1002399
1069 Ga0055527_1000014
1070 Ga0055527_1001374
1071 Ga0055535_1000001
1072 Ga0055535_1000998
1073 Ga0055535_1002924
1074 Ga0055535_1002982
1075 Ga0055542_1000001
1076 Ga0055542_1000004
1077 Ga0055542_1001017
1078 Ga0055542_1002094
1079 Ga0055529_1000001
1080 Ga0055529_1001769
1081 Ga0055526_1000649
1082 Ga0055526_1002772
1083 Ga0055526_1004608
1084 Ga0055537_1000390
1085 Ga0055537_1001113
1086 Ga0055524_1001840
1087 Ga0055536_1001135
1088 Ga0055536_1001267
1089 Ga0055536_1002880
1090 Ga0055534_1000349
1091 Ga0055534_1001367
1092 Ga0055534_1006607
1093 Ga0055528_1000914
1094 Ga0055528_1002082
1095 Ga0055530_10001555
1096 Ga0055540_1000996
1097 Ga0055540_1003629
1098 Ga0055540_1003698
1099 Ga0055540_1004049
1100 Ga0055540_1008591
1101 Ga0055531_10001175
1102 Ga0055531_10004876
1103 Ga0055531_10021333
1104 Ga0058692_1002599
1105 Ga0055543_1002168
1106 Ga0055543_1002259
1107 Ga0065165_1001193
1108 Ga0065165_1003400
1109 Ga0065714_10008370
1110 Ga0065704_10072545
1111 Ga0070658_10002647
1112 Ga0070658_10014898
1113 Ga0070658_10265732
1114 Ga0070666_10057749
1115 Ga0068868_100081982
1116 Ga0070660_100000032
1117 Ga0070660_100002402
1118 Ga0070661_100237510
1119 Ga0070659_100000355
1120 Ga0070659_100304392
1121 Ga0070667_100050240
1122 Ga0070663_100009295
1123 Ga0070678_100084625
1124 Ga0070678_100109415
1125 Ga0070678_100142288
1126 Ga0070662_100017863
1127 Ga0070662_100267055
1128 Ga0068853_100020864
1129 Ga0068853_100081717
1130 Ga0070665_100385058
1131 Ga0068855_100009319
1132 Ga0068855_100022698
1133 Ga0068855_100424737
1134 Ga0070664_100029930
1135 Ga0068852_100003043
1136 Ga0068852_100136933
1137 Ga0068859_100253636
1138 Ga0068862_100153601
1139 Ga0075368_10007239
1140 Ga0075363_100020228
1141 Ga0075363_100033095
1142 Ga0075363_100182109
1143 Ga0075364_10008450
1144 Ga0075364_10133357
1145 Ga0075362_10007125
1146 Ga0075362_10030423
1147 Ga0075362_10031860
1148 Ga0075362_10033809
1149 Ga0075362_10078284
1150 Ga0075367_10023801
1151 Ga0075369_10048964
1152 Ga0075369_10069478
1153 Ga0075366_10003695
1154 Ga0075366_10006163
1155 Ga0075366_10087818
1156 Ga0075370_10001351
1157 Ga0075370_10001937
1158 Ga0075370_10031089
1159 Ga0075370_10040569
1160 Ga0075370_10128971
1161 Ga0068871_100223272
1162 Ga0097620_100253623
1163 Ga0099826_10030220
1164 Ga0105251_10000097
1165 Ga0105251_10004896
1166 Ga0105251_10076755
1167 Ga0105244_10001759
1168 Ga0105244_10050125
1169 Ga0105250_10006717
1170 Ga0105240_10000656
1171 Ga0105240_10008487
1172 Ga0105240_10045631
1173 Ga0105240_10081746
1174 Ga0105240_10089914
1175 Ga0105240_10345382
1176 Ga0105243_10002439
1177 Ga0105243_10004361
1178 Ga0105243_10347035
1179 Ga0105241_10129036
1180 Ga0105242_10127949
1181 Ga0105248_10036706
1182 Ga0105248_10177643
1183 Ga0105248_10179120
1184 Ga0105237_10013204
1185 Ga0105237_10057546
1186 Ga0105237_10063269
1187 Ga0105238_10037100
1188 Ga0105238_10070714
1189 Ga0105238_10244627
1190 Ga0105239_10007406
1191 Ga0105239_10036412
1192 Ga0105246_10061294
1193 Ga0105246_10352220
1194 Ga0157373_10003547
1195 Ga0157373_10053204
1196 Ga0157371_10027247
1197 Ga0157370_10000328
1198 Ga0157370_10001149
1199 Ga0157370_10055529
1200 Ga0157370_10186502
1201 Ga0157370_10193324
1202 Ga0157369_10000206
1203 Ga0157369_10000556
1204 Ga0157369_10000953
1205 Ga0157369_10387518
1206 Ga0157374_10000370
1207 Ga0163162_10010310
1208 Ga0163162_10047011
1209 Ga0157372_10003805
1210 Ga0157372_10019343
1211 Ga0182008_10001707
1212 Ga0182008_10029056
1213 Ga0157379_10120360
1214 Ga0182006_1000990
1215 Ga0182006_1030114
1216 Ga0182007_10000150
1217 Ga0182007_10000673
1218 Ga0182007_10005814
1219 Ga0182007_10016384
1220 Ga0183362_10001
1221 Ga0183361_10012
1222 Ga0163161_10000743
1223 Ga0163161_10005081
1224 Ga0163161_10011455
1225 Ga0163161_10016751
1226 Ga0197907_10707312
1227 Ga0206354_11366513
1228 Ga0206353_11314560
1229 Ga0224712_10000022
1230 Ga0209436_103577
1231 Ga0209436_108792
1232 Ga0209566_100216
1233 Ga0209674_100005
1234 Ga0209674_100092
1235 Ga0209674_101735
1236 Ga0209672_100001
1237 Ga0209672_100028
1238 Ga0209672_100038
1239 Ga0209672_101148
1240 Ga0209672_101654
1241 Ga0209147_100001
1242 Ga0209147_100112
1243 Ga0209147_100163
1244 Ga0209147_100686
1245 Ga0209147_102613
1246 Ga0209563_104011
1247 Ga0207427_103987
1248 Ga0209258_100001
1249 Ga0209258_100022
1250 Ga0209258_100109
1251 Ga0209258_100112
1252 Ga0207425_1000199
1253 Ga0207425_1000595
1254 Ga0207425_1002925
1255 Ga0209148_1000003
1256 Ga0209148_1000034
1257 Ga0209148_1000081
1258 Ga0209148_1000997
1259 Ga0209759_1000053
1260 Ga0209759_1000074
1261 Ga0209759_1000601
1262 Ga0209129_1000023
1263 Ga0209129_1000089
1264 Ga0209129_1001975
1265 Ga0209233_1000016
1266 Ga0209565_1000288
1267 Ga0209565_1000293
1268 Ga0209565_1001947
1269 Ga0209455_1000001
1270 Ga0209455_1000050
1271 Ga0209455_1014935
1272 Ga0209673_1000038
1273 Ga0209673_1000265
1274 Ga0209673_1000838
1275 Ga0209673_1001258
1276 Ga0209130_1000113
1277 Ga0209130_1001550
1278 Ga0209130_1004836
1279 Ga0209675_1000127
1280 Ga0209675_1000276
1281 Ga0209675_1000887
1282 Ga0209675_1002155
1283 Ga0209676_1000005
1284 Ga0209676_1001480
1285 Ga0209676_1003545
1286 Ga0209676_1004910
1287 Ga0209676_1009073
1288 Ga0209676_1017071
1289 Ga0209025_1000134
1290 Ga0209025_1000484
1291 Ga0209025_1001331
1292 Ga0209025_1002208
1293 Ga0209025_1009028
1294 Ga0209564_1000053
1295 Ga0209564_1000394
1296 Ga0209564_1000698
1297 Ga0209564_1006730
1298 Ga0209564_1027441
1299 Ga0209758_1000064
1300 Ga0209758_1000622
1301 Ga0209758_1014045
1302 Ga0209050_1000007
1303 Ga0209050_1001433
1304 Ga0209050_1011252
1305 Ga0209256_1000115
1306 Ga0209256_1000864
1307 Ga0207426_1000001
1308 Ga0207426_1000031
1309 Ga0207426_1000037
1310 Ga0209051_1000009
1311 Ga0209051_1000385
1312 Ga0209051_1000781
1313 Ga0209051_1001504
1314 Ga0209051_1002109
1315 Ga0209051_1002621
1316 Ga0209051_1019996
1317 Ga0209051_1053265
1318 Ga0209257_1000011
1319 Ga0209257_1001057
1320 Ga0209257_1003120
1321 Ga0209257_1005156
1322 Ga0207655_1013658
1323 Ga0207713_1000305
1324 Ga0207682_10034113
1325 Ga0207680_10008834
1326 Ga0207647_10000268
1327 Ga0207647_10004135
1328 Ga0207647_10008546
1329 Ga0207647_10019591
1330 Ga0207647_10027493
1331 Ga0207647_10043031
1332 Ga0207705_10000708
1333 Ga0207705_10134982
1334 Ga0207695_10005102
1335 Ga0207695_10018782
1336 Ga0207695_10099910
1337 Ga0207695_10188464
1338 Ga0207695_10373598
1339 Ga0207671_10026696
1340 Ga0207671_10059100
1341 Ga0207671_10103198
1342 Ga0207657_10000051
1343 Ga0207657_10000131
1344 Ga0207694_10019539
1345 Ga0207694_10065076
1346 Ga0207690_10000034
1347 Ga0207709_10001032
1348 Ga0207709_10001454
1349 Ga0207711_10026135
1350 Ga0207711_10031612
1351 Ga0207711_10228248
1352 Ga0207679_10015470
1353 Ga0207667_10003149
1354 Ga0207667_10009431
1355 Ga0207667_10113941
1356 Ga0207667_10202305
1357 Ga0207640_10215795
1358 Ga0207658_10047893
1359 Ga0207658_10057051
1360 Ga0207639_10007462
1361 Ga0207639_10065918
1362 Ga0207678_10002721
1363 Ga0207678_10037514
1364 Ga0207678_10262867
1365 Ga0207674_10198781
1366 Ga0207674_10369757
1367 Ga0207683_10014003
1368 Ga0207683_10056358
1369 Ga0207698_10010500
1370 Ga0207698_10111986
1371 Ga0209371_1000090
1372 Ga0209371_1001109
1373 Ga0209282_1000334
1374 Ga0207428_10351654
1375 Ga0268266_10240987
1376 Ga0268266_10335955
1377 Ga0268265_10118263
1378 Ga0268264_10171693
1379 Ga0307515_10000028
1380 Ga0307515_10024629
1381 Ga0265338_10000113
1382 Ga0268256_1000115
1383 Ga0268256_1000921
1384 Ga0307511_10000025
1385 Ga0316177_1029429
1386 Ga0316176_1080864
1387 Ga0314311_1124028
1388 Ga0316180_1012367
1389 Ga0316182_1325098
1390 Ga0265332_10000013
1391 Ga0265325_10000262
1392 Ga0265327_10000722
1393 Ga0265327_10015860
1394 Ga0265316_10000299
1395 Ga0265316_10089534
1396 Ga0307513_10116636
1397 Ga0307509_10000006
1398 Ga0307408_100002431
1399 Ga0307408_100024541
1400 Ga0307408_100114667
1401 Ga0307408_100157292
1402 Ga0307508_10059988
1403 Ga0307514_10005152
1404 Ga0307516_10003171
1405 Ga0307405_10002949
1406 Ga0307406_10001482
1407 Ga0307406_10033625
1408 Ga0307412_10000051
1409 Ga0307412_10061531
1410 Ga0307412_10194031
1411 Ga0307416_100023777
1412 Ga0307416_100462395
1413 Ga0307414_10071445
1414 Ga0307411_10020506
1415 Ga0307411_10118497
1416 Ga0307411_10207668
1417 Ga0316583_10029627
1418 Ga0307507_10088851
1419 Ga0395899_0000008
1420 Ga0395900_0000055
1421 Ga0395900_0002303
1422 Ga0395900_0007321
1423 Ga0395900_0028412
1424 Ga0395900_0134985
1425 Ga0395900_0138938
1426 Ga0395900_0250241
1427 Ga0395898_0000119
1428 Ga0395898_0001260
1429 Ga0395898_0032722
1430 Ga0395905_0000168
1431 Ga0395905_0075175
1432 Ga0395901_0000003
1433 Ga0395901_0010491
1434 Ga0395901_0019159
1435 Ga0395901_0170239
1436 Ga0395901_0194691
1437 Ga0436361_0131139
1438 Ga0439436_0000470
1439 Ga0439436_0002954
1440 Ga0439439_0002400
1441 Ga0439447_002633
1442 Ga0439447_012795
1443 Ga0439461_0018568
1444 Ga0439466_0003460
1445 Ga0439465_0000108
1446 Ga0439465_0007545
1447 Ga0451853_4091276
1448 Ga0439431_0004413
1449 Ga0439433_0000895
1450 Ga0439442_004394
1451 Ga0439445_0001046
1452 Ga0439445_0008898
1453 Ga0439448_0001330
1454 Ga0439432_003819
1455 Ga0439432_010034
1456 Ga0439449_0000245
1457 Ga0439449_0001647
1458 Ga0439449_0003981
1459 Ga0439449_0004140
1460 Ga0439452_000792
1461 Ga0439452_005772
1462 Ga0439457_001278
1463 Ga0439457_029009
1464 Ga0439462_0017172
1465 Ga0450894_003722
1466 Ga0450906_001265
1467 Ga0450907_010923
1468 Ga0439446_0010238
1469 Ga0450908_000841
1470 Ga0450909_003757
1471 Ga0439434_0001099
1472 Ga0439434_0006472
1473 Ga0451577_0003100
1474 Ga0451577_0025039
1475 Ga0451577_0072441
1476 Ga0451577_0078031
1477 Ga0451577_0091835
1478 Ga0466969_0002847
1479 Ga0466969_0004757
1480 Ga0466973_0009139
1481 Ga0453683_0156859
1482 Ga0466965_0001211
1483 Ga0466965_0001863
1484 Ga0466965_0032927
1485 Ga0466966_0000032
1486 Ga0466966_0002909
1487 Ga0466966_0016532
1488 Ga0466966_0063721
1489 Ga0466961_0004925
1490 Ga0466961_0116424
1491 Ga0466963_0001953
1492 Ga0466963_0015153
1493 Ga0466964_0002026
1494 Ga0466964_0039190
1495 Ga0453684_0000005
1496 Ga0453684_0000583
1497 Ga0453684_0004902
1498 Ga0453684_0005751
1499 Ga0453684_0008183
1500 Ga0453684_0116937
1501 Ga0453684_0524355
1502 Ga0466968_0005823
1503 Ga0466970_0026347
1504 Ga0466970_0091606
1505 Ga0466957_0015351
1506 Ga0466957_0047793
1507 Ga0466957_0097795
1508 Ga0466960_0010342
1509 Ga0466959_0010040
1510 Ga0466959_0014675
1511 Ga0466959_0222376
1512 Ga0451576_0000137
1513 Ga0451576_0000738
1514 Ga0451576_0001961
1515 Ga0451576_0012728
1516 Ga0451576_0052917
1517 Ga0451576_0145389
1518 Ga0466958_0001759
1519 Ga0466958_0005164
1520 Ga0466958_0009785
1521 Ga0466958_0021413
1522 Ga0466967_0343404
1523 Ga0495627_007509
1524 Ga0495592_0040557
1525 Ga0495592_0052099
1526 Ga0495592_0197290
1527 Ga0495603_0001297
1528 Ga0495603_0007952
1529 Ga0495603_0009400
1530 Ga0495590_0001947
1531 Ga0495590_0060794
1532 Ga0495591_006781
1533 Ga0495629_0000369
1534 Ga0495629_0004351
1535 Ga0495629_0005165
1536 Ga0495629_0014711
1537 Ga0495629_0041923
1538 Ga0495629_0049525
1539 Ga0495638_0028169
1540 Ga0495638_0074310
1541 Ga0495641_0003603
1542 Ga0495651_0009952
1543 Ga0495651_0023058
1544 Ga0495651_0196935
1545 Ga0495651_0218439
1546 Ga0495653_0006567
1547 Ga0495653_0018833
1548 Ga0495653_0023696
1549 Ga0495653_0037748
1550 Ga0495653_0092915
1551 Ga0495653_0175644
1552 Ga0495650_0004632
1553 Ga0495650_0014058
1554 Ga0495650_0017226
1555 Ga0495650_0019000
1556 Ga0495650_0027417
1557 Ga0495580_0002054
1558 Ga0495580_0005418
1559 Ga0495580_0023500
1560 Ga0495580_0070077
1561 Ga0495580_0113459
1562 Ga0495580_0149687
1563 Ga0495580_0159856
1564 Ga0495582_0002285
1565 Ga0495582_0052398
1566 Ga0495605_0002196
1567 Ga0495605_0004899
1568 Ga0495605_0010712
1569 Ga0495605_0016596
1570 Ga0495639_0009089
1571 Ga0495662_0024751
1572 Ga0495662_0077914
1573 Ga0495664_0001019
1574 Ga0495664_0015601
1575 Ga0495664_0083586
1576 Ga0495596_0005025
1577 Ga0495596_0039764
1578 Ga0495596_0073211
1579 Ga0495583_0003894
1580 Ga0495583_0006862
1581 Ga0495583_0013530
1582 Ga0495606_0012257
1583 Ga0495606_0039182
1584 Ga0495606_0072098
1585 Ga0495606_0083444
1586 Ga0495606_0099160
1587 Ga0495606_0138973
1588 Ga0495608_0007446
1589 Ga0495608_0042458
1590 Ga0495610_0019946
1591 Ga0495616_0002124
1592 Ga0495616_0073811
1593 Ga0495618_0001663
1594 Ga0495618_0011271
1595 Ga0495618_0014447
1596 Ga0495620_0011576
1597 Ga0495620_0036745
1598 Ga0495628_0002617
1599 Ga0495628_0027908
1600 Ga0495628_0033448
1601 Ga0495628_0037443
1602 Ga0495628_0049906
1603 Ga0495628_0174155
1604 Ga0495630_0020532
1605 Ga0495630_0044761
1606 Ga0495630_0235052
1607 Ga0495631_0001388
1608 Ga0495637_0007495
1609 Ga0495648_0012380
1610 Ga0495648_0021277
1611 Ga0495648_0022600
1612 Ga0495648_0044551
1613 Ga0495648_0142954
1614 Ga0495663_0002160
1615 Ga0495666_0004704
1616 Ga0495666_0005594
1617 Ga0495666_0006495
1618 Ga0495642_0006746
1619 Ga0495642_0021025
1620 Ga0495652_0029140
1621 Ga0495652_0033248
1622 Ga0495654_0018415
1623 Ga0495654_0028146
1624 Ga0495654_0081073
1625 Ga0495665_0005886
1626 Ga0495665_0021328
1627 Ga0495665_0025686
1628 Ga0495640_0002933
1629 Ga0495640_0005861
1630 Ga0495640_0026287
1631 Ga0495640_0113370
1632 Ga0495586_0000633
1633 Ga0495586_0031997
1634 Ga0495586_0092520
1635 Ga0495587_0018778
1636 Ga0495621_0009096
1637 Ga0495597_0002648
1638 Ga0495597_0016569
1639 Ga0495597_0044837
1640 Ga0495645_0003050
1641 Ga0495645_0011091
1642 Ga0495645_0045339
1643 Ga0495645_0122181
1644 Ga0495622_0004831
1645 Ga0495622_0016921
1646 Ga0495667_0017947
1647 Ga0495667_0022585
1648 Ga0495668_0011933
1649 Ga0495668_0041562
1650 Ga0495634_0009735
1651 Ga0495634_0011188
1652 Ga0495634_0022513
1653 Ga0495625_0000279
1654 Ga0495625_0147991
1655 Ga0495625_0155597
1656 Ga0495635_0013627
1657 Ga0495635_0034889
1658 Ga0495635_0040500
1659 Ga0495635_0102843
1660 Ga0495661_0005519
1661 Ga0495661_0010232
1662 Ga0495588_0008649
1663 Ga0495588_0025253
1664 Ga0495588_0035503
1665 Ga0495599_0015425
1666 Ga0495599_0023267
1667 Ga0495599_0032828
1668 Ga0495599_0048735
1669 Ga0495599_0131437
1670 Ga0495623_0007011
1671 Ga0495623_0010956
1672 Ga0495623_0021667
1673 Ga0495623_0135016
1674 Ga0495646_0001320
1675 Ga0495646_0011483
1676 Ga0495646_0021365
1677 Ga0495646_0023967
1678 Ga0495646_0034617
1679 Ga0495646_0053517
1680 Ga0495646_0076910
1681 Ga0495658_0132556
1682 Ga0495669_0035962
1683 Ga0495669_0084553
1684 Ga0495669_0102943
1685 Ga0495613_0002624
1686 Ga0495613_0010806
1687 Ga0495624_0009914
1688 Ga0495624_0010314
1689 Ga0495624_0016074
1690 Ga0495624_0016284
1691 Ga0495624_0017769
1692 Ga0495624_0053963
1693 Ga0495624_0121640
1694 Ga0495624_0179046
1695 Ga0495670_0064305
1696 Ga0495670_0089064
1697 Ga0495671_0002320
1698 Ga0495671_0016957
1699 Ga0495671_0038591
1700 Ga0495671_0076100
1701 Ga0495649_0001567
1702 Ga0495649_0004421
1703 Ga0495649_0068416
1704 Ga0495649_0079163
1705 Ga0495649_0083897
1706 Ga0495589_0005849
1707 Ga0495589_0010940
1708 Ga0495589_0082331
1709 Ga0495600_0013215
1710 Ga0495600_0032687
1711 Ga0495600_0044562
1712 Ga0495600_0143413
1713 Ga0495660_0138054
1714 Ga0495581_0005698
1715 Ga0495581_0006202
1716 Ga0495581_0006589
1717 Ga0495581_0023067
1718 Ga0495604_0005007
1719 Ga0495604_0036700
1720 Ga0495604_0037578
1721 Ga0495604_0126928
1722 Ga0495674_0022004
1723 Ga0495674_0023710
1724 Ga0495674_0036272
1725 Ga0495674_0045553
1726 Ga0495674_0082240
1727 Ga0495674_0094523
1728 Ga0495674_0294906
1729 Ga0495672_0003028
1730 Ga0495676_0017431
1731 Ga0495676_0038899
1732 Ga0495676_0046582
1733 Ga0495676_0105211
1734 Ga0495680_0007394
1735 Ga0495680_0021369
1736 Ga0495680_0035715
1737 Ga0495680_0086575
1738 Ga0495683_0002898
1739 Ga0495683_0006607
1740 Ga0495683_0075182
1741 Ga0495683_0084673
1742 Ga0495687_000011
1743 Ga0495687_006437
1744 Ga0495687_017752
1745 Ga0495687_060421
1746 Ga0495675_0003779
1747 Ga0495675_0024722
1748 Ga0495675_0036826
1749 Ga0495675_0132796
1750 Ga0495679_000109
1751 Ga0495679_003488
1752 Ga0495673_0040365
1753 Ga0495673_0051646
1754 Ga0495673_0096997
1755 Ga0495684_0110236
1756 Ga0495684_0132016
1757 Ga0495686_0000014
1758 Ga0495686_0014261
1759 Ga0495593_0001995
1760 Ga0495593_0004554
1761 Ga0495593_0006696
1762 Ga0495593_0010859
1763 Ga0495593_0018130
1764 Ga0495593_0025266
1765 Ga0495602_0019497
1766 Ga0495602_0027611
1767 Ga0495614_0000770
1768 Ga0495614_0006640
1769 Ga0495614_0082923
1770 Ga0495626_0017922
1771 Ga0495626_0021549
1772 Ga0495626_0049299
1773 Ga0496100_0003845
1774 Ga0496100_0009676
1775 Ga0496100_0018508
1776 Ga0496100_0039852
1777 Ga0496100_0136746
1778 Ga0496101_0006420
1779 Ga0496101_0128488
1780 Ga0496102_0001889
1781 Ga0496102_0003852
1782 Ga0496102_0021914
1783 Ga0496102_0035899
1784 Ga0496102_0048343
1785 Ga0496102_0269160
1786 Ga0496103_0006863
1787 Ga0496103_0011673
1788 Ga0496103_0019064
1789 Ga0496103_0040992
1790 Ga0496104_0028881
1791 Ga0496104_0054037
1792 Ga0496105_0008551
1793 Ga0496105_0052227
1794 Ga0496105_0107959
1795 Ga0496105_0171307
1796 Ga0496105_0173630
1797 Ga0496105_0208750
1798 Ga0496106_0000031
1799 Ga0496106_0019590
1800 Ga0496106_0089452
1801 Ga0496107_0023185
1802 Ga0496107_0085859
1803 Ga0496107_0116962
1804 Ga0496108_0232750
1805 Ga0496109_0240207
1806 Ga0496109_0281411
1807 Ga0496110_0026740
1808 Ga0496110_0156871
1809 Ga0496111_0060199
1810 Ga0496112_0008182
1811 Ga0496112_0041577
1812 Ga0496113_0011230
1813 Ga0496113_0256718
1814 Ga0496114_0001502
1815 Ga0496114_0275292
1816 Ga0496114_0318659
1817 Ga0496115_0113660
1818 Ga0496116_0012792
1819 Ga0496116_0066210
1820 Ga0496116_0104757
1821 Ga0496117_0004561
1822 Ga0496117_0008670
1823 Ga0496117_0010958
1824 Ga0496117_0011477
1825 Ga0496117_0017799
1826 Ga0496117_0064264
1827 Ga0496118_0001983
1828 Ga0496118_0002651
1829 Ga0496118_0013236
1830 Ga0496118_0017009
1831 Ga0496118_0020524
1832 Ga0496118_0022762
1833 Ga0496118_0027358
1834 Ga0496118_0043345
1835 Ga0496118_0056034
1836 Ga0496118_0104184
1837 Ga0496118_0131107
1838 Ga0496121_0000305
1839 Ga0496121_0006229
1840 Ga0496121_0028228
1841 Ga0496121_0074371
1842 Ga0496121_0082136
1843 Ga0496121_0156425
1844 Ga0496122_0000217
1845 Ga0496122_0026227
1846 Ga0496123_0000057
1847 Ga0496123_0028101
1848 Ga0496123_0028452
1849 Ga0496123_0126072
1850 Ga0496124_0026584
1851 Ga0496124_0031416
1852 Ga0496124_0054648
1853 Ga0496125_0032287
1854 Ga0496126_0001240
1855 Ga0496126_0003440
1856 Ga0496126_0003523
1857 Ga0496126_0016774
1858 Ga0496126_0198119
1859 Ga0496126_0244826
1860 Ga0496126_0315125
1861 Ga0495678_017996
1862 Ga0495678_051418
1863 Ga0495678_058272
1864 Ga0495682_0007262
1865 Ga0495682_0015318
1866 Ga0495682_0060012
1867 Ga0501225_0002703
1868 Ga0501280_000651
1869 nmdc:mga03683_11163_c1
1870 nmdc:mga03683_25651_c1
1871 nmdc:mga03683_45642_c1
1872 nmdc:mga03683_51169_c1
1873 nmdc:mga03683_53022_c1
1874 nmdc:mga03683_80225_c1
1875 nmdc:mga03n38_21763_c1
1876 nmdc:mga03n38_24136_c1
1877 nmdc:mga03n38_49718_c1
1878 nmdc:mga00v17_126852_c1
1879 nmdc:mga00v17_190727_c1
1880 nmdc:mga0yw44_16735_c1
1881 nmdc:mga0k408_116628_c1
1882 nmdc:mga0k408_196920_c1
1883 nmdc:mga0k408_61213_c1
1884 nmdc:mga06z11_44049_c1
1885 nmdc:mga04h51_31327_c1
1886 nmdc:mga07m45_113912_c1
1887 nmdc:mga07m45_143028_c1
1888 nmdc:mga07m45_34458_c1
1889 nmdc:mga07m45_356_c1
1890 nmdc:mga07m45_8280_c1
1891 nmdc:mga07m45_89697_c1
1892 nmdc:mga0sz30_34877_c1
1893 Ga0500610_0000451
1894 Ga0500610_0001074
1895 Ga0500643_001718
1896 Ga0500583_0002376
1897 Ga0500651_0000642
1898 Ga0500569_023454
1899 Ga0500571_000477
1900 Ga0500592_003170
1901 Ga0500593_000735
1902 Ga0500594_0007251
1903 Ga0500597_019885
1904 Ga0500607_003250
1905 Ga0500607_010629
1906 Ga0500608_003396
1907 Ga0500608_080724
1908 Ga0500618_001179
1909 Ga0500655_000925
1910 Ga0500658_0000263
1911 Ga0500658_0001281
1912 Ga0500559_0001594
1913 Ga0500559_0002800
1914 Ga0500564_013191
1915 Ga0500568_0001164
1916 Ga0500568_0001787
1917 Ga0500574_039308
1918 Ga0500604_0000752
1919 Ga0500616_0011322
1920 Ga0500624_003981
1921 Ga0500627_0004123
1922 Ga0500634_0002263
1923 Ga0500636_0015064
1924 Ga0466962_0008411
1925 Ga0466962_0016712
1926 Ga0466962_0061442
1927 Ga0466962_0070809
1928 2514046283
1929 2501071009
1930 2501078836
1931 2501413839
1932 2509129383
1933 2510249971
1934 2511089475
1935 2511094892
1936 2511104551
1937 2512347518
1938 2513227435
1939 2513551591
1940 2513560242
1941 2513962461
1942 2515679422
1943 2515690480
1944 2516016996
1945 2519457891
1946 2527079139
1947 2548846186
1948 2563061899
1949 2585295192
1950 2599624543
1951 2599672595
1952 2599683595
1953 2599694204
1954 2599737023
1955 2599742865
1956 2600204983
1957 2600814623
1958 2643975203
1959 2644163141
1960 2644328106
1961 2644398585
1962 2644468670
1963 2676741972
1964 2713478265
1965 2719639129
1966 2735816181
1967 2738720157
1968 2738820116
1969 2738832596
1970 2738874123
1971 2738881701
1972 2739185753
1973 2739220721
1974 2739279356
1975 2746092230
1976 2746095271
1977 2753568824
1978 2792833011
1979 2808971581
1980 2809006410
1981 2809013672
1982 2817260070
1983 2817277734
1984 2817456853
1985 2819595955
1986 2819620873
1987 2819632525
1988 2831266895
1989 2838056954
1990 2842331332
1991 2842355672
1992 2842462024
1993 2842678772
1994 2842735573
1995 2842751331
1996 2856289142
1997 2857363488
1998 2863421566
1999 2870069008
2000 2881105141
2001 2883094751
2002 2885192875
2003 2885199050
2004 2885212687
2005 2885277302
2006 2891634731
2007 2899925304
2008 2900636243
2009 2902683440
2010 2904456458
2011 2904460679
2012 2904483966
2013 2904548408
2014 2904565747
2015 2904572790
2016 2904618883
2017 2919464400
2018 2919529914
2019 2921643715
2020 2928038574
2021 2928045821
2022 2928053438
2023 2928067043
2024 2928071057
2025 2928085001
2026 2928109675
2027 2928136871
2028 2928159856
2029 2928164104
2030 2928173367
2031 2928506399
2032 2928538687
2033 2929163805
2034 2929524888
2035 2945912459
2036 2945935425
2037 2945947233
2038 2945976991
2039 2945985222
2040 2954771966
2041 2981994294
2042 2990704026
2043 642422183
2044 642417462
2045 642594292
2046 642620297
2047 8003957509
2048 8018848983
2049 8020813039
2050 8020944843
2051 8020949716
2052 8020959928
2053 8021126730
2054 8039099204
2055 8040172292
2056 8040175757
2057 8055266704
2058 8055303920

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

57

381

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4klc-assembly1.cif.gz_B e343d/f110a double mutant of human ferrochelatase 0.9106 16 341
2pnj-assembly1.cif.gz_A crystal structure of human ferrochelatase mutant with phe 337 replaced by ala 0.9092 14 341
2pnj-assembly1.cif.gz_B crystal structure of human ferrochelatase mutant with phe 337 replaced by ala 0.9062 16 341
3aqi-assembly1.cif.gz_B h240a variant of human ferrochelatase 0.8989 14 341
2po7-assembly1.cif.gz_B crystal structure of human ferrochelatase mutant with his 341 replaced by cys 0.8981 14 341
ID Description Score Start End Superfamily
af_P23871_188_298_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9849 209 317 3.40.50.1400
af_P23871_6_161_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9793 18 176 3.40.50.1400
af_P23871_6_250_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.977 18 269 3.40.605.10
af_P23871_6_161_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.967 18 176 3.40.50.1400
af_Q8ID58_27_285_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9656 18 278 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A6P2EL70-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9922 20 347 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A0G4JB43-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9919 1 348 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A2M7FPN8-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9908 42 347 GO:0004325
GO:0005737
GO:0006783
AF-A0A259PFH2-F1-model_v4 coproporphyrin ferrochelatase (EC 4.99.1.9) 0.9894 90 346 GO:0004325
GO:0006783
AF-A0A537GB29-F1-model_v4 Ferrochelatase 0.9876 18 121 GO:0004325
GO:0006783

Map