F488593
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1030 | 427 | 2060 | 337 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100322628|Ga0075431_1003226282 |
| Length | 353 |
| Sequence | VTDPTSERAAGLEVVRYRPQPSEFAWTFGGVRPVRSVRPGTVLEVWTEDAFGGRVKGPDDLVSRVIEFPFVNPQTGPFFIEGAEPGDTLAVHFVSITPSRDVAASSTIPFFGALTATGPIHTASLQDPLEERVWMYEVDRAGWTVTFTASRGEFSVALPMDPMHGTVGVAPGSFEARSSLVPDAHGGNMDTPEMRAGTTCYLGVNVEGALFSLGDGHCRQGEGESCGVAVEAAMDTVVIVDLLKGVATPWPRLETDDYVMSTGSARPLEDAFRISQVDLVSWVASQFGLETLDAYQLVTQAVEAPVANVCDPNYTFISKLRKRWLPRVDPYGGVHARLREMAAAYQAEEGSRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 68 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 156 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 161 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 162 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 165 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 168 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 175 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 176 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 177 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 179 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 192 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 213 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 214 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 215 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 216 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 217 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 218 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 219 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 220 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 221 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 222 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 223 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 224 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 225 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 226 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 230 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 231 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 232 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 322 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 325 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 326 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 327 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 368 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 382 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 384 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 386 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 387 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 388 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 389 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 391 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 392 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 393 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 394 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 396 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 397 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 401 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 402 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 403 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 404 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 405 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 406 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 407 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 408 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 409 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 410 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 411 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 412 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 413 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 414 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 415 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 416 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 417 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 418 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 419 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 420 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 421 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 422 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 423 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 424 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 425 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 426 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 427 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.5 |
| Metatranscriptomes | 0.87 |
| Isolates | 2.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.04 |
| Nodule | 0.1 |
| Rhizoplane | 4.27 |
| Rhizosphere | 88.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075431_100322628 | 3300006847 | Bacteria | 1557 |
| 2 | JGI25406J46586_10031578 | 3300003203 | Bacteria | 1979 |
| 3 | rootH1_10101709 | 3300003316 | Bacteria | 1490 |
| 4 | JGI25407J50210_10035106 | 3300003373 | Bacteria | 1293 |
| 5 | Ga0070658_10006893 | 3300005327 | Bacteria | 9180 |
| 6 | Ga0070683_100001796 | 3300005329 | Bacteria | 16715 |
| 7 | Ga0070683_100037024 | 3300005329 | Bacteria | 4465 |
| 8 | Ga0070683_100077938 | 3300005329 | Bacteria | 3100 |
| 9 | Ga0070683_100173457 | 3300005329 | Bacteria | 2047 |
| 10 | Ga0070683_100236990 | 3300005329 | Bacteria | 1735 |
| 11 | Ga0070680_100108855 | 3300005336 | Bacteria | 2305 |
| 12 | Ga0070682_100002746 | 3300005337 | Bacteria | 9750 |
| 13 | Ga0070682_100044017 | 3300005337 | Bacteria | 2762 |
| 14 | Ga0070682_100193492 | 3300005337 | Bacteria | 1429 |
| 15 | Ga0068868_100020069 | 3300005338 | Bacteria | 5016 |
| 16 | Ga0070660_100084688 | 3300005339 | Bacteria | 2492 |
| 17 | Ga0070660_100173781 | 3300005339 | Bacteria | 1741 |
| 18 | Ga0070660_100195402 | 3300005339 | Bacteria | 1640 |
| 19 | Ga0070691_10041579 | 3300005341 | Bacteria | 2173 |
| 20 | Ga0070691_10125745 | 3300005341 | Bacteria | 1295 |
| 21 | Ga0070661_100149372 | 3300005344 | Bacteria | 1765 |
| 22 | Ga0070692_10095894 | 3300005345 | Bacteria | 1619 |
| 23 | Ga0070675_100105217 | 3300005354 | Bacteria | 2381 |
| 24 | Ga0070659_100012412 | 3300005366 | Bacteria | 6318 |
| 25 | Ga0070659_100035946 | 3300005366 | Bacteria | 3860 |
| 26 | Ga0070709_10000860 | 3300005434 | Bacteria | 16969 |
| 27 | Ga0070709_10006505 | 3300005434 | Bacteria | 6370 |
| 28 | Ga0070709_10072398 | 3300005434 | Bacteria | 2228 |
| 29 | Ga0070714_100000689 | 3300005435 | Bacteria | 23869 |
| 30 | Ga0070714_100008563 | 3300005435 | Bacteria | 7998 |
| 31 | Ga0070714_100032055 | 3300005435 | Bacteria | 4387 |
| 32 | Ga0070714_100039832 | 3300005435 | Bacteria | 3958 |
| 33 | Ga0070714_100053955 | 3300005435 | Bacteria | 3433 |
| 34 | Ga0070714_100058409 | 3300005435 | Bacteria | 3304 |
| 35 | Ga0070714_100060750 | 3300005435 | Bacteria | 3244 |
| 36 | Ga0070714_100339940 | 3300005435 | Bacteria | 1408 |
| 37 | Ga0070713_100005240 | 3300005436 | Bacteria | 8838 |
| 38 | Ga0070713_100015430 | 3300005436 | Bacteria | 5711 |
| 39 | Ga0070713_100016652 | 3300005436 | Bacteria | 5531 |
| 40 | Ga0070713_100034356 | 3300005436 | Bacteria | 4072 |
| 41 | Ga0070713_100040573 | 3300005436 | Bacteria | 3785 |
| 42 | Ga0070713_100056444 | 3300005436 | Bacteria | 3267 |
| 43 | Ga0070713_100102646 | 3300005436 | Bacteria | 2480 |
| 44 | Ga0070713_100119803 | 3300005436 | Bacteria | 2306 |
| 45 | Ga0070710_10001129 | 3300005437 | Bacteria | 12635 |
| 46 | Ga0070710_10005384 | 3300005437 | Bacteria | 6073 |
| 47 | Ga0070710_10066854 | 3300005437 | Bacteria | 2061 |
| 48 | Ga0070711_100001373 | 3300005439 | Bacteria | 13307 |
| 49 | Ga0070711_100113632 | 3300005439 | Bacteria | 1991 |
| 50 | Ga0070705_100174382 | 3300005440 | Bacteria | 1450 |
| 51 | Ga0070700_100161241 | 3300005441 | Bacteria | 1544 |
| 52 | Ga0070708_100000572 | 3300005445 | Bacteria | 27610 |
| 53 | Ga0070708_100004428 | 3300005445 | Bacteria | 11035 |
| 54 | Ga0070708_100164741 | 3300005445 | Bacteria | 2067 |
| 55 | Ga0070708_100430744 | 3300005445 | Bacteria | 1244 |
| 56 | Ga0070663_100041840 | 3300005455 | Bacteria | 3217 |
| 57 | Ga0070685_10182773 | 3300005466 | Bacteria | 1351 |
| 58 | Ga0070706_100005350 | 3300005467 | Bacteria | 12234 |
| 59 | Ga0070706_100009709 | 3300005467 | Bacteria | 8945 |
| 60 | Ga0070706_100016121 | 3300005467 | Bacteria | 6900 |
| 61 | Ga0070706_100020458 | 3300005467 | Bacteria | 6100 |
| 62 | Ga0070706_100021910 | 3300005467 | Bacteria | 5884 |
| 63 | Ga0070707_100003304 | 3300005468 | Bacteria | 15226 |
| 64 | Ga0070707_100003555 | 3300005468 | Bacteria | 14713 |
| 65 | Ga0070707_100004577 | 3300005468 | Bacteria | 12950 |
| 66 | Ga0070707_100007078 | 3300005468 | Bacteria | 10401 |
| 67 | Ga0070707_100062407 | 3300005468 | Bacteria | 3575 |
| 68 | Ga0070707_100119997 | 3300005468 | Bacteria | 2553 |
| 69 | Ga0070707_100127635 | 3300005468 | Bacteria | 2471 |
| 70 | Ga0070698_100000677 | 3300005471 | Bacteria | 36359 |
| 71 | Ga0070698_100000986 | 3300005471 | Bacteria | 31324 |
| 72 | Ga0070698_100006573 | 3300005471 | Bacteria | 12610 |
| 73 | Ga0070698_100009522 | 3300005471 | Bacteria | 10403 |
| 74 | Ga0070698_100010816 | 3300005471 | Bacteria | 9712 |
| 75 | Ga0070698_100061266 | 3300005471 | Bacteria | 3796 |
| 76 | Ga0070698_100085106 | 3300005471 | Bacteria | 3150 |
| 77 | Ga0070698_100182287 | 3300005471 | Bacteria | 2038 |
| 78 | Ga0070699_100153687 | 3300005518 | Bacteria | 2036 |
| 79 | Ga0070699_100349094 | 3300005518 | Bacteria | 1332 |
| 80 | Ga0070699_100365505 | 3300005518 | Bacteria | 1301 |
| 81 | Ga0070679_100068481 | 3300005530 | Bacteria | 3540 |
| 82 | Ga0070679_100189982 | 3300005530 | Bacteria | 2023 |
| 83 | Ga0070679_100205666 | 3300005530 | Bacteria | 1933 |
| 84 | Ga0070684_100000608 | 3300005535 | Bacteria | 24723 |
| 85 | Ga0070684_100002313 | 3300005535 | Bacteria | 14044 |
| 86 | Ga0070684_100020130 | 3300005535 | Bacteria | 5535 |
| 87 | Ga0070684_100038507 | 3300005535 | Bacteria | 4107 |
| 88 | Ga0070684_100045374 | 3300005535 | Bacteria | 3806 |
| 89 | Ga0070697_100030792 | 3300005536 | Bacteria | 4312 |
| 90 | Ga0070697_100056089 | 3300005536 | Bacteria | 3204 |
| 91 | Ga0068853_100062864 | 3300005539 | Bacteria | 3214 |
| 92 | Ga0068853_100117379 | 3300005539 | Bacteria | 2370 |
| 93 | Ga0070686_100252333 | 3300005544 | Bacteria | 1289 |
| 94 | Ga0070696_100243923 | 3300005546 | Bacteria | 1356 |
| 95 | Ga0070693_100059186 | 3300005547 | Bacteria | 2220 |
| 96 | Ga0070665_100000582 | 3300005548 | Bacteria | 50895 |
| 97 | Ga0070665_100081229 | 3300005548 | Bacteria | 3247 |
| 98 | Ga0070665_100212801 | 3300005548 | Bacteria | 1934 |
| 99 | Ga0068855_100093327 | 3300005563 | Bacteria | 3470 |
| 100 | Ga0068855_100205944 | 3300005563 | Bacteria | 2213 |
| 101 | Ga0070664_100040523 | 3300005564 | Bacteria | 3927 |
| 102 | Ga0070664_100294746 | 3300005564 | Bacteria | 1465 |
| 103 | Ga0068857_100008605 | 3300005577 | Bacteria | 8830 |
| 104 | Ga0068857_100020356 | 3300005577 | Bacteria | 5835 |
| 105 | Ga0068857_100191074 | 3300005577 | Bacteria | 1865 |
| 106 | Ga0068857_100193134 | 3300005577 | Bacteria | 1854 |
| 107 | Ga0068856_100065834 | 3300005614 | Bacteria | 3581 |
| 108 | Ga0068856_100068931 | 3300005614 | Bacteria | 3497 |
| 109 | Ga0068856_100102493 | 3300005614 | Bacteria | 2856 |
| 110 | Ga0070702_100169701 | 3300005615 | Bacteria | 1418 |
| 111 | Ga0068852_100030636 | 3300005616 | Bacteria | 4432 |
| 112 | Ga0068852_100072771 | 3300005616 | Bacteria | 3022 |
| 113 | Ga0068859_100038330 | 3300005617 | Bacteria | 4809 |
| 114 | Ga0068859_100359984 | 3300005617 | Bacteria | 1550 |
| 115 | Ga0068863_100088483 | 3300005841 | Bacteria | 2935 |
| 116 | Ga0068863_100208021 | 3300005841 | Bacteria | 1884 |
| 117 | Ga0068858_100020418 | 3300005842 | Bacteria | 6194 |
| 118 | Ga0068858_100237970 | 3300005842 | Bacteria | 1727 |
| 119 | Ga0081455_10112013 | 3300005937 | Bacteria | 2167 |
| 120 | Ga0081538_10002686 | 3300005981 | Bacteria | 17125 |
| 121 | Ga0081538_10002769 | 3300005981 | Bacteria | 16806 |
| 122 | Ga0081538_10008960 | 3300005981 | Bacteria | 8408 |
| 123 | Ga0081540_1000362 | 3300005983 | Bacteria | 45713 |
| 124 | Ga0081540_1005003 | 3300005983 | Bacteria | 9962 |
| 125 | Ga0081540_1020904 | 3300005983 | Bacteria | 3919 |
| 126 | Ga0081539_10000039 | 3300005985 | Bacteria | 295914 |
| 127 | Ga0081539_10004894 | 3300005985 | Bacteria | 14288 |
| 128 | Ga0081539_10006034 | 3300005985 | Bacteria | 11869 |
| 129 | Ga0081539_10053769 | 3300005985 | Bacteria | 2252 |
| 130 | Ga0070717_10035078 | 3300006028 | Bacteria | 4058 |
| 131 | Ga0070717_10052905 | 3300006028 | Bacteria | 3346 |
| 132 | Ga0070717_10056812 | 3300006028 | Bacteria | 3235 |
| 133 | Ga0070717_10074523 | 3300006028 | Bacteria | 2837 |
| 134 | Ga0070717_10079373 | 3300006028 | Bacteria | 2752 |
| 135 | Ga0070717_10084720 | 3300006028 | Bacteria | 2666 |
| 136 | Ga0070717_10091955 | 3300006028 | Bacteria | 2563 |
| 137 | Ga0070717_10146186 | 3300006028 | Bacteria | 2042 |
| 138 | Ga0070717_10271008 | 3300006028 | Bacteria | 1504 |
| 139 | Ga0075432_10001729 | 3300006058 | Bacteria | 7183 |
| 140 | Ga0070715_10004785 | 3300006163 | Bacteria | 4478 |
| 141 | Ga0070716_100002145 | 3300006173 | Bacteria | 9066 |
| 142 | Ga0070716_100010128 | 3300006173 | Bacteria | 4720 |
| 143 | Ga0070716_100035985 | 3300006173 | Bacteria | 2726 |
| 144 | Ga0070716_100094031 | 3300006173 | Bacteria | 1821 |
| 145 | Ga0070716_100156320 | 3300006173 | Bacteria | 1473 |
| 146 | Ga0070712_100028908 | 3300006175 | Bacteria | 3712 |
| 147 | Ga0070712_100035014 | 3300006175 | Bacteria | 3406 |
| 148 | Ga0075367_10000378 | 3300006178 | Bacteria | 16096 |
| 149 | Ga0068871_100245715 | 3300006358 | Bacteria | 1557 |
| 150 | Ga0068871_100446539 | 3300006358 | Bacteria | 1158 |
| 151 | Ga0075428_100078984 | 3300006844 | Bacteria | 3591 |
| 152 | Ga0075430_100006129 | 3300006846 | Bacteria | 10131 |
| 153 | Ga0075431_100177162 | 3300006847 | Bacteria | 2189 |
| 154 | Ga0075433_10052354 | 3300006852 | Bacteria | 3557 |
| 155 | Ga0075433_10179093 | 3300006852 | Bacteria | 1886 |
| 156 | Ga0075434_100016613 | 3300006871 | Bacteria | 7078 |
| 157 | Ga0075434_100129791 | 3300006871 | Bacteria | 2539 |
| 158 | Ga0075434_100138927 | 3300006871 | Bacteria | 2449 |
| 159 | Ga0075429_100070862 | 3300006880 | Bacteria | 3035 |
| 160 | Ga0068865_100023351 | 3300006881 | Bacteria | 4048 |
| 161 | Ga0068865_100052087 | 3300006881 | Bacteria | 2836 |
| 162 | Ga0075436_100031854 | 3300006914 | Bacteria | 3633 |
| 163 | Ga0097620_100038330 | 3300006931 | Bacteria | 4809 |
| 164 | Ga0097620_100359963 | 3300006931 | Bacteria | 1550 |
| 165 | Ga0075435_100021794 | 3300007076 | Bacteria | 4935 |
| 166 | Ga0075435_100248277 | 3300007076 | Bacteria | 1515 |
| 167 | Ga0099794_10034778 | 3300007265 | Bacteria | 2376 |
| 168 | Ga0099795_10046895 | 3300007788 | Bacteria | 1559 |
| 169 | Ga0105240_10130379 | 3300009093 | Bacteria | 3017 |
| 170 | Ga0105240_10424807 | 3300009093 | Bacteria | 1492 |
| 171 | Ga0111539_10038804 | 3300009094 | Bacteria | 5744 |
| 172 | Ga0111539_10055365 | 3300009094 | Bacteria | 4715 |
| 173 | Ga0105245_10006123 | 3300009098 | Bacteria | 10580 |
| 174 | Ga0105245_10013974 | 3300009098 | Bacteria | 6992 |
| 175 | Ga0105245_10032946 | 3300009098 | Bacteria | 4589 |
| 176 | Ga0114129_10010765 | 3300009147 | Bacteria | 13035 |
| 177 | Ga0114129_10046417 | 3300009147 | Bacteria | 6105 |
| 178 | Ga0114129_10069176 | 3300009147 | Bacteria | 4921 |
| 179 | Ga0114129_10867256 | 3300009147 | Bacteria | 1146 |
| 180 | Ga0105241_10052977 | 3300009174 | Bacteria | 3101 |
| 181 | Ga0105248_10179331 | 3300009177 | Bacteria | 2387 |
| 182 | Ga0105237_10030620 | 3300009545 | Bacteria | 5464 |
| 183 | Ga0105237_10371231 | 3300009545 | Bacteria | 1435 |
| 184 | Ga0105238_10078537 | 3300009551 | Bacteria | 3290 |
| 185 | Ga0105249_10002630 | 3300009553 | Bacteria | 15550 |
| 186 | Ga0105249_10011140 | 3300009553 | Bacteria | 7899 |
| 187 | Ga0105249_10043204 | 3300009553 | Bacteria | 4100 |
| 188 | Ga0105239_10002393 | 3300010375 | Bacteria | 23914 |
| 189 | Ga0105239_10002486 | 3300010375 | Bacteria | 23478 |
| 190 | Ga0105239_10051480 | 3300010375 | Bacteria | 4514 |
| 191 | Ga0105246_10000375 | 3300011119 | Bacteria | 23857 |
| 192 | Ga0105246_10001529 | 3300011119 | Bacteria | 13708 |
| 193 | Ga0105246_10080398 | 3300011119 | Bacteria | 2320 |
| 194 | Ga0105246_10228961 | 3300011119 | Bacteria | 1462 |
| 195 | Ga0157373_10192458 | 3300013100 | Bacteria | 1437 |
| 196 | Ga0157370_10093073 | 3300013104 | Bacteria | 2829 |
| 197 | Ga0157369_10004516 | 3300013105 | Bacteria | 16375 |
| 198 | Ga0157369_10030857 | 3300013105 | Bacteria | 5908 |
| 199 | Ga0157369_10051301 | 3300013105 | Bacteria | 4464 |
| 200 | Ga0157369_10057279 | 3300013105 | Bacteria | 4205 |
| 201 | Ga0157369_10095454 | 3300013105 | Bacteria | 3173 |
| 202 | Ga0157374_10264870 | 3300013296 | Bacteria | 1694 |
| 203 | Ga0157374_10529327 | 3300013296 | Bacteria | 1185 |
| 204 | Ga0163162_10012538 | 3300013306 | Bacteria | 8280 |
| 205 | Ga0163162_10075259 | 3300013306 | Bacteria | 3437 |
| 206 | Ga0163162_10133191 | 3300013306 | Bacteria | 2595 |
| 207 | Ga0157372_10006919 | 3300013307 | Bacteria | 12068 |
| 208 | Ga0157372_10014256 | 3300013307 | Bacteria | 8497 |
| 209 | Ga0157372_10059793 | 3300013307 | Bacteria | 4263 |
| 210 | Ga0157375_10009992 | 3300013308 | Bacteria | 8342 |
| 211 | Ga0157375_10010284 | 3300013308 | Bacteria | 8231 |
| 212 | Ga0157375_10077426 | 3300013308 | Bacteria | 3355 |
| 213 | Ga0163163_10063038 | 3300014325 | Bacteria | 3675 |
| 214 | Ga0182008_10003575 | 3300014497 | Bacteria | 9317 |
| 215 | Ga0157379_10036296 | 3300014968 | Bacteria | 4395 |
| 216 | Ga0157379_10073580 | 3300014968 | Bacteria | 3059 |
| 217 | Ga0182007_10003274 | 3300015262 | Bacteria | 7696 |
| 218 | Ga0183367_1003 | 3300015688 | Bacteria | 814276 |
| 219 | Ga0163161_10053784 | 3300017792 | Bacteria | 2920 |
| 220 | Ga0206356_10634487 | 3300020070 | Bacteria | 1162 |
| 221 | Ga0206356_11862379 | 3300020070 | Bacteria | 3395 |
| 222 | Ga0206352_10692001 | 3300020078 | Bacteria | 2997 |
| 223 | Ga0206354_11398097 | 3300020081 | Bacteria | 2794 |
| 224 | Ga0206353_11223522 | 3300020082 | Bacteria | 1722 |
| 225 | Ga0206353_11401531 | 3300020082 | Bacteria | 4725 |
| 226 | Ga0213874_10010623 | 3300021377 | Bacteria | 2310 |
| 227 | Ga0213876_10032554 | 3300021384 | Bacteria | 2750 |
| 228 | Ga0213875_10000733 | 3300021388 | Bacteria | 25011 |
| 229 | Ga0213875_10001317 | 3300021388 | Bacteria | 16413 |
| 230 | Ga0213875_10072346 | 3300021388 | Bacteria | 1609 |
| 231 | Ga0224712_10010694 | 3300022467 | Bacteria | 2817 |
| 232 | Ga0224712_10027516 | 3300022467 | Bacteria | 2023 |
| 233 | Ga0224712_10050471 | 3300022467 | Bacteria | 1616 |
| 234 | Ga0209758_1010847 | 3300025297 | Bacteria | 5381 |
| 235 | Ga0207692_10008396 | 3300025898 | Bacteria | 4272 |
| 236 | Ga0207692_10015692 | 3300025898 | Bacteria | 3340 |
| 237 | Ga0207688_10019493 | 3300025901 | Bacteria | 3698 |
| 238 | Ga0207688_10071225 | 3300025901 | Bacteria | 1973 |
| 239 | Ga0207647_10003769 | 3300025904 | Bacteria | 11334 |
| 240 | Ga0207647_10040416 | 3300025904 | Bacteria | 2937 |
| 241 | Ga0207685_10002713 | 3300025905 | Bacteria | 4121 |
| 242 | Ga0207685_10042902 | 3300025905 | Bacteria | 1701 |
| 243 | Ga0207699_10004435 | 3300025906 | Bacteria | 6710 |
| 244 | Ga0207699_10007040 | 3300025906 | Bacteria | 5480 |
| 245 | Ga0207699_10008456 | 3300025906 | Bacteria | 5081 |
| 246 | Ga0207699_10012336 | 3300025906 | Bacteria | 4345 |
| 247 | Ga0207699_10085070 | 3300025906 | Bacteria | 1971 |
| 248 | Ga0207705_10028490 | 3300025909 | Bacteria | 3982 |
| 249 | Ga0207705_10028636 | 3300025909 | Bacteria | 3971 |
| 250 | Ga0207705_10050015 | 3300025909 | Bacteria | 3008 |
| 251 | Ga0207684_10000987 | 3300025910 | Bacteria | 31919 |
| 252 | Ga0207684_10001173 | 3300025910 | Bacteria | 29296 |
| 253 | Ga0207684_10004337 | 3300025910 | Bacteria | 13414 |
| 254 | Ga0207684_10008945 | 3300025910 | Bacteria | 8880 |
| 255 | Ga0207684_10049953 | 3300025910 | Bacteria | 3548 |
| 256 | Ga0207684_10054486 | 3300025910 | Bacteria | 3393 |
| 257 | Ga0207684_10108883 | 3300025910 | Bacteria | 2371 |
| 258 | Ga0207684_10236430 | 3300025910 | Bacteria | 1576 |
| 259 | Ga0207654_10031288 | 3300025911 | Bacteria | 2930 |
| 260 | Ga0207707_10073527 | 3300025912 | Bacteria | 2981 |
| 261 | Ga0207707_10214544 | 3300025912 | Bacteria | 1676 |
| 262 | Ga0207695_10025447 | 3300025913 | Bacteria | 6625 |
| 263 | Ga0207671_10000197 | 3300025914 | Bacteria | 93773 |
| 264 | Ga0207693_10047191 | 3300025915 | Bacteria | 3385 |
| 265 | Ga0207693_10235904 | 3300025915 | Bacteria | 1436 |
| 266 | Ga0207663_10001110 | 3300025916 | Bacteria | 12377 |
| 267 | Ga0207663_10045424 | 3300025916 | Bacteria | 2702 |
| 268 | Ga0207663_10120871 | 3300025916 | Bacteria | 1793 |
| 269 | Ga0207660_10076651 | 3300025917 | Bacteria | 2445 |
| 270 | Ga0207662_10058702 | 3300025918 | Bacteria | 2304 |
| 271 | Ga0207657_10051552 | 3300025919 | Bacteria | 3577 |
| 272 | Ga0207657_10057965 | 3300025919 | Bacteria | 3335 |
| 273 | Ga0207657_10285260 | 3300025919 | Bacteria | 1310 |
| 274 | Ga0207649_10099387 | 3300025920 | Bacteria | 1922 |
| 275 | Ga0207652_10203944 | 3300025921 | Bacteria | 1780 |
| 276 | Ga0207646_10000049 | 3300025922 | Bacteria | 171680 |
| 277 | Ga0207646_10007857 | 3300025922 | Bacteria | 10778 |
| 278 | Ga0207646_10018496 | 3300025922 | Bacteria | 6497 |
| 279 | Ga0207646_10051512 | 3300025922 | Bacteria | 3683 |
| 280 | Ga0207646_10057527 | 3300025922 | Bacteria | 3474 |
| 281 | Ga0207646_10129186 | 3300025922 | Bacteria | 2273 |
| 282 | Ga0207646_10135456 | 3300025922 | Bacteria | 2217 |
| 283 | Ga0207646_10146084 | 3300025922 | Bacteria | 2131 |
| 284 | Ga0207694_10060725 | 3300025924 | Bacteria | 2942 |
| 285 | Ga0207687_10043182 | 3300025927 | Bacteria | 3105 |
| 286 | Ga0207700_10003695 | 3300025928 | Bacteria | 8926 |
| 287 | Ga0207700_10003979 | 3300025928 | Bacteria | 8650 |
| 288 | Ga0207700_10006305 | 3300025928 | Bacteria | 7155 |
| 289 | Ga0207700_10008111 | 3300025928 | Bacteria | 6483 |
| 290 | Ga0207700_10068205 | 3300025928 | Bacteria | 2725 |
| 291 | Ga0207700_10129802 | 3300025928 | Bacteria | 2056 |
| 292 | Ga0207700_10215218 | 3300025928 | Bacteria | 1626 |
| 293 | Ga0207664_10005230 | 3300025929 | Bacteria | 8852 |
| 294 | Ga0207664_10005718 | 3300025929 | Bacteria | 8501 |
| 295 | Ga0207664_10012080 | 3300025929 | Bacteria | 6167 |
| 296 | Ga0207664_10024351 | 3300025929 | Bacteria | 4549 |
| 297 | Ga0207664_10057241 | 3300025929 | Bacteria | 3098 |
| 298 | Ga0207664_10342894 | 3300025929 | Bacteria | 1321 |
| 299 | Ga0207690_10013592 | 3300025932 | Bacteria | 4894 |
| 300 | Ga0207690_10090061 | 3300025932 | Bacteria | 2165 |
| 301 | Ga0207706_10004215 | 3300025933 | Bacteria | 13541 |
| 302 | Ga0207669_10032987 | 3300025937 | Bacteria | 2916 |
| 303 | Ga0207704_10029079 | 3300025938 | Bacteria | 3075 |
| 304 | Ga0207704_10033132 | 3300025938 | Bacteria | 2934 |
| 305 | Ga0207665_10004164 | 3300025939 | Bacteria | 9626 |
| 306 | Ga0207665_10020054 | 3300025939 | Bacteria | 4391 |
| 307 | Ga0207665_10061603 | 3300025939 | Bacteria | 2544 |
| 308 | Ga0207661_10001526 | 3300025944 | Bacteria | 15727 |
| 309 | Ga0207661_10013022 | 3300025944 | Bacteria | 6069 |
| 310 | Ga0207661_10077242 | 3300025944 | Bacteria | 2738 |
| 311 | Ga0207661_10148458 | 3300025944 | Bacteria | 2025 |
| 312 | Ga0207679_10024923 | 3300025945 | Bacteria | 4107 |
| 313 | Ga0207679_10175210 | 3300025945 | Bacteria | 1770 |
| 314 | Ga0207667_10109524 | 3300025949 | Bacteria | 2848 |
| 315 | Ga0207667_10216285 | 3300025949 | Bacteria | 1963 |
| 316 | Ga0207712_10065078 | 3300025961 | Bacteria | 2601 |
| 317 | Ga0207712_10078665 | 3300025961 | Bacteria | 2394 |
| 318 | Ga0207668_10116748 | 3300025972 | Bacteria | 2013 |
| 319 | Ga0207640_10021202 | 3300025981 | Bacteria | 3869 |
| 320 | Ga0207658_10102280 | 3300025986 | Bacteria | 2247 |
| 321 | Ga0207677_10309929 | 3300026023 | Bacteria | 1307 |
| 322 | Ga0207703_10048104 | 3300026035 | Bacteria | 3440 |
| 323 | Ga0207703_10102134 | 3300026035 | Bacteria | 2433 |
| 324 | Ga0207703_10320547 | 3300026035 | Bacteria | 1419 |
| 325 | Ga0207639_10349244 | 3300026041 | Bacteria | 1321 |
| 326 | Ga0207678_10022818 | 3300026067 | Bacteria | 5481 |
| 327 | Ga0207678_10273427 | 3300026067 | Bacteria | 1449 |
| 328 | Ga0207708_10188986 | 3300026075 | Bacteria | 1639 |
| 329 | Ga0207702_10028124 | 3300026078 | Bacteria | 4671 |
| 330 | Ga0207702_10076975 | 3300026078 | Bacteria | 2884 |
| 331 | Ga0207702_10087925 | 3300026078 | Bacteria | 2714 |
| 332 | Ga0207702_10145929 | 3300026078 | Bacteria | 2147 |
| 333 | Ga0207676_10193894 | 3300026095 | Bacteria | 1790 |
| 334 | Ga0207676_10541905 | 3300026095 | Bacteria | 1111 |
| 335 | Ga0207674_10007103 | 3300026116 | Bacteria | 13086 |
| 336 | Ga0207674_10024704 | 3300026116 | Bacteria | 6415 |
| 337 | Ga0207674_10028804 | 3300026116 | Bacteria | 5855 |
| 338 | Ga0207674_10047529 | 3300026116 | Bacteria | 4398 |
| 339 | Ga0207675_100002050 | 3300026118 | Bacteria | 20092 |
| 340 | Ga0207683_10067823 | 3300026121 | Bacteria | 3148 |
| 341 | Ga0207698_10044778 | 3300026142 | Bacteria | 3329 |
| 342 | Ga0207428_10022977 | 3300027907 | Bacteria | 5252 |
| 343 | Ga0268266_10003627 | 3300028379 | Bacteria | 15268 |
| 344 | Ga0268266_10148383 | 3300028379 | Bacteria | 2111 |
| 345 | Ga0268265_10168578 | 3300028380 | Bacteria | 1869 |
| 346 | Ga0268264_10029455 | 3300028381 | Bacteria | 4496 |
| 347 | Ga0268264_10274692 | 3300028381 | Bacteria | 1576 |
| 348 | Ga0307517_10001103 | 3300028786 | Bacteria | 45619 |
| 349 | Ga0307517_10001543 | 3300028786 | Bacteria | 38377 |
| 350 | Ga0307515_10002955 | 3300028794 | Bacteria | 36045 |
| 351 | Ga0265338_10006470 | 3300028800 | Bacteria | 14924 |
| 352 | Ga0265338_10007640 | 3300028800 | Bacteria | 13342 |
| 353 | Ga0265338_10007919 | 3300028800 | Bacteria | 13017 |
| 354 | Ga0307511_10000334 | 3300030521 | Bacteria | 50044 |
| 355 | Ga0307511_10080861 | 3300030521 | Bacteria | 2286 |
| 356 | Ga0307511_10116044 | 3300030521 | Bacteria | 1679 |
| 357 | Ga0307512_10001670 | 3300030522 | Bacteria | 30513 |
| 358 | Ga0307512_10053638 | 3300030522 | Bacteria | 3204 |
| 359 | Ga0307513_10001865 | 3300031456 | Bacteria | 29946 |
| 360 | Ga0307513_10134545 | 3300031456 | Bacteria | 2410 |
| 361 | Ga0307509_10024865 | 3300031507 | Bacteria | 6700 |
| 362 | Ga0307509_10030629 | 3300031507 | Bacteria | 5948 |
| 363 | Ga0307408_100015369 | 3300031548 | Bacteria | 5095 |
| 364 | Ga0307408_100250961 | 3300031548 | Bacteria | 1459 |
| 365 | Ga0307508_10002111 | 3300031616 | Bacteria | 21339 |
| 366 | Ga0307508_10002445 | 3300031616 | Bacteria | 19572 |
| 367 | Ga0307508_10010556 | 3300031616 | Bacteria | 8451 |
| 368 | Ga0307514_10140248 | 3300031649 | Bacteria | 1645 |
| 369 | Ga0307516_10028396 | 3300031730 | Bacteria | 5661 |
| 370 | Ga0307405_10048727 | 3300031731 | Bacteria | 2614 |
| 371 | Ga0307405_10054300 | 3300031731 | Bacteria | 2500 |
| 372 | Ga0307405_10055207 | 3300031731 | Bacteria | 2485 |
| 373 | Ga0307405_10082874 | 3300031731 | Bacteria | 2101 |
| 374 | Ga0307405_10113982 | 3300031731 | Bacteria | 1836 |
| 375 | Ga0307413_10020376 | 3300031824 | Bacteria | 3525 |
| 376 | Ga0307518_10020369 | 3300031838 | Bacteria | 4766 |
| 377 | Ga0307518_10067094 | 3300031838 | Bacteria | 2602 |
| 378 | Ga0307410_10009806 | 3300031852 | Bacteria | 5392 |
| 379 | Ga0307410_10031309 | 3300031852 | Bacteria | 3412 |
| 380 | Ga0307410_10196612 | 3300031852 | Bacteria | 1537 |
| 381 | Ga0307406_10029112 | 3300031901 | Bacteria | 3342 |
| 382 | Ga0307406_10115818 | 3300031901 | Bacteria | 1853 |
| 383 | Ga0307407_10003597 | 3300031903 | Bacteria | 6407 |
| 384 | Ga0307407_10018666 | 3300031903 | Bacteria | 3513 |
| 385 | Ga0307409_100001240 | 3300031995 | Bacteria | 12299 |
| 386 | Ga0307416_100000885 | 3300032002 | Bacteria | 15784 |
| 387 | Ga0307416_100005485 | 3300032002 | Bacteria | 7794 |
| 388 | Ga0307416_100025764 | 3300032002 | Bacteria | 4319 |
| 389 | Ga0307416_100155120 | 3300032002 | Bacteria | 2107 |
| 390 | Ga0307416_100259631 | 3300032002 | Bacteria | 1697 |
| 391 | Ga0307416_100546994 | 3300032002 | Bacteria | 1230 |
| 392 | Ga0307414_10033856 | 3300032004 | Bacteria | 3381 |
| 393 | Ga0307414_10049041 | 3300032004 | Bacteria | 2917 |
| 394 | Ga0307414_10069025 | 3300032004 | Bacteria | 2539 |
| 395 | Ga0307414_10200278 | 3300032004 | Bacteria | 1623 |
| 396 | Ga0307411_10080483 | 3300032005 | Bacteria | 2240 |
| 397 | Ga0307411_10097769 | 3300032005 | Bacteria | 2067 |
| 398 | Ga0307415_100008431 | 3300032126 | Bacteria | 5710 |
| 399 | Ga0307415_100009901 | 3300032126 | Bacteria | 5373 |
| 400 | Ga0307415_100036653 | 3300032126 | Bacteria | 3215 |
| 401 | Ga0307415_100043355 | 3300032126 | Bacteria | 3001 |
| 402 | Ga0307415_100063572 | 3300032126 | Bacteria | 2565 |
| 403 | Ga0307507_10031417 | 3300033179 | Bacteria | 5576 |
| 404 | Ga0307507_10104011 | 3300033179 | Bacteria | 2359 |
| 405 | Ga0307507_10179135 | 3300033179 | Bacteria | 1519 |
| 406 | Ga0307510_10015027 | 3300033180 | Bacteria | 9155 |
| 407 | Ga0316214_1001164 | 3300033545 | Bacteria | 2971 |
| 408 | Ga0373948_0045592 | 3300034817 | Bacteria | 930 |
| 409 | Ga0373926_0000303 | 3300035083 | Bacteria | 12183 |
| 410 | Ga0373926_0102196 | 3300035083 | Bacteria | 1072 |
| 411 | Ga0373934_0000901 | 3300035086 | Bacteria | 10732 |
| 412 | Ga0373934_0048431 | 3300035086 | Bacteria | 1682 |
| 413 | Ga0373940_0040899 | 3300035088 | Bacteria | 1274 |
| 414 | Ga0373944_0023619 | 3300035089 | Bacteria | 1795 |
| 415 | Ga0373949_0035623 | 3300035090 | Bacteria | 1204 |
| 416 | Ga0373923_0001192 | 3300035111 | Bacteria | 7269 |
| 417 | Ga0373923_0006452 | 3300035111 | Bacteria | 4057 |
| 418 | Ga0373936_0000261 | 3300035113 | Bacteria | 17307 |
| 419 | Ga0373936_0003311 | 3300035113 | Bacteria | 6043 |
| 420 | Ga0373939_0003903 | 3300035114 | Bacteria | 3508 |
| 421 | Ga0373941_0013082 | 3300035115 | Bacteria | 2186 |
| 422 | Ga0373945_0001094 | 3300035116 | Bacteria | 8161 |
| 423 | Ga0373953_0000513 | 3300035117 | Bacteria | 10765 |
| 424 | Ga0373953_0011058 | 3300035117 | Bacteria | 3155 |
| 425 | Ga0373953_0068048 | 3300035117 | Bacteria | 1465 |
| 426 | Ga0373954_0003115 | 3300035118 | Bacteria | 7001 |
| 427 | Ga0373954_0012807 | 3300035118 | Bacteria | 3734 |
| 428 | Ga0373954_0017144 | 3300035118 | Bacteria | 3249 |
| 429 | Ga0373954_0036240 | 3300035118 | Bacteria | 2289 |
| 430 | Ga0373956_0009927 | 3300035119 | Bacteria | 3882 |
| 431 | Ga0373956_0018086 | 3300035119 | Bacteria | 2980 |
| 432 | Ga0373957_0000657 | 3300035120 | Bacteria | 8889 |
| 433 | Ga0373957_0000760 | 3300035120 | Bacteria | 8375 |
| 434 | Ga0373957_0007245 | 3300035120 | Bacteria | 3544 |
| 435 | Ga0373957_0010835 | 3300035120 | Bacteria | 3025 |
| 436 | Ga0373957_0012232 | 3300035120 | Bacteria | 2885 |
| 437 | Ga0373957_0065310 | 3300035120 | Bacteria | 1416 |
| 438 | Ga0373960_0058072 | 3300035121 | Bacteria | 1166 |
| 439 | Ga0373943_0039356 | 3300035170 | Bacteria | 2277 |
| 440 | Ga0373943_0111130 | 3300035170 | Bacteria | 1445 |
| 441 | Ga0373946_0003584 | 3300035171 | Bacteria | 5508 |
| 442 | Ga0373946_0009123 | 3300035171 | Bacteria | 3651 |
| 443 | Ga0373946_0033982 | 3300035171 | Bacteria | 2056 |
| 444 | Ga0373946_0134219 | 3300035171 | Bacteria | 1141 |
| 445 | Ga0373955_0000006 | 3300035172 | Bacteria | 101050 |
| 446 | Ga0373955_0002081 | 3300035172 | Bacteria | 8629 |
| 447 | Ga0373955_0029188 | 3300035172 | Bacteria | 2866 |
| 448 | Ga0373955_0063906 | 3300035172 | Bacteria | 2038 |
| 449 | Ga0373955_0068852 | 3300035172 | Bacteria | 1973 |
| 450 | Ga0373942_0000318 | 3300035207 | Bacteria | 13094 |
| 451 | Ga0373924_0000743 | 3300035410 | Bacteria | 10150 |
| 452 | Ga0373924_0001349 | 3300035410 | Bacteria | 7914 |
| 453 | Ga0373924_0003886 | 3300035410 | Bacteria | 5177 |
| 454 | Ga0373924_0058859 | 3300035410 | Bacteria | 1604 |
| 455 | Ga0373935_0010564 | 3300035692 | Bacteria | 5539 |
| 456 | Ga0373935_0012709 | 3300035692 | Bacteria | 5068 |
| 457 | Ga0373935_0213332 | 3300035692 | Bacteria | 1338 |
| 458 | Ga0373927_0023290 | 3300035695 | Bacteria | 4056 |
| 459 | Ga0373927_0195461 | 3300035695 | Bacteria | 1327 |
| 460 | Ga0373933_0012156 | 3300035724 | Bacteria | 4755 |
| 461 | Ga0373933_0077306 | 3300035724 | Bacteria | 2034 |
| 462 | Ga0373933_0093070 | 3300035724 | Bacteria | 1862 |
| 463 | Ga0373933_0094971 | 3300035724 | Bacteria | 1844 |
| 464 | Ga0373933_0240472 | 3300035724 | Bacteria | 1164 |
| 465 | Ga0373947_0000002 | 3300035725 | Bacteria | 383924 |
| 466 | Ga0373947_0005570 | 3300035725 | Bacteria | 7338 |
| 467 | Ga0373937_0000039 | 3300036401 | Bacteria | 109668 |
| 468 | Ga0373937_0019920 | 3300036401 | Bacteria | 6009 |
| 469 | Ga0373937_0051116 | 3300036401 | Bacteria | 3788 |
| 470 | Ga0373937_0170479 | 3300036401 | Bacteria | 2042 |
| 471 | Ga0373937_0213368 | 3300036401 | Bacteria | 1816 |
| 472 | Ga0373925_0000129 | 3300037068 | Bacteria | 80897 |
| 473 | Ga0373925_0000789 | 3300037068 | Bacteria | 29187 |
| 474 | Ga0373925_0004572 | 3300037068 | Bacteria | 10456 |
| 475 | Ga0373925_0014080 | 3300037068 | Bacteria | 5788 |
| 476 | Ga0373925_0037019 | 3300037068 | Bacteria | 3600 |
| 477 | Ga0373925_0074646 | 3300037068 | Bacteria | 2568 |
| 478 | Ga0373925_0237633 | 3300037068 | Bacteria | 1458 |
| 479 | Ga0395899_0134922 | 3300037312 | Bacteria | 1760 |
| 480 | Ga0395900_0001460 | 3300037418 | Bacteria | 28192 |
| 481 | Ga0395900_0017541 | 3300037418 | Bacteria | 7305 |
| 482 | Ga0395900_0021811 | 3300037418 | Bacteria | 6548 |
| 483 | Ga0395900_0042006 | 3300037418 | Bacteria | 4711 |
| 484 | Ga0395900_0047250 | 3300037418 | Bacteria | 4432 |
| 485 | Ga0395898_0012712 | 3300037466 | Bacteria | 8694 |
| 486 | Ga0395898_0034736 | 3300037466 | Bacteria | 5019 |
| 487 | Ga0395898_0204919 | 3300037466 | Bacteria | 1882 |
| 488 | Ga0395905_0002907 | 3300037471 | Bacteria | 18691 |
| 489 | Ga0395905_0015416 | 3300037471 | Bacteria | 7265 |
| 490 | Ga0436364_0185875 | 3300037853 | Bacteria | 1399 |
| 491 | Ga0436364_0403534 | 3300037853 | Bacteria | 17431 |
| 492 | Ga0436364_0770879 | 3300037853 | Bacteria | 5466 |
| 493 | Ga0436364_1220868 | 3300037853 | Bacteria | 4901 |
| 494 | Ga0436364_1535764 | 3300037853 | Bacteria | 8445 |
| 495 | Ga0395901_0005424 | 3300038443 | Bacteria | 12904 |
| 496 | Ga0395901_0015291 | 3300038443 | Bacteria | 7808 |
| 497 | Ga0395901_0019313 | 3300038443 | Bacteria | 6967 |
| 498 | Ga0395901_0092863 | 3300038443 | Bacteria | 3159 |
| 499 | Ga0395901_0113364 | 3300038443 | Bacteria | 2847 |
| 500 | Ga0436363_1185395 | 3300039450 | Bacteria | 1702 |
| 501 | Ga0436363_1403459 | 3300039450 | Bacteria | 2927 |
| 502 | Ga0436362_0651943 | 3300039453 | Bacteria | 1187 |
| 503 | Ga0439443_025121 | 3300042003 | Bacteria | 959 |
| 504 | Ga0439448_0004998 | 3300042005 | Bacteria | 3769 |
| 505 | Ga0439450_000186 | 3300042008 | Bacteria | 7237 |
| 506 | Ga0439450_012499 | 3300042008 | Bacteria | 1686 |
| 507 | Ga0439450_036932 | 3300042008 | Bacteria | 1120 |
| 508 | Ga0439451_009603 | 3300042009 | Bacteria | 1957 |
| 509 | Ga0439454_003425 | 3300042011 | Bacteria | 1763 |
| 510 | Ga0439455_0004764 | 3300042012 | Bacteria | 2708 |
| 511 | Ga0439455_0007280 | 3300042012 | Bacteria | 2335 |
| 512 | Ga0439463_002090 | 3300042016 | Bacteria | 5167 |
| 513 | Ga0439463_006978 | 3300042016 | Bacteria | 2787 |
| 514 | Ga0439463_013041 | 3300042016 | Bacteria | 2044 |
| 515 | Ga0450913_002786 | 3300042117 | Bacteria | 1102 |
| 516 | Ga0450888_001316 | 3300042126 | Bacteria | 2377 |
| 517 | Ga0450903_000015 | 3300042138 | Bacteria | 34074 |
| 518 | Ga0450904_002193 | 3300042139 | Bacteria | 2389 |
| 519 | Ga0439464_0005595 | 3300042439 | Bacteria | 3254 |
| 520 | Ga0439464_0007007 | 3300042439 | Bacteria | 2945 |
| 521 | Ga0439440_0000237 | 3300042993 | Bacteria | 8821 |
| 522 | Ga0466969_0000938 | 3300044656 | Bacteria | 15726 |
| 523 | Ga0466969_0073055 | 3300044656 | Bacteria | 1646 |
| 524 | Ga0466972_0060027 | 3300044658 | Bacteria | 1825 |
| 525 | Ga0466966_0010118 | 3300044684 | Bacteria | 6257 |
| 526 | Ga0466966_0035826 | 3300044684 | Bacteria | 3205 |
| 527 | Ga0466966_0115377 | 3300044684 | Bacteria | 1653 |
| 528 | Ga0466961_0036247 | 3300044693 | Bacteria | 3166 |
| 529 | Ga0466961_0052102 | 3300044693 | Bacteria | 2612 |
| 530 | Ga0466961_0108162 | 3300044693 | Bacteria | 1750 |
| 531 | Ga0466963_0033483 | 3300044694 | Bacteria | 3337 |
| 532 | Ga0466963_0051587 | 3300044694 | Bacteria | 2727 |
| 533 | Ga0466963_0087142 | 3300044694 | Bacteria | 2123 |
| 534 | Ga0466963_0218562 | 3300044694 | Bacteria | 1334 |
| 535 | Ga0466964_0097103 | 3300044706 | Bacteria | 1292 |
| 536 | Ga0466971_0002879 | 3300044719 | Bacteria | 7300 |
| 537 | Ga0466971_0086463 | 3300044719 | Bacteria | 1433 |
| 538 | Ga0466970_0117570 | 3300044765 | Bacteria | 1454 |
| 539 | Ga0466957_0045184 | 3300044842 | Bacteria | 2671 |
| 540 | Ga0466959_0020690 | 3300045049 | Bacteria | 4848 |
| 541 | Ga0466959_0186226 | 3300045049 | Bacteria | 1450 |
| 542 | Ga0466958_0054078 | 3300045836 | Bacteria | 2434 |
| 543 | Ga0466958_0072099 | 3300045836 | Bacteria | 2115 |
| 544 | Ga0466967_0016992 | 3300045976 | Bacteria | 5757 |
| 545 | Ga0466967_0019461 | 3300045976 | Bacteria | 5458 |
| 546 | Ga0466967_0025071 | 3300045976 | Bacteria | 4912 |
| 547 | Ga0466967_0026680 | 3300045976 | Bacteria | 4789 |
| 548 | Ga0466967_0037445 | 3300045976 | Bacteria | 4151 |
| 549 | Ga0466967_0112800 | 3300045976 | Bacteria | 2500 |
| 550 | Ga0466967_0146068 | 3300045976 | Bacteria | 2206 |
| 551 | Ga0466967_0198712 | 3300045976 | Bacteria | 1898 |
| 552 | Ga0466967_0247896 | 3300045976 | Bacteria | 1700 |
| 553 | Ga0466967_0316256 | 3300045976 | Bacteria | 1505 |
| 554 | Ga0495592_0000567 | 3300046454 | Bacteria | 26216 |
| 555 | Ga0495592_0005211 | 3300046454 | Bacteria | 9587 |
| 556 | Ga0495592_0020327 | 3300046454 | Bacteria | 5050 |
| 557 | Ga0495592_0060608 | 3300046454 | Bacteria | 2783 |
| 558 | Ga0495592_0142098 | 3300046454 | Bacteria | 1668 |
| 559 | Ga0495603_0000412 | 3300046455 | Bacteria | 23683 |
| 560 | Ga0495603_0002412 | 3300046455 | Bacteria | 10989 |
| 561 | Ga0495603_0004797 | 3300046455 | Bacteria | 8080 |
| 562 | Ga0495603_0006225 | 3300046455 | Bacteria | 7135 |
| 563 | Ga0495603_0007066 | 3300046455 | Bacteria | 6734 |
| 564 | Ga0495603_0038207 | 3300046455 | Bacteria | 2879 |
| 565 | Ga0495603_0070862 | 3300046455 | Bacteria | 2049 |
| 566 | Ga0495629_0000886 | 3300046459 | Bacteria | 24144 |
| 567 | Ga0495629_0003035 | 3300046459 | Bacteria | 12762 |
| 568 | Ga0495629_0004317 | 3300046459 | Bacteria | 10661 |
| 569 | Ga0495629_0004730 | 3300046459 | Bacteria | 10202 |
| 570 | Ga0495629_0008814 | 3300046459 | Bacteria | 7417 |
| 571 | Ga0495629_0012006 | 3300046459 | Bacteria | 6279 |
| 572 | Ga0495629_0017721 | 3300046459 | Bacteria | 5104 |
| 573 | Ga0495629_0018334 | 3300046459 | Bacteria | 5010 |
| 574 | Ga0495638_0083603 | 3300046460 | Bacteria | 1933 |
| 575 | Ga0495638_0133406 | 3300046460 | Bacteria | 1457 |
| 576 | Ga0495641_0004729 | 3300046461 | Bacteria | 9485 |
| 577 | Ga0495641_0006497 | 3300046461 | Bacteria | 7563 |
| 578 | Ga0495641_0008040 | 3300046461 | Bacteria | 6492 |
| 579 | Ga0495641_0039190 | 3300046461 | Bacteria | 2211 |
| 580 | Ga0495651_0000013 | 3300046462 | Bacteria | 137933 |
| 581 | Ga0495651_0002609 | 3300046462 | Bacteria | 13943 |
| 582 | Ga0495651_0004896 | 3300046462 | Bacteria | 10240 |
| 583 | Ga0495651_0005277 | 3300046462 | Bacteria | 9850 |
| 584 | Ga0495651_0006641 | 3300046462 | Bacteria | 8840 |
| 585 | Ga0495651_0015508 | 3300046462 | Bacteria | 5894 |
| 586 | Ga0495651_0053799 | 3300046462 | Bacteria | 3097 |
| 587 | Ga0495651_0062785 | 3300046462 | Bacteria | 2841 |
| 588 | Ga0495653_0005478 | 3300046463 | Bacteria | 10337 |
| 589 | Ga0495653_0006741 | 3300046463 | Bacteria | 9428 |
| 590 | Ga0495653_0038056 | 3300046463 | Bacteria | 3776 |
| 591 | Ga0495653_0113118 | 3300046463 | Bacteria | 1947 |
| 592 | Ga0495653_0197191 | 3300046463 | Bacteria | 1369 |
| 593 | Ga0495580_0006999 | 3300046472 | Bacteria | 9091 |
| 594 | Ga0495582_0002025 | 3300046473 | Bacteria | 11355 |
| 595 | Ga0495582_0005524 | 3300046473 | Bacteria | 7039 |
| 596 | Ga0495582_0016720 | 3300046473 | Bacteria | 4017 |
| 597 | Ga0495582_0022952 | 3300046473 | Bacteria | 3412 |
| 598 | Ga0495582_0161015 | 3300046473 | Bacteria | 1276 |
| 599 | Ga0495605_0016046 | 3300046474 | Bacteria | 4062 |
| 600 | Ga0495605_0039514 | 3300046474 | Bacteria | 2363 |
| 601 | Ga0495639_0006511 | 3300046475 | Bacteria | 5024 |
| 602 | Ga0495639_0135211 | 3300046475 | Bacteria | 1182 |
| 603 | Ga0495662_0000687 | 3300046476 | Bacteria | 15995 |
| 604 | Ga0495662_0002464 | 3300046476 | Bacteria | 9314 |
| 605 | Ga0495662_0003024 | 3300046476 | Bacteria | 8483 |
| 606 | Ga0495662_0003887 | 3300046476 | Bacteria | 7533 |
| 607 | Ga0495662_0006157 | 3300046476 | Bacteria | 5998 |
| 608 | Ga0495662_0015599 | 3300046476 | Bacteria | 3687 |
| 609 | Ga0495662_0073391 | 3300046476 | Bacteria | 1659 |
| 610 | Ga0495585_0173773 | 3300046492 | Bacteria | 1111 |
| 611 | Ga0495594_0002999 | 3300046499 | Bacteria | 8742 |
| 612 | Ga0495594_0005157 | 3300046499 | Bacteria | 6721 |
| 613 | Ga0495594_0008585 | 3300046499 | Bacteria | 5266 |
| 614 | Ga0495607_0063014 | 3300046501 | Bacteria | 2099 |
| 615 | Ga0495607_0078925 | 3300046501 | Bacteria | 1815 |
| 616 | Ga0495583_0011636 | 3300046506 | Bacteria | 5040 |
| 617 | Ga0495583_0085468 | 3300046506 | Bacteria | 1365 |
| 618 | Ga0495606_0012472 | 3300046507 | Bacteria | 6810 |
| 619 | Ga0495608_0000114 | 3300046511 | Bacteria | 57810 |
| 620 | Ga0495608_0002000 | 3300046511 | Bacteria | 14603 |
| 621 | Ga0495608_0067426 | 3300046511 | Bacteria | 2340 |
| 622 | Ga0495616_0010477 | 3300046513 | Bacteria | 5364 |
| 623 | Ga0495618_0004694 | 3300046514 | Bacteria | 8357 |
| 624 | Ga0495618_0010288 | 3300046514 | Bacteria | 5659 |
| 625 | Ga0495618_0046177 | 3300046514 | Bacteria | 2749 |
| 626 | Ga0495618_0197356 | 3300046514 | Bacteria | 1274 |
| 627 | Ga0495620_0002993 | 3300046515 | Bacteria | 9723 |
| 628 | Ga0495620_0014051 | 3300046515 | Bacteria | 4082 |
| 629 | Ga0495628_0039946 | 3300046516 | Bacteria | 3751 |
| 630 | Ga0495628_0044087 | 3300046516 | Bacteria | 3550 |
| 631 | Ga0495628_0046875 | 3300046516 | Bacteria | 3431 |
| 632 | Ga0495628_0064055 | 3300046516 | Bacteria | 2879 |
| 633 | Ga0495628_0081187 | 3300046516 | Bacteria | 2518 |
| 634 | Ga0495628_0143740 | 3300046516 | Bacteria | 1819 |
| 635 | Ga0495630_0016315 | 3300046517 | Bacteria | 5426 |
| 636 | Ga0495630_0100368 | 3300046517 | Bacteria | 2190 |
| 637 | Ga0495630_0122947 | 3300046517 | Bacteria | 1969 |
| 638 | Ga0495630_0169388 | 3300046517 | Bacteria | 1664 |
| 639 | Ga0495643_0001800 | 3300046522 | Bacteria | 18343 |
| 640 | Ga0495643_0006360 | 3300046522 | Bacteria | 7800 |
| 641 | Ga0495648_0033986 | 3300046524 | Bacteria | 3325 |
| 642 | Ga0495648_0146539 | 3300046524 | Bacteria | 1236 |
| 643 | Ga0495663_0038475 | 3300046525 | Bacteria | 1446 |
| 644 | Ga0495666_0002910 | 3300046526 | Bacteria | 8578 |
| 645 | Ga0495642_0055077 | 3300046528 | Bacteria | 1641 |
| 646 | Ga0495652_0000145 | 3300046529 | Bacteria | 80170 |
| 647 | Ga0495652_0001696 | 3300046529 | Bacteria | 23783 |
| 648 | Ga0495652_0002970 | 3300046529 | Bacteria | 17061 |
| 649 | Ga0495652_0022281 | 3300046529 | Bacteria | 5622 |
| 650 | Ga0495652_0123221 | 3300046529 | Bacteria | 2063 |
| 651 | Ga0495654_0035163 | 3300046530 | Bacteria | 2525 |
| 652 | Ga0495665_0009058 | 3300046531 | Bacteria | 5397 |
| 653 | Ga0495640_0012649 | 3300046533 | Bacteria | 6442 |
| 654 | Ga0495640_0017468 | 3300046533 | Bacteria | 5347 |
| 655 | Ga0495640_0027608 | 3300046533 | Bacteria | 4092 |
| 656 | Ga0495640_0031606 | 3300046533 | Bacteria | 3776 |
| 657 | Ga0495586_0005351 | 3300046535 | Bacteria | 6866 |
| 658 | Ga0495586_0090821 | 3300046535 | Bacteria | 1687 |
| 659 | Ga0495587_0000063 | 3300046536 | Bacteria | 91300 |
| 660 | Ga0495587_0003797 | 3300046536 | Bacteria | 10023 |
| 661 | Ga0495587_0022426 | 3300046536 | Bacteria | 3888 |
| 662 | Ga0495587_0059215 | 3300046536 | Bacteria | 2248 |
| 663 | Ga0495587_0094069 | 3300046536 | Bacteria | 1730 |
| 664 | Ga0495587_0126579 | 3300046536 | Bacteria | 1461 |
| 665 | Ga0495609_0011318 | 3300046538 | Bacteria | 4251 |
| 666 | Ga0495597_0027365 | 3300046542 | Bacteria | 2614 |
| 667 | Ga0495645_0005532 | 3300046543 | Bacteria | 8686 |
| 668 | Ga0495645_0034718 | 3300046543 | Bacteria | 3677 |
| 669 | Ga0495622_0138073 | 3300046557 | Bacteria | 1108 |
| 670 | Ga0495633_0027478 | 3300046558 | Bacteria | 2782 |
| 671 | Ga0495667_0000049 | 3300046559 | Bacteria | 115812 |
| 672 | Ga0495667_0001442 | 3300046559 | Bacteria | 15667 |
| 673 | Ga0495667_0004790 | 3300046559 | Bacteria | 9148 |
| 674 | Ga0495667_0008790 | 3300046559 | Bacteria | 6866 |
| 675 | Ga0495667_0024556 | 3300046559 | Bacteria | 4059 |
| 676 | Ga0495667_0105715 | 3300046559 | Bacteria | 1819 |
| 677 | Ga0495656_0000626 | 3300046615 | Bacteria | 11297 |
| 678 | Ga0495668_0008327 | 3300046616 | Bacteria | 6493 |
| 679 | Ga0495668_0017593 | 3300046616 | Bacteria | 4142 |
| 680 | Ga0495634_0004604 | 3300046642 | Bacteria | 10772 |
| 681 | Ga0495634_0004827 | 3300046642 | Bacteria | 10464 |
| 682 | Ga0495634_0014110 | 3300046642 | Bacteria | 5768 |
| 683 | Ga0495634_0054403 | 3300046642 | Bacteria | 2679 |
| 684 | Ga0495634_0063506 | 3300046642 | Bacteria | 2450 |
| 685 | Ga0495634_0067673 | 3300046642 | Bacteria | 2362 |
| 686 | Ga0495634_0085216 | 3300046642 | Bacteria | 2059 |
| 687 | Ga0495625_0009696 | 3300046660 | Bacteria | 8020 |
| 688 | Ga0495635_0008752 | 3300046663 | Bacteria | 7068 |
| 689 | Ga0495635_0017835 | 3300046663 | Bacteria | 4958 |
| 690 | Ga0495635_0029051 | 3300046663 | Bacteria | 3843 |
| 691 | Ga0495635_0057653 | 3300046663 | Bacteria | 2672 |
| 692 | Ga0495635_0113599 | 3300046663 | Bacteria | 1849 |
| 693 | Ga0495661_0058379 | 3300046665 | Bacteria | 2300 |
| 694 | Ga0495588_0001052 | 3300046674 | Bacteria | 11984 |
| 695 | Ga0495588_0009383 | 3300046674 | Bacteria | 4520 |
| 696 | Ga0495588_0019330 | 3300046674 | Bacteria | 3336 |
| 697 | Ga0495588_0083071 | 3300046674 | Bacteria | 1673 |
| 698 | Ga0495657_0000513 | 3300046675 | Bacteria | 36152 |
| 699 | Ga0495657_0003849 | 3300046675 | Bacteria | 12103 |
| 700 | Ga0495657_0006358 | 3300046675 | Bacteria | 9248 |
| 701 | Ga0495657_0010243 | 3300046675 | Bacteria | 7056 |
| 702 | Ga0495657_0011590 | 3300046675 | Bacteria | 6587 |
| 703 | Ga0495657_0015439 | 3300046675 | Bacteria | 5589 |
| 704 | Ga0495657_0029912 | 3300046675 | Bacteria | 3817 |
| 705 | Ga0495657_0050964 | 3300046675 | Bacteria | 2781 |
| 706 | Ga0495657_0111713 | 3300046675 | Bacteria | 1730 |
| 707 | Ga0495599_0000077 | 3300046678 | Bacteria | 68751 |
| 708 | Ga0495599_0001711 | 3300046678 | Bacteria | 12692 |
| 709 | Ga0495599_0008164 | 3300046678 | Bacteria | 6358 |
| 710 | Ga0495623_0016860 | 3300046679 | Bacteria | 4718 |
| 711 | Ga0495623_0043723 | 3300046679 | Bacteria | 2849 |
| 712 | Ga0495646_0004530 | 3300046680 | Bacteria | 8748 |
| 713 | Ga0495646_0083147 | 3300046680 | Bacteria | 1861 |
| 714 | Ga0495647_0003643 | 3300046681 | Bacteria | 4946 |
| 715 | Ga0495658_0011983 | 3300046683 | Bacteria | 4378 |
| 716 | Ga0495658_0015551 | 3300046683 | Bacteria | 3904 |
| 717 | Ga0495658_0016589 | 3300046683 | Bacteria | 3791 |
| 718 | Ga0495658_0024478 | 3300046683 | Bacteria | 3216 |
| 719 | Ga0495658_0051655 | 3300046683 | Bacteria | 2329 |
| 720 | Ga0495613_0002958 | 3300046689 | Bacteria | 12716 |
| 721 | Ga0495613_0004216 | 3300046689 | Bacteria | 10766 |
| 722 | Ga0495613_0004610 | 3300046689 | Bacteria | 10347 |
| 723 | Ga0495613_0014800 | 3300046689 | Bacteria | 5789 |
| 724 | Ga0495613_0047411 | 3300046689 | Bacteria | 3174 |
| 725 | Ga0495613_0053228 | 3300046689 | Bacteria | 2979 |
| 726 | Ga0495613_0075107 | 3300046689 | Bacteria | 2460 |
| 727 | Ga0495613_0081336 | 3300046689 | Bacteria | 2353 |
| 728 | Ga0495624_0014953 | 3300046690 | Bacteria | 5256 |
| 729 | Ga0495624_0042611 | 3300046690 | Bacteria | 2900 |
| 730 | Ga0495624_0084447 | 3300046690 | Bacteria | 1962 |
| 731 | Ga0495624_0126745 | 3300046690 | Bacteria | 1566 |
| 732 | Ga0495624_0169922 | 3300046690 | Bacteria | 1330 |
| 733 | Ga0495670_0010579 | 3300046691 | Bacteria | 4534 |
| 734 | Ga0495670_0026031 | 3300046691 | Bacteria | 2896 |
| 735 | Ga0495671_0049061 | 3300046692 | Bacteria | 2105 |
| 736 | Ga0495649_0027030 | 3300046694 | Bacteria | 3185 |
| 737 | Ga0495649_0102475 | 3300046694 | Bacteria | 1520 |
| 738 | Ga0495589_0003791 | 3300046794 | Bacteria | 8133 |
| 739 | Ga0495589_0008907 | 3300046794 | Bacteria | 5222 |
| 740 | Ga0495589_0077824 | 3300046794 | Bacteria | 1615 |
| 741 | Ga0495589_0091719 | 3300046794 | Bacteria | 1475 |
| 742 | Ga0495600_0000124 | 3300046809 | Bacteria | 43037 |
| 743 | Ga0495600_0004312 | 3300046809 | Bacteria | 8509 |
| 744 | Ga0495600_0006029 | 3300046809 | Bacteria | 7337 |
| 745 | Ga0495600_0026387 | 3300046809 | Bacteria | 3749 |
| 746 | Ga0495600_0033821 | 3300046809 | Bacteria | 3318 |
| 747 | Ga0495600_0042804 | 3300046809 | Bacteria | 2953 |
| 748 | Ga0495600_0070644 | 3300046809 | Bacteria | 2281 |
| 749 | Ga0495600_0094695 | 3300046809 | Bacteria | 1947 |
| 750 | Ga0495600_0121418 | 3300046809 | Bacteria | 1699 |
| 751 | Ga0495660_0053103 | 3300046810 | Bacteria | 2201 |
| 752 | Ga0495581_0013815 | 3300047315 | Bacteria | 4679 |
| 753 | Ga0495581_0026066 | 3300047315 | Bacteria | 3390 |
| 754 | Ga0495581_0057624 | 3300047315 | Bacteria | 2242 |
| 755 | Ga0495581_0058630 | 3300047315 | Bacteria | 2224 |
| 756 | Ga0495604_0000032 | 3300047317 | Bacteria | 137882 |
| 757 | Ga0495604_0000635 | 3300047317 | Bacteria | 30134 |
| 758 | Ga0495604_0005069 | 3300047317 | Bacteria | 10426 |
| 759 | Ga0495604_0021140 | 3300047317 | Bacteria | 5193 |
| 760 | Ga0495604_0021660 | 3300047317 | Bacteria | 5131 |
| 761 | Ga0495604_0040941 | 3300047317 | Bacteria | 3635 |
| 762 | Ga0495604_0124068 | 3300047317 | Bacteria | 1865 |
| 763 | Ga0495604_0124827 | 3300047317 | Bacteria | 1858 |
| 764 | Ga0495636_0026436 | 3300047318 | Bacteria | 2361 |
| 765 | Ga0495636_0029658 | 3300047318 | Bacteria | 2234 |
| 766 | Ga0495674_0007591 | 3300047319 | Bacteria | 10363 |
| 767 | Ga0495674_0008937 | 3300047319 | Bacteria | 9524 |
| 768 | Ga0495674_0031385 | 3300047319 | Bacteria | 4826 |
| 769 | Ga0495674_0037970 | 3300047319 | Bacteria | 4326 |
| 770 | Ga0495674_0177865 | 3300047319 | Bacteria | 1773 |
| 771 | Ga0495674_0182603 | 3300047319 | Bacteria | 1746 |
| 772 | Ga0495672_0071716 | 3300047320 | Bacteria | 1959 |
| 773 | Ga0495676_0002926 | 3300047321 | Bacteria | 15426 |
| 774 | Ga0495676_0003257 | 3300047321 | Bacteria | 14666 |
| 775 | Ga0495676_0005841 | 3300047321 | Bacteria | 11298 |
| 776 | Ga0495676_0016062 | 3300047321 | Bacteria | 6651 |
| 777 | Ga0495676_0032758 | 3300047321 | Bacteria | 4383 |
| 778 | Ga0495676_0065186 | 3300047321 | Bacteria | 2828 |
| 779 | Ga0495680_0000058 | 3300047322 | Bacteria | 91920 |
| 780 | Ga0495680_0025736 | 3300047322 | Bacteria | 4865 |
| 781 | Ga0495680_0032888 | 3300047322 | Bacteria | 4204 |
| 782 | Ga0495680_0045293 | 3300047322 | Bacteria | 3473 |
| 783 | Ga0495680_0066907 | 3300047322 | Bacteria | 2748 |
| 784 | Ga0495683_0084340 | 3300047323 | Bacteria | 1546 |
| 785 | Ga0495687_007958 | 3300047443 | Bacteria | 6154 |
| 786 | Ga0495675_0000679 | 3300047444 | Bacteria | 21395 |
| 787 | Ga0495675_0003848 | 3300047444 | Bacteria | 9090 |
| 788 | Ga0495675_0018011 | 3300047444 | Bacteria | 4478 |
| 789 | Ga0495675_0034143 | 3300047444 | Bacteria | 3246 |
| 790 | Ga0495675_0096493 | 3300047444 | Bacteria | 1853 |
| 791 | Ga0495685_000446 | 3300047447 | Bacteria | 12986 |
| 792 | Ga0495685_020320 | 3300047447 | Bacteria | 2282 |
| 793 | Ga0495685_025216 | 3300047447 | Bacteria | 2046 |
| 794 | Ga0495685_040160 | 3300047447 | Bacteria | 1600 |
| 795 | Ga0495685_044066 | 3300047447 | Bacteria | 1522 |
| 796 | Ga0495681_0002353 | 3300047470 | Bacteria | 13576 |
| 797 | Ga0495681_0002430 | 3300047470 | Bacteria | 13307 |
| 798 | Ga0495681_0043645 | 3300047470 | Bacteria | 2160 |
| 799 | Ga0495684_0010142 | 3300047471 | Bacteria | 7285 |
| 800 | Ga0495684_0014339 | 3300047471 | Bacteria | 6099 |
| 801 | Ga0495684_0037283 | 3300047471 | Bacteria | 3728 |
| 802 | Ga0495684_0040812 | 3300047471 | Bacteria | 3557 |
| 803 | Ga0495684_0106139 | 3300047471 | Bacteria | 2122 |
| 804 | Ga0495686_0039322 | 3300047472 | Bacteria | 3022 |
| 805 | Ga0495593_0001065 | 3300047673 | Bacteria | 16022 |
| 806 | Ga0495593_0002190 | 3300047673 | Bacteria | 11688 |
| 807 | Ga0495593_0009073 | 3300047673 | Bacteria | 5770 |
| 808 | Ga0495602_0000092 | 3300048088 | Bacteria | 85286 |
| 809 | Ga0495602_0014113 | 3300048088 | Bacteria | 8124 |
| 810 | Ga0495602_0022032 | 3300048088 | Bacteria | 6248 |
| 811 | Ga0495602_0043234 | 3300048088 | Bacteria | 4099 |
| 812 | Ga0495614_0001443 | 3300048089 | Bacteria | 10271 |
| 813 | Ga0495614_0002481 | 3300048089 | Bacteria | 8208 |
| 814 | Ga0495614_0002629 | 3300048089 | Bacteria | 7982 |
| 815 | Ga0495614_0045180 | 3300048089 | Bacteria | 1889 |
| 816 | Ga0495614_0098504 | 3300048089 | Bacteria | 1276 |
| 817 | Ga0496100_0092905 | 3300048903 | Bacteria | 2063 |
| 818 | Ga0496101_0154968 | 3300048904 | Bacteria | 1754 |
| 819 | Ga0496102_0003034 | 3300048905 | Bacteria | 14221 |
| 820 | Ga0496102_0021775 | 3300048905 | Bacteria | 5672 |
| 821 | Ga0496102_0042867 | 3300048905 | Bacteria | 4102 |
| 822 | Ga0496102_0064997 | 3300048905 | Bacteria | 3343 |
| 823 | Ga0496102_0072382 | 3300048905 | Bacteria | 3167 |
| 824 | Ga0496102_0204762 | 3300048905 | Bacteria | 1860 |
| 825 | Ga0496102_0324159 | 3300048905 | Bacteria | 1451 |
| 826 | Ga0496103_0074772 | 3300048906 | Bacteria | 2124 |
| 827 | Ga0496104_0000244 | 3300048907 | Bacteria | 48036 |
| 828 | Ga0496104_0134978 | 3300048907 | Bacteria | 2370 |
| 829 | Ga0496105_0001370 | 3300048908 | Bacteria | 17152 |
| 830 | Ga0496105_0034393 | 3300048908 | Bacteria | 4167 |
| 831 | Ga0496107_0010045 | 3300048910 | Bacteria | 6565 |
| 832 | Ga0496107_0030908 | 3300048910 | Bacteria | 3819 |
| 833 | Ga0496107_0031927 | 3300048910 | Bacteria | 3761 |
| 834 | Ga0496108_0008554 | 3300048911 | Bacteria | 8300 |
| 835 | Ga0496108_0010090 | 3300048911 | Bacteria | 7664 |
| 836 | Ga0496108_0166033 | 3300048911 | Bacteria | 1909 |
| 837 | Ga0496109_0013798 | 3300048912 | Bacteria | 7021 |
| 838 | Ga0496109_0019583 | 3300048912 | Bacteria | 5970 |
| 839 | Ga0496109_0023085 | 3300048912 | Bacteria | 5518 |
| 840 | Ga0496109_0048147 | 3300048912 | Bacteria | 3878 |
| 841 | Ga0496109_0059631 | 3300048912 | Bacteria | 3486 |
| 842 | Ga0496110_0014679 | 3300048913 | Bacteria | 6511 |
| 843 | Ga0496110_0030416 | 3300048913 | Bacteria | 4655 |
| 844 | Ga0496110_0041963 | 3300048913 | Bacteria | 3993 |
| 845 | Ga0496111_0006908 | 3300048914 | Bacteria | 7406 |
| 846 | Ga0496111_0040657 | 3300048914 | Bacteria | 3335 |
| 847 | Ga0496111_0086378 | 3300048914 | Bacteria | 2295 |
| 848 | Ga0496111_0102376 | 3300048914 | Bacteria | 2105 |
| 849 | Ga0496112_0001754 | 3300048915 | Bacteria | 17007 |
| 850 | Ga0496112_0316828 | 3300048915 | Bacteria | 1504 |
| 851 | Ga0496113_0024868 | 3300048916 | Bacteria | 4263 |
| 852 | Ga0496113_0049159 | 3300048916 | Bacteria | 3140 |
| 853 | Ga0496113_0050330 | 3300048916 | Bacteria | 3106 |
| 854 | Ga0496113_0256454 | 3300048916 | Bacteria | 1397 |
| 855 | Ga0496114_0172821 | 3300048917 | Bacteria | 1884 |
| 856 | Ga0496115_0042719 | 3300048918 | Bacteria | 3613 |
| 857 | Ga0496115_0046890 | 3300048918 | Bacteria | 3456 |
| 858 | Ga0496115_0112732 | 3300048918 | Bacteria | 2234 |
| 859 | Ga0496115_0116202 | 3300048918 | Bacteria | 2200 |
| 860 | Ga0496115_0116233 | 3300048918 | Bacteria | 2200 |
| 861 | Ga0496121_0114469 | 3300048924 | Bacteria | 2050 |
| 862 | Ga0496126_0187819 | 3300048929 | Bacteria | 1752 |
| 863 | Ga0496126_0211467 | 3300048929 | Bacteria | 1633 |
| 864 | Ga0495678_048034 | 3300049459 | Bacteria | 1667 |
| 865 | Ga0501031_0001656 | 3300049568 | Bacteria | 13987 |
| 866 | Ga0501031_0015250 | 3300049568 | Bacteria | 4989 |
| 867 | Ga0501031_0102009 | 3300049568 | Bacteria | 1872 |
| 868 | Ga0501032_0105058 | 3300049569 | Bacteria | 1871 |
| 869 | Ga0501033_0002616 | 3300049570 | Bacteria | 15157 |
| 870 | Ga0501033_0017648 | 3300049570 | Bacteria | 5390 |
| 871 | Ga0501034_0029918 | 3300049571 | Bacteria | 5536 |
| 872 | Ga0501034_0197263 | 3300049571 | Bacteria | 1972 |
| 873 | Ga0501036_0000024 | 3300049572 | Bacteria | 110026 |
| 874 | Ga0501036_0028132 | 3300049572 | Bacteria | 4752 |
| 875 | Ga0501037_0015902 | 3300049573 | Bacteria | 5541 |
| 876 | Ga0501037_0017673 | 3300049573 | Bacteria | 5249 |
| 877 | Ga0501038_0008017 | 3300049574 | Bacteria | 9731 |
| 878 | Ga0501038_0010473 | 3300049574 | Bacteria | 8481 |
| 879 | Ga0501038_0012747 | 3300049574 | Bacteria | 7679 |
| 880 | Ga0501039_0001591 | 3300049575 | Bacteria | 16711 |
| 881 | Ga0501039_0012453 | 3300049575 | Bacteria | 6493 |
| 882 | Ga0501040_0000144 | 3300049576 | Bacteria | 38633 |
| 883 | Ga0501040_0016439 | 3300049576 | Bacteria | 4898 |
| 884 | Ga0501041_0000359 | 3300049577 | Bacteria | 22602 |
| 885 | Ga0501041_0025301 | 3300049577 | Bacteria | 3567 |
| 886 | Ga0501042_0000388 | 3300049578 | Bacteria | 22349 |
| 887 | Ga0501042_0003232 | 3300049578 | Bacteria | 10187 |
| 888 | Ga0501042_0012100 | 3300049578 | Bacteria | 5838 |
| 889 | Ga0501043_0004254 | 3300049579 | Bacteria | 11656 |
| 890 | Ga0501043_0042936 | 3300049579 | Bacteria | 3554 |
| 891 | Ga0501043_0049855 | 3300049579 | Bacteria | 3292 |
| 892 | Ga0501046_0000495 | 3300049580 | Bacteria | 39248 |
| 893 | Ga0501047_0049314 | 3300049581 | Bacteria | 4066 |
| 894 | Ga0501048_0000192 | 3300049582 | Bacteria | 39421 |
| 895 | Ga0501048_0021176 | 3300049582 | Bacteria | 4760 |
| 896 | Ga0501067_0020366 | 3300049583 | Bacteria | 3670 |
| 897 | Ga0501068_0001934 | 3300049584 | Bacteria | 11009 |
| 898 | Ga0501068_0019718 | 3300049584 | Bacteria | 3920 |
| 899 | Ga0501069_0055833 | 3300049585 | Bacteria | 2200 |
| 900 | Ga0501070_0028315 | 3300049586 | Bacteria | 4698 |
| 901 | Ga0501070_0036609 | 3300049586 | Bacteria | 4098 |
| 902 | Ga0501070_0198983 | 3300049586 | Bacteria | 1646 |
| 903 | Ga0501071_0003188 | 3300049587 | Bacteria | 10210 |
| 904 | Ga0501071_0037072 | 3300049587 | Bacteria | 3480 |
| 905 | Ga0501072_0000920 | 3300049588 | Bacteria | 21630 |
| 906 | Ga0501072_0032965 | 3300049588 | Bacteria | 4057 |
| 907 | Ga0501072_0048194 | 3300049588 | Bacteria | 3355 |
| 908 | Ga0501073_0023674 | 3300049589 | Bacteria | 4407 |
| 909 | Ga0501073_0113897 | 3300049589 | Bacteria | 1875 |
| 910 | Ga0501074_0001328 | 3300049590 | Bacteria | 16420 |
| 911 | Ga0501074_0004667 | 3300049590 | Bacteria | 9815 |
| 912 | Ga0501074_0035653 | 3300049590 | Bacteria | 3604 |
| 913 | Ga0501075_0000132 | 3300049591 | Bacteria | 37143 |
| 914 | Ga0501076_0000281 | 3300049592 | Bacteria | 31694 |
| 915 | Ga0501076_0023286 | 3300049592 | Bacteria | 4772 |
| 916 | Ga0501077_0000332 | 3300049593 | Bacteria | 27953 |
| 917 | Ga0501077_0003894 | 3300049593 | Bacteria | 8987 |
| 918 | Ga0501079_0003439 | 3300049741 | Bacteria | 11629 |
| 919 | Ga0501079_0015673 | 3300049741 | Bacteria | 5788 |
| 920 | Ga0501079_0020586 | 3300049741 | Bacteria | 5043 |
| 921 | Ga0501080_0019407 | 3300049742 | Bacteria | 6298 |
| 922 | Ga0501080_0033312 | 3300049742 | Bacteria | 4808 |
| 923 | Ga0501081_0010172 | 3300049743 | Bacteria | 6139 |
| 924 | Ga0501081_0013408 | 3300049743 | Bacteria | 5389 |
| 925 | Ga0501083_0004138 | 3300049744 | Bacteria | 10213 |
| 926 | Ga0501035_0019738 | 3300049822 | Bacteria | 6192 |
| 927 | Ga0501035_0082078 | 3300049822 | Bacteria | 2845 |
| 928 | Ga0501035_0215949 | 3300049822 | Bacteria | 1639 |
| 929 | Ga0501044_0054713 | 3300049823 | Bacteria | 4101 |
| 930 | Ga0501044_0092412 | 3300049823 | Bacteria | 3051 |
| 931 | Ga0501045_0000216 | 3300049824 | Bacteria | 33098 |
| 932 | Ga0501045_0013278 | 3300049824 | Bacteria | 5814 |
| 933 | nmdc:mga0yw44_213472_c1 | 3300050492 | Bacteria | 1277 |
| 934 | nmdc:mga06z11_2103_c1 | 3300050494 | Bacteria | 7556 |
| 935 | nmdc:mga05p37_110293_c1 | 3300050507 | Bacteria | 3385 |
| 936 | nmdc:mga05p37_313554_c1 | 3300050507 | Bacteria | 1859 |
| 937 | nmdc:mga05p37_353928_c1 | 3300050507 | Bacteria | 1728 |
| 938 | nmdc:mga05p37_42108_c1 | 3300050507 | Bacteria | 5610 |
| 939 | nmdc:mga05p37_4546_c1 | 3300050507 | Bacteria | 16215 |
| 940 | nmdc:mga05p37_544681_c1 | 3300050507 | Bacteria | 1322 |
| 941 | nmdc:mga09592_102592_c1 | 3300050508 | Bacteria | 2451 |
| 942 | nmdc:mga0qj67_15701_c1 | 3300050509 | Bacteria | 5735 |
| 943 | nmdc:mga0qj67_38148_c1 | 3300050509 | Bacteria | 3769 |
| 944 | nmdc:mga06r32_118242_c1 | 3300050510 | Bacteria | 2612 |
| 945 | nmdc:mga06r32_20455_c1 | 3300050510 | Bacteria | 6095 |
| 946 | nmdc:mga08y16_129001_c1 | 3300050511 | Bacteria | 2630 |
| 947 | nmdc:mga08y16_27457_c1 | 3300050511 | Bacteria | 6000 |
| 948 | nmdc:mga0n895_103058_c1 | 3300050512 | Bacteria | 2865 |
| 949 | nmdc:mga0n895_232198_c1 | 3300050512 | Bacteria | 1872 |
| 950 | nmdc:mga0n895_334805_c1 | 3300050512 | Bacteria | 1534 |
| 951 | nmdc:mga0rr50_190743_c1 | 3300050513 | Bacteria | 1679 |
| 952 | nmdc:mga0rr50_19286_c1 | 3300050513 | Bacteria | 4600 |
| 953 | nmdc:mga08x19_12598_c1 | 3300050514 | Bacteria | 3663 |
| 954 | nmdc:mga0a205_10334_c1 | 3300050515 | Bacteria | 8579 |
| 955 | nmdc:mga0a205_1709_c1 | 3300050515 | Bacteria | 18947 |
| 956 | nmdc:mga0a205_5529_c1 | 3300050515 | Bacteria | 11384 |
| 957 | nmdc:mga0a205_59766_c1 | 3300050515 | Bacteria | 2712 |
| 958 | Ga0495601_0001343 | 3300053077 | Bacteria | 13513 |
| 959 | Ga0495601_0005633 | 3300053077 | Bacteria | 7300 |
| 960 | Ga0495601_0010347 | 3300053077 | Bacteria | 5549 |
| 961 | Ga0495601_0034033 | 3300053077 | Bacteria | 3176 |
| 962 | Ga0495601_0034403 | 3300053077 | Bacteria | 3161 |
| 963 | Ga0495601_0076024 | 3300053077 | Bacteria | 2150 |
| 964 | Ga0495601_0152149 | 3300053077 | Bacteria | 1510 |
| 965 | Ga0495601_0155307 | 3300053077 | Bacteria | 1494 |
| 966 | Ga0495612_0005116 | 3300053078 | Bacteria | 5422 |
| 967 | Ga0495612_0005699 | 3300053078 | Bacteria | 5144 |
| 968 | Ga0495612_0015201 | 3300053078 | Bacteria | 3086 |
| 969 | Ga0495612_0030014 | 3300053078 | Bacteria | 2190 |
| 970 | Ga0495595_0009801 | 3300053084 | Bacteria | 3971 |
| 971 | Ga0495595_0021794 | 3300053084 | Bacteria | 2803 |
| 972 | Ga0495595_0022058 | 3300053084 | Bacteria | 2791 |
| 973 | Ga0495595_0071417 | 3300053084 | Bacteria | 1641 |
| 974 | Ga0495619_0001479 | 3300053085 | Bacteria | 15483 |
| 975 | Ga0495619_0010401 | 3300053085 | Bacteria | 5855 |
| 976 | Ga0495619_0066283 | 3300053085 | Bacteria | 2409 |
| 977 | Ga0495619_0105032 | 3300053085 | Bacteria | 1926 |
| 978 | Ga0495619_0320213 | 3300053085 | Bacteria | 1073 |
| 979 | Ga0500578_0007649 | 3300053086 | Bacteria | 7121 |
| 980 | Ga0500644_0004472 | 3300053088 | Bacteria | 3500 |
| 981 | Ga0500640_046359 | 3300053095 | Bacteria | 1905 |
| 982 | Ga0500654_030751 | 3300053099 | Bacteria | 3234 |
| 983 | Ga0500569_014808 | 3300053109 | Bacteria | 1939 |
| 984 | Ga0500614_005706 | 3300053123 | Bacteria | 2612 |
| 985 | Ga0500628_002620 | 3300053129 | Bacteria | 2964 |
| 986 | Ga0500652_002244 | 3300053131 | Bacteria | 5809 |
| 987 | Ga0500658_0008353 | 3300053134 | Bacteria | 3826 |
| 988 | Ga0500561_0000448 | 3300053137 | Bacteria | 6689 |
| 989 | Ga0500573_0036939 | 3300053140 | Bacteria | 2821 |
| 990 | Ga0500579_021942 | 3300053143 | Bacteria | 4139 |
| 991 | Ga0500600_0007019 | 3300053149 | Bacteria | 6755 |
| 992 | Ga0500616_0014405 | 3300053153 | Bacteria | 4544 |
| 993 | Ga0500634_0028656 | 3300053161 | Bacteria | 3032 |
| 994 | Ga0500656_000457 | 3300053732 | Bacteria | 3005 |
| 995 | Ga0500587_005173 | 3300053739 | Bacteria | 1764 |
| 996 | Ga0501084_0001254 | 3300054114 | Bacteria | 19977 |
| 997 | Ga0501084_0014854 | 3300054114 | Bacteria | 6457 |
| 998 | Ga0501084_0016371 | 3300054114 | Bacteria | 6156 |
| 999 | Ga0501082_0000366 | 3300060353 | Bacteria | 39900 |
| 1000 | Ga0501082_0005003 | 3300060353 | Bacteria | 11568 |
| 1001 | Ga0501082_0049464 | 3300060353 | Bacteria | 3625 |
| 1002 | Ga0466962_0008057 | 3300061719 | Bacteria | 5051 |
| 1003 | Ga0530510_0000013 | 3300061734 | Bacteria | 110065 |
| 1004 | 2585317345 | 2582581314 | Bacteria | 11452267 |
| 1005 | 2616693144 | 2616644814 | Bacteria | 11555299 |
| 1006 | 2616904349 | 2616644941 | Bacteria | 8510691 |
| 1007 | 2644263513 | 2643221647 | Bacteria | 10741251 |
| 1008 | 2785366749 | 2784746768 | Bacteria | 10036182 |
| 1009 | 2786667807 | 2786546132 | Bacteria | 10419719 |
| 1010 | 2808828189 | 2808606357 | Bacteria | 4466944 |
| 1011 | 2808877972 | 2808606366 | Bacteria | 4415912 |
| 1012 | 2808918053 | 2808606375 | Bacteria | 9466072 |
| 1013 | 2812372489 | 2811994882 | Bacteria | 4688362 |
| 1014 | 2812373356 | 2811994882 | Bacteria | 4688362 |
| 1015 | 2835188483 | 2835188231 | Bacteria | 3476928 |
| 1016 | 2862180702 | 2862178590 | Bacteria | 8583590 |
| 1017 | 2862290056 | 2862281513 | Bacteria | 9621493 |
| 1018 | 2862574991 | 2862574272 | Bacteria | 10567477 |
| 1019 | 2873158096 | 2873151551 | Bacteria | 8625867 |
| 1020 | 2877683794 | 2877676314 | Bacteria | 9512378 |
| 1021 | 2912726530 | 2912723979 | Bacteria | 8557534 |
| 1022 | 2945917807 | 2945916053 | Bacteria | 4555517 |
| 1023 | 2954389097 | 2954380949 | Bacteria | 10050426 |
| 1024 | 2954673947 | 2954673503 | Bacteria | 9685905 |
| 1025 | 2954690044 | 2954682443 | Bacteria | 9862841 |
| 1026 | 2954699843 | 2954691527 | Bacteria | 10720516 |
| 1027 | 2954702355 | 2954701450 | Bacteria | 10834262 |
| 1028 | 3006497048 | 3006493962 | Bacteria | 8825450 |
| 1029 | 8008581090 | 8008574985 | Bacteria | 7815457 |
| 1030 | 8056832647 | 8056829672 | Bacteria | 9045328 |
| 1031 | Ga0075431_100322628 | |||
| 1032 | JGI25406J46586_10031578 | |||
| 1033 | rootH1_10101709 | |||
| 1034 | JGI25407J50210_10035106 | |||
| 1035 | Ga0070658_10006893 | |||
| 1036 | Ga0070683_100001796 | |||
| 1037 | Ga0070683_100037024 | |||
| 1038 | Ga0070683_100077938 | |||
| 1039 | Ga0070683_100173457 | |||
| 1040 | Ga0070683_100236990 | |||
| 1041 | Ga0070680_100108855 | |||
| 1042 | Ga0070682_100002746 | |||
| 1043 | Ga0070682_100044017 | |||
| 1044 | Ga0070682_100193492 | |||
| 1045 | Ga0068868_100020069 | |||
| 1046 | Ga0070660_100084688 | |||
| 1047 | Ga0070660_100173781 | |||
| 1048 | Ga0070660_100195402 | |||
| 1049 | Ga0070691_10041579 | |||
| 1050 | Ga0070691_10125745 | |||
| 1051 | Ga0070661_100149372 | |||
| 1052 | Ga0070692_10095894 | |||
| 1053 | Ga0070675_100105217 | |||
| 1054 | Ga0070659_100012412 | |||
| 1055 | Ga0070659_100035946 | |||
| 1056 | Ga0070709_10000860 | |||
| 1057 | Ga0070709_10006505 | |||
| 1058 | Ga0070709_10072398 | |||
| 1059 | Ga0070714_100000689 | |||
| 1060 | Ga0070714_100008563 | |||
| 1061 | Ga0070714_100032055 | |||
| 1062 | Ga0070714_100039832 | |||
| 1063 | Ga0070714_100053955 | |||
| 1064 | Ga0070714_100058409 | |||
| 1065 | Ga0070714_100060750 | |||
| 1066 | Ga0070714_100339940 | |||
| 1067 | Ga0070713_100005240 | |||
| 1068 | Ga0070713_100015430 | |||
| 1069 | Ga0070713_100016652 | |||
| 1070 | Ga0070713_100034356 | |||
| 1071 | Ga0070713_100040573 | |||
| 1072 | Ga0070713_100056444 | |||
| 1073 | Ga0070713_100102646 | |||
| 1074 | Ga0070713_100119803 | |||
| 1075 | Ga0070710_10001129 | |||
| 1076 | Ga0070710_10005384 | |||
| 1077 | Ga0070710_10066854 | |||
| 1078 | Ga0070711_100001373 | |||
| 1079 | Ga0070711_100113632 | |||
| 1080 | Ga0070705_100174382 | |||
| 1081 | Ga0070700_100161241 | |||
| 1082 | Ga0070708_100000572 | |||
| 1083 | Ga0070708_100004428 | |||
| 1084 | Ga0070708_100164741 | |||
| 1085 | Ga0070708_100430744 | |||
| 1086 | Ga0070663_100041840 | |||
| 1087 | Ga0070685_10182773 | |||
| 1088 | Ga0070706_100005350 | |||
| 1089 | Ga0070706_100009709 | |||
| 1090 | Ga0070706_100016121 | |||
| 1091 | Ga0070706_100020458 | |||
| 1092 | Ga0070706_100021910 | |||
| 1093 | Ga0070707_100003304 | |||
| 1094 | Ga0070707_100003555 | |||
| 1095 | Ga0070707_100004577 | |||
| 1096 | Ga0070707_100007078 | |||
| 1097 | Ga0070707_100062407 | |||
| 1098 | Ga0070707_100119997 | |||
| 1099 | Ga0070707_100127635 | |||
| 1100 | Ga0070698_100000677 | |||
| 1101 | Ga0070698_100000986 | |||
| 1102 | Ga0070698_100006573 | |||
| 1103 | Ga0070698_100009522 | |||
| 1104 | Ga0070698_100010816 | |||
| 1105 | Ga0070698_100061266 | |||
| 1106 | Ga0070698_100085106 | |||
| 1107 | Ga0070698_100182287 | |||
| 1108 | Ga0070699_100153687 | |||
| 1109 | Ga0070699_100349094 | |||
| 1110 | Ga0070699_100365505 | |||
| 1111 | Ga0070679_100068481 | |||
| 1112 | Ga0070679_100189982 | |||
| 1113 | Ga0070679_100205666 | |||
| 1114 | Ga0070684_100000608 | |||
| 1115 | Ga0070684_100002313 | |||
| 1116 | Ga0070684_100020130 | |||
| 1117 | Ga0070684_100038507 | |||
| 1118 | Ga0070684_100045374 | |||
| 1119 | Ga0070697_100030792 | |||
| 1120 | Ga0070697_100056089 | |||
| 1121 | Ga0068853_100062864 | |||
| 1122 | Ga0068853_100117379 | |||
| 1123 | Ga0070686_100252333 | |||
| 1124 | Ga0070696_100243923 | |||
| 1125 | Ga0070693_100059186 | |||
| 1126 | Ga0070665_100000582 | |||
| 1127 | Ga0070665_100081229 | |||
| 1128 | Ga0070665_100212801 | |||
| 1129 | Ga0068855_100093327 | |||
| 1130 | Ga0068855_100205944 | |||
| 1131 | Ga0070664_100040523 | |||
| 1132 | Ga0070664_100294746 | |||
| 1133 | Ga0068857_100008605 | |||
| 1134 | Ga0068857_100020356 | |||
| 1135 | Ga0068857_100191074 | |||
| 1136 | Ga0068857_100193134 | |||
| 1137 | Ga0068856_100065834 | |||
| 1138 | Ga0068856_100068931 | |||
| 1139 | Ga0068856_100102493 | |||
| 1140 | Ga0070702_100169701 | |||
| 1141 | Ga0068852_100030636 | |||
| 1142 | Ga0068852_100072771 | |||
| 1143 | Ga0068859_100038330 | |||
| 1144 | Ga0068859_100359984 | |||
| 1145 | Ga0068863_100088483 | |||
| 1146 | Ga0068863_100208021 | |||
| 1147 | Ga0068858_100020418 | |||
| 1148 | Ga0068858_100237970 | |||
| 1149 | Ga0081455_10112013 | |||
| 1150 | Ga0081538_10002686 | |||
| 1151 | Ga0081538_10002769 | |||
| 1152 | Ga0081538_10008960 | |||
| 1153 | Ga0081540_1000362 | |||
| 1154 | Ga0081540_1005003 | |||
| 1155 | Ga0081540_1020904 | |||
| 1156 | Ga0081539_10000039 | |||
| 1157 | Ga0081539_10004894 | |||
| 1158 | Ga0081539_10006034 | |||
| 1159 | Ga0081539_10053769 | |||
| 1160 | Ga0070717_10035078 | |||
| 1161 | Ga0070717_10052905 | |||
| 1162 | Ga0070717_10056812 | |||
| 1163 | Ga0070717_10074523 | |||
| 1164 | Ga0070717_10079373 | |||
| 1165 | Ga0070717_10084720 | |||
| 1166 | Ga0070717_10091955 | |||
| 1167 | Ga0070717_10146186 | |||
| 1168 | Ga0070717_10271008 | |||
| 1169 | Ga0075432_10001729 | |||
| 1170 | Ga0070715_10004785 | |||
| 1171 | Ga0070716_100002145 | |||
| 1172 | Ga0070716_100010128 | |||
| 1173 | Ga0070716_100035985 | |||
| 1174 | Ga0070716_100094031 | |||
| 1175 | Ga0070716_100156320 | |||
| 1176 | Ga0070712_100028908 | |||
| 1177 | Ga0070712_100035014 | |||
| 1178 | Ga0075367_10000378 | |||
| 1179 | Ga0068871_100245715 | |||
| 1180 | Ga0068871_100446539 | |||
| 1181 | Ga0075428_100078984 | |||
| 1182 | Ga0075430_100006129 | |||
| 1183 | Ga0075431_100177162 | |||
| 1184 | Ga0075433_10052354 | |||
| 1185 | Ga0075433_10179093 | |||
| 1186 | Ga0075434_100016613 | |||
| 1187 | Ga0075434_100129791 | |||
| 1188 | Ga0075434_100138927 | |||
| 1189 | Ga0075429_100070862 | |||
| 1190 | Ga0068865_100023351 | |||
| 1191 | Ga0068865_100052087 | |||
| 1192 | Ga0075436_100031854 | |||
| 1193 | Ga0097620_100038330 | |||
| 1194 | Ga0097620_100359963 | |||
| 1195 | Ga0075435_100021794 | |||
| 1196 | Ga0075435_100248277 | |||
| 1197 | Ga0099794_10034778 | |||
| 1198 | Ga0099795_10046895 | |||
| 1199 | Ga0105240_10130379 | |||
| 1200 | Ga0105240_10424807 | |||
| 1201 | Ga0111539_10038804 | |||
| 1202 | Ga0111539_10055365 | |||
| 1203 | Ga0105245_10006123 | |||
| 1204 | Ga0105245_10013974 | |||
| 1205 | Ga0105245_10032946 | |||
| 1206 | Ga0114129_10010765 | |||
| 1207 | Ga0114129_10046417 | |||
| 1208 | Ga0114129_10069176 | |||
| 1209 | Ga0114129_10867256 | |||
| 1210 | Ga0105241_10052977 | |||
| 1211 | Ga0105248_10179331 | |||
| 1212 | Ga0105237_10030620 | |||
| 1213 | Ga0105237_10371231 | |||
| 1214 | Ga0105238_10078537 | |||
| 1215 | Ga0105249_10002630 | |||
| 1216 | Ga0105249_10011140 | |||
| 1217 | Ga0105249_10043204 | |||
| 1218 | Ga0105239_10002393 | |||
| 1219 | Ga0105239_10002486 | |||
| 1220 | Ga0105239_10051480 | |||
| 1221 | Ga0105246_10000375 | |||
| 1222 | Ga0105246_10001529 | |||
| 1223 | Ga0105246_10080398 | |||
| 1224 | Ga0105246_10228961 | |||
| 1225 | Ga0157373_10192458 | |||
| 1226 | Ga0157370_10093073 | |||
| 1227 | Ga0157369_10004516 | |||
| 1228 | Ga0157369_10030857 | |||
| 1229 | Ga0157369_10051301 | |||
| 1230 | Ga0157369_10057279 | |||
| 1231 | Ga0157369_10095454 | |||
| 1232 | Ga0157374_10264870 | |||
| 1233 | Ga0157374_10529327 | |||
| 1234 | Ga0163162_10012538 | |||
| 1235 | Ga0163162_10075259 | |||
| 1236 | Ga0163162_10133191 | |||
| 1237 | Ga0157372_10006919 | |||
| 1238 | Ga0157372_10014256 | |||
| 1239 | Ga0157372_10059793 | |||
| 1240 | Ga0157375_10009992 | |||
| 1241 | Ga0157375_10010284 | |||
| 1242 | Ga0157375_10077426 | |||
| 1243 | Ga0163163_10063038 | |||
| 1244 | Ga0182008_10003575 | |||
| 1245 | Ga0157379_10036296 | |||
| 1246 | Ga0157379_10073580 | |||
| 1247 | Ga0182007_10003274 | |||
| 1248 | Ga0183367_1003 | |||
| 1249 | Ga0163161_10053784 | |||
| 1250 | Ga0206356_10634487 | |||
| 1251 | Ga0206356_11862379 | |||
| 1252 | Ga0206352_10692001 | |||
| 1253 | Ga0206354_11398097 | |||
| 1254 | Ga0206353_11223522 | |||
| 1255 | Ga0206353_11401531 | |||
| 1256 | Ga0213874_10010623 | |||
| 1257 | Ga0213876_10032554 | |||
| 1258 | Ga0213875_10000733 | |||
| 1259 | Ga0213875_10001317 | |||
| 1260 | Ga0213875_10072346 | |||
| 1261 | Ga0224712_10010694 | |||
| 1262 | Ga0224712_10027516 | |||
| 1263 | Ga0224712_10050471 | |||
| 1264 | Ga0209758_1010847 | |||
| 1265 | Ga0207692_10008396 | |||
| 1266 | Ga0207692_10015692 | |||
| 1267 | Ga0207688_10019493 | |||
| 1268 | Ga0207688_10071225 | |||
| 1269 | Ga0207647_10003769 | |||
| 1270 | Ga0207647_10040416 | |||
| 1271 | Ga0207685_10002713 | |||
| 1272 | Ga0207685_10042902 | |||
| 1273 | Ga0207699_10004435 | |||
| 1274 | Ga0207699_10007040 | |||
| 1275 | Ga0207699_10008456 | |||
| 1276 | Ga0207699_10012336 | |||
| 1277 | Ga0207699_10085070 | |||
| 1278 | Ga0207705_10028490 | |||
| 1279 | Ga0207705_10028636 | |||
| 1280 | Ga0207705_10050015 | |||
| 1281 | Ga0207684_10000987 | |||
| 1282 | Ga0207684_10001173 | |||
| 1283 | Ga0207684_10004337 | |||
| 1284 | Ga0207684_10008945 | |||
| 1285 | Ga0207684_10049953 | |||
| 1286 | Ga0207684_10054486 | |||
| 1287 | Ga0207684_10108883 | |||
| 1288 | Ga0207684_10236430 | |||
| 1289 | Ga0207654_10031288 | |||
| 1290 | Ga0207707_10073527 | |||
| 1291 | Ga0207707_10214544 | |||
| 1292 | Ga0207695_10025447 | |||
| 1293 | Ga0207671_10000197 | |||
| 1294 | Ga0207693_10047191 | |||
| 1295 | Ga0207693_10235904 | |||
| 1296 | Ga0207663_10001110 | |||
| 1297 | Ga0207663_10045424 | |||
| 1298 | Ga0207663_10120871 | |||
| 1299 | Ga0207660_10076651 | |||
| 1300 | Ga0207662_10058702 | |||
| 1301 | Ga0207657_10051552 | |||
| 1302 | Ga0207657_10057965 | |||
| 1303 | Ga0207657_10285260 | |||
| 1304 | Ga0207649_10099387 | |||
| 1305 | Ga0207652_10203944 | |||
| 1306 | Ga0207646_10000049 | |||
| 1307 | Ga0207646_10007857 | |||
| 1308 | Ga0207646_10018496 | |||
| 1309 | Ga0207646_10051512 | |||
| 1310 | Ga0207646_10057527 | |||
| 1311 | Ga0207646_10129186 | |||
| 1312 | Ga0207646_10135456 | |||
| 1313 | Ga0207646_10146084 | |||
| 1314 | Ga0207694_10060725 | |||
| 1315 | Ga0207687_10043182 | |||
| 1316 | Ga0207700_10003695 | |||
| 1317 | Ga0207700_10003979 | |||
| 1318 | Ga0207700_10006305 | |||
| 1319 | Ga0207700_10008111 | |||
| 1320 | Ga0207700_10068205 | |||
| 1321 | Ga0207700_10129802 | |||
| 1322 | Ga0207700_10215218 | |||
| 1323 | Ga0207664_10005230 | |||
| 1324 | Ga0207664_10005718 | |||
| 1325 | Ga0207664_10012080 | |||
| 1326 | Ga0207664_10024351 | |||
| 1327 | Ga0207664_10057241 | |||
| 1328 | Ga0207664_10342894 | |||
| 1329 | Ga0207690_10013592 | |||
| 1330 | Ga0207690_10090061 | |||
| 1331 | Ga0207706_10004215 | |||
| 1332 | Ga0207669_10032987 | |||
| 1333 | Ga0207704_10029079 | |||
| 1334 | Ga0207704_10033132 | |||
| 1335 | Ga0207665_10004164 | |||
| 1336 | Ga0207665_10020054 | |||
| 1337 | Ga0207665_10061603 | |||
| 1338 | Ga0207661_10001526 | |||
| 1339 | Ga0207661_10013022 | |||
| 1340 | Ga0207661_10077242 | |||
| 1341 | Ga0207661_10148458 | |||
| 1342 | Ga0207679_10024923 | |||
| 1343 | Ga0207679_10175210 | |||
| 1344 | Ga0207667_10109524 | |||
| 1345 | Ga0207667_10216285 | |||
| 1346 | Ga0207712_10065078 | |||
| 1347 | Ga0207712_10078665 | |||
| 1348 | Ga0207668_10116748 | |||
| 1349 | Ga0207640_10021202 | |||
| 1350 | Ga0207658_10102280 | |||
| 1351 | Ga0207677_10309929 | |||
| 1352 | Ga0207703_10048104 | |||
| 1353 | Ga0207703_10102134 | |||
| 1354 | Ga0207703_10320547 | |||
| 1355 | Ga0207639_10349244 | |||
| 1356 | Ga0207678_10022818 | |||
| 1357 | Ga0207678_10273427 | |||
| 1358 | Ga0207708_10188986 | |||
| 1359 | Ga0207702_10028124 | |||
| 1360 | Ga0207702_10076975 | |||
| 1361 | Ga0207702_10087925 | |||
| 1362 | Ga0207702_10145929 | |||
| 1363 | Ga0207676_10193894 | |||
| 1364 | Ga0207676_10541905 | |||
| 1365 | Ga0207674_10007103 | |||
| 1366 | Ga0207674_10024704 | |||
| 1367 | Ga0207674_10028804 | |||
| 1368 | Ga0207674_10047529 | |||
| 1369 | Ga0207675_100002050 | |||
| 1370 | Ga0207683_10067823 | |||
| 1371 | Ga0207698_10044778 | |||
| 1372 | Ga0207428_10022977 | |||
| 1373 | Ga0268266_10003627 | |||
| 1374 | Ga0268266_10148383 | |||
| 1375 | Ga0268265_10168578 | |||
| 1376 | Ga0268264_10029455 | |||
| 1377 | Ga0268264_10274692 | |||
| 1378 | Ga0307517_10001103 | |||
| 1379 | Ga0307517_10001543 | |||
| 1380 | Ga0307515_10002955 | |||
| 1381 | Ga0265338_10006470 | |||
| 1382 | Ga0265338_10007640 | |||
| 1383 | Ga0265338_10007919 | |||
| 1384 | Ga0307511_10000334 | |||
| 1385 | Ga0307511_10080861 | |||
| 1386 | Ga0307511_10116044 | |||
| 1387 | Ga0307512_10001670 | |||
| 1388 | Ga0307512_10053638 | |||
| 1389 | Ga0307513_10001865 | |||
| 1390 | Ga0307513_10134545 | |||
| 1391 | Ga0307509_10024865 | |||
| 1392 | Ga0307509_10030629 | |||
| 1393 | Ga0307408_100015369 | |||
| 1394 | Ga0307408_100250961 | |||
| 1395 | Ga0307508_10002111 | |||
| 1396 | Ga0307508_10002445 | |||
| 1397 | Ga0307508_10010556 | |||
| 1398 | Ga0307514_10140248 | |||
| 1399 | Ga0307516_10028396 | |||
| 1400 | Ga0307405_10048727 | |||
| 1401 | Ga0307405_10054300 | |||
| 1402 | Ga0307405_10055207 | |||
| 1403 | Ga0307405_10082874 | |||
| 1404 | Ga0307405_10113982 | |||
| 1405 | Ga0307413_10020376 | |||
| 1406 | Ga0307518_10020369 | |||
| 1407 | Ga0307518_10067094 | |||
| 1408 | Ga0307410_10009806 | |||
| 1409 | Ga0307410_10031309 | |||
| 1410 | Ga0307410_10196612 | |||
| 1411 | Ga0307406_10029112 | |||
| 1412 | Ga0307406_10115818 | |||
| 1413 | Ga0307407_10003597 | |||
| 1414 | Ga0307407_10018666 | |||
| 1415 | Ga0307409_100001240 | |||
| 1416 | Ga0307416_100000885 | |||
| 1417 | Ga0307416_100005485 | |||
| 1418 | Ga0307416_100025764 | |||
| 1419 | Ga0307416_100155120 | |||
| 1420 | Ga0307416_100259631 | |||
| 1421 | Ga0307416_100546994 | |||
| 1422 | Ga0307414_10033856 | |||
| 1423 | Ga0307414_10049041 | |||
| 1424 | Ga0307414_10069025 | |||
| 1425 | Ga0307414_10200278 | |||
| 1426 | Ga0307411_10080483 | |||
| 1427 | Ga0307411_10097769 | |||
| 1428 | Ga0307415_100008431 | |||
| 1429 | Ga0307415_100009901 | |||
| 1430 | Ga0307415_100036653 | |||
| 1431 | Ga0307415_100043355 | |||
| 1432 | Ga0307415_100063572 | |||
| 1433 | Ga0307507_10031417 | |||
| 1434 | Ga0307507_10104011 | |||
| 1435 | Ga0307507_10179135 | |||
| 1436 | Ga0307510_10015027 | |||
| 1437 | Ga0316214_1001164 | |||
| 1438 | Ga0373948_0045592 | |||
| 1439 | Ga0373926_0000303 | |||
| 1440 | Ga0373926_0102196 | |||
| 1441 | Ga0373934_0000901 | |||
| 1442 | Ga0373934_0048431 | |||
| 1443 | Ga0373940_0040899 | |||
| 1444 | Ga0373944_0023619 | |||
| 1445 | Ga0373949_0035623 | |||
| 1446 | Ga0373923_0001192 | |||
| 1447 | Ga0373923_0006452 | |||
| 1448 | Ga0373936_0000261 | |||
| 1449 | Ga0373936_0003311 | |||
| 1450 | Ga0373939_0003903 | |||
| 1451 | Ga0373941_0013082 | |||
| 1452 | Ga0373945_0001094 | |||
| 1453 | Ga0373953_0000513 | |||
| 1454 | Ga0373953_0011058 | |||
| 1455 | Ga0373953_0068048 | |||
| 1456 | Ga0373954_0003115 | |||
| 1457 | Ga0373954_0012807 | |||
| 1458 | Ga0373954_0017144 | |||
| 1459 | Ga0373954_0036240 | |||
| 1460 | Ga0373956_0009927 | |||
| 1461 | Ga0373956_0018086 | |||
| 1462 | Ga0373957_0000657 | |||
| 1463 | Ga0373957_0000760 | |||
| 1464 | Ga0373957_0007245 | |||
| 1465 | Ga0373957_0010835 | |||
| 1466 | Ga0373957_0012232 | |||
| 1467 | Ga0373957_0065310 | |||
| 1468 | Ga0373960_0058072 | |||
| 1469 | Ga0373943_0039356 | |||
| 1470 | Ga0373943_0111130 | |||
| 1471 | Ga0373946_0003584 | |||
| 1472 | Ga0373946_0009123 | |||
| 1473 | Ga0373946_0033982 | |||
| 1474 | Ga0373946_0134219 | |||
| 1475 | Ga0373955_0000006 | |||
| 1476 | Ga0373955_0002081 | |||
| 1477 | Ga0373955_0029188 | |||
| 1478 | Ga0373955_0063906 | |||
| 1479 | Ga0373955_0068852 | |||
| 1480 | Ga0373942_0000318 | |||
| 1481 | Ga0373924_0000743 | |||
| 1482 | Ga0373924_0001349 | |||
| 1483 | Ga0373924_0003886 | |||
| 1484 | Ga0373924_0058859 | |||
| 1485 | Ga0373935_0010564 | |||
| 1486 | Ga0373935_0012709 | |||
| 1487 | Ga0373935_0213332 | |||
| 1488 | Ga0373927_0023290 | |||
| 1489 | Ga0373927_0195461 | |||
| 1490 | Ga0373933_0012156 | |||
| 1491 | Ga0373933_0077306 | |||
| 1492 | Ga0373933_0093070 | |||
| 1493 | Ga0373933_0094971 | |||
| 1494 | Ga0373933_0240472 | |||
| 1495 | Ga0373947_0000002 | |||
| 1496 | Ga0373947_0005570 | |||
| 1497 | Ga0373937_0000039 | |||
| 1498 | Ga0373937_0019920 | |||
| 1499 | Ga0373937_0051116 | |||
| 1500 | Ga0373937_0170479 | |||
| 1501 | Ga0373937_0213368 | |||
| 1502 | Ga0373925_0000129 | |||
| 1503 | Ga0373925_0000789 | |||
| 1504 | Ga0373925_0004572 | |||
| 1505 | Ga0373925_0014080 | |||
| 1506 | Ga0373925_0037019 | |||
| 1507 | Ga0373925_0074646 | |||
| 1508 | Ga0373925_0237633 | |||
| 1509 | Ga0395899_0134922 | |||
| 1510 | Ga0395900_0001460 | |||
| 1511 | Ga0395900_0017541 | |||
| 1512 | Ga0395900_0021811 | |||
| 1513 | Ga0395900_0042006 | |||
| 1514 | Ga0395900_0047250 | |||
| 1515 | Ga0395898_0012712 | |||
| 1516 | Ga0395898_0034736 | |||
| 1517 | Ga0395898_0204919 | |||
| 1518 | Ga0395905_0002907 | |||
| 1519 | Ga0395905_0015416 | |||
| 1520 | Ga0436364_0185875 | |||
| 1521 | Ga0436364_0403534 | |||
| 1522 | Ga0436364_0770879 | |||
| 1523 | Ga0436364_1220868 | |||
| 1524 | Ga0436364_1535764 | |||
| 1525 | Ga0395901_0005424 | |||
| 1526 | Ga0395901_0015291 | |||
| 1527 | Ga0395901_0019313 | |||
| 1528 | Ga0395901_0092863 | |||
| 1529 | Ga0395901_0113364 | |||
| 1530 | Ga0436363_1185395 | |||
| 1531 | Ga0436363_1403459 | |||
| 1532 | Ga0436362_0651943 | |||
| 1533 | Ga0439443_025121 | |||
| 1534 | Ga0439448_0004998 | |||
| 1535 | Ga0439450_000186 | |||
| 1536 | Ga0439450_012499 | |||
| 1537 | Ga0439450_036932 | |||
| 1538 | Ga0439451_009603 | |||
| 1539 | Ga0439454_003425 | |||
| 1540 | Ga0439455_0004764 | |||
| 1541 | Ga0439455_0007280 | |||
| 1542 | Ga0439463_002090 | |||
| 1543 | Ga0439463_006978 | |||
| 1544 | Ga0439463_013041 | |||
| 1545 | Ga0450913_002786 | |||
| 1546 | Ga0450888_001316 | |||
| 1547 | Ga0450903_000015 | |||
| 1548 | Ga0450904_002193 | |||
| 1549 | Ga0439464_0005595 | |||
| 1550 | Ga0439464_0007007 | |||
| 1551 | Ga0439440_0000237 | |||
| 1552 | Ga0466969_0000938 | |||
| 1553 | Ga0466969_0073055 | |||
| 1554 | Ga0466972_0060027 | |||
| 1555 | Ga0466966_0010118 | |||
| 1556 | Ga0466966_0035826 | |||
| 1557 | Ga0466966_0115377 | |||
| 1558 | Ga0466961_0036247 | |||
| 1559 | Ga0466961_0052102 | |||
| 1560 | Ga0466961_0108162 | |||
| 1561 | Ga0466963_0033483 | |||
| 1562 | Ga0466963_0051587 | |||
| 1563 | Ga0466963_0087142 | |||
| 1564 | Ga0466963_0218562 | |||
| 1565 | Ga0466964_0097103 | |||
| 1566 | Ga0466971_0002879 | |||
| 1567 | Ga0466971_0086463 | |||
| 1568 | Ga0466970_0117570 | |||
| 1569 | Ga0466957_0045184 | |||
| 1570 | Ga0466959_0020690 | |||
| 1571 | Ga0466959_0186226 | |||
| 1572 | Ga0466958_0054078 | |||
| 1573 | Ga0466958_0072099 | |||
| 1574 | Ga0466967_0016992 | |||
| 1575 | Ga0466967_0019461 | |||
| 1576 | Ga0466967_0025071 | |||
| 1577 | Ga0466967_0026680 | |||
| 1578 | Ga0466967_0037445 | |||
| 1579 | Ga0466967_0112800 | |||
| 1580 | Ga0466967_0146068 | |||
| 1581 | Ga0466967_0198712 | |||
| 1582 | Ga0466967_0247896 | |||
| 1583 | Ga0466967_0316256 | |||
| 1584 | Ga0495592_0000567 | |||
| 1585 | Ga0495592_0005211 | |||
| 1586 | Ga0495592_0020327 | |||
| 1587 | Ga0495592_0060608 | |||
| 1588 | Ga0495592_0142098 | |||
| 1589 | Ga0495603_0000412 | |||
| 1590 | Ga0495603_0002412 | |||
| 1591 | Ga0495603_0004797 | |||
| 1592 | Ga0495603_0006225 | |||
| 1593 | Ga0495603_0007066 | |||
| 1594 | Ga0495603_0038207 | |||
| 1595 | Ga0495603_0070862 | |||
| 1596 | Ga0495629_0000886 | |||
| 1597 | Ga0495629_0003035 | |||
| 1598 | Ga0495629_0004317 | |||
| 1599 | Ga0495629_0004730 | |||
| 1600 | Ga0495629_0008814 | |||
| 1601 | Ga0495629_0012006 | |||
| 1602 | Ga0495629_0017721 | |||
| 1603 | Ga0495629_0018334 | |||
| 1604 | Ga0495638_0083603 | |||
| 1605 | Ga0495638_0133406 | |||
| 1606 | Ga0495641_0004729 | |||
| 1607 | Ga0495641_0006497 | |||
| 1608 | Ga0495641_0008040 | |||
| 1609 | Ga0495641_0039190 | |||
| 1610 | Ga0495651_0000013 | |||
| 1611 | Ga0495651_0002609 | |||
| 1612 | Ga0495651_0004896 | |||
| 1613 | Ga0495651_0005277 | |||
| 1614 | Ga0495651_0006641 | |||
| 1615 | Ga0495651_0015508 | |||
| 1616 | Ga0495651_0053799 | |||
| 1617 | Ga0495651_0062785 | |||
| 1618 | Ga0495653_0005478 | |||
| 1619 | Ga0495653_0006741 | |||
| 1620 | Ga0495653_0038056 | |||
| 1621 | Ga0495653_0113118 | |||
| 1622 | Ga0495653_0197191 | |||
| 1623 | Ga0495580_0006999 | |||
| 1624 | Ga0495582_0002025 | |||
| 1625 | Ga0495582_0005524 | |||
| 1626 | Ga0495582_0016720 | |||
| 1627 | Ga0495582_0022952 | |||
| 1628 | Ga0495582_0161015 | |||
| 1629 | Ga0495605_0016046 | |||
| 1630 | Ga0495605_0039514 | |||
| 1631 | Ga0495639_0006511 | |||
| 1632 | Ga0495639_0135211 | |||
| 1633 | Ga0495662_0000687 | |||
| 1634 | Ga0495662_0002464 | |||
| 1635 | Ga0495662_0003024 | |||
| 1636 | Ga0495662_0003887 | |||
| 1637 | Ga0495662_0006157 | |||
| 1638 | Ga0495662_0015599 | |||
| 1639 | Ga0495662_0073391 | |||
| 1640 | Ga0495585_0173773 | |||
| 1641 | Ga0495594_0002999 | |||
| 1642 | Ga0495594_0005157 | |||
| 1643 | Ga0495594_0008585 | |||
| 1644 | Ga0495607_0063014 | |||
| 1645 | Ga0495607_0078925 | |||
| 1646 | Ga0495583_0011636 | |||
| 1647 | Ga0495583_0085468 | |||
| 1648 | Ga0495606_0012472 | |||
| 1649 | Ga0495608_0000114 | |||
| 1650 | Ga0495608_0002000 | |||
| 1651 | Ga0495608_0067426 | |||
| 1652 | Ga0495616_0010477 | |||
| 1653 | Ga0495618_0004694 | |||
| 1654 | Ga0495618_0010288 | |||
| 1655 | Ga0495618_0046177 | |||
| 1656 | Ga0495618_0197356 | |||
| 1657 | Ga0495620_0002993 | |||
| 1658 | Ga0495620_0014051 | |||
| 1659 | Ga0495628_0039946 | |||
| 1660 | Ga0495628_0044087 | |||
| 1661 | Ga0495628_0046875 | |||
| 1662 | Ga0495628_0064055 | |||
| 1663 | Ga0495628_0081187 | |||
| 1664 | Ga0495628_0143740 | |||
| 1665 | Ga0495630_0016315 | |||
| 1666 | Ga0495630_0100368 | |||
| 1667 | Ga0495630_0122947 | |||
| 1668 | Ga0495630_0169388 | |||
| 1669 | Ga0495643_0001800 | |||
| 1670 | Ga0495643_0006360 | |||
| 1671 | Ga0495648_0033986 | |||
| 1672 | Ga0495648_0146539 | |||
| 1673 | Ga0495663_0038475 | |||
| 1674 | Ga0495666_0002910 | |||
| 1675 | Ga0495642_0055077 | |||
| 1676 | Ga0495652_0000145 | |||
| 1677 | Ga0495652_0001696 | |||
| 1678 | Ga0495652_0002970 | |||
| 1679 | Ga0495652_0022281 | |||
| 1680 | Ga0495652_0123221 | |||
| 1681 | Ga0495654_0035163 | |||
| 1682 | Ga0495665_0009058 | |||
| 1683 | Ga0495640_0012649 | |||
| 1684 | Ga0495640_0017468 | |||
| 1685 | Ga0495640_0027608 | |||
| 1686 | Ga0495640_0031606 | |||
| 1687 | Ga0495586_0005351 | |||
| 1688 | Ga0495586_0090821 | |||
| 1689 | Ga0495587_0000063 | |||
| 1690 | Ga0495587_0003797 | |||
| 1691 | Ga0495587_0022426 | |||
| 1692 | Ga0495587_0059215 | |||
| 1693 | Ga0495587_0094069 | |||
| 1694 | Ga0495587_0126579 | |||
| 1695 | Ga0495609_0011318 | |||
| 1696 | Ga0495597_0027365 | |||
| 1697 | Ga0495645_0005532 | |||
| 1698 | Ga0495645_0034718 | |||
| 1699 | Ga0495622_0138073 | |||
| 1700 | Ga0495633_0027478 | |||
| 1701 | Ga0495667_0000049 | |||
| 1702 | Ga0495667_0001442 | |||
| 1703 | Ga0495667_0004790 | |||
| 1704 | Ga0495667_0008790 | |||
| 1705 | Ga0495667_0024556 | |||
| 1706 | Ga0495667_0105715 | |||
| 1707 | Ga0495656_0000626 | |||
| 1708 | Ga0495668_0008327 | |||
| 1709 | Ga0495668_0017593 | |||
| 1710 | Ga0495634_0004604 | |||
| 1711 | Ga0495634_0004827 | |||
| 1712 | Ga0495634_0014110 | |||
| 1713 | Ga0495634_0054403 | |||
| 1714 | Ga0495634_0063506 | |||
| 1715 | Ga0495634_0067673 | |||
| 1716 | Ga0495634_0085216 | |||
| 1717 | Ga0495625_0009696 | |||
| 1718 | Ga0495635_0008752 | |||
| 1719 | Ga0495635_0017835 | |||
| 1720 | Ga0495635_0029051 | |||
| 1721 | Ga0495635_0057653 | |||
| 1722 | Ga0495635_0113599 | |||
| 1723 | Ga0495661_0058379 | |||
| 1724 | Ga0495588_0001052 | |||
| 1725 | Ga0495588_0009383 | |||
| 1726 | Ga0495588_0019330 | |||
| 1727 | Ga0495588_0083071 | |||
| 1728 | Ga0495657_0000513 | |||
| 1729 | Ga0495657_0003849 | |||
| 1730 | Ga0495657_0006358 | |||
| 1731 | Ga0495657_0010243 | |||
| 1732 | Ga0495657_0011590 | |||
| 1733 | Ga0495657_0015439 | |||
| 1734 | Ga0495657_0029912 | |||
| 1735 | Ga0495657_0050964 | |||
| 1736 | Ga0495657_0111713 | |||
| 1737 | Ga0495599_0000077 | |||
| 1738 | Ga0495599_0001711 | |||
| 1739 | Ga0495599_0008164 | |||
| 1740 | Ga0495623_0016860 | |||
| 1741 | Ga0495623_0043723 | |||
| 1742 | Ga0495646_0004530 | |||
| 1743 | Ga0495646_0083147 | |||
| 1744 | Ga0495647_0003643 | |||
| 1745 | Ga0495658_0011983 | |||
| 1746 | Ga0495658_0015551 | |||
| 1747 | Ga0495658_0016589 | |||
| 1748 | Ga0495658_0024478 | |||
| 1749 | Ga0495658_0051655 | |||
| 1750 | Ga0495613_0002958 | |||
| 1751 | Ga0495613_0004216 | |||
| 1752 | Ga0495613_0004610 | |||
| 1753 | Ga0495613_0014800 | |||
| 1754 | Ga0495613_0047411 | |||
| 1755 | Ga0495613_0053228 | |||
| 1756 | Ga0495613_0075107 | |||
| 1757 | Ga0495613_0081336 | |||
| 1758 | Ga0495624_0014953 | |||
| 1759 | Ga0495624_0042611 | |||
| 1760 | Ga0495624_0084447 | |||
| 1761 | Ga0495624_0126745 | |||
| 1762 | Ga0495624_0169922 | |||
| 1763 | Ga0495670_0010579 | |||
| 1764 | Ga0495670_0026031 | |||
| 1765 | Ga0495671_0049061 | |||
| 1766 | Ga0495649_0027030 | |||
| 1767 | Ga0495649_0102475 | |||
| 1768 | Ga0495589_0003791 | |||
| 1769 | Ga0495589_0008907 | |||
| 1770 | Ga0495589_0077824 | |||
| 1771 | Ga0495589_0091719 | |||
| 1772 | Ga0495600_0000124 | |||
| 1773 | Ga0495600_0004312 | |||
| 1774 | Ga0495600_0006029 | |||
| 1775 | Ga0495600_0026387 | |||
| 1776 | Ga0495600_0033821 | |||
| 1777 | Ga0495600_0042804 | |||
| 1778 | Ga0495600_0070644 | |||
| 1779 | Ga0495600_0094695 | |||
| 1780 | Ga0495600_0121418 | |||
| 1781 | Ga0495660_0053103 | |||
| 1782 | Ga0495581_0013815 | |||
| 1783 | Ga0495581_0026066 | |||
| 1784 | Ga0495581_0057624 | |||
| 1785 | Ga0495581_0058630 | |||
| 1786 | Ga0495604_0000032 | |||
| 1787 | Ga0495604_0000635 | |||
| 1788 | Ga0495604_0005069 | |||
| 1789 | Ga0495604_0021140 | |||
| 1790 | Ga0495604_0021660 | |||
| 1791 | Ga0495604_0040941 | |||
| 1792 | Ga0495604_0124068 | |||
| 1793 | Ga0495604_0124827 | |||
| 1794 | Ga0495636_0026436 | |||
| 1795 | Ga0495636_0029658 | |||
| 1796 | Ga0495674_0007591 | |||
| 1797 | Ga0495674_0008937 | |||
| 1798 | Ga0495674_0031385 | |||
| 1799 | Ga0495674_0037970 | |||
| 1800 | Ga0495674_0177865 | |||
| 1801 | Ga0495674_0182603 | |||
| 1802 | Ga0495672_0071716 | |||
| 1803 | Ga0495676_0002926 | |||
| 1804 | Ga0495676_0003257 | |||
| 1805 | Ga0495676_0005841 | |||
| 1806 | Ga0495676_0016062 | |||
| 1807 | Ga0495676_0032758 | |||
| 1808 | Ga0495676_0065186 | |||
| 1809 | Ga0495680_0000058 | |||
| 1810 | Ga0495680_0025736 | |||
| 1811 | Ga0495680_0032888 | |||
| 1812 | Ga0495680_0045293 | |||
| 1813 | Ga0495680_0066907 | |||
| 1814 | Ga0495683_0084340 | |||
| 1815 | Ga0495687_007958 | |||
| 1816 | Ga0495675_0000679 | |||
| 1817 | Ga0495675_0003848 | |||
| 1818 | Ga0495675_0018011 | |||
| 1819 | Ga0495675_0034143 | |||
| 1820 | Ga0495675_0096493 | |||
| 1821 | Ga0495685_000446 | |||
| 1822 | Ga0495685_020320 | |||
| 1823 | Ga0495685_025216 | |||
| 1824 | Ga0495685_040160 | |||
| 1825 | Ga0495685_044066 | |||
| 1826 | Ga0495681_0002353 | |||
| 1827 | Ga0495681_0002430 | |||
| 1828 | Ga0495681_0043645 | |||
| 1829 | Ga0495684_0010142 | |||
| 1830 | Ga0495684_0014339 | |||
| 1831 | Ga0495684_0037283 | |||
| 1832 | Ga0495684_0040812 | |||
| 1833 | Ga0495684_0106139 | |||
| 1834 | Ga0495686_0039322 | |||
| 1835 | Ga0495593_0001065 | |||
| 1836 | Ga0495593_0002190 | |||
| 1837 | Ga0495593_0009073 | |||
| 1838 | Ga0495602_0000092 | |||
| 1839 | Ga0495602_0014113 | |||
| 1840 | Ga0495602_0022032 | |||
| 1841 | Ga0495602_0043234 | |||
| 1842 | Ga0495614_0001443 | |||
| 1843 | Ga0495614_0002481 | |||
| 1844 | Ga0495614_0002629 | |||
| 1845 | Ga0495614_0045180 | |||
| 1846 | Ga0495614_0098504 | |||
| 1847 | Ga0496100_0092905 | |||
| 1848 | Ga0496101_0154968 | |||
| 1849 | Ga0496102_0003034 | |||
| 1850 | Ga0496102_0021775 | |||
| 1851 | Ga0496102_0042867 | |||
| 1852 | Ga0496102_0064997 | |||
| 1853 | Ga0496102_0072382 | |||
| 1854 | Ga0496102_0204762 | |||
| 1855 | Ga0496102_0324159 | |||
| 1856 | Ga0496103_0074772 | |||
| 1857 | Ga0496104_0000244 | |||
| 1858 | Ga0496104_0134978 | |||
| 1859 | Ga0496105_0001370 | |||
| 1860 | Ga0496105_0034393 | |||
| 1861 | Ga0496107_0010045 | |||
| 1862 | Ga0496107_0030908 | |||
| 1863 | Ga0496107_0031927 | |||
| 1864 | Ga0496108_0008554 | |||
| 1865 | Ga0496108_0010090 | |||
| 1866 | Ga0496108_0166033 | |||
| 1867 | Ga0496109_0013798 | |||
| 1868 | Ga0496109_0019583 | |||
| 1869 | Ga0496109_0023085 | |||
| 1870 | Ga0496109_0048147 | |||
| 1871 | Ga0496109_0059631 | |||
| 1872 | Ga0496110_0014679 | |||
| 1873 | Ga0496110_0030416 | |||
| 1874 | Ga0496110_0041963 | |||
| 1875 | Ga0496111_0006908 | |||
| 1876 | Ga0496111_0040657 | |||
| 1877 | Ga0496111_0086378 | |||
| 1878 | Ga0496111_0102376 | |||
| 1879 | Ga0496112_0001754 | |||
| 1880 | Ga0496112_0316828 | |||
| 1881 | Ga0496113_0024868 | |||
| 1882 | Ga0496113_0049159 | |||
| 1883 | Ga0496113_0050330 | |||
| 1884 | Ga0496113_0256454 | |||
| 1885 | Ga0496114_0172821 | |||
| 1886 | Ga0496115_0042719 | |||
| 1887 | Ga0496115_0046890 | |||
| 1888 | Ga0496115_0112732 | |||
| 1889 | Ga0496115_0116202 | |||
| 1890 | Ga0496115_0116233 | |||
| 1891 | Ga0496121_0114469 | |||
| 1892 | Ga0496126_0187819 | |||
| 1893 | Ga0496126_0211467 | |||
| 1894 | Ga0495678_048034 | |||
| 1895 | Ga0501031_0001656 | |||
| 1896 | Ga0501031_0015250 | |||
| 1897 | Ga0501031_0102009 | |||
| 1898 | Ga0501032_0105058 | |||
| 1899 | Ga0501033_0002616 | |||
| 1900 | Ga0501033_0017648 | |||
| 1901 | Ga0501034_0029918 | |||
| 1902 | Ga0501034_0197263 | |||
| 1903 | Ga0501036_0000024 | |||
| 1904 | Ga0501036_0028132 | |||
| 1905 | Ga0501037_0015902 | |||
| 1906 | Ga0501037_0017673 | |||
| 1907 | Ga0501038_0008017 | |||
| 1908 | Ga0501038_0010473 | |||
| 1909 | Ga0501038_0012747 | |||
| 1910 | Ga0501039_0001591 | |||
| 1911 | Ga0501039_0012453 | |||
| 1912 | Ga0501040_0000144 | |||
| 1913 | Ga0501040_0016439 | |||
| 1914 | Ga0501041_0000359 | |||
| 1915 | Ga0501041_0025301 | |||
| 1916 | Ga0501042_0000388 | |||
| 1917 | Ga0501042_0003232 | |||
| 1918 | Ga0501042_0012100 | |||
| 1919 | Ga0501043_0004254 | |||
| 1920 | Ga0501043_0042936 | |||
| 1921 | Ga0501043_0049855 | |||
| 1922 | Ga0501046_0000495 | |||
| 1923 | Ga0501047_0049314 | |||
| 1924 | Ga0501048_0000192 | |||
| 1925 | Ga0501048_0021176 | |||
| 1926 | Ga0501067_0020366 | |||
| 1927 | Ga0501068_0001934 | |||
| 1928 | Ga0501068_0019718 | |||
| 1929 | Ga0501069_0055833 | |||
| 1930 | Ga0501070_0028315 | |||
| 1931 | Ga0501070_0036609 | |||
| 1932 | Ga0501070_0198983 | |||
| 1933 | Ga0501071_0003188 | |||
| 1934 | Ga0501071_0037072 | |||
| 1935 | Ga0501072_0000920 | |||
| 1936 | Ga0501072_0032965 | |||
| 1937 | Ga0501072_0048194 | |||
| 1938 | Ga0501073_0023674 | |||
| 1939 | Ga0501073_0113897 | |||
| 1940 | Ga0501074_0001328 | |||
| 1941 | Ga0501074_0004667 | |||
| 1942 | Ga0501074_0035653 | |||
| 1943 | Ga0501075_0000132 | |||
| 1944 | Ga0501076_0000281 | |||
| 1945 | Ga0501076_0023286 | |||
| 1946 | Ga0501077_0000332 | |||
| 1947 | Ga0501077_0003894 | |||
| 1948 | Ga0501079_0003439 | |||
| 1949 | Ga0501079_0015673 | |||
| 1950 | Ga0501079_0020586 | |||
| 1951 | Ga0501080_0019407 | |||
| 1952 | Ga0501080_0033312 | |||
| 1953 | Ga0501081_0010172 | |||
| 1954 | Ga0501081_0013408 | |||
| 1955 | Ga0501083_0004138 | |||
| 1956 | Ga0501035_0019738 | |||
| 1957 | Ga0501035_0082078 | |||
| 1958 | Ga0501035_0215949 | |||
| 1959 | Ga0501044_0054713 | |||
| 1960 | Ga0501044_0092412 | |||
| 1961 | Ga0501045_0000216 | |||
| 1962 | Ga0501045_0013278 | |||
| 1963 | nmdc:mga0yw44_213472_c1 | |||
| 1964 | nmdc:mga06z11_2103_c1 | |||
| 1965 | nmdc:mga05p37_110293_c1 | |||
| 1966 | nmdc:mga05p37_313554_c1 | |||
| 1967 | nmdc:mga05p37_353928_c1 | |||
| 1968 | nmdc:mga05p37_42108_c1 | |||
| 1969 | nmdc:mga05p37_4546_c1 | |||
| 1970 | nmdc:mga05p37_544681_c1 | |||
| 1971 | nmdc:mga09592_102592_c1 | |||
| 1972 | nmdc:mga0qj67_15701_c1 | |||
| 1973 | nmdc:mga0qj67_38148_c1 | |||
| 1974 | nmdc:mga06r32_118242_c1 | |||
| 1975 | nmdc:mga06r32_20455_c1 | |||
| 1976 | nmdc:mga08y16_129001_c1 | |||
| 1977 | nmdc:mga08y16_27457_c1 | |||
| 1978 | nmdc:mga0n895_103058_c1 | |||
| 1979 | nmdc:mga0n895_232198_c1 | |||
| 1980 | nmdc:mga0n895_334805_c1 | |||
| 1981 | nmdc:mga0rr50_190743_c1 | |||
| 1982 | nmdc:mga0rr50_19286_c1 | |||
| 1983 | nmdc:mga08x19_12598_c1 | |||
| 1984 | nmdc:mga0a205_10334_c1 | |||
| 1985 | nmdc:mga0a205_1709_c1 | |||
| 1986 | nmdc:mga0a205_5529_c1 | |||
| 1987 | nmdc:mga0a205_59766_c1 | |||
| 1988 | Ga0495601_0001343 | |||
| 1989 | Ga0495601_0005633 | |||
| 1990 | Ga0495601_0010347 | |||
| 1991 | Ga0495601_0034033 | |||
| 1992 | Ga0495601_0034403 | |||
| 1993 | Ga0495601_0076024 | |||
| 1994 | Ga0495601_0152149 | |||
| 1995 | Ga0495601_0155307 | |||
| 1996 | Ga0495612_0005116 | |||
| 1997 | Ga0495612_0005699 | |||
| 1998 | Ga0495612_0015201 | |||
| 1999 | Ga0495612_0030014 | |||
| 2000 | Ga0495595_0009801 | |||
| 2001 | Ga0495595_0021794 | |||
| 2002 | Ga0495595_0022058 | |||
| 2003 | Ga0495595_0071417 | |||
| 2004 | Ga0495619_0001479 | |||
| 2005 | Ga0495619_0010401 | |||
| 2006 | Ga0495619_0066283 | |||
| 2007 | Ga0495619_0105032 | |||
| 2008 | Ga0495619_0320213 | |||
| 2009 | Ga0500578_0007649 | |||
| 2010 | Ga0500644_0004472 | |||
| 2011 | Ga0500640_046359 | |||
| 2012 | Ga0500654_030751 | |||
| 2013 | Ga0500569_014808 | |||
| 2014 | Ga0500614_005706 | |||
| 2015 | Ga0500628_002620 | |||
| 2016 | Ga0500652_002244 | |||
| 2017 | Ga0500658_0008353 | |||
| 2018 | Ga0500561_0000448 | |||
| 2019 | Ga0500573_0036939 | |||
| 2020 | Ga0500579_021942 | |||
| 2021 | Ga0500600_0007019 | |||
| 2022 | Ga0500616_0014405 | |||
| 2023 | Ga0500634_0028656 | |||
| 2024 | Ga0500656_000457 | |||
| 2025 | Ga0500587_005173 | |||
| 2026 | Ga0501084_0001254 | |||
| 2027 | Ga0501084_0014854 | |||
| 2028 | Ga0501084_0016371 | |||
| 2029 | Ga0501082_0000366 | |||
| 2030 | Ga0501082_0005003 | |||
| 2031 | Ga0501082_0049464 | |||
| 2032 | Ga0466962_0008057 | |||
| 2033 | Ga0530510_0000013 | |||
| 2034 | 2585317345 | |||
| 2035 | 2616693144 | |||
| 2036 | 2616904349 | |||
| 2037 | 2644263513 | |||
| 2038 | 2785366749 | |||
| 2039 | 2786667807 | |||
| 2040 | 2808828189 | |||
| 2041 | 2808877972 | |||
| 2042 | 2808918053 | |||
| 2043 | 2812372489 | |||
| 2044 | 2812373356 | |||
| 2045 | 2835188483 | |||
| 2046 | 2862180702 | |||
| 2047 | 2862290056 | |||
| 2048 | 2862574991 | |||
| 2049 | 2873158096 | |||
| 2050 | 2877683794 | |||
| 2051 | 2912726530 | |||
| 2052 | 2945917807 | |||
| 2053 | 2954389097 | |||
| 2054 | 2954673947 | |||
| 2055 | 2954690044 | |||
| 2056 | 2954699843 | |||
| 2057 | 2954702355 | |||
| 2058 | 3006497048 | |||
| 2059 | 8008581090 | |||
| 2060 | 8056832647 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ubu-assembly1.cif.gz_D | 2.75 angstrom resolution crystal structure of acetamidase from yersinia enterocolitica. | 0.9304 | 2 | 314 |
| 2ii1-assembly2.cif.gz_B | crystal structure of acetamidase (10172637) from bacillus halodurans at 1.95 a resolution | 0.9264 | 4 | 311 |
| 2f4l-assembly2.cif.gz_C | crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution | 0.925 | 1 | 313 |
| 2f4l-assembly1.cif.gz_B | crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution | 0.9248 | 1 | 313 |
| 3tkk-assembly2.cif.gz_D | crystal structure analysis of a recombinant predicted acetamidase/ formamidase from the thermophile thermoanaerobacter tengcongensis | 0.9234 | 1 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2f4lB01 | Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains | 0.935 | 5 | 230 | 2.60.120.580 |
| 2f4lB01 | Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains | 0.9047 | 5 | 230 | 2.60.120.580 |
| 2f4lD03 | Alpha Beta;Roll;Endonuclease I-creI;Acetamidase/Formamidase-like domains | 0.9031 | 236 | 313 | 3.10.28.20 |
| 2f4lD03 | Alpha Beta;Roll;Endonuclease I-creI;Acetamidase/Formamidase-like domains | 0.8823 | 236 | 313 | 3.10.28.20 |
| af_Q5AJF2_20_284_2.60.120.580 | Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains | 0.8181 | 9 | 229 | 2.60.120.580 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I6SE48-F1-model_v4 | Acetamidase | 0.9808 | 2 | 332 |
GO:0016811
|
| AF-A0A6I3X6V0-F1-model_v4 | Acetamidase | 0.9778 | 2 | 331 |
GO:0016811
|
| AF-E6S7Q4-F1-model_v4 | Acetamidase/Formamidase | 0.9777 | 1 | 332 |
GO:0016811
|
| AF-A0A1Q9SBM4-F1-model_v4 | Acetamidase | 0.9775 | 2 | 336 |
GO:0016811
|
| AF-A0A1D7W201-F1-model_v4 | Acetamidase | 0.9773 | 1 | 332 |
GO:0016811
|