F488599
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1030 | 426 | 2061 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300053139|Ga0500568_0000336|Ga0500568_0000336_32114_33235 |
| Length | 373 |
| Sequence | LKSARIPLILRVPRASARRDAAGACSPGIGVAGGKEPASASEETLRSREKKRRGLYMTTHTHSRLIILGSGPAGYAAAVYAARANLKPTLITGLAQGGQLMTTTDVDNWPGDPEGVQGPELMKRMAEHAERFETSMVFDHIHSVDLSSRPFKLKGDAGSYSCDALIIATGATAKYLGLSSEEKYKGRGVSACATCDGFFFRDQDVAVVGGGNTAVEEALYLSNIAKKVTLIHRRDKLRAEKIMQDKLFEKQAAGKIDIVWNTAVSEVKGDGNGVTGLKLKSLVDTKTSELVIHGLFVAIGHTPNTGIFEGQLDMHNGYVKIKSGIEGNATATSVPGVFAAGDVADQVYRQAVTSAGFGCMAALDAEKFLDNGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 188 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 193 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 203 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 222 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 223 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 231 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 236 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 241 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 242 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 247 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 248 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 249 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 250 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 251 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 252 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 253 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 254 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 255 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 256 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 257 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 258 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 259 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 260 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 261 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 262 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 263 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 264 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 337 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 338 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 339 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 340 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 341 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 342 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 343 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 344 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 345 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 346 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 379 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 380 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 387 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 388 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 389 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 390 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 392 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 393 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 394 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 395 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 397 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 398 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 400 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 403 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 404 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 405 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 406 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 407 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 408 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 409 | 2643221665 | Acinetobacter sp. Root1280 | Isolate | Unclassified |
| 410 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 411 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 412 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 413 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 414 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 415 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 416 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 417 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 418 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 419 | 2928515477 | Acinetobacter bereziniae 1375 | Isolate | Rhizosphere |
| 420 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 421 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 422 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 423 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 424 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 425 | 8033232454 | Acinetobacter radioresistens SA188 | Isolate | Unclassified |
| 426 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.48 |
| Metatranscriptomes | 0.19 |
| Isolates | 2.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.2 |
| Nodule | 0.19 |
| Rhizoplane | 2.91 |
| Rhizosphere | 87.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500568_0000336 | 3300053139 | Bacteria | 37013 |
| 2 | MRS2a_Contig_29 | 2124908027 | Bacteria | 60739 |
| 3 | SwRhRL2b_contig_1815281 | 2162886007 | Bacteria | 1521 |
| 4 | JGI24736J21556_1007917 | 3300001904 | Bacteria | 1776 |
| 5 | JGI24741J21665_1000887 | 3300001915 | Bacteria | 9016 |
| 6 | JGI24740J21852_10001934 | 3300001979 | Bacteria | 9485 |
| 7 | JGI25406J46586_10009821 | 3300003203 | Bacteria | 4273 |
| 8 | rootH1_10092201 | 3300003316 | Bacteria | 3401 |
| 9 | rootH1_10092201 | 3300003323 | Bacteria | 2946 |
| 10 | rootH2_10036460 | 3300003320 | Bacteria | 1320 |
| 11 | rootL2_10049723 | 3300003322 | Bacteria | 5279 |
| 12 | Ga0055530_10007678 | 3300003791 | Bacteria | 4490 |
| 13 | Ga0055540_1006734 | 3300003792 | Bacteria | 4496 |
| 14 | Ga0065714_10000586 | 3300005288 | Bacteria | 3626 |
| 15 | Ga0065714_10004993 | 3300005288 | Bacteria | 6032 |
| 16 | Ga0065714_10078307 | 3300005288 | Bacteria | 2600 |
| 17 | Ga0065714_10161649 | 3300005288 | Bacteria | 1049 |
| 18 | Ga0065704_10002538 | 3300005289 | Bacteria | 5890 |
| 19 | Ga0065712_10000263 | 3300005290 | Bacteria | 16961 |
| 20 | Ga0065715_10006697 | 3300005293 | Bacteria | 4022 |
| 21 | Ga0065707_10227509 | 3300005295 | Bacteria | 1195 |
| 22 | Ga0070658_10002861 | 3300005327 | Bacteria | 14332 |
| 23 | Ga0070658_10021105 | 3300005327 | Bacteria | 5217 |
| 24 | Ga0070658_10098004 | 3300005327 | Bacteria | 2421 |
| 25 | Ga0070658_10188720 | 3300005327 | Bacteria | 1737 |
| 26 | Ga0070658_10365753 | 3300005327 | Bacteria | 1236 |
| 27 | Ga0070676_10000801 | 3300005328 | Bacteria | 15534 |
| 28 | Ga0070683_100028714 | 3300005329 | Bacteria | 5029 |
| 29 | Ga0070683_100097958 | 3300005329 | Bacteria | 2759 |
| 30 | Ga0070690_100014512 | 3300005330 | Bacteria | 4675 |
| 31 | Ga0070670_100000001 | 3300005331 | Bacteria | 728788 |
| 32 | Ga0070670_100010905 | 3300005331 | Bacteria | 7762 |
| 33 | Ga0070670_100040521 | 3300005331 | Bacteria | 4004 |
| 34 | Ga0070670_100228039 | 3300005331 | Bacteria | 1621 |
| 35 | Ga0070666_10000266 | 3300005335 | Bacteria | 34748 |
| 36 | Ga0070666_10000366 | 3300005335 | Bacteria | 28523 |
| 37 | Ga0070666_10002682 | 3300005335 | Bacteria | 10736 |
| 38 | Ga0070666_10020127 | 3300005335 | Bacteria | 4311 |
| 39 | Ga0070666_10038890 | 3300005335 | Bacteria | 3167 |
| 40 | Ga0070666_10096976 | 3300005335 | Bacteria | 2030 |
| 41 | Ga0070680_100013113 | 3300005336 | Bacteria | 6450 |
| 42 | Ga0070680_100020091 | 3300005336 | Bacteria | 5297 |
| 43 | Ga0070680_100042636 | 3300005336 | Bacteria | 3683 |
| 44 | Ga0070682_100003230 | 3300005337 | Bacteria | 9038 |
| 45 | Ga0070682_100029006 | 3300005337 | Bacteria | 3331 |
| 46 | Ga0070682_100170824 | 3300005337 | Bacteria | 1511 |
| 47 | Ga0068868_100038971 | 3300005338 | Bacteria | 3690 |
| 48 | Ga0068868_100245212 | 3300005338 | Bacteria | 1506 |
| 49 | Ga0070660_100232151 | 3300005339 | Bacteria | 1501 |
| 50 | Ga0070691_10037348 | 3300005341 | Bacteria | 2291 |
| 51 | Ga0070661_100030042 | 3300005344 | Bacteria | 3924 |
| 52 | Ga0070661_100131620 | 3300005344 | Bacteria | 1879 |
| 53 | Ga0070661_100166713 | 3300005344 | Bacteria | 1671 |
| 54 | Ga0070661_100236324 | 3300005344 | Bacteria | 1406 |
| 55 | Ga0070668_100009295 | 3300005347 | Bacteria | 7290 |
| 56 | Ga0070668_100027917 | 3300005347 | Bacteria | 4283 |
| 57 | Ga0070669_100006195 | 3300005353 | Bacteria | 8636 |
| 58 | Ga0070669_100131881 | 3300005353 | Bacteria | 1918 |
| 59 | Ga0070671_100000008 | 3300005355 | Bacteria | 207831 |
| 60 | Ga0070671_100002122 | 3300005355 | Bacteria | 15297 |
| 61 | Ga0070671_100027704 | 3300005355 | Bacteria | 4665 |
| 62 | Ga0070674_100040640 | 3300005356 | Bacteria | 3147 |
| 63 | Ga0070674_100121220 | 3300005356 | Bacteria | 1936 |
| 64 | Ga0070673_100132447 | 3300005364 | Bacteria | 2094 |
| 65 | Ga0070688_100000972 | 3300005365 | Bacteria | 14354 |
| 66 | Ga0070659_100050655 | 3300005366 | Bacteria | 3264 |
| 67 | Ga0070659_100092399 | 3300005366 | Bacteria | 2426 |
| 68 | Ga0070667_100000023 | 3300005367 | Bacteria | 199687 |
| 69 | Ga0070667_100000225 | 3300005367 | Bacteria | 65088 |
| 70 | Ga0070667_100000351 | 3300005367 | Bacteria | 51098 |
| 71 | Ga0070667_100027768 | 3300005367 | Bacteria | 4709 |
| 72 | Ga0070667_100030752 | 3300005367 | Bacteria | 4477 |
| 73 | Ga0070667_100036062 | 3300005367 | Bacteria | 4145 |
| 74 | Ga0070667_100059701 | 3300005367 | Bacteria | 3226 |
| 75 | Ga0070667_100105858 | 3300005367 | Bacteria | 2434 |
| 76 | Ga0070667_100141629 | 3300005367 | Bacteria | 2106 |
| 77 | Ga0070709_10015157 | 3300005434 | Bacteria | 4380 |
| 78 | Ga0070713_100011000 | 3300005436 | Bacteria | 6566 |
| 79 | Ga0070710_10006012 | 3300005437 | Bacteria | 5797 |
| 80 | Ga0070710_10205949 | 3300005437 | Bacteria | 1244 |
| 81 | Ga0070711_100077846 | 3300005439 | Bacteria | 2354 |
| 82 | Ga0070700_100215673 | 3300005441 | Bacteria | 1357 |
| 83 | Ga0070663_100000103 | 3300005455 | Bacteria | 39106 |
| 84 | Ga0070663_100037863 | 3300005455 | Bacteria | 3360 |
| 85 | Ga0070663_100087828 | 3300005455 | Bacteria | 2298 |
| 86 | Ga0070663_100140479 | 3300005455 | Bacteria | 1843 |
| 87 | Ga0070678_100040516 | 3300005456 | Bacteria | 3297 |
| 88 | Ga0070678_100071337 | 3300005456 | Bacteria | 2600 |
| 89 | Ga0070678_100147590 | 3300005456 | Bacteria | 1890 |
| 90 | Ga0070678_100164989 | 3300005456 | Bacteria | 1799 |
| 91 | Ga0070662_100009906 | 3300005457 | Bacteria | 6243 |
| 92 | Ga0070662_100016490 | 3300005457 | Bacteria | 4962 |
| 93 | Ga0070681_10000007 | 3300005458 | Bacteria | 159821 |
| 94 | Ga0070681_10001003 | 3300005458 | Bacteria | 23931 |
| 95 | Ga0070681_10003796 | 3300005458 | Bacteria | 14193 |
| 96 | Ga0070681_10004322 | 3300005458 | Bacteria | 13500 |
| 97 | Ga0070681_10013362 | 3300005458 | Bacteria | 8159 |
| 98 | Ga0070681_10046179 | 3300005458 | Bacteria | 4355 |
| 99 | Ga0070681_10073546 | 3300005458 | Bacteria | 3379 |
| 100 | Ga0068867_100006727 | 3300005459 | Bacteria | 8127 |
| 101 | Ga0068867_100027219 | 3300005459 | Bacteria | 4108 |
| 102 | Ga0068867_100046833 | 3300005459 | Bacteria | 3177 |
| 103 | Ga0070685_10000008 | 3300005466 | Bacteria | 166350 |
| 104 | Ga0070685_10001807 | 3300005466 | Bacteria | 11144 |
| 105 | Ga0070698_100104748 | 3300005471 | Bacteria | 2798 |
| 106 | Ga0070679_100003433 | 3300005530 | Bacteria | 14509 |
| 107 | Ga0070679_100081974 | 3300005530 | Bacteria | 3216 |
| 108 | Ga0070679_100210745 | 3300005530 | Bacteria | 1907 |
| 109 | Ga0070684_100014025 | 3300005535 | Bacteria | 6480 |
| 110 | Ga0070684_100119988 | 3300005535 | Bacteria | 2365 |
| 111 | Ga0068853_100020049 | 3300005539 | Bacteria | 5556 |
| 112 | Ga0068853_100187248 | 3300005539 | Bacteria | 1879 |
| 113 | Ga0070672_100003658 | 3300005543 | Bacteria | 9989 |
| 114 | Ga0070672_100004615 | 3300005543 | Bacteria | 9023 |
| 115 | Ga0070686_100127961 | 3300005544 | Bacteria | 1753 |
| 116 | Ga0070696_100000793 | 3300005546 | Bacteria | 20343 |
| 117 | Ga0070696_100237882 | 3300005546 | Bacteria | 1372 |
| 118 | Ga0070693_100013299 | 3300005547 | Bacteria | 4189 |
| 119 | Ga0070693_100025885 | 3300005547 | Bacteria | 3160 |
| 120 | Ga0070665_100000102 | 3300005548 | Bacteria | 159058 |
| 121 | Ga0070665_100000709 | 3300005548 | Bacteria | 44346 |
| 122 | Ga0070665_100002620 | 3300005548 | Bacteria | 19622 |
| 123 | Ga0070665_100008098 | 3300005548 | Bacteria | 10638 |
| 124 | Ga0070665_100012413 | 3300005548 | Bacteria | 8587 |
| 125 | Ga0070665_100021778 | 3300005548 | Bacteria | 6445 |
| 126 | Ga0070665_100028052 | 3300005548 | Bacteria | 5670 |
| 127 | Ga0070665_100048855 | 3300005548 | Bacteria | 4247 |
| 128 | Ga0070665_100052726 | 3300005548 | Bacteria | 4079 |
| 129 | Ga0070665_100090078 | 3300005548 | Bacteria | 3073 |
| 130 | Ga0070665_100138712 | 3300005548 | Bacteria | 2435 |
| 131 | Ga0068855_100000869 | 3300005563 | Bacteria | 37546 |
| 132 | Ga0068855_100003358 | 3300005563 | Bacteria | 19597 |
| 133 | Ga0068855_100015402 | 3300005563 | Bacteria | 9205 |
| 134 | Ga0068855_100015412 | 3300005563 | Bacteria | 9202 |
| 135 | Ga0068855_100015869 | 3300005563 | Bacteria | 9063 |
| 136 | Ga0068855_100018045 | 3300005563 | Bacteria | 8479 |
| 137 | Ga0068855_100099120 | 3300005563 | Bacteria | 3356 |
| 138 | Ga0068855_100121723 | 3300005563 | Bacteria | 2986 |
| 139 | Ga0068855_100152349 | 3300005563 | Bacteria | 2629 |
| 140 | Ga0068855_100259873 | 3300005563 | Bacteria | 1935 |
| 141 | Ga0070664_100066002 | 3300005564 | Bacteria | 3089 |
| 142 | Ga0070664_100107734 | 3300005564 | Bacteria | 2429 |
| 143 | Ga0070664_100529649 | 3300005564 | Bacteria | 1088 |
| 144 | Ga0068857_100065824 | 3300005577 | Bacteria | 3223 |
| 145 | Ga0068854_100000359 | 3300005578 | Bacteria | 29216 |
| 146 | Ga0068854_100007279 | 3300005578 | Bacteria | 7069 |
| 147 | Ga0068854_100095849 | 3300005578 | Bacteria | 2216 |
| 148 | Ga0068856_100005926 | 3300005614 | Bacteria | 12028 |
| 149 | Ga0068856_100009532 | 3300005614 | Bacteria | 9433 |
| 150 | Ga0068856_100020508 | 3300005614 | Bacteria | 6419 |
| 151 | Ga0068856_100023176 | 3300005614 | Bacteria | 6038 |
| 152 | Ga0068856_100068937 | 3300005614 | Bacteria | 3497 |
| 153 | Ga0068856_100086641 | 3300005614 | Bacteria | 3112 |
| 154 | Ga0068856_100126287 | 3300005614 | Bacteria | 2561 |
| 155 | Ga0068856_100149213 | 3300005614 | Bacteria | 2346 |
| 156 | Ga0068856_100184422 | 3300005614 | Bacteria | 2100 |
| 157 | Ga0068856_100333947 | 3300005614 | Bacteria | 1533 |
| 158 | Ga0068852_100000619 | 3300005616 | Bacteria | 23305 |
| 159 | Ga0068852_100048326 | 3300005616 | Bacteria | 3634 |
| 160 | Ga0068852_100072643 | 3300005616 | Bacteria | 3024 |
| 161 | Ga0068852_100176946 | 3300005616 | Bacteria | 2004 |
| 162 | Ga0068852_100192265 | 3300005616 | Bacteria | 1926 |
| 163 | Ga0068859_100004845 | 3300005617 | Bacteria | 13696 |
| 164 | Ga0068859_100005322 | 3300005617 | Bacteria | 13085 |
| 165 | Ga0068859_100024482 | 3300005617 | Bacteria | 6057 |
| 166 | Ga0068859_100024740 | 3300005617 | Bacteria | 6026 |
| 167 | Ga0068859_100382414 | 3300005617 | Bacteria | 1503 |
| 168 | Ga0068864_100000006 | 3300005618 | Bacteria | 393838 |
| 169 | Ga0068864_100005151 | 3300005618 | Bacteria | 10705 |
| 170 | Ga0068866_10010588 | 3300005718 | Bacteria | 3959 |
| 171 | Ga0068861_100003245 | 3300005719 | Bacteria | 10767 |
| 172 | Ga0068861_100140580 | 3300005719 | Bacteria | 1970 |
| 173 | Ga0068861_100210198 | 3300005719 | Bacteria | 1638 |
| 174 | Ga0068861_100417058 | 3300005719 | Bacteria | 1195 |
| 175 | Ga0068851_10014998 | 3300005834 | Bacteria | 3686 |
| 176 | Ga0068863_100002746 | 3300005841 | Bacteria | 17414 |
| 177 | Ga0068863_100048963 | 3300005841 | Bacteria | 4007 |
| 178 | Ga0068863_100079149 | 3300005841 | Bacteria | 3113 |
| 179 | Ga0068863_100211377 | 3300005841 | Bacteria | 1868 |
| 180 | Ga0068858_100002744 | 3300005842 | Bacteria | 17703 |
| 181 | Ga0068858_100008701 | 3300005842 | Bacteria | 9746 |
| 182 | Ga0068858_100023716 | 3300005842 | Bacteria | 5716 |
| 183 | Ga0068858_100064339 | 3300005842 | Bacteria | 3394 |
| 184 | Ga0068858_100329660 | 3300005842 | Bacteria | 1460 |
| 185 | Ga0068860_100001556 | 3300005843 | Bacteria | 24714 |
| 186 | Ga0068860_100004920 | 3300005843 | Bacteria | 13614 |
| 187 | Ga0068860_100015642 | 3300005843 | Bacteria | 7408 |
| 188 | Ga0068860_100027176 | 3300005843 | Bacteria | 5513 |
| 189 | Ga0068860_100030918 | 3300005843 | Bacteria | 5148 |
| 190 | Ga0068862_100001815 | 3300005844 | Bacteria | 19329 |
| 191 | Ga0068862_100005746 | 3300005844 | Bacteria | 10350 |
| 192 | Ga0068862_100019192 | 3300005844 | Bacteria | 5702 |
| 193 | Ga0068862_100033996 | 3300005844 | Bacteria | 4312 |
| 194 | Ga0081455_10001394 | 3300005937 | Bacteria | 29861 |
| 195 | Ga0081455_10207510 | 3300005937 | Bacteria | 1462 |
| 196 | Ga0081540_1004452 | 3300005983 | Bacteria | 10679 |
| 197 | Ga0081539_10000004 | 3300005985 | Bacteria | 555600 |
| 198 | Ga0075432_10010912 | 3300006058 | Bacteria | 3084 |
| 199 | Ga0075432_10080061 | 3300006058 | Bacteria | 1183 |
| 200 | Ga0070715_10000150 | 3300006163 | Bacteria | 16297 |
| 201 | Ga0070715_10121259 | 3300006163 | Bacteria | 1247 |
| 202 | Ga0070716_100002317 | 3300006173 | Bacteria | 8768 |
| 203 | Ga0070716_100042131 | 3300006173 | Bacteria | 2547 |
| 204 | Ga0070712_100040018 | 3300006175 | Bacteria | 3211 |
| 205 | Ga0097621_100055375 | 3300006237 | Bacteria | 3238 |
| 206 | Ga0097621_100103451 | 3300006237 | Bacteria | 2398 |
| 207 | Ga0097621_100150592 | 3300006237 | Bacteria | 1995 |
| 208 | Ga0097621_100178016 | 3300006237 | Bacteria | 1836 |
| 209 | Ga0068871_100025776 | 3300006358 | Bacteria | 4579 |
| 210 | Ga0068871_100048555 | 3300006358 | Bacteria | 3427 |
| 211 | Ga0068871_100070433 | 3300006358 | Bacteria | 2874 |
| 212 | Ga0068871_100094004 | 3300006358 | Bacteria | 2502 |
| 213 | Ga0075428_100062267 | 3300006844 | Bacteria | 4085 |
| 214 | Ga0075428_100102828 | 3300006844 | Bacteria | 3116 |
| 215 | Ga0075430_100118948 | 3300006846 | Bacteria | 2202 |
| 216 | Ga0075430_100203250 | 3300006846 | Bacteria | 1645 |
| 217 | Ga0075431_100026131 | 3300006847 | Bacteria | 5988 |
| 218 | Ga0075431_100029453 | 3300006847 | Bacteria | 5651 |
| 219 | Ga0075431_100049198 | 3300006847 | Bacteria | 4347 |
| 220 | Ga0075431_100259610 | 3300006847 | Bacteria | 1763 |
| 221 | Ga0068865_100016243 | 3300006881 | Bacteria | 4759 |
| 222 | Ga0068865_100085170 | 3300006881 | Bacteria | 2279 |
| 223 | Ga0068865_100094246 | 3300006881 | Bacteria | 2178 |
| 224 | Ga0068865_100139785 | 3300006881 | Bacteria | 1825 |
| 225 | Ga0097620_100004845 | 3300006931 | Bacteria | 13696 |
| 226 | Ga0097620_100005322 | 3300006931 | Bacteria | 13085 |
| 227 | Ga0097620_100024482 | 3300006931 | Bacteria | 6057 |
| 228 | Ga0097620_100024739 | 3300006931 | Bacteria | 6026 |
| 229 | Ga0097620_100052208 | 3300006931 | Bacteria | 4110 |
| 230 | Ga0097620_100382409 | 3300006931 | Bacteria | 1503 |
| 231 | Ga0079104_1000242 | 3300006946 | Bacteria | 72707 |
| 232 | Ga0099795_10000011 | 3300007788 | Bacteria | 78558 |
| 233 | Ga0105251_10022084 | 3300009011 | Bacteria | 3313 |
| 234 | Ga0105244_10001520 | 3300009036 | Bacteria | 18538 |
| 235 | Ga0105250_10000006 | 3300009092 | Bacteria | 390071 |
| 236 | Ga0105250_10034494 | 3300009092 | Bacteria | 2031 |
| 237 | Ga0105240_10003206 | 3300009093 | Bacteria | 25662 |
| 238 | Ga0105240_10005121 | 3300009093 | Bacteria | 19617 |
| 239 | Ga0105240_10006350 | 3300009093 | Bacteria | 17408 |
| 240 | Ga0105240_10017411 | 3300009093 | Bacteria | 9685 |
| 241 | Ga0105240_10022180 | 3300009093 | Bacteria | 8423 |
| 242 | Ga0105240_10044864 | 3300009093 | Bacteria | 5612 |
| 243 | Ga0105240_10058656 | 3300009093 | Bacteria | 4805 |
| 244 | Ga0105240_10099273 | 3300009093 | Bacteria | 3544 |
| 245 | Ga0105240_10122562 | 3300009093 | Bacteria | 3128 |
| 246 | Ga0105240_10227971 | 3300009093 | Bacteria | 2167 |
| 247 | Ga0105240_10309191 | 3300009093 | Bacteria | 1805 |
| 248 | Ga0105240_10315261 | 3300009093 | Bacteria | 1784 |
| 249 | Ga0105240_10434659 | 3300009093 | Bacteria | 1472 |
| 250 | Ga0111539_10085808 | 3300009094 | Bacteria | 3700 |
| 251 | Ga0111539_10303991 | 3300009094 | Bacteria | 1856 |
| 252 | Ga0105247_10012741 | 3300009101 | Bacteria | 5047 |
| 253 | Ga0105247_10033707 | 3300009101 | Bacteria | 3116 |
| 254 | Ga0105247_10148403 | 3300009101 | Bacteria | 1543 |
| 255 | Ga0114129_10015627 | 3300009147 | Bacteria | 10794 |
| 256 | Ga0114129_10319798 | 3300009147 | Bacteria | 2063 |
| 257 | Ga0105241_10004820 | 3300009174 | Bacteria | 9940 |
| 258 | Ga0105241_10006404 | 3300009174 | Bacteria | 8677 |
| 259 | Ga0105241_10022169 | 3300009174 | Bacteria | 4701 |
| 260 | Ga0105242_10013658 | 3300009176 | Bacteria | 6281 |
| 261 | Ga0105248_10000148 | 3300009177 | Bacteria | 81603 |
| 262 | Ga0105248_10017268 | 3300009177 | Bacteria | 7952 |
| 263 | Ga0105248_10030874 | 3300009177 | Bacteria | 5986 |
| 264 | Ga0105248_10032216 | 3300009177 | Bacteria | 5859 |
| 265 | Ga0105248_10042508 | 3300009177 | Bacteria | 5097 |
| 266 | Ga0105248_10097336 | 3300009177 | Bacteria | 3315 |
| 267 | Ga0105237_10001581 | 3300009545 | Bacteria | 29638 |
| 268 | Ga0105237_10004537 | 3300009545 | Bacteria | 16046 |
| 269 | Ga0105237_10011215 | 3300009545 | Bacteria | 9495 |
| 270 | Ga0105237_10028376 | 3300009545 | Bacteria | 5701 |
| 271 | Ga0105237_10031922 | 3300009545 | Bacteria | 5333 |
| 272 | Ga0105237_10032183 | 3300009545 | Bacteria | 5311 |
| 273 | Ga0105237_10086247 | 3300009545 | Bacteria | 3130 |
| 274 | Ga0105237_10120739 | 3300009545 | Bacteria | 2615 |
| 275 | Ga0105237_10134974 | 3300009545 | Bacteria | 2462 |
| 276 | Ga0105237_10163499 | 3300009545 | Bacteria | 2225 |
| 277 | Ga0105238_10005734 | 3300009551 | Bacteria | 12281 |
| 278 | Ga0105238_10021517 | 3300009551 | Bacteria | 6568 |
| 279 | Ga0105238_10023740 | 3300009551 | Bacteria | 6250 |
| 280 | Ga0105238_10060320 | 3300009551 | Bacteria | 3798 |
| 281 | Ga0105238_10061006 | 3300009551 | Bacteria | 3775 |
| 282 | Ga0105238_10064775 | 3300009551 | Bacteria | 3654 |
| 283 | Ga0105238_10085294 | 3300009551 | Bacteria | 3146 |
| 284 | Ga0105238_10088190 | 3300009551 | Bacteria | 3089 |
| 285 | Ga0105238_10164670 | 3300009551 | Bacteria | 2193 |
| 286 | Ga0105249_10001612 | 3300009553 | Bacteria | 19749 |
| 287 | Ga0105249_10002933 | 3300009553 | Bacteria | 14710 |
| 288 | Ga0105249_10003331 | 3300009553 | Bacteria | 13914 |
| 289 | Ga0105249_10004420 | 3300009553 | Bacteria | 12156 |
| 290 | Ga0105249_10089063 | 3300009553 | Bacteria | 2883 |
| 291 | Ga0105249_10218969 | 3300009553 | Bacteria | 1872 |
| 292 | Ga0099796_10000024 | 3300010159 | Bacteria | 38665 |
| 293 | Ga0105239_10003663 | 3300010375 | Bacteria | 18768 |
| 294 | Ga0105239_10004199 | 3300010375 | Bacteria | 17302 |
| 295 | Ga0105239_10020407 | 3300010375 | Bacteria | 7310 |
| 296 | Ga0105239_10060951 | 3300010375 | Bacteria | 4141 |
| 297 | Ga0105239_10216960 | 3300010375 | Bacteria | 2145 |
| 298 | Ga0105239_10791366 | 3300010375 | Bacteria | 1086 |
| 299 | Ga0105246_10024366 | 3300011119 | Bacteria | 3931 |
| 300 | Ga0105246_10243049 | 3300011119 | Bacteria | 1424 |
| 301 | Ga0157373_10045545 | 3300013100 | Bacteria | 3131 |
| 302 | Ga0157373_10134665 | 3300013100 | Bacteria | 1737 |
| 303 | Ga0157373_10219683 | 3300013100 | Bacteria | 1340 |
| 304 | Ga0157371_10007059 | 3300013102 | Bacteria | 9139 |
| 305 | Ga0157371_10008053 | 3300013102 | Bacteria | 8432 |
| 306 | Ga0157370_10017048 | 3300013104 | Bacteria | 7341 |
| 307 | Ga0157370_10025869 | 3300013104 | Bacteria | 5804 |
| 308 | Ga0157370_10044313 | 3300013104 | Bacteria | 4277 |
| 309 | Ga0157370_10077034 | 3300013104 | Bacteria | 3142 |
| 310 | Ga0157370_10078927 | 3300013104 | Bacteria | 3100 |
| 311 | Ga0157370_10273004 | 3300013104 | Bacteria | 1562 |
| 312 | Ga0157370_10489331 | 3300013104 | Bacteria | 1130 |
| 313 | Ga0157369_10000027 | 3300013105 | Bacteria | 213988 |
| 314 | Ga0157369_10002023 | 3300013105 | Bacteria | 24459 |
| 315 | Ga0157369_10008199 | 3300013105 | Bacteria | 11984 |
| 316 | Ga0157369_10012504 | 3300013105 | Bacteria | 9632 |
| 317 | Ga0157369_10022625 | 3300013105 | Bacteria | 7010 |
| 318 | Ga0157369_10085695 | 3300013105 | Bacteria | 3366 |
| 319 | Ga0157369_10099878 | 3300013105 | Bacteria | 3093 |
| 320 | Ga0157369_10125769 | 3300013105 | Bacteria | 2718 |
| 321 | Ga0157369_10161053 | 3300013105 | Bacteria | 2369 |
| 322 | Ga0157369_10184799 | 3300013105 | Bacteria | 2192 |
| 323 | Ga0157369_10261416 | 3300013105 | Bacteria | 1805 |
| 324 | Ga0157369_10348633 | 3300013105 | Bacteria | 1538 |
| 325 | Ga0157369_10356448 | 3300013105 | Bacteria | 1519 |
| 326 | Ga0157374_10047854 | 3300013296 | Bacteria | 3966 |
| 327 | Ga0157374_10097958 | 3300013296 | Bacteria | 2807 |
| 328 | Ga0157374_10161175 | 3300013296 | Bacteria | 2185 |
| 329 | Ga0157378_10000018 | 3300013297 | Bacteria | 134075 |
| 330 | Ga0157378_10001851 | 3300013297 | Bacteria | 18989 |
| 331 | Ga0157378_10033212 | 3300013297 | Bacteria | 4560 |
| 332 | Ga0157378_10065676 | 3300013297 | Bacteria | 3248 |
| 333 | Ga0157378_10463461 | 3300013297 | Bacteria | 1260 |
| 334 | Ga0163162_10000662 | 3300013306 | Bacteria | 31904 |
| 335 | Ga0163162_10005502 | 3300013306 | Bacteria | 12240 |
| 336 | Ga0163162_10011348 | 3300013306 | Bacteria | 8687 |
| 337 | Ga0163162_10019703 | 3300013306 | Bacteria | 6622 |
| 338 | Ga0163162_10344129 | 3300013306 | Bacteria | 1624 |
| 339 | Ga0163162_10729712 | 3300013306 | Bacteria | 1111 |
| 340 | Ga0157372_10015942 | 3300013307 | Bacteria | 8059 |
| 341 | Ga0157372_10066288 | 3300013307 | Bacteria | 4056 |
| 342 | Ga0157375_10000154 | 3300013308 | Bacteria | 66940 |
| 343 | Ga0157375_10001786 | 3300013308 | Bacteria | 18442 |
| 344 | Ga0157375_10003810 | 3300013308 | Bacteria | 13074 |
| 345 | Ga0157375_10014424 | 3300013308 | Bacteria | 7050 |
| 346 | Ga0157375_10172726 | 3300013308 | Bacteria | 2310 |
| 347 | Ga0163163_10000381 | 3300014325 | Bacteria | 42231 |
| 348 | Ga0163163_10000766 | 3300014325 | Bacteria | 27287 |
| 349 | Ga0163163_10086362 | 3300014325 | Bacteria | 3146 |
| 350 | Ga0163163_10129218 | 3300014325 | Bacteria | 2566 |
| 351 | Ga0182008_10037120 | 3300014497 | Bacteria | 2438 |
| 352 | Ga0157379_10000444 | 3300014968 | Bacteria | 33508 |
| 353 | Ga0157379_10000830 | 3300014968 | Bacteria | 25057 |
| 354 | Ga0157379_10005133 | 3300014968 | Bacteria | 11236 |
| 355 | Ga0157379_10101152 | 3300014968 | Bacteria | 2587 |
| 356 | Ga0157376_10009073 | 3300014969 | Bacteria | 7204 |
| 357 | Ga0157376_10011633 | 3300014969 | Bacteria | 6495 |
| 358 | Ga0157376_10064361 | 3300014969 | Bacteria | 3092 |
| 359 | Ga0182006_1003790 | 3300015261 | Bacteria | 7607 |
| 360 | Ga0182006_1021301 | 3300015261 | Bacteria | 2704 |
| 361 | Ga0182007_10013242 | 3300015262 | Bacteria | 3151 |
| 362 | Ga0182005_1002273 | 3300015265 | Bacteria | 7045 |
| 363 | Ga0182005_1006568 | 3300015265 | Bacteria | 3539 |
| 364 | Ga0163161_10176586 | 3300017792 | Bacteria | 1635 |
| 365 | Ga0209147_102387 | 3300025229 | Bacteria | 4726 |
| 366 | Ga0209233_1005559 | 3300025261 | Bacteria | 4168 |
| 367 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 368 | Ga0209051_1000380 | 3300025303 | Bacteria | 63324 |
| 369 | Ga0209051_1002103 | 3300025303 | Bacteria | 14932 |
| 370 | Ga0209257_1013988 | 3300025304 | Bacteria | 3499 |
| 371 | Ga0209257_1024565 | 3300025304 | Bacteria | 2083 |
| 372 | Ga0207697_10055947 | 3300025315 | Bacteria | 1636 |
| 373 | Ga0207656_10005278 | 3300025321 | Bacteria | 4558 |
| 374 | Ga0207656_10011987 | 3300025321 | Bacteria | 3288 |
| 375 | Ga0207696_1000069 | 3300025711 | Bacteria | 227744 |
| 376 | Ga0207696_1026731 | 3300025711 | Bacteria | 1783 |
| 377 | Ga0207692_10197154 | 3300025898 | Bacteria | 1182 |
| 378 | Ga0207710_10000196 | 3300025900 | Bacteria | 57024 |
| 379 | Ga0207710_10124575 | 3300025900 | Bacteria | 1233 |
| 380 | Ga0207680_10000249 | 3300025903 | Bacteria | 25802 |
| 381 | Ga0207680_10007170 | 3300025903 | Bacteria | 5419 |
| 382 | Ga0207680_10034740 | 3300025903 | Bacteria | 2887 |
| 383 | Ga0207680_10082161 | 3300025903 | Bacteria | 2027 |
| 384 | Ga0207680_10131819 | 3300025903 | Bacteria | 1648 |
| 385 | Ga0207680_10251697 | 3300025903 | Bacteria | 1220 |
| 386 | Ga0207647_10000150 | 3300025904 | Bacteria | 55376 |
| 387 | Ga0207647_10000344 | 3300025904 | Bacteria | 37604 |
| 388 | Ga0207647_10037600 | 3300025904 | Bacteria | 3068 |
| 389 | Ga0207685_10028645 | 3300025905 | Bacteria | 1964 |
| 390 | Ga0207645_10002185 | 3300025907 | Bacteria | 15611 |
| 391 | Ga0207645_10057755 | 3300025907 | Bacteria | 2477 |
| 392 | Ga0207643_10167435 | 3300025908 | Bacteria | 1325 |
| 393 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 394 | Ga0207705_10018658 | 3300025909 | Bacteria | 4961 |
| 395 | Ga0207705_10081844 | 3300025909 | Bacteria | 2353 |
| 396 | Ga0207705_10300606 | 3300025909 | Bacteria | 1231 |
| 397 | Ga0207654_10002216 | 3300025911 | Bacteria | 9973 |
| 398 | Ga0207654_10003305 | 3300025911 | Bacteria | 8153 |
| 399 | Ga0207707_10003587 | 3300025912 | Bacteria | 13757 |
| 400 | Ga0207707_10007193 | 3300025912 | Bacteria | 9690 |
| 401 | Ga0207707_10007902 | 3300025912 | Bacteria | 9251 |
| 402 | Ga0207707_10020385 | 3300025912 | Bacteria | 5789 |
| 403 | Ga0207707_10049851 | 3300025912 | Bacteria | 3648 |
| 404 | Ga0207707_10053851 | 3300025912 | Bacteria | 3503 |
| 405 | Ga0207695_10000007 | 3300025913 | Bacteria | 1092551 |
| 406 | Ga0207695_10000094 | 3300025913 | Bacteria | 265779 |
| 407 | Ga0207695_10000774 | 3300025913 | Bacteria | 60584 |
| 408 | Ga0207695_10005278 | 3300025913 | Bacteria | 17223 |
| 409 | Ga0207695_10009302 | 3300025913 | Bacteria | 12160 |
| 410 | Ga0207695_10009661 | 3300025913 | Bacteria | 11888 |
| 411 | Ga0207695_10035599 | 3300025913 | Bacteria | 5396 |
| 412 | Ga0207695_10181007 | 3300025913 | Bacteria | 2028 |
| 413 | Ga0207695_10218179 | 3300025913 | Bacteria | 1815 |
| 414 | Ga0207695_10272752 | 3300025913 | Bacteria | 1587 |
| 415 | Ga0207695_10381717 | 3300025913 | Bacteria | 1295 |
| 416 | Ga0207671_10001596 | 3300025914 | Bacteria | 25759 |
| 417 | Ga0207671_10002269 | 3300025914 | Bacteria | 20795 |
| 418 | Ga0207671_10005102 | 3300025914 | Bacteria | 12251 |
| 419 | Ga0207671_10019921 | 3300025914 | Bacteria | 5118 |
| 420 | Ga0207671_10176370 | 3300025914 | Bacteria | 1661 |
| 421 | Ga0207671_10210970 | 3300025914 | Bacteria | 1519 |
| 422 | Ga0207693_10000059 | 3300025915 | Bacteria | 94053 |
| 423 | Ga0207660_10058298 | 3300025917 | Bacteria | 2768 |
| 424 | Ga0207660_10077871 | 3300025917 | Bacteria | 2429 |
| 425 | Ga0207660_10082234 | 3300025917 | Bacteria | 2369 |
| 426 | Ga0207660_10137992 | 3300025917 | Bacteria | 1862 |
| 427 | Ga0207660_10234030 | 3300025917 | Bacteria | 1445 |
| 428 | Ga0207657_10073696 | 3300025919 | Bacteria | 2884 |
| 429 | Ga0207649_10002216 | 3300025920 | Bacteria | 10975 |
| 430 | Ga0207649_10176942 | 3300025920 | Bacteria | 1491 |
| 431 | Ga0207652_10018536 | 3300025921 | Bacteria | 5711 |
| 432 | Ga0207652_10102091 | 3300025921 | Bacteria | 2534 |
| 433 | Ga0207652_10141465 | 3300025921 | Bacteria | 2151 |
| 434 | Ga0207652_10387149 | 3300025921 | Bacteria | 1262 |
| 435 | Ga0207681_10078982 | 3300025923 | Bacteria | 2317 |
| 436 | Ga0207694_10007199 | 3300025924 | Bacteria | 8449 |
| 437 | Ga0207694_10010916 | 3300025924 | Bacteria | 6862 |
| 438 | Ga0207694_10017515 | 3300025924 | Bacteria | 5415 |
| 439 | Ga0207694_10025369 | 3300025924 | Bacteria | 4506 |
| 440 | Ga0207694_10028313 | 3300025924 | Bacteria | 4271 |
| 441 | Ga0207694_10030514 | 3300025924 | Bacteria | 4117 |
| 442 | Ga0207694_10037642 | 3300025924 | Bacteria | 3717 |
| 443 | Ga0207694_10059003 | 3300025924 | Bacteria | 2984 |
| 444 | Ga0207694_10436564 | 3300025924 | Bacteria | 1092 |
| 445 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 446 | Ga0207650_10051347 | 3300025925 | Bacteria | 3051 |
| 447 | Ga0207650_10172554 | 3300025925 | Bacteria | 1719 |
| 448 | Ga0207687_10176243 | 3300025927 | Bacteria | 1653 |
| 449 | Ga0207687_10369194 | 3300025927 | Bacteria | 1173 |
| 450 | Ga0207700_10006806 | 3300025928 | Bacteria | 6947 |
| 451 | Ga0207644_10000019 | 3300025931 | Bacteria | 170919 |
| 452 | Ga0207644_10022578 | 3300025931 | Bacteria | 4301 |
| 453 | Ga0207644_10025916 | 3300025931 | Bacteria | 4035 |
| 454 | Ga0207690_10268050 | 3300025932 | Bacteria | 1325 |
| 455 | Ga0207706_10003284 | 3300025933 | Bacteria | 15475 |
| 456 | Ga0207706_10009739 | 3300025933 | Bacteria | 8819 |
| 457 | Ga0207706_10280834 | 3300025933 | Bacteria | 1452 |
| 458 | Ga0207669_10055623 | 3300025937 | Bacteria | 2397 |
| 459 | Ga0207704_10024154 | 3300025938 | Bacteria | 3290 |
| 460 | Ga0207704_10041355 | 3300025938 | Bacteria | 2702 |
| 461 | Ga0207704_10133563 | 3300025938 | Bacteria | 1723 |
| 462 | Ga0207665_10020938 | 3300025939 | Bacteria | 4298 |
| 463 | Ga0207665_10058315 | 3300025939 | Bacteria | 2610 |
| 464 | Ga0207691_10003235 | 3300025940 | Bacteria | 15872 |
| 465 | Ga0207691_10003264 | 3300025940 | Bacteria | 15799 |
| 466 | Ga0207691_10021992 | 3300025940 | Bacteria | 6018 |
| 467 | Ga0207691_10060721 | 3300025940 | Bacteria | 3435 |
| 468 | Ga0207691_10211810 | 3300025940 | Bacteria | 1683 |
| 469 | Ga0207691_10372523 | 3300025940 | Bacteria | 1220 |
| 470 | Ga0207711_10000156 | 3300025941 | Bacteria | 73391 |
| 471 | Ga0207711_10025310 | 3300025941 | Bacteria | 4980 |
| 472 | Ga0207711_10101702 | 3300025941 | Bacteria | 2543 |
| 473 | Ga0207711_10175212 | 3300025941 | Bacteria | 1948 |
| 474 | Ga0207711_10199823 | 3300025941 | Bacteria | 1824 |
| 475 | Ga0207661_10024536 | 3300025944 | Bacteria | 4571 |
| 476 | Ga0207661_10137628 | 3300025944 | Bacteria | 2099 |
| 477 | Ga0207679_10050846 | 3300025945 | Bacteria | 3031 |
| 478 | Ga0207679_10144001 | 3300025945 | Bacteria | 1930 |
| 479 | Ga0207667_10002665 | 3300025949 | Bacteria | 22067 |
| 480 | Ga0207667_10021307 | 3300025949 | Bacteria | 7183 |
| 481 | Ga0207667_10036769 | 3300025949 | Bacteria | 5243 |
| 482 | Ga0207667_10075315 | 3300025949 | Bacteria | 3504 |
| 483 | Ga0207667_10100428 | 3300025949 | Bacteria | 2984 |
| 484 | Ga0207667_10184546 | 3300025949 | Bacteria | 2142 |
| 485 | Ga0207667_10236063 | 3300025949 | Bacteria | 1872 |
| 486 | Ga0207667_10316207 | 3300025949 | Bacteria | 1595 |
| 487 | Ga0207667_10328032 | 3300025949 | Bacteria | 1563 |
| 488 | Ga0207667_10554530 | 3300025949 | Bacteria | 1162 |
| 489 | Ga0207667_10587844 | 3300025949 | Bacteria | 1123 |
| 490 | Ga0207651_10054134 | 3300025960 | Bacteria | 2748 |
| 491 | Ga0207712_10000302 | 3300025961 | Bacteria | 46123 |
| 492 | Ga0207712_10000609 | 3300025961 | Bacteria | 28411 |
| 493 | Ga0207712_10010397 | 3300025961 | Bacteria | 5908 |
| 494 | Ga0207712_10047926 | 3300025961 | Bacteria | 2970 |
| 495 | Ga0207712_10108029 | 3300025961 | Bacteria | 2081 |
| 496 | Ga0207668_10002464 | 3300025972 | Bacteria | 10810 |
| 497 | Ga0207668_10006814 | 3300025972 | Bacteria | 6770 |
| 498 | Ga0207640_10077819 | 3300025981 | Bacteria | 2256 |
| 499 | Ga0207640_10252003 | 3300025981 | Bacteria | 1371 |
| 500 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 501 | Ga0207658_10000098 | 3300025986 | Bacteria | 96611 |
| 502 | Ga0207658_10005045 | 3300025986 | Bacteria | 9088 |
| 503 | Ga0207658_10013389 | 3300025986 | Bacteria | 5602 |
| 504 | Ga0207658_10243827 | 3300025986 | Bacteria | 1524 |
| 505 | Ga0207658_10476849 | 3300025986 | Bacteria | 1108 |
| 506 | Ga0207677_10012878 | 3300026023 | Bacteria | 4828 |
| 507 | Ga0207677_10030007 | 3300026023 | Bacteria | 3464 |
| 508 | Ga0207677_10073203 | 3300026023 | Bacteria | 2425 |
| 509 | Ga0207703_10000240 | 3300026035 | Bacteria | 62235 |
| 510 | Ga0207703_10003355 | 3300026035 | Bacteria | 13446 |
| 511 | Ga0207703_10019664 | 3300026035 | Bacteria | 5278 |
| 512 | Ga0207639_10000130 | 3300026041 | Bacteria | 55330 |
| 513 | Ga0207639_10000942 | 3300026041 | Bacteria | 19708 |
| 514 | Ga0207639_10010126 | 3300026041 | Bacteria | 6522 |
| 515 | Ga0207639_10011822 | 3300026041 | Bacteria | 6069 |
| 516 | Ga0207639_10014126 | 3300026041 | Bacteria | 5606 |
| 517 | Ga0207639_10020388 | 3300026041 | Bacteria | 4745 |
| 518 | Ga0207639_10224849 | 3300026041 | Bacteria | 1623 |
| 519 | Ga0207678_10001241 | 3300026067 | Bacteria | 23520 |
| 520 | Ga0207678_10008329 | 3300026067 | Bacteria | 9138 |
| 521 | Ga0207678_10023458 | 3300026067 | Bacteria | 5397 |
| 522 | Ga0207678_10094528 | 3300026067 | Bacteria | 2554 |
| 523 | Ga0207708_10008413 | 3300026075 | Bacteria | 7634 |
| 524 | Ga0207702_10013824 | 3300026078 | Bacteria | 6704 |
| 525 | Ga0207702_10022598 | 3300026078 | Bacteria | 5215 |
| 526 | Ga0207702_10023888 | 3300026078 | Bacteria | 5071 |
| 527 | Ga0207702_10054636 | 3300026078 | Bacteria | 3384 |
| 528 | Ga0207702_10231885 | 3300026078 | Bacteria | 1726 |
| 529 | Ga0207702_10287414 | 3300026078 | Bacteria | 1557 |
| 530 | Ga0207641_10000247 | 3300026088 | Bacteria | 69132 |
| 531 | Ga0207641_10002054 | 3300026088 | Bacteria | 19118 |
| 532 | Ga0207641_10007379 | 3300026088 | Bacteria | 9150 |
| 533 | Ga0207641_10079659 | 3300026088 | Bacteria | 2840 |
| 534 | Ga0207641_10084263 | 3300026088 | Bacteria | 2767 |
| 535 | Ga0207641_10098495 | 3300026088 | Bacteria | 2571 |
| 536 | Ga0207648_10001100 | 3300026089 | Bacteria | 30324 |
| 537 | Ga0207648_10128412 | 3300026089 | Bacteria | 2230 |
| 538 | Ga0207648_10148282 | 3300026089 | Bacteria | 2070 |
| 539 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 540 | Ga0207676_10016113 | 3300026095 | Bacteria | 5406 |
| 541 | Ga0207674_10038872 | 3300026116 | Bacteria | 4936 |
| 542 | Ga0207674_10391787 | 3300026116 | Bacteria | 1343 |
| 543 | Ga0207675_100003413 | 3300026118 | Bacteria | 15508 |
| 544 | Ga0207675_100041525 | 3300026118 | Bacteria | 4295 |
| 545 | Ga0207683_10014558 | 3300026121 | Bacteria | 6699 |
| 546 | Ga0207683_10252905 | 3300026121 | Bacteria | 1608 |
| 547 | Ga0207683_10359106 | 3300026121 | Bacteria | 1338 |
| 548 | Ga0207683_10470509 | 3300026121 | Bacteria | 1159 |
| 549 | Ga0207698_10000177 | 3300026142 | Bacteria | 39133 |
| 550 | Ga0207698_10003436 | 3300026142 | Bacteria | 9534 |
| 551 | Ga0207698_10005219 | 3300026142 | Bacteria | 7992 |
| 552 | Ga0207698_10021795 | 3300026142 | Bacteria | 4438 |
| 553 | Ga0207698_10165670 | 3300026142 | Bacteria | 1939 |
| 554 | Ga0207698_10203381 | 3300026142 | Bacteria | 1775 |
| 555 | Ga0207698_10467472 | 3300026142 | Bacteria | 1221 |
| 556 | Ga0209281_1000245 | 3300027111 | Bacteria | 109870 |
| 557 | Ga0209179_1000083 | 3300027512 | Bacteria | 15248 |
| 558 | Ga0209970_1002609 | 3300027614 | Bacteria | 3046 |
| 559 | Ga0210002_1010728 | 3300027617 | Bacteria | 1410 |
| 560 | Ga0209983_1000335 | 3300027665 | Bacteria | 9843 |
| 561 | Ga0209971_1000386 | 3300027682 | Bacteria | 12051 |
| 562 | Ga0265354_1000595 | 3300028016 | Bacteria | 6101 |
| 563 | Ga0265356_1003406 | 3300028017 | Bacteria | 2012 |
| 564 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 565 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 566 | Ga0268266_10000392 | 3300028379 | Bacteria | 66301 |
| 567 | Ga0268266_10003314 | 3300028379 | Bacteria | 16169 |
| 568 | Ga0268266_10040793 | 3300028379 | Bacteria | 3958 |
| 569 | Ga0268266_10069452 | 3300028379 | Bacteria | 3052 |
| 570 | Ga0268266_10073483 | 3300028379 | Bacteria | 2967 |
| 571 | Ga0268266_10105828 | 3300028379 | Bacteria | 2486 |
| 572 | Ga0268266_10633162 | 3300028379 | Bacteria | 1029 |
| 573 | Ga0268265_10000288 | 3300028380 | Bacteria | 56817 |
| 574 | Ga0268265_10002215 | 3300028380 | Bacteria | 14973 |
| 575 | Ga0268265_10009164 | 3300028380 | Bacteria | 6689 |
| 576 | Ga0268265_10047108 | 3300028380 | Bacteria | 3228 |
| 577 | Ga0268265_10089519 | 3300028380 | Bacteria | 2455 |
| 578 | Ga0268264_10000057 | 3300028381 | Bacteria | 309824 |
| 579 | Ga0268264_10000165 | 3300028381 | Bacteria | 147648 |
| 580 | Ga0268264_10000348 | 3300028381 | Bacteria | 70273 |
| 581 | Ga0268264_10000419 | 3300028381 | Bacteria | 59940 |
| 582 | Ga0268264_10010755 | 3300028381 | Bacteria | 7560 |
| 583 | Ga0268264_10105190 | 3300028381 | Bacteria | 2461 |
| 584 | Ga0268264_10105465 | 3300028381 | Bacteria | 2458 |
| 585 | Ga0265326_10011710 | 3300028558 | Bacteria | 2582 |
| 586 | Ga0265319_1041561 | 3300028563 | Bacteria | 1550 |
| 587 | Ga0265334_10000123 | 3300028573 | Bacteria | 50146 |
| 588 | Ga0265318_10001505 | 3300028577 | Bacteria | 13592 |
| 589 | Ga0307515_10010000 | 3300028794 | Bacteria | 18265 |
| 590 | Ga0265338_10008882 | 3300028800 | Bacteria | 12109 |
| 591 | Ga0265338_10013818 | 3300028800 | Bacteria | 9072 |
| 592 | Ga0265770_1000073 | 3300030878 | Bacteria | 11131 |
| 593 | Ga0265760_10000738 | 3300031090 | Bacteria | 9338 |
| 594 | Ga0265330_10008236 | 3300031235 | Bacteria | 5029 |
| 595 | Ga0265332_10001382 | 3300031238 | Bacteria | 13676 |
| 596 | Ga0265328_10005954 | 3300031239 | Bacteria | 5192 |
| 597 | Ga0265320_10011833 | 3300031240 | Bacteria | 5112 |
| 598 | Ga0265325_10002595 | 3300031241 | Bacteria | 12116 |
| 599 | Ga0265329_10000811 | 3300031242 | Bacteria | 15899 |
| 600 | Ga0265340_10034832 | 3300031247 | Bacteria | 2503 |
| 601 | Ga0265331_10002545 | 3300031250 | Bacteria | 12263 |
| 602 | Ga0265327_10000008 | 3300031251 | Bacteria | 658870 |
| 603 | Ga0265316_10005931 | 3300031344 | Bacteria | 11762 |
| 604 | Ga0307509_10000006 | 3300031507 | Bacteria | 421538 |
| 605 | Ga0307509_10000013 | 3300031507 | Bacteria | 283027 |
| 606 | Ga0265313_10002136 | 3300031595 | Bacteria | 17574 |
| 607 | Ga0316575_10011453 | 3300031665 | Bacteria | 3285 |
| 608 | Ga0316575_10057235 | 3300031665 | Bacteria | 1554 |
| 609 | Ga0265314_10006700 | 3300031711 | Bacteria | 10117 |
| 610 | Ga0265342_10006567 | 3300031712 | Bacteria | 8650 |
| 611 | Ga0316576_10018502 | 3300031727 | Bacteria | 4758 |
| 612 | Ga0316576_10035263 | 3300031727 | Bacteria | 3570 |
| 613 | Ga0316576_10081661 | 3300031727 | Bacteria | 2399 |
| 614 | Ga0316576_10099000 | 3300031727 | Bacteria | 2177 |
| 615 | Ga0316576_10178140 | 3300031727 | Bacteria | 1604 |
| 616 | Ga0307516_10000423 | 3300031730 | Bacteria | 55387 |
| 617 | Ga0307516_10089152 | 3300031730 | Bacteria | 2915 |
| 618 | Ga0316577_10007639 | 3300031733 | Bacteria | 5771 |
| 619 | Ga0307410_10301516 | 3300031852 | Bacteria | 1264 |
| 620 | Ga0307409_100118344 | 3300031995 | Bacteria | 2237 |
| 621 | Ga0307411_10021251 | 3300032005 | Bacteria | 3793 |
| 622 | Ga0307415_100107797 | 3300032126 | Bacteria | 2059 |
| 623 | Ga0307507_10033572 | 3300033179 | Bacteria | 5325 |
| 624 | Ga0307510_10000014 | 3300033180 | Bacteria | 271607 |
| 625 | Ga0307510_10001790 | 3300033180 | Bacteria | 23983 |
| 626 | Ga0373956_0049119 | 3300035119 | Bacteria | 1892 |
| 627 | Ga0373955_0017113 | 3300035172 | Bacteria | 3581 |
| 628 | Ga0373955_0111529 | 3300035172 | Bacteria | 1582 |
| 629 | Ga0316574_0036450 | 3300035398 | Bacteria | 3011 |
| 630 | Ga0316574_0085969 | 3300035398 | Bacteria | 2001 |
| 631 | Ga0316574_0105684 | 3300035398 | Bacteria | 1803 |
| 632 | Ga0316574_0116904 | 3300035398 | Bacteria | 1711 |
| 633 | Ga0316574_0142325 | 3300035398 | Bacteria | 1545 |
| 634 | Ga0316574_0198515 | 3300035398 | Bacteria | 1289 |
| 635 | Ga0373924_0077687 | 3300035410 | Bacteria | 1408 |
| 636 | Ga0373947_0025472 | 3300035725 | Bacteria | 3451 |
| 637 | Ga0373937_0017693 | 3300036401 | Bacteria | 6358 |
| 638 | Ga0373937_0030591 | 3300036401 | Bacteria | 4875 |
| 639 | Ga0316582_0028076 | 3300036647 | Bacteria | 3406 |
| 640 | Ga0316582_0046994 | 3300036647 | Bacteria | 2724 |
| 641 | Ga0316584_0038421 | 3300036712 | Bacteria | 3560 |
| 642 | Ga0373925_0047339 | 3300037068 | Bacteria | 3201 |
| 643 | Ga0395900_0000033 | 3300037418 | Bacteria | 260271 |
| 644 | Ga0395900_0021084 | 3300037418 | Bacteria | 6659 |
| 645 | Ga0395900_0112462 | 3300037418 | Bacteria | 2796 |
| 646 | Ga0395900_0493220 | 3300037418 | Bacteria | 1176 |
| 647 | Ga0395898_0037202 | 3300037466 | Bacteria | 4829 |
| 648 | Ga0395898_0074656 | 3300037466 | Bacteria | 3275 |
| 649 | Ga0400483_005143 | 3300039062 | Bacteria | 1657 |
| 650 | Ga0400489_70870 | 3300039093 | Bacteria | 1097 |
| 651 | Ga0436365_0748338 | 3300039437 | Bacteria | 6625 |
| 652 | Ga0436365_0842660 | 3300039437 | Bacteria | 2367 |
| 653 | Ga0436365_1093700 | 3300039437 | Bacteria | 15149 |
| 654 | Ga0436365_1613235 | 3300039437 | Bacteria | 1729 |
| 655 | Ga0436365_1889773 | 3300039437 | Bacteria | 1378 |
| 656 | Ga0436361_0230354 | 3300039447 | Bacteria | 2392 |
| 657 | Ga0436363_1071014 | 3300039450 | Bacteria | 1829 |
| 658 | Ga0436363_1479011 | 3300039450 | Bacteria | 5101 |
| 659 | Ga0439447_005158 | 3300041407 | Bacteria | 4377 |
| 660 | Ga0439447_014249 | 3300041407 | Bacteria | 2234 |
| 661 | Ga0439466_0012927 | 3300041411 | Bacteria | 3062 |
| 662 | Ga0451787_694605 | 3300041441 | Bacteria | 1213 |
| 663 | Ga0451791_1728031 | 3300041451 | Bacteria | 1530 |
| 664 | Ga0451797_1183596 | 3300041453 | Bacteria | 2166 |
| 665 | Ga0451807_0437021 | 3300041486 | Bacteria | 3852 |
| 666 | Ga0451833_1189488 | 3300041491 | Bacteria | 1975 |
| 667 | Ga0451835_0512670 | 3300041492 | Bacteria | 1495 |
| 668 | Ga0451843_1118340 | 3300041509 | Bacteria | 1364 |
| 669 | Ga0439431_0007281 | 3300041997 | Bacteria | 2465 |
| 670 | Ga0439445_0034640 | 3300042004 | Bacteria | 1324 |
| 671 | Ga0439432_054490 | 3300042006 | Bacteria | 1242 |
| 672 | Ga0439452_014029 | 3300042010 | Bacteria | 2234 |
| 673 | Ga0450911_000013 | 3300042115 | Bacteria | 129019 |
| 674 | Ga0450907_000001 | 3300042146 | Bacteria | 236562 |
| 675 | Ga0439434_0008163 | 3300042435 | Bacteria | 3068 |
| 676 | Ga0439434_0011204 | 3300042435 | Bacteria | 2648 |
| 677 | Ga0439459_0003975 | 3300042438 | Bacteria | 2367 |
| 678 | Ga0439464_0001840 | 3300042439 | Bacteria | 5120 |
| 679 | Ga0450893_0004839 | 3300042532 | Bacteria | 2151 |
| 680 | Ga0451577_0032097 | 3300042876 | Bacteria | 4732 |
| 681 | Ga0451577_0041635 | 3300042876 | Bacteria | 4123 |
| 682 | Ga0451577_0096140 | 3300042876 | Bacteria | 2644 |
| 683 | Ga0466969_0115383 | 3300044656 | Bacteria | 1254 |
| 684 | Ga0466972_0006153 | 3300044658 | Bacteria | 6029 |
| 685 | Ga0453683_0008221 | 3300044673 | Bacteria | 7016 |
| 686 | Ga0466966_0038805 | 3300044684 | Bacteria | 3067 |
| 687 | Ga0453684_0000114 | 3300044712 | Bacteria | 356610 |
| 688 | Ga0453684_0050669 | 3300044712 | Bacteria | 5457 |
| 689 | Ga0453684_0052350 | 3300044712 | Bacteria | 5340 |
| 690 | Ga0453684_0087328 | 3300044712 | Bacteria | 3865 |
| 691 | Ga0453684_0105732 | 3300044712 | Bacteria | 3432 |
| 692 | Ga0453684_0150940 | 3300044712 | Bacteria | 2761 |
| 693 | Ga0453684_0303950 | 3300044712 | Bacteria | 1812 |
| 694 | Ga0453684_0460007 | 3300044712 | Bacteria | 1415 |
| 695 | Ga0453684_0583682 | 3300044712 | Bacteria | 1227 |
| 696 | Ga0466968_0007288 | 3300044735 | Bacteria | 4203 |
| 697 | Ga0466970_0002897 | 3300044765 | Bacteria | 8313 |
| 698 | Ga0466959_0051648 | 3300045049 | Bacteria | 3014 |
| 699 | Ga0451576_0000335 | 3300045051 | Bacteria | 113806 |
| 700 | Ga0451576_0002565 | 3300045051 | Bacteria | 26810 |
| 701 | Ga0451576_0078228 | 3300045051 | Bacteria | 3442 |
| 702 | Ga0451576_0197363 | 3300045051 | Bacteria | 2102 |
| 703 | Ga0451576_0228884 | 3300045051 | Bacteria | 1941 |
| 704 | Ga0451576_0239021 | 3300045051 | Bacteria | 1897 |
| 705 | Ga0451576_0261348 | 3300045051 | Bacteria | 1809 |
| 706 | Ga0466958_0060702 | 3300045836 | Bacteria | 2301 |
| 707 | Ga0495617_013663 | 3300046452 | Bacteria | 2761 |
| 708 | Ga0495603_0036201 | 3300046455 | Bacteria | 2963 |
| 709 | Ga0495591_051507 | 3300046458 | Bacteria | 1123 |
| 710 | Ga0495638_0041021 | 3300046460 | Bacteria | 2930 |
| 711 | Ga0495638_0064700 | 3300046460 | Bacteria | 2252 |
| 712 | Ga0495638_0092420 | 3300046460 | Bacteria | 1821 |
| 713 | Ga0495653_0025158 | 3300046463 | Bacteria | 4788 |
| 714 | Ga0495580_0005280 | 3300046472 | Bacteria | 10728 |
| 715 | Ga0495580_0022256 | 3300046472 | Bacteria | 4667 |
| 716 | Ga0495580_0035673 | 3300046472 | Bacteria | 3575 |
| 717 | Ga0495582_0009708 | 3300046473 | Bacteria | 5302 |
| 718 | Ga0495605_0016705 | 3300046474 | Bacteria | 3968 |
| 719 | Ga0495605_0042159 | 3300046474 | Bacteria | 2270 |
| 720 | Ga0495605_0082072 | 3300046474 | Bacteria | 1507 |
| 721 | Ga0495584_0042415 | 3300046491 | Bacteria | 2296 |
| 722 | Ga0495584_0059681 | 3300046491 | Bacteria | 1918 |
| 723 | Ga0495585_0000151 | 3300046492 | Bacteria | 74774 |
| 724 | Ga0495585_0005731 | 3300046492 | Bacteria | 7794 |
| 725 | Ga0495585_0028014 | 3300046492 | Bacteria | 3215 |
| 726 | Ga0495585_0032554 | 3300046492 | Bacteria | 2954 |
| 727 | Ga0495594_0013192 | 3300046499 | Bacteria | 4309 |
| 728 | Ga0495607_0036688 | 3300046501 | Bacteria | 2951 |
| 729 | Ga0495607_0039233 | 3300046501 | Bacteria | 2829 |
| 730 | Ga0495607_0048920 | 3300046501 | Bacteria | 2469 |
| 731 | Ga0495607_0051728 | 3300046501 | Bacteria | 2383 |
| 732 | Ga0495606_0026264 | 3300046507 | Bacteria | 4152 |
| 733 | Ga0495610_0026603 | 3300046512 | Bacteria | 3087 |
| 734 | Ga0495616_0027533 | 3300046513 | Bacteria | 3015 |
| 735 | Ga0495620_0063337 | 3300046515 | Bacteria | 1533 |
| 736 | Ga0495637_0010354 | 3300046520 | Bacteria | 4517 |
| 737 | Ga0495637_0018315 | 3300046520 | Bacteria | 3249 |
| 738 | Ga0495637_0023866 | 3300046520 | Bacteria | 2770 |
| 739 | Ga0495643_0088908 | 3300046522 | Bacteria | 1596 |
| 740 | Ga0495648_0000737 | 3300046524 | Bacteria | 34869 |
| 741 | Ga0495648_0030360 | 3300046524 | Bacteria | 3574 |
| 742 | Ga0495648_0063669 | 3300046524 | Bacteria | 2176 |
| 743 | Ga0495666_0056183 | 3300046526 | Bacteria | 1886 |
| 744 | Ga0495654_0016328 | 3300046530 | Bacteria | 3928 |
| 745 | Ga0495665_0071163 | 3300046531 | Bacteria | 1832 |
| 746 | Ga0495586_0202010 | 3300046535 | Bacteria | 1127 |
| 747 | Ga0495621_0007301 | 3300046539 | Bacteria | 3268 |
| 748 | Ga0495621_0010037 | 3300046539 | Bacteria | 2890 |
| 749 | Ga0495597_0024782 | 3300046542 | Bacteria | 2766 |
| 750 | Ga0495597_0063695 | 3300046542 | Bacteria | 1602 |
| 751 | Ga0495645_0034114 | 3300046543 | Bacteria | 3714 |
| 752 | Ga0495622_0009765 | 3300046557 | Bacteria | 4436 |
| 753 | Ga0495633_0013335 | 3300046558 | Bacteria | 4335 |
| 754 | Ga0495634_0009244 | 3300046642 | Bacteria | 7274 |
| 755 | Ga0495625_0145333 | 3300046660 | Bacteria | 1597 |
| 756 | Ga0495635_0019431 | 3300046663 | Bacteria | 4735 |
| 757 | Ga0495661_0059793 | 3300046665 | Bacteria | 2266 |
| 758 | Ga0495588_0008764 | 3300046674 | Bacteria | 4648 |
| 759 | Ga0495623_0032187 | 3300046679 | Bacteria | 3370 |
| 760 | Ga0495647_0000270 | 3300046681 | Bacteria | 14393 |
| 761 | Ga0495658_0011959 | 3300046683 | Bacteria | 4381 |
| 762 | Ga0495613_0164966 | 3300046689 | Bacteria | 1574 |
| 763 | Ga0495670_0013682 | 3300046691 | Bacteria | 3990 |
| 764 | Ga0495670_0015465 | 3300046691 | Bacteria | 3749 |
| 765 | Ga0495649_0032179 | 3300046694 | Bacteria | 2890 |
| 766 | Ga0495649_0055277 | 3300046694 | Bacteria | 2145 |
| 767 | Ga0495674_0052642 | 3300047319 | Bacteria | 3581 |
| 768 | Ga0495674_0243090 | 3300047319 | Bacteria | 1483 |
| 769 | Ga0495672_0029354 | 3300047320 | Bacteria | 3464 |
| 770 | Ga0495680_0072114 | 3300047322 | Bacteria | 2627 |
| 771 | Ga0495680_0197639 | 3300047322 | Bacteria | 1444 |
| 772 | Ga0495683_0004043 | 3300047323 | Bacteria | 8414 |
| 773 | Ga0495683_0066671 | 3300047323 | Bacteria | 1773 |
| 774 | Ga0495683_0085319 | 3300047323 | Bacteria | 1535 |
| 775 | Ga0495683_0122872 | 3300047323 | Bacteria | 1230 |
| 776 | Ga0495687_022890 | 3300047443 | Bacteria | 2993 |
| 777 | Ga0495687_035532 | 3300047443 | Bacteria | 2239 |
| 778 | Ga0495673_0004833 | 3300047469 | Bacteria | 8328 |
| 779 | Ga0495673_0020837 | 3300047469 | Bacteria | 3254 |
| 780 | Ga0495673_0040112 | 3300047469 | Bacteria | 2118 |
| 781 | Ga0495673_0054629 | 3300047469 | Bacteria | 1736 |
| 782 | Ga0495681_0024511 | 3300047470 | Bacteria | 3177 |
| 783 | Ga0495684_0260875 | 3300047471 | Bacteria | 1257 |
| 784 | Ga0495686_0002423 | 3300047472 | Bacteria | 17631 |
| 785 | Ga0495593_0063141 | 3300047673 | Bacteria | 1934 |
| 786 | Ga0495602_0073193 | 3300048088 | Bacteria | 2918 |
| 787 | Ga0495626_0057907 | 3300048091 | Bacteria | 1772 |
| 788 | Ga0496100_0114524 | 3300048903 | Bacteria | 1878 |
| 789 | Ga0496101_0023799 | 3300048904 | Bacteria | 4234 |
| 790 | Ga0496102_0003905 | 3300048905 | Bacteria | 12625 |
| 791 | Ga0496102_0017255 | 3300048905 | Bacteria | 6322 |
| 792 | Ga0496102_0017799 | 3300048905 | Bacteria | 6229 |
| 793 | Ga0496102_0057014 | 3300048905 | Bacteria | 3565 |
| 794 | Ga0496102_0062224 | 3300048905 | Bacteria | 3418 |
| 795 | Ga0496103_0032017 | 3300048906 | Bacteria | 3207 |
| 796 | Ga0496103_0168628 | 3300048906 | Bacteria | 1405 |
| 797 | Ga0496104_0000020 | 3300048907 | Bacteria | 247296 |
| 798 | Ga0496104_0403286 | 3300048907 | Bacteria | 1279 |
| 799 | Ga0496105_0000028 | 3300048908 | Bacteria | 145917 |
| 800 | Ga0496107_0002714 | 3300048910 | Bacteria | 11607 |
| 801 | Ga0496108_0002437 | 3300048911 | Bacteria | 14865 |
| 802 | Ga0496108_0069055 | 3300048911 | Bacteria | 2982 |
| 803 | Ga0496109_0091567 | 3300048912 | Bacteria | 2812 |
| 804 | Ga0496110_0002260 | 3300048913 | Bacteria | 14391 |
| 805 | Ga0496111_0006561 | 3300048914 | Bacteria | 7565 |
| 806 | Ga0496112_0011818 | 3300048915 | Bacteria | 7995 |
| 807 | Ga0496112_0058214 | 3300048915 | Bacteria | 3805 |
| 808 | Ga0496113_0003696 | 3300048916 | Bacteria | 9219 |
| 809 | Ga0496114_0002691 | 3300048917 | Bacteria | 13577 |
| 810 | Ga0496114_0242835 | 3300048917 | Bacteria | 1584 |
| 811 | Ga0496115_0000138 | 3300048918 | Bacteria | 66964 |
| 812 | Ga0496115_0081834 | 3300048918 | Bacteria | 2630 |
| 813 | Ga0496116_0024324 | 3300048919 | Bacteria | 4483 |
| 814 | Ga0496116_0102505 | 3300048919 | Bacteria | 1706 |
| 815 | Ga0496117_0000228 | 3300048920 | Bacteria | 106070 |
| 816 | Ga0496117_0028819 | 3300048920 | Bacteria | 4292 |
| 817 | Ga0496117_0046428 | 3300048920 | Bacteria | 3124 |
| 818 | Ga0496117_0117275 | 3300048920 | Bacteria | 1643 |
| 819 | Ga0496118_0000005 | 3300048921 | Bacteria | 697350 |
| 820 | Ga0496118_0000166 | 3300048921 | Bacteria | 119204 |
| 821 | Ga0496118_0004388 | 3300048921 | Bacteria | 16769 |
| 822 | Ga0496118_0005801 | 3300048921 | Bacteria | 13846 |
| 823 | Ga0496118_0043277 | 3300048921 | Bacteria | 3542 |
| 824 | Ga0496118_0045586 | 3300048921 | Bacteria | 3420 |
| 825 | Ga0496118_0143103 | 3300048921 | Bacteria | 1511 |
| 826 | Ga0496119_0003238 | 3300048922 | Bacteria | 17043 |
| 827 | Ga0496120_0002153 | 3300048923 | Bacteria | 20987 |
| 828 | Ga0496121_0000044 | 3300048924 | Bacteria | 337672 |
| 829 | Ga0496121_0000522 | 3300048924 | Bacteria | 73298 |
| 830 | Ga0496121_0263813 | 3300048924 | Bacteria | 1187 |
| 831 | Ga0496122_0000734 | 3300048925 | Bacteria | 64135 |
| 832 | Ga0496122_0030184 | 3300048925 | Bacteria | 4551 |
| 833 | Ga0496123_0002408 | 3300048926 | Bacteria | 23357 |
| 834 | Ga0496125_0008666 | 3300048928 | Bacteria | 10595 |
| 835 | Ga0496125_0071229 | 3300048928 | Bacteria | 2717 |
| 836 | Ga0496125_0092354 | 3300048928 | Bacteria | 2263 |
| 837 | Ga0496126_0000132 | 3300048929 | Bacteria | 172325 |
| 838 | Ga0496126_0017383 | 3300048929 | Bacteria | 7166 |
| 839 | Ga0496126_0085681 | 3300048929 | Bacteria | 2777 |
| 840 | Ga0496126_0112906 | 3300048929 | Bacteria | 2365 |
| 841 | Ga0496126_0172907 | 3300048929 | Bacteria | 1839 |
| 842 | Ga0496126_0210892 | 3300048929 | Bacteria | 1635 |
| 843 | Ga0496126_0257557 | 3300048929 | Bacteria | 1452 |
| 844 | Ga0495678_012628 | 3300049459 | Bacteria | 3997 |
| 845 | Ga0495682_0013067 | 3300049460 | Bacteria | 3166 |
| 846 | Ga0495682_0013093 | 3300049460 | Bacteria | 3162 |
| 847 | Ga0495682_0050159 | 3300049460 | Bacteria | 1519 |
| 848 | Ga0501031_0045198 | 3300049568 | Bacteria | 2873 |
| 849 | Ga0501032_0034257 | 3300049569 | Bacteria | 3477 |
| 850 | Ga0501032_0065866 | 3300049569 | Bacteria | 2422 |
| 851 | Ga0501032_0205292 | 3300049569 | Bacteria | 1285 |
| 852 | Ga0501033_0001231 | 3300049570 | Bacteria | 22962 |
| 853 | Ga0501033_0033405 | 3300049570 | Bacteria | 3862 |
| 854 | Ga0501033_0034603 | 3300049570 | Bacteria | 3788 |
| 855 | Ga0501033_0049699 | 3300049570 | Bacteria | 3113 |
| 856 | Ga0501033_0053640 | 3300049570 | Bacteria | 2985 |
| 857 | Ga0501034_0181122 | 3300049571 | Bacteria | 2072 |
| 858 | Ga0501034_0318718 | 3300049571 | Bacteria | 1488 |
| 859 | Ga0501034_0487526 | 3300049571 | Bacteria | 1147 |
| 860 | Ga0501034_0487829 | 3300049571 | Bacteria | 1147 |
| 861 | Ga0501036_0006455 | 3300049572 | Bacteria | 9525 |
| 862 | Ga0501036_0011152 | 3300049572 | Bacteria | 7435 |
| 863 | Ga0501036_0013569 | 3300049572 | Bacteria | 6772 |
| 864 | Ga0501036_0033365 | 3300049572 | Bacteria | 4353 |
| 865 | Ga0501036_0040241 | 3300049572 | Bacteria | 3953 |
| 866 | Ga0501036_0409537 | 3300049572 | Bacteria | 1131 |
| 867 | Ga0501037_0000433 | 3300049573 | Bacteria | 34581 |
| 868 | Ga0501037_0030190 | 3300049573 | Bacteria | 4005 |
| 869 | Ga0501037_0061595 | 3300049573 | Bacteria | 2736 |
| 870 | Ga0501038_0002574 | 3300049574 | Bacteria | 16929 |
| 871 | Ga0501038_0010947 | 3300049574 | Bacteria | 8285 |
| 872 | Ga0501038_0017873 | 3300049574 | Bacteria | 6405 |
| 873 | Ga0501038_0043326 | 3300049574 | Bacteria | 3913 |
| 874 | Ga0501038_0061330 | 3300049574 | Bacteria | 3216 |
| 875 | Ga0501038_0357286 | 3300049574 | Bacteria | 1137 |
| 876 | Ga0501039_0000322 | 3300049575 | Bacteria | 34031 |
| 877 | Ga0501039_0024008 | 3300049575 | Bacteria | 4682 |
| 878 | Ga0501039_0076546 | 3300049575 | Bacteria | 2601 |
| 879 | Ga0501040_0004666 | 3300049576 | Bacteria | 8893 |
| 880 | Ga0501040_0012738 | 3300049576 | Bacteria | 5518 |
| 881 | Ga0501041_0000050 | 3300049577 | Bacteria | 41953 |
| 882 | Ga0501041_0021444 | 3300049577 | Bacteria | 3870 |
| 883 | Ga0501042_0016733 | 3300049578 | Bacteria | 5041 |
| 884 | Ga0501042_0020388 | 3300049578 | Bacteria | 4614 |
| 885 | Ga0501042_0056875 | 3300049578 | Bacteria | 2791 |
| 886 | Ga0501042_0059218 | 3300049578 | Bacteria | 2735 |
| 887 | Ga0501043_0005762 | 3300049579 | Bacteria | 9981 |
| 888 | Ga0501043_0026213 | 3300049579 | Bacteria | 4573 |
| 889 | Ga0501043_0029669 | 3300049579 | Bacteria | 4298 |
| 890 | Ga0501046_0010896 | 3300049580 | Bacteria | 7791 |
| 891 | Ga0501046_0016090 | 3300049580 | Bacteria | 6272 |
| 892 | Ga0501046_0018895 | 3300049580 | Bacteria | 5723 |
| 893 | Ga0501046_0035443 | 3300049580 | Bacteria | 4021 |
| 894 | Ga0501046_0160428 | 3300049580 | Bacteria | 1691 |
| 895 | Ga0501046_0183261 | 3300049580 | Bacteria | 1564 |
| 896 | Ga0501047_0013100 | 3300049581 | Bacteria | 7853 |
| 897 | Ga0501047_0042005 | 3300049581 | Bacteria | 4419 |
| 898 | Ga0501047_0120567 | 3300049581 | Bacteria | 2505 |
| 899 | Ga0501048_0002201 | 3300049582 | Bacteria | 14832 |
| 900 | Ga0501048_0078250 | 3300049582 | Bacteria | 2333 |
| 901 | Ga0501067_0015905 | 3300049583 | Bacteria | 4161 |
| 902 | Ga0501067_0053716 | 3300049583 | Bacteria | 2232 |
| 903 | Ga0501068_0008748 | 3300049584 | Bacteria | 5647 |
| 904 | Ga0501068_0019256 | 3300049584 | Bacteria | 3960 |
| 905 | Ga0501068_0025418 | 3300049584 | Bacteria | 3483 |
| 906 | Ga0501068_0045849 | 3300049584 | Bacteria | 2634 |
| 907 | Ga0501068_0095043 | 3300049584 | Bacteria | 1842 |
| 908 | Ga0501068_0140935 | 3300049584 | Bacteria | 1511 |
| 909 | Ga0501069_0005978 | 3300049585 | Bacteria | 6348 |
| 910 | Ga0501069_0011840 | 3300049585 | Bacteria | 4625 |
| 911 | Ga0501069_0037144 | 3300049585 | Bacteria | 2688 |
| 912 | Ga0501070_0020286 | 3300049586 | Bacteria | 5575 |
| 913 | Ga0501070_0027644 | 3300049586 | Bacteria | 4758 |
| 914 | Ga0501070_0037695 | 3300049586 | Bacteria | 4035 |
| 915 | Ga0501070_0039821 | 3300049586 | Bacteria | 3919 |
| 916 | Ga0501070_0053766 | 3300049586 | Bacteria | 3339 |
| 917 | Ga0501071_0005299 | 3300049587 | Bacteria | 8269 |
| 918 | Ga0501072_0005973 | 3300049588 | Bacteria | 9284 |
| 919 | Ga0501072_0013976 | 3300049588 | Bacteria | 6152 |
| 920 | Ga0501072_0028040 | 3300049588 | Bacteria | 4396 |
| 921 | Ga0501072_0113299 | 3300049588 | Bacteria | 2159 |
| 922 | Ga0501072_0140460 | 3300049588 | Bacteria | 1925 |
| 923 | Ga0501073_0015294 | 3300049589 | Bacteria | 5564 |
| 924 | Ga0501073_0026756 | 3300049589 | Bacteria | 4130 |
| 925 | Ga0501073_0061592 | 3300049589 | Bacteria | 2618 |
| 926 | Ga0501073_0085819 | 3300049589 | Bacteria | 2189 |
| 927 | Ga0501074_0018374 | 3300049590 | Bacteria | 5077 |
| 928 | Ga0501074_0038756 | 3300049590 | Bacteria | 3452 |
| 929 | Ga0501074_0145205 | 3300049590 | Bacteria | 1697 |
| 930 | Ga0501075_0001730 | 3300049591 | Bacteria | 14341 |
| 931 | Ga0501075_0039743 | 3300049591 | Bacteria | 3520 |
| 932 | Ga0501076_0000449 | 3300049592 | Bacteria | 26138 |
| 933 | Ga0501076_0046821 | 3300049592 | Bacteria | 3418 |
| 934 | Ga0501076_0174656 | 3300049592 | Bacteria | 1751 |
| 935 | Ga0501076_0193603 | 3300049592 | Bacteria | 1660 |
| 936 | Ga0501077_0014639 | 3300049593 | Bacteria | 4930 |
| 937 | Ga0501077_0137041 | 3300049593 | Bacteria | 1552 |
| 938 | Ga0501077_0181953 | 3300049593 | Bacteria | 1336 |
| 939 | Ga0501077_0257606 | 3300049593 | Bacteria | 1110 |
| 940 | Ga0501079_0000290 | 3300049741 | Bacteria | 31028 |
| 941 | Ga0501079_0062902 | 3300049741 | Bacteria | 2862 |
| 942 | Ga0501079_0121602 | 3300049741 | Bacteria | 2030 |
| 943 | Ga0501080_0000303 | 3300049742 | Bacteria | 37542 |
| 944 | Ga0501080_0008141 | 3300049742 | Bacteria | 9497 |
| 945 | Ga0501080_0015951 | 3300049742 | Bacteria | 6930 |
| 946 | Ga0501080_0021908 | 3300049742 | Bacteria | 5918 |
| 947 | Ga0501080_0041442 | 3300049742 | Bacteria | 4290 |
| 948 | Ga0501080_0082803 | 3300049742 | Bacteria | 2980 |
| 949 | Ga0501080_0187843 | 3300049742 | Bacteria | 1899 |
| 950 | Ga0501080_0223525 | 3300049742 | Bacteria | 1722 |
| 951 | Ga0501080_0431771 | 3300049742 | Bacteria | 1182 |
| 952 | Ga0501081_0000015 | 3300049743 | Bacteria | 57696 |
| 953 | Ga0501081_0008092 | 3300049743 | Bacteria | 6824 |
| 954 | Ga0501083_0005544 | 3300049744 | Bacteria | 8946 |
| 955 | Ga0501083_0031075 | 3300049744 | Bacteria | 3665 |
| 956 | Ga0501083_0123178 | 3300049744 | Bacteria | 1700 |
| 957 | Ga0501280_000079 | 3300049776 | Bacteria | 25935 |
| 958 | Ga0501282_000175 | 3300049778 | Bacteria | 7824 |
| 959 | Ga0501035_0003154 | 3300049822 | Bacteria | 15840 |
| 960 | Ga0501035_0124515 | 3300049822 | Bacteria | 2251 |
| 961 | Ga0501044_0005761 | 3300049823 | Bacteria | 13710 |
| 962 | Ga0501044_0026745 | 3300049823 | Bacteria | 6105 |
| 963 | Ga0501044_0151903 | 3300049823 | Bacteria | 2297 |
| 964 | Ga0501044_0255676 | 3300049823 | Bacteria | 1691 |
| 965 | Ga0501044_0416253 | 3300049823 | Bacteria | 1254 |
| 966 | Ga0501045_0001840 | 3300049824 | Bacteria | 14334 |
| 967 | Ga0501045_0007052 | 3300049824 | Bacteria | 7787 |
| 968 | Ga0501045_0010494 | 3300049824 | Bacteria | 6489 |
| 969 | Ga0501045_0086403 | 3300049824 | Bacteria | 2315 |
| 970 | nmdc:mga06r32_24033_c1 | 3300050510 | Bacteria | 5650 |
| 971 | nmdc:mga06r32_73299_c1 | 3300050510 | Bacteria | 3317 |
| 972 | Ga0495601_0003744 | 3300053077 | Bacteria | 8752 |
| 973 | Ga0495619_0031028 | 3300053085 | Bacteria | 3461 |
| 974 | Ga0500643_004659 | 3300053087 | Bacteria | 6116 |
| 975 | Ga0500583_0024967 | 3300053092 | Bacteria | 2544 |
| 976 | Ga0500583_0035173 | 3300053092 | Bacteria | 2233 |
| 977 | Ga0500641_0052588 | 3300053096 | Bacteria | 1679 |
| 978 | Ga0500650_0000012 | 3300053098 | Bacteria | 81170 |
| 979 | Ga0500556_0018658 | 3300053104 | Bacteria | 2193 |
| 980 | Ga0500559_0010723 | 3300053136 | Bacteria | 3928 |
| 981 | Ga0500568_0009904 | 3300053139 | Bacteria | 4500 |
| 982 | Ga0500568_0012982 | 3300053139 | Bacteria | 3813 |
| 983 | Ga0500588_0017395 | 3300053146 | Bacteria | 1876 |
| 984 | Ga0500616_0000032 | 3300053153 | Bacteria | 403673 |
| 985 | Ga0500616_0021061 | 3300053153 | Bacteria | 3660 |
| 986 | Ga0500616_0022716 | 3300053153 | Bacteria | 3500 |
| 987 | Ga0500622_0000318 | 3300053156 | Bacteria | 48445 |
| 988 | Ga0500622_0022558 | 3300053156 | Bacteria | 3336 |
| 989 | Ga0500622_0023493 | 3300053156 | Bacteria | 3265 |
| 990 | Ga0500636_0000154 | 3300053177 | Bacteria | 35799 |
| 991 | Ga0500637_0013056 | 3300053178 | Bacteria | 4341 |
| 992 | Ga0500637_0022087 | 3300053178 | Bacteria | 3464 |
| 993 | Ga0500637_0140891 | 3300053178 | Bacteria | 1396 |
| 994 | Ga0500625_018000 | 3300053729 | Bacteria | 3303 |
| 995 | Ga0500645_000509 | 3300053730 | Bacteria | 26108 |
| 996 | Ga0500656_001869 | 3300053732 | Bacteria | 1857 |
| 997 | Ga0501084_0005557 | 3300054114 | Bacteria | 10346 |
| 998 | Ga0501084_0027046 | 3300054114 | Bacteria | 4793 |
| 999 | Ga0501084_0055548 | 3300054114 | Bacteria | 3312 |
| 1000 | Ga0501084_0068267 | 3300054114 | Bacteria | 2976 |
| 1001 | Ga0501084_0084474 | 3300054114 | Bacteria | 2665 |
| 1002 | Ga0501082_0000222 | 3300060353 | Bacteria | 49671 |
| 1003 | Ga0501082_0043846 | 3300060353 | Bacteria | 3858 |
| 1004 | Ga0501082_0080108 | 3300060353 | Bacteria | 2818 |
| 1005 | Ga0501082_0080646 | 3300060353 | Bacteria | 2808 |
| 1006 | Ga0530510_0008213 | 3300061734 | Bacteria | 7280 |
| 1007 | Ga0530510_0025506 | 3300061734 | Bacteria | 4227 |
| 1008 | 2511824167 | 2511231156 | Bacteria | 6845832 |
| 1009 | 2599994562 | 2599185311 | Bacteria | 6354990 |
| 1010 | 2624493029 | 2623620446 | Bacteria | 6500345 |
| 1011 | 2643953834 | 2643221589 | Bacteria | 6250934 |
| 1012 | 2644021768 | 2643221602 | Bacteria | 6249926 |
| 1013 | 2644282527 | 2643221650 | Bacteria | 7029547 |
| 1014 | 2644362658 | 2643221665 | Bacteria | 4699229 |
| 1015 | 2738717088 | 2738541276 | Bacteria | 4690596 |
| 1016 | 2794596844 | 2791355520 | Bacteria | 5948615 |
| 1017 | 2808907836 | 2808606373 | Bacteria | 4423627 |
| 1018 | 2819565338 | 2818991440 | Bacteria | 4774720 |
| 1019 | 2860344263 | 2860339153 | Bacteria | 6846989 |
| 1020 | 2884341053 | 2884338543 | Bacteria | 4610696 |
| 1021 | 2904466632 | 2904463128 | Bacteria | 4775606 |
| 1022 | 2919699695 | 2919697872 | Bacteria | 6553725 |
| 1023 | 2923587925 | 2923586266 | Bacteria | 6565975 |
| 1024 | 2928519654 | 2928515477 | Bacteria | 4448421 |
| 1025 | 2931374613 | 2931369376 | Bacteria | 6847892 |
| 1026 | 2931402994 | 2931396565 | Bacteria | 7251677 |
| 1027 | 2939671757 | 2939669807 | Bacteria | 5028511 |
| 1028 | 2941471806 | 2941471342 | Bacteria | 5018624 |
| 1029 | 8019776034 | 8019775933 | Bacteria | 6858656 |
| 1030 | 8033233660 | 8033232454 | Bacteria | 3202805 |
| 1031 | 8054568167 | 8054563764 | Bacteria | 5592885 |
| 1032 | Ga0500568_0000336 | |||
| 1033 | MRS2a_Contig_29 | |||
| 1034 | SwRhRL2b_contig_1815281 | |||
| 1035 | JGI24736J21556_1007917 | |||
| 1036 | JGI24741J21665_1000887 | |||
| 1037 | JGI24740J21852_10001934 | |||
| 1038 | JGI25406J46586_10009821 | |||
| 1039 | rootH1_10092201 | |||
| 1040 | rootH2_10036460 | |||
| 1041 | rootL2_10049723 | |||
| 1042 | Ga0055530_10007678 | |||
| 1043 | Ga0055540_1006734 | |||
| 1044 | Ga0065714_10000586 | |||
| 1045 | Ga0065714_10004993 | |||
| 1046 | Ga0065714_10078307 | |||
| 1047 | Ga0065714_10161649 | |||
| 1048 | Ga0065704_10002538 | |||
| 1049 | Ga0065712_10000263 | |||
| 1050 | Ga0065715_10006697 | |||
| 1051 | Ga0065707_10227509 | |||
| 1052 | Ga0070658_10002861 | |||
| 1053 | Ga0070658_10021105 | |||
| 1054 | Ga0070658_10098004 | |||
| 1055 | Ga0070658_10188720 | |||
| 1056 | Ga0070658_10365753 | |||
| 1057 | Ga0070676_10000801 | |||
| 1058 | Ga0070683_100028714 | |||
| 1059 | Ga0070683_100097958 | |||
| 1060 | Ga0070690_100014512 | |||
| 1061 | Ga0070670_100000001 | |||
| 1062 | Ga0070670_100010905 | |||
| 1063 | Ga0070670_100040521 | |||
| 1064 | Ga0070670_100228039 | |||
| 1065 | Ga0070666_10000266 | |||
| 1066 | Ga0070666_10000366 | |||
| 1067 | Ga0070666_10002682 | |||
| 1068 | Ga0070666_10020127 | |||
| 1069 | Ga0070666_10038890 | |||
| 1070 | Ga0070666_10096976 | |||
| 1071 | Ga0070680_100013113 | |||
| 1072 | Ga0070680_100020091 | |||
| 1073 | Ga0070680_100042636 | |||
| 1074 | Ga0070682_100003230 | |||
| 1075 | Ga0070682_100029006 | |||
| 1076 | Ga0070682_100170824 | |||
| 1077 | Ga0068868_100038971 | |||
| 1078 | Ga0068868_100245212 | |||
| 1079 | Ga0070660_100232151 | |||
| 1080 | Ga0070691_10037348 | |||
| 1081 | Ga0070661_100030042 | |||
| 1082 | Ga0070661_100131620 | |||
| 1083 | Ga0070661_100166713 | |||
| 1084 | Ga0070661_100236324 | |||
| 1085 | Ga0070668_100009295 | |||
| 1086 | Ga0070668_100027917 | |||
| 1087 | Ga0070669_100006195 | |||
| 1088 | Ga0070669_100131881 | |||
| 1089 | Ga0070671_100000008 | |||
| 1090 | Ga0070671_100002122 | |||
| 1091 | Ga0070671_100027704 | |||
| 1092 | Ga0070674_100040640 | |||
| 1093 | Ga0070674_100121220 | |||
| 1094 | Ga0070673_100132447 | |||
| 1095 | Ga0070688_100000972 | |||
| 1096 | Ga0070659_100050655 | |||
| 1097 | Ga0070659_100092399 | |||
| 1098 | Ga0070667_100000023 | |||
| 1099 | Ga0070667_100000225 | |||
| 1100 | Ga0070667_100000351 | |||
| 1101 | Ga0070667_100027768 | |||
| 1102 | Ga0070667_100030752 | |||
| 1103 | Ga0070667_100036062 | |||
| 1104 | Ga0070667_100059701 | |||
| 1105 | Ga0070667_100105858 | |||
| 1106 | Ga0070667_100141629 | |||
| 1107 | Ga0070709_10015157 | |||
| 1108 | Ga0070713_100011000 | |||
| 1109 | Ga0070710_10006012 | |||
| 1110 | Ga0070710_10205949 | |||
| 1111 | Ga0070711_100077846 | |||
| 1112 | Ga0070700_100215673 | |||
| 1113 | Ga0070663_100000103 | |||
| 1114 | Ga0070663_100037863 | |||
| 1115 | Ga0070663_100087828 | |||
| 1116 | Ga0070663_100140479 | |||
| 1117 | Ga0070678_100040516 | |||
| 1118 | Ga0070678_100071337 | |||
| 1119 | Ga0070678_100147590 | |||
| 1120 | Ga0070678_100164989 | |||
| 1121 | Ga0070662_100009906 | |||
| 1122 | Ga0070662_100016490 | |||
| 1123 | Ga0070681_10000007 | |||
| 1124 | Ga0070681_10001003 | |||
| 1125 | Ga0070681_10003796 | |||
| 1126 | Ga0070681_10004322 | |||
| 1127 | Ga0070681_10013362 | |||
| 1128 | Ga0070681_10046179 | |||
| 1129 | Ga0070681_10073546 | |||
| 1130 | Ga0068867_100006727 | |||
| 1131 | Ga0068867_100027219 | |||
| 1132 | Ga0068867_100046833 | |||
| 1133 | Ga0070685_10000008 | |||
| 1134 | Ga0070685_10001807 | |||
| 1135 | Ga0070698_100104748 | |||
| 1136 | Ga0070679_100003433 | |||
| 1137 | Ga0070679_100081974 | |||
| 1138 | Ga0070679_100210745 | |||
| 1139 | Ga0070684_100014025 | |||
| 1140 | Ga0070684_100119988 | |||
| 1141 | Ga0068853_100020049 | |||
| 1142 | Ga0068853_100187248 | |||
| 1143 | Ga0070672_100003658 | |||
| 1144 | Ga0070672_100004615 | |||
| 1145 | Ga0070686_100127961 | |||
| 1146 | Ga0070696_100000793 | |||
| 1147 | Ga0070696_100237882 | |||
| 1148 | Ga0070693_100013299 | |||
| 1149 | Ga0070693_100025885 | |||
| 1150 | Ga0070665_100000102 | |||
| 1151 | Ga0070665_100000709 | |||
| 1152 | Ga0070665_100002620 | |||
| 1153 | Ga0070665_100008098 | |||
| 1154 | Ga0070665_100012413 | |||
| 1155 | Ga0070665_100021778 | |||
| 1156 | Ga0070665_100028052 | |||
| 1157 | Ga0070665_100048855 | |||
| 1158 | Ga0070665_100052726 | |||
| 1159 | Ga0070665_100090078 | |||
| 1160 | Ga0070665_100138712 | |||
| 1161 | Ga0068855_100000869 | |||
| 1162 | Ga0068855_100003358 | |||
| 1163 | Ga0068855_100015402 | |||
| 1164 | Ga0068855_100015412 | |||
| 1165 | Ga0068855_100015869 | |||
| 1166 | Ga0068855_100018045 | |||
| 1167 | Ga0068855_100099120 | |||
| 1168 | Ga0068855_100121723 | |||
| 1169 | Ga0068855_100152349 | |||
| 1170 | Ga0068855_100259873 | |||
| 1171 | Ga0070664_100066002 | |||
| 1172 | Ga0070664_100107734 | |||
| 1173 | Ga0070664_100529649 | |||
| 1174 | Ga0068857_100065824 | |||
| 1175 | Ga0068854_100000359 | |||
| 1176 | Ga0068854_100007279 | |||
| 1177 | Ga0068854_100095849 | |||
| 1178 | Ga0068856_100005926 | |||
| 1179 | Ga0068856_100009532 | |||
| 1180 | Ga0068856_100020508 | |||
| 1181 | Ga0068856_100023176 | |||
| 1182 | Ga0068856_100068937 | |||
| 1183 | Ga0068856_100086641 | |||
| 1184 | Ga0068856_100126287 | |||
| 1185 | Ga0068856_100149213 | |||
| 1186 | Ga0068856_100184422 | |||
| 1187 | Ga0068856_100333947 | |||
| 1188 | Ga0068852_100000619 | |||
| 1189 | Ga0068852_100048326 | |||
| 1190 | Ga0068852_100072643 | |||
| 1191 | Ga0068852_100176946 | |||
| 1192 | Ga0068852_100192265 | |||
| 1193 | Ga0068859_100004845 | |||
| 1194 | Ga0068859_100005322 | |||
| 1195 | Ga0068859_100024482 | |||
| 1196 | Ga0068859_100024740 | |||
| 1197 | Ga0068859_100382414 | |||
| 1198 | Ga0068864_100000006 | |||
| 1199 | Ga0068864_100005151 | |||
| 1200 | Ga0068866_10010588 | |||
| 1201 | Ga0068861_100003245 | |||
| 1202 | Ga0068861_100140580 | |||
| 1203 | Ga0068861_100210198 | |||
| 1204 | Ga0068861_100417058 | |||
| 1205 | Ga0068851_10014998 | |||
| 1206 | Ga0068863_100002746 | |||
| 1207 | Ga0068863_100048963 | |||
| 1208 | Ga0068863_100079149 | |||
| 1209 | Ga0068863_100211377 | |||
| 1210 | Ga0068858_100002744 | |||
| 1211 | Ga0068858_100008701 | |||
| 1212 | Ga0068858_100023716 | |||
| 1213 | Ga0068858_100064339 | |||
| 1214 | Ga0068858_100329660 | |||
| 1215 | Ga0068860_100001556 | |||
| 1216 | Ga0068860_100004920 | |||
| 1217 | Ga0068860_100015642 | |||
| 1218 | Ga0068860_100027176 | |||
| 1219 | Ga0068860_100030918 | |||
| 1220 | Ga0068862_100001815 | |||
| 1221 | Ga0068862_100005746 | |||
| 1222 | Ga0068862_100019192 | |||
| 1223 | Ga0068862_100033996 | |||
| 1224 | Ga0081455_10001394 | |||
| 1225 | Ga0081455_10207510 | |||
| 1226 | Ga0081540_1004452 | |||
| 1227 | Ga0081539_10000004 | |||
| 1228 | Ga0075432_10010912 | |||
| 1229 | Ga0075432_10080061 | |||
| 1230 | Ga0070715_10000150 | |||
| 1231 | Ga0070715_10121259 | |||
| 1232 | Ga0070716_100002317 | |||
| 1233 | Ga0070716_100042131 | |||
| 1234 | Ga0070712_100040018 | |||
| 1235 | Ga0097621_100055375 | |||
| 1236 | Ga0097621_100103451 | |||
| 1237 | Ga0097621_100150592 | |||
| 1238 | Ga0097621_100178016 | |||
| 1239 | Ga0068871_100025776 | |||
| 1240 | Ga0068871_100048555 | |||
| 1241 | Ga0068871_100070433 | |||
| 1242 | Ga0068871_100094004 | |||
| 1243 | Ga0075428_100062267 | |||
| 1244 | Ga0075428_100102828 | |||
| 1245 | Ga0075430_100118948 | |||
| 1246 | Ga0075430_100203250 | |||
| 1247 | Ga0075431_100026131 | |||
| 1248 | Ga0075431_100029453 | |||
| 1249 | Ga0075431_100049198 | |||
| 1250 | Ga0075431_100259610 | |||
| 1251 | Ga0068865_100016243 | |||
| 1252 | Ga0068865_100085170 | |||
| 1253 | Ga0068865_100094246 | |||
| 1254 | Ga0068865_100139785 | |||
| 1255 | Ga0097620_100004845 | |||
| 1256 | Ga0097620_100005322 | |||
| 1257 | Ga0097620_100024482 | |||
| 1258 | Ga0097620_100024739 | |||
| 1259 | Ga0097620_100052208 | |||
| 1260 | Ga0097620_100382409 | |||
| 1261 | Ga0079104_1000242 | |||
| 1262 | Ga0099795_10000011 | |||
| 1263 | Ga0105251_10022084 | |||
| 1264 | Ga0105244_10001520 | |||
| 1265 | Ga0105250_10000006 | |||
| 1266 | Ga0105250_10034494 | |||
| 1267 | Ga0105240_10003206 | |||
| 1268 | Ga0105240_10005121 | |||
| 1269 | Ga0105240_10006350 | |||
| 1270 | Ga0105240_10017411 | |||
| 1271 | Ga0105240_10022180 | |||
| 1272 | Ga0105240_10044864 | |||
| 1273 | Ga0105240_10058656 | |||
| 1274 | Ga0105240_10099273 | |||
| 1275 | Ga0105240_10122562 | |||
| 1276 | Ga0105240_10227971 | |||
| 1277 | Ga0105240_10309191 | |||
| 1278 | Ga0105240_10315261 | |||
| 1279 | Ga0105240_10434659 | |||
| 1280 | Ga0111539_10085808 | |||
| 1281 | Ga0111539_10303991 | |||
| 1282 | Ga0105247_10012741 | |||
| 1283 | Ga0105247_10033707 | |||
| 1284 | Ga0105247_10148403 | |||
| 1285 | Ga0114129_10015627 | |||
| 1286 | Ga0114129_10319798 | |||
| 1287 | Ga0105241_10004820 | |||
| 1288 | Ga0105241_10006404 | |||
| 1289 | Ga0105241_10022169 | |||
| 1290 | Ga0105242_10013658 | |||
| 1291 | Ga0105248_10000148 | |||
| 1292 | Ga0105248_10017268 | |||
| 1293 | Ga0105248_10030874 | |||
| 1294 | Ga0105248_10032216 | |||
| 1295 | Ga0105248_10042508 | |||
| 1296 | Ga0105248_10097336 | |||
| 1297 | Ga0105237_10001581 | |||
| 1298 | Ga0105237_10004537 | |||
| 1299 | Ga0105237_10011215 | |||
| 1300 | Ga0105237_10028376 | |||
| 1301 | Ga0105237_10031922 | |||
| 1302 | Ga0105237_10032183 | |||
| 1303 | Ga0105237_10086247 | |||
| 1304 | Ga0105237_10120739 | |||
| 1305 | Ga0105237_10134974 | |||
| 1306 | Ga0105237_10163499 | |||
| 1307 | Ga0105238_10005734 | |||
| 1308 | Ga0105238_10021517 | |||
| 1309 | Ga0105238_10023740 | |||
| 1310 | Ga0105238_10060320 | |||
| 1311 | Ga0105238_10061006 | |||
| 1312 | Ga0105238_10064775 | |||
| 1313 | Ga0105238_10085294 | |||
| 1314 | Ga0105238_10088190 | |||
| 1315 | Ga0105238_10164670 | |||
| 1316 | Ga0105249_10001612 | |||
| 1317 | Ga0105249_10002933 | |||
| 1318 | Ga0105249_10003331 | |||
| 1319 | Ga0105249_10004420 | |||
| 1320 | Ga0105249_10089063 | |||
| 1321 | Ga0105249_10218969 | |||
| 1322 | Ga0099796_10000024 | |||
| 1323 | Ga0105239_10003663 | |||
| 1324 | Ga0105239_10004199 | |||
| 1325 | Ga0105239_10020407 | |||
| 1326 | Ga0105239_10060951 | |||
| 1327 | Ga0105239_10216960 | |||
| 1328 | Ga0105239_10791366 | |||
| 1329 | Ga0105246_10024366 | |||
| 1330 | Ga0105246_10243049 | |||
| 1331 | Ga0157373_10045545 | |||
| 1332 | Ga0157373_10134665 | |||
| 1333 | Ga0157373_10219683 | |||
| 1334 | Ga0157371_10007059 | |||
| 1335 | Ga0157371_10008053 | |||
| 1336 | Ga0157370_10017048 | |||
| 1337 | Ga0157370_10025869 | |||
| 1338 | Ga0157370_10044313 | |||
| 1339 | Ga0157370_10077034 | |||
| 1340 | Ga0157370_10078927 | |||
| 1341 | Ga0157370_10273004 | |||
| 1342 | Ga0157370_10489331 | |||
| 1343 | Ga0157369_10000027 | |||
| 1344 | Ga0157369_10002023 | |||
| 1345 | Ga0157369_10008199 | |||
| 1346 | Ga0157369_10012504 | |||
| 1347 | Ga0157369_10022625 | |||
| 1348 | Ga0157369_10085695 | |||
| 1349 | Ga0157369_10099878 | |||
| 1350 | Ga0157369_10125769 | |||
| 1351 | Ga0157369_10161053 | |||
| 1352 | Ga0157369_10184799 | |||
| 1353 | Ga0157369_10261416 | |||
| 1354 | Ga0157369_10348633 | |||
| 1355 | Ga0157369_10356448 | |||
| 1356 | Ga0157374_10047854 | |||
| 1357 | Ga0157374_10097958 | |||
| 1358 | Ga0157374_10161175 | |||
| 1359 | Ga0157378_10000018 | |||
| 1360 | Ga0157378_10001851 | |||
| 1361 | Ga0157378_10033212 | |||
| 1362 | Ga0157378_10065676 | |||
| 1363 | Ga0157378_10463461 | |||
| 1364 | Ga0163162_10000662 | |||
| 1365 | Ga0163162_10005502 | |||
| 1366 | Ga0163162_10011348 | |||
| 1367 | Ga0163162_10019703 | |||
| 1368 | Ga0163162_10344129 | |||
| 1369 | Ga0163162_10729712 | |||
| 1370 | Ga0157372_10015942 | |||
| 1371 | Ga0157372_10066288 | |||
| 1372 | Ga0157375_10000154 | |||
| 1373 | Ga0157375_10001786 | |||
| 1374 | Ga0157375_10003810 | |||
| 1375 | Ga0157375_10014424 | |||
| 1376 | Ga0157375_10172726 | |||
| 1377 | Ga0163163_10000381 | |||
| 1378 | Ga0163163_10000766 | |||
| 1379 | Ga0163163_10086362 | |||
| 1380 | Ga0163163_10129218 | |||
| 1381 | Ga0182008_10037120 | |||
| 1382 | Ga0157379_10000444 | |||
| 1383 | Ga0157379_10000830 | |||
| 1384 | Ga0157379_10005133 | |||
| 1385 | Ga0157379_10101152 | |||
| 1386 | Ga0157376_10009073 | |||
| 1387 | Ga0157376_10011633 | |||
| 1388 | Ga0157376_10064361 | |||
| 1389 | Ga0182006_1003790 | |||
| 1390 | Ga0182006_1021301 | |||
| 1391 | Ga0182007_10013242 | |||
| 1392 | Ga0182005_1002273 | |||
| 1393 | Ga0182005_1006568 | |||
| 1394 | Ga0163161_10176586 | |||
| 1395 | Ga0209147_102387 | |||
| 1396 | Ga0209233_1005559 | |||
| 1397 | Ga0209050_1000037 | |||
| 1398 | Ga0209051_1000380 | |||
| 1399 | Ga0209051_1002103 | |||
| 1400 | Ga0209257_1013988 | |||
| 1401 | Ga0209257_1024565 | |||
| 1402 | Ga0207697_10055947 | |||
| 1403 | Ga0207656_10005278 | |||
| 1404 | Ga0207656_10011987 | |||
| 1405 | Ga0207696_1000069 | |||
| 1406 | Ga0207696_1026731 | |||
| 1407 | Ga0207692_10197154 | |||
| 1408 | Ga0207710_10000196 | |||
| 1409 | Ga0207710_10124575 | |||
| 1410 | Ga0207680_10000249 | |||
| 1411 | Ga0207680_10007170 | |||
| 1412 | Ga0207680_10034740 | |||
| 1413 | Ga0207680_10082161 | |||
| 1414 | Ga0207680_10131819 | |||
| 1415 | Ga0207680_10251697 | |||
| 1416 | Ga0207647_10000150 | |||
| 1417 | Ga0207647_10000344 | |||
| 1418 | Ga0207647_10037600 | |||
| 1419 | Ga0207685_10028645 | |||
| 1420 | Ga0207645_10002185 | |||
| 1421 | Ga0207645_10057755 | |||
| 1422 | Ga0207643_10167435 | |||
| 1423 | Ga0207705_10000004 | |||
| 1424 | Ga0207705_10018658 | |||
| 1425 | Ga0207705_10081844 | |||
| 1426 | Ga0207705_10300606 | |||
| 1427 | Ga0207654_10002216 | |||
| 1428 | Ga0207654_10003305 | |||
| 1429 | Ga0207707_10003587 | |||
| 1430 | Ga0207707_10007193 | |||
| 1431 | Ga0207707_10007902 | |||
| 1432 | Ga0207707_10020385 | |||
| 1433 | Ga0207707_10049851 | |||
| 1434 | Ga0207707_10053851 | |||
| 1435 | Ga0207695_10000007 | |||
| 1436 | Ga0207695_10000094 | |||
| 1437 | Ga0207695_10000774 | |||
| 1438 | Ga0207695_10005278 | |||
| 1439 | Ga0207695_10009302 | |||
| 1440 | Ga0207695_10009661 | |||
| 1441 | Ga0207695_10035599 | |||
| 1442 | Ga0207695_10181007 | |||
| 1443 | Ga0207695_10218179 | |||
| 1444 | Ga0207695_10272752 | |||
| 1445 | Ga0207695_10381717 | |||
| 1446 | Ga0207671_10001596 | |||
| 1447 | Ga0207671_10002269 | |||
| 1448 | Ga0207671_10005102 | |||
| 1449 | Ga0207671_10019921 | |||
| 1450 | Ga0207671_10176370 | |||
| 1451 | Ga0207671_10210970 | |||
| 1452 | Ga0207693_10000059 | |||
| 1453 | Ga0207660_10058298 | |||
| 1454 | Ga0207660_10077871 | |||
| 1455 | Ga0207660_10082234 | |||
| 1456 | Ga0207660_10137992 | |||
| 1457 | Ga0207660_10234030 | |||
| 1458 | Ga0207657_10073696 | |||
| 1459 | Ga0207649_10002216 | |||
| 1460 | Ga0207649_10176942 | |||
| 1461 | Ga0207652_10018536 | |||
| 1462 | Ga0207652_10102091 | |||
| 1463 | Ga0207652_10141465 | |||
| 1464 | Ga0207652_10387149 | |||
| 1465 | Ga0207681_10078982 | |||
| 1466 | Ga0207694_10007199 | |||
| 1467 | Ga0207694_10010916 | |||
| 1468 | Ga0207694_10017515 | |||
| 1469 | Ga0207694_10025369 | |||
| 1470 | Ga0207694_10028313 | |||
| 1471 | Ga0207694_10030514 | |||
| 1472 | Ga0207694_10037642 | |||
| 1473 | Ga0207694_10059003 | |||
| 1474 | Ga0207694_10436564 | |||
| 1475 | Ga0207650_10000002 | |||
| 1476 | Ga0207650_10051347 | |||
| 1477 | Ga0207650_10172554 | |||
| 1478 | Ga0207687_10176243 | |||
| 1479 | Ga0207687_10369194 | |||
| 1480 | Ga0207700_10006806 | |||
| 1481 | Ga0207644_10000019 | |||
| 1482 | Ga0207644_10022578 | |||
| 1483 | Ga0207644_10025916 | |||
| 1484 | Ga0207690_10268050 | |||
| 1485 | Ga0207706_10003284 | |||
| 1486 | Ga0207706_10009739 | |||
| 1487 | Ga0207706_10280834 | |||
| 1488 | Ga0207669_10055623 | |||
| 1489 | Ga0207704_10024154 | |||
| 1490 | Ga0207704_10041355 | |||
| 1491 | Ga0207704_10133563 | |||
| 1492 | Ga0207665_10020938 | |||
| 1493 | Ga0207665_10058315 | |||
| 1494 | Ga0207691_10003235 | |||
| 1495 | Ga0207691_10003264 | |||
| 1496 | Ga0207691_10021992 | |||
| 1497 | Ga0207691_10060721 | |||
| 1498 | Ga0207691_10211810 | |||
| 1499 | Ga0207691_10372523 | |||
| 1500 | Ga0207711_10000156 | |||
| 1501 | Ga0207711_10025310 | |||
| 1502 | Ga0207711_10101702 | |||
| 1503 | Ga0207711_10175212 | |||
| 1504 | Ga0207711_10199823 | |||
| 1505 | Ga0207661_10024536 | |||
| 1506 | Ga0207661_10137628 | |||
| 1507 | Ga0207679_10050846 | |||
| 1508 | Ga0207679_10144001 | |||
| 1509 | Ga0207667_10002665 | |||
| 1510 | Ga0207667_10021307 | |||
| 1511 | Ga0207667_10036769 | |||
| 1512 | Ga0207667_10075315 | |||
| 1513 | Ga0207667_10100428 | |||
| 1514 | Ga0207667_10184546 | |||
| 1515 | Ga0207667_10236063 | |||
| 1516 | Ga0207667_10316207 | |||
| 1517 | Ga0207667_10328032 | |||
| 1518 | Ga0207667_10554530 | |||
| 1519 | Ga0207667_10587844 | |||
| 1520 | Ga0207651_10054134 | |||
| 1521 | Ga0207712_10000302 | |||
| 1522 | Ga0207712_10000609 | |||
| 1523 | Ga0207712_10010397 | |||
| 1524 | Ga0207712_10047926 | |||
| 1525 | Ga0207712_10108029 | |||
| 1526 | Ga0207668_10002464 | |||
| 1527 | Ga0207668_10006814 | |||
| 1528 | Ga0207640_10077819 | |||
| 1529 | Ga0207640_10252003 | |||
| 1530 | Ga0207658_10000001 | |||
| 1531 | Ga0207658_10000098 | |||
| 1532 | Ga0207658_10005045 | |||
| 1533 | Ga0207658_10013389 | |||
| 1534 | Ga0207658_10243827 | |||
| 1535 | Ga0207658_10476849 | |||
| 1536 | Ga0207677_10012878 | |||
| 1537 | Ga0207677_10030007 | |||
| 1538 | Ga0207677_10073203 | |||
| 1539 | Ga0207703_10000240 | |||
| 1540 | Ga0207703_10003355 | |||
| 1541 | Ga0207703_10019664 | |||
| 1542 | Ga0207639_10000130 | |||
| 1543 | Ga0207639_10000942 | |||
| 1544 | Ga0207639_10010126 | |||
| 1545 | Ga0207639_10011822 | |||
| 1546 | Ga0207639_10014126 | |||
| 1547 | Ga0207639_10020388 | |||
| 1548 | Ga0207639_10224849 | |||
| 1549 | Ga0207678_10001241 | |||
| 1550 | Ga0207678_10008329 | |||
| 1551 | Ga0207678_10023458 | |||
| 1552 | Ga0207678_10094528 | |||
| 1553 | Ga0207708_10008413 | |||
| 1554 | Ga0207702_10013824 | |||
| 1555 | Ga0207702_10022598 | |||
| 1556 | Ga0207702_10023888 | |||
| 1557 | Ga0207702_10054636 | |||
| 1558 | Ga0207702_10231885 | |||
| 1559 | Ga0207702_10287414 | |||
| 1560 | Ga0207641_10000247 | |||
| 1561 | Ga0207641_10002054 | |||
| 1562 | Ga0207641_10007379 | |||
| 1563 | Ga0207641_10079659 | |||
| 1564 | Ga0207641_10084263 | |||
| 1565 | Ga0207641_10098495 | |||
| 1566 | Ga0207648_10001100 | |||
| 1567 | Ga0207648_10128412 | |||
| 1568 | Ga0207648_10148282 | |||
| 1569 | Ga0207676_10000001 | |||
| 1570 | Ga0207676_10016113 | |||
| 1571 | Ga0207674_10038872 | |||
| 1572 | Ga0207674_10391787 | |||
| 1573 | Ga0207675_100003413 | |||
| 1574 | Ga0207675_100041525 | |||
| 1575 | Ga0207683_10014558 | |||
| 1576 | Ga0207683_10252905 | |||
| 1577 | Ga0207683_10359106 | |||
| 1578 | Ga0207683_10470509 | |||
| 1579 | Ga0207698_10000177 | |||
| 1580 | Ga0207698_10003436 | |||
| 1581 | Ga0207698_10005219 | |||
| 1582 | Ga0207698_10021795 | |||
| 1583 | Ga0207698_10165670 | |||
| 1584 | Ga0207698_10203381 | |||
| 1585 | Ga0207698_10467472 | |||
| 1586 | Ga0209281_1000245 | |||
| 1587 | Ga0209179_1000083 | |||
| 1588 | Ga0209970_1002609 | |||
| 1589 | Ga0210002_1010728 | |||
| 1590 | Ga0209983_1000335 | |||
| 1591 | Ga0209971_1000386 | |||
| 1592 | Ga0265354_1000595 | |||
| 1593 | Ga0265356_1003406 | |||
| 1594 | Ga0268266_10000001 | |||
| 1595 | Ga0268266_10000006 | |||
| 1596 | Ga0268266_10000392 | |||
| 1597 | Ga0268266_10003314 | |||
| 1598 | Ga0268266_10040793 | |||
| 1599 | Ga0268266_10069452 | |||
| 1600 | Ga0268266_10073483 | |||
| 1601 | Ga0268266_10105828 | |||
| 1602 | Ga0268266_10633162 | |||
| 1603 | Ga0268265_10000288 | |||
| 1604 | Ga0268265_10002215 | |||
| 1605 | Ga0268265_10009164 | |||
| 1606 | Ga0268265_10047108 | |||
| 1607 | Ga0268265_10089519 | |||
| 1608 | Ga0268264_10000057 | |||
| 1609 | Ga0268264_10000165 | |||
| 1610 | Ga0268264_10000348 | |||
| 1611 | Ga0268264_10000419 | |||
| 1612 | Ga0268264_10010755 | |||
| 1613 | Ga0268264_10105190 | |||
| 1614 | Ga0268264_10105465 | |||
| 1615 | Ga0265326_10011710 | |||
| 1616 | Ga0265319_1041561 | |||
| 1617 | Ga0265334_10000123 | |||
| 1618 | Ga0265318_10001505 | |||
| 1619 | Ga0307515_10010000 | |||
| 1620 | Ga0265338_10008882 | |||
| 1621 | Ga0265338_10013818 | |||
| 1622 | Ga0265770_1000073 | |||
| 1623 | Ga0265760_10000738 | |||
| 1624 | Ga0265330_10008236 | |||
| 1625 | Ga0265332_10001382 | |||
| 1626 | Ga0265328_10005954 | |||
| 1627 | Ga0265320_10011833 | |||
| 1628 | Ga0265325_10002595 | |||
| 1629 | Ga0265329_10000811 | |||
| 1630 | Ga0265340_10034832 | |||
| 1631 | Ga0265331_10002545 | |||
| 1632 | Ga0265327_10000008 | |||
| 1633 | Ga0265316_10005931 | |||
| 1634 | Ga0307509_10000006 | |||
| 1635 | Ga0307509_10000013 | |||
| 1636 | Ga0265313_10002136 | |||
| 1637 | Ga0316575_10011453 | |||
| 1638 | Ga0316575_10057235 | |||
| 1639 | Ga0265314_10006700 | |||
| 1640 | Ga0265342_10006567 | |||
| 1641 | Ga0316576_10018502 | |||
| 1642 | Ga0316576_10035263 | |||
| 1643 | Ga0316576_10081661 | |||
| 1644 | Ga0316576_10099000 | |||
| 1645 | Ga0316576_10178140 | |||
| 1646 | Ga0307516_10000423 | |||
| 1647 | Ga0307516_10089152 | |||
| 1648 | Ga0316577_10007639 | |||
| 1649 | Ga0307410_10301516 | |||
| 1650 | Ga0307409_100118344 | |||
| 1651 | Ga0307411_10021251 | |||
| 1652 | Ga0307415_100107797 | |||
| 1653 | Ga0307507_10033572 | |||
| 1654 | Ga0307510_10000014 | |||
| 1655 | Ga0307510_10001790 | |||
| 1656 | Ga0373956_0049119 | |||
| 1657 | Ga0373955_0017113 | |||
| 1658 | Ga0373955_0111529 | |||
| 1659 | Ga0316574_0036450 | |||
| 1660 | Ga0316574_0085969 | |||
| 1661 | Ga0316574_0105684 | |||
| 1662 | Ga0316574_0116904 | |||
| 1663 | Ga0316574_0142325 | |||
| 1664 | Ga0316574_0198515 | |||
| 1665 | Ga0373924_0077687 | |||
| 1666 | Ga0373947_0025472 | |||
| 1667 | Ga0373937_0017693 | |||
| 1668 | Ga0373937_0030591 | |||
| 1669 | Ga0316582_0028076 | |||
| 1670 | Ga0316582_0046994 | |||
| 1671 | Ga0316584_0038421 | |||
| 1672 | Ga0373925_0047339 | |||
| 1673 | Ga0395900_0000033 | |||
| 1674 | Ga0395900_0021084 | |||
| 1675 | Ga0395900_0112462 | |||
| 1676 | Ga0395900_0493220 | |||
| 1677 | Ga0395898_0037202 | |||
| 1678 | Ga0395898_0074656 | |||
| 1679 | Ga0400483_005143 | |||
| 1680 | Ga0400489_70870 | |||
| 1681 | Ga0436365_0748338 | |||
| 1682 | Ga0436365_0842660 | |||
| 1683 | Ga0436365_1093700 | |||
| 1684 | Ga0436365_1613235 | |||
| 1685 | Ga0436365_1889773 | |||
| 1686 | Ga0436361_0230354 | |||
| 1687 | Ga0436363_1071014 | |||
| 1688 | Ga0436363_1479011 | |||
| 1689 | Ga0439447_005158 | |||
| 1690 | Ga0439447_014249 | |||
| 1691 | Ga0439466_0012927 | |||
| 1692 | Ga0451787_694605 | |||
| 1693 | Ga0451791_1728031 | |||
| 1694 | Ga0451797_1183596 | |||
| 1695 | Ga0451807_0437021 | |||
| 1696 | Ga0451833_1189488 | |||
| 1697 | Ga0451835_0512670 | |||
| 1698 | Ga0451843_1118340 | |||
| 1699 | Ga0439431_0007281 | |||
| 1700 | Ga0439445_0034640 | |||
| 1701 | Ga0439432_054490 | |||
| 1702 | Ga0439452_014029 | |||
| 1703 | Ga0450911_000013 | |||
| 1704 | Ga0450907_000001 | |||
| 1705 | Ga0439434_0008163 | |||
| 1706 | Ga0439434_0011204 | |||
| 1707 | Ga0439459_0003975 | |||
| 1708 | Ga0439464_0001840 | |||
| 1709 | Ga0450893_0004839 | |||
| 1710 | Ga0451577_0032097 | |||
| 1711 | Ga0451577_0041635 | |||
| 1712 | Ga0451577_0096140 | |||
| 1713 | Ga0466969_0115383 | |||
| 1714 | Ga0466972_0006153 | |||
| 1715 | Ga0453683_0008221 | |||
| 1716 | Ga0466966_0038805 | |||
| 1717 | Ga0453684_0000114 | |||
| 1718 | Ga0453684_0050669 | |||
| 1719 | Ga0453684_0052350 | |||
| 1720 | Ga0453684_0087328 | |||
| 1721 | Ga0453684_0105732 | |||
| 1722 | Ga0453684_0150940 | |||
| 1723 | Ga0453684_0303950 | |||
| 1724 | Ga0453684_0460007 | |||
| 1725 | Ga0453684_0583682 | |||
| 1726 | Ga0466968_0007288 | |||
| 1727 | Ga0466970_0002897 | |||
| 1728 | Ga0466959_0051648 | |||
| 1729 | Ga0451576_0000335 | |||
| 1730 | Ga0451576_0002565 | |||
| 1731 | Ga0451576_0078228 | |||
| 1732 | Ga0451576_0197363 | |||
| 1733 | Ga0451576_0228884 | |||
| 1734 | Ga0451576_0239021 | |||
| 1735 | Ga0451576_0261348 | |||
| 1736 | Ga0466958_0060702 | |||
| 1737 | Ga0495617_013663 | |||
| 1738 | Ga0495603_0036201 | |||
| 1739 | Ga0495591_051507 | |||
| 1740 | Ga0495638_0041021 | |||
| 1741 | Ga0495638_0064700 | |||
| 1742 | Ga0495638_0092420 | |||
| 1743 | Ga0495653_0025158 | |||
| 1744 | Ga0495580_0005280 | |||
| 1745 | Ga0495580_0022256 | |||
| 1746 | Ga0495580_0035673 | |||
| 1747 | Ga0495582_0009708 | |||
| 1748 | Ga0495605_0016705 | |||
| 1749 | Ga0495605_0042159 | |||
| 1750 | Ga0495605_0082072 | |||
| 1751 | Ga0495584_0042415 | |||
| 1752 | Ga0495584_0059681 | |||
| 1753 | Ga0495585_0000151 | |||
| 1754 | Ga0495585_0005731 | |||
| 1755 | Ga0495585_0028014 | |||
| 1756 | Ga0495585_0032554 | |||
| 1757 | Ga0495594_0013192 | |||
| 1758 | Ga0495607_0036688 | |||
| 1759 | Ga0495607_0039233 | |||
| 1760 | Ga0495607_0048920 | |||
| 1761 | Ga0495607_0051728 | |||
| 1762 | Ga0495606_0026264 | |||
| 1763 | Ga0495610_0026603 | |||
| 1764 | Ga0495616_0027533 | |||
| 1765 | Ga0495620_0063337 | |||
| 1766 | Ga0495637_0010354 | |||
| 1767 | Ga0495637_0018315 | |||
| 1768 | Ga0495637_0023866 | |||
| 1769 | Ga0495643_0088908 | |||
| 1770 | Ga0495648_0000737 | |||
| 1771 | Ga0495648_0030360 | |||
| 1772 | Ga0495648_0063669 | |||
| 1773 | Ga0495666_0056183 | |||
| 1774 | Ga0495654_0016328 | |||
| 1775 | Ga0495665_0071163 | |||
| 1776 | Ga0495586_0202010 | |||
| 1777 | Ga0495621_0007301 | |||
| 1778 | Ga0495621_0010037 | |||
| 1779 | Ga0495597_0024782 | |||
| 1780 | Ga0495597_0063695 | |||
| 1781 | Ga0495645_0034114 | |||
| 1782 | Ga0495622_0009765 | |||
| 1783 | Ga0495633_0013335 | |||
| 1784 | Ga0495634_0009244 | |||
| 1785 | Ga0495625_0145333 | |||
| 1786 | Ga0495635_0019431 | |||
| 1787 | Ga0495661_0059793 | |||
| 1788 | Ga0495588_0008764 | |||
| 1789 | Ga0495623_0032187 | |||
| 1790 | Ga0495647_0000270 | |||
| 1791 | Ga0495658_0011959 | |||
| 1792 | Ga0495613_0164966 | |||
| 1793 | Ga0495670_0013682 | |||
| 1794 | Ga0495670_0015465 | |||
| 1795 | Ga0495649_0032179 | |||
| 1796 | Ga0495649_0055277 | |||
| 1797 | Ga0495674_0052642 | |||
| 1798 | Ga0495674_0243090 | |||
| 1799 | Ga0495672_0029354 | |||
| 1800 | Ga0495680_0072114 | |||
| 1801 | Ga0495680_0197639 | |||
| 1802 | Ga0495683_0004043 | |||
| 1803 | Ga0495683_0066671 | |||
| 1804 | Ga0495683_0085319 | |||
| 1805 | Ga0495683_0122872 | |||
| 1806 | Ga0495687_022890 | |||
| 1807 | Ga0495687_035532 | |||
| 1808 | Ga0495673_0004833 | |||
| 1809 | Ga0495673_0020837 | |||
| 1810 | Ga0495673_0040112 | |||
| 1811 | Ga0495673_0054629 | |||
| 1812 | Ga0495681_0024511 | |||
| 1813 | Ga0495684_0260875 | |||
| 1814 | Ga0495686_0002423 | |||
| 1815 | Ga0495593_0063141 | |||
| 1816 | Ga0495602_0073193 | |||
| 1817 | Ga0495626_0057907 | |||
| 1818 | Ga0496100_0114524 | |||
| 1819 | Ga0496101_0023799 | |||
| 1820 | Ga0496102_0003905 | |||
| 1821 | Ga0496102_0017255 | |||
| 1822 | Ga0496102_0017799 | |||
| 1823 | Ga0496102_0057014 | |||
| 1824 | Ga0496102_0062224 | |||
| 1825 | Ga0496103_0032017 | |||
| 1826 | Ga0496103_0168628 | |||
| 1827 | Ga0496104_0000020 | |||
| 1828 | Ga0496104_0403286 | |||
| 1829 | Ga0496105_0000028 | |||
| 1830 | Ga0496107_0002714 | |||
| 1831 | Ga0496108_0002437 | |||
| 1832 | Ga0496108_0069055 | |||
| 1833 | Ga0496109_0091567 | |||
| 1834 | Ga0496110_0002260 | |||
| 1835 | Ga0496111_0006561 | |||
| 1836 | Ga0496112_0011818 | |||
| 1837 | Ga0496112_0058214 | |||
| 1838 | Ga0496113_0003696 | |||
| 1839 | Ga0496114_0002691 | |||
| 1840 | Ga0496114_0242835 | |||
| 1841 | Ga0496115_0000138 | |||
| 1842 | Ga0496115_0081834 | |||
| 1843 | Ga0496116_0024324 | |||
| 1844 | Ga0496116_0102505 | |||
| 1845 | Ga0496117_0000228 | |||
| 1846 | Ga0496117_0028819 | |||
| 1847 | Ga0496117_0046428 | |||
| 1848 | Ga0496117_0117275 | |||
| 1849 | Ga0496118_0000005 | |||
| 1850 | Ga0496118_0000166 | |||
| 1851 | Ga0496118_0004388 | |||
| 1852 | Ga0496118_0005801 | |||
| 1853 | Ga0496118_0043277 | |||
| 1854 | Ga0496118_0045586 | |||
| 1855 | Ga0496118_0143103 | |||
| 1856 | Ga0496119_0003238 | |||
| 1857 | Ga0496120_0002153 | |||
| 1858 | Ga0496121_0000044 | |||
| 1859 | Ga0496121_0000522 | |||
| 1860 | Ga0496121_0263813 | |||
| 1861 | Ga0496122_0000734 | |||
| 1862 | Ga0496122_0030184 | |||
| 1863 | Ga0496123_0002408 | |||
| 1864 | Ga0496125_0008666 | |||
| 1865 | Ga0496125_0071229 | |||
| 1866 | Ga0496125_0092354 | |||
| 1867 | Ga0496126_0000132 | |||
| 1868 | Ga0496126_0017383 | |||
| 1869 | Ga0496126_0085681 | |||
| 1870 | Ga0496126_0112906 | |||
| 1871 | Ga0496126_0172907 | |||
| 1872 | Ga0496126_0210892 | |||
| 1873 | Ga0496126_0257557 | |||
| 1874 | Ga0495678_012628 | |||
| 1875 | Ga0495682_0013067 | |||
| 1876 | Ga0495682_0013093 | |||
| 1877 | Ga0495682_0050159 | |||
| 1878 | Ga0501031_0045198 | |||
| 1879 | Ga0501032_0034257 | |||
| 1880 | Ga0501032_0065866 | |||
| 1881 | Ga0501032_0205292 | |||
| 1882 | Ga0501033_0001231 | |||
| 1883 | Ga0501033_0033405 | |||
| 1884 | Ga0501033_0034603 | |||
| 1885 | Ga0501033_0049699 | |||
| 1886 | Ga0501033_0053640 | |||
| 1887 | Ga0501034_0181122 | |||
| 1888 | Ga0501034_0318718 | |||
| 1889 | Ga0501034_0487526 | |||
| 1890 | Ga0501034_0487829 | |||
| 1891 | Ga0501036_0006455 | |||
| 1892 | Ga0501036_0011152 | |||
| 1893 | Ga0501036_0013569 | |||
| 1894 | Ga0501036_0033365 | |||
| 1895 | Ga0501036_0040241 | |||
| 1896 | Ga0501036_0409537 | |||
| 1897 | Ga0501037_0000433 | |||
| 1898 | Ga0501037_0030190 | |||
| 1899 | Ga0501037_0061595 | |||
| 1900 | Ga0501038_0002574 | |||
| 1901 | Ga0501038_0010947 | |||
| 1902 | Ga0501038_0017873 | |||
| 1903 | Ga0501038_0043326 | |||
| 1904 | Ga0501038_0061330 | |||
| 1905 | Ga0501038_0357286 | |||
| 1906 | Ga0501039_0000322 | |||
| 1907 | Ga0501039_0024008 | |||
| 1908 | Ga0501039_0076546 | |||
| 1909 | Ga0501040_0004666 | |||
| 1910 | Ga0501040_0012738 | |||
| 1911 | Ga0501041_0000050 | |||
| 1912 | Ga0501041_0021444 | |||
| 1913 | Ga0501042_0016733 | |||
| 1914 | Ga0501042_0020388 | |||
| 1915 | Ga0501042_0056875 | |||
| 1916 | Ga0501042_0059218 | |||
| 1917 | Ga0501043_0005762 | |||
| 1918 | Ga0501043_0026213 | |||
| 1919 | Ga0501043_0029669 | |||
| 1920 | Ga0501046_0010896 | |||
| 1921 | Ga0501046_0016090 | |||
| 1922 | Ga0501046_0018895 | |||
| 1923 | Ga0501046_0035443 | |||
| 1924 | Ga0501046_0160428 | |||
| 1925 | Ga0501046_0183261 | |||
| 1926 | Ga0501047_0013100 | |||
| 1927 | Ga0501047_0042005 | |||
| 1928 | Ga0501047_0120567 | |||
| 1929 | Ga0501048_0002201 | |||
| 1930 | Ga0501048_0078250 | |||
| 1931 | Ga0501067_0015905 | |||
| 1932 | Ga0501067_0053716 | |||
| 1933 | Ga0501068_0008748 | |||
| 1934 | Ga0501068_0019256 | |||
| 1935 | Ga0501068_0025418 | |||
| 1936 | Ga0501068_0045849 | |||
| 1937 | Ga0501068_0095043 | |||
| 1938 | Ga0501068_0140935 | |||
| 1939 | Ga0501069_0005978 | |||
| 1940 | Ga0501069_0011840 | |||
| 1941 | Ga0501069_0037144 | |||
| 1942 | Ga0501070_0020286 | |||
| 1943 | Ga0501070_0027644 | |||
| 1944 | Ga0501070_0037695 | |||
| 1945 | Ga0501070_0039821 | |||
| 1946 | Ga0501070_0053766 | |||
| 1947 | Ga0501071_0005299 | |||
| 1948 | Ga0501072_0005973 | |||
| 1949 | Ga0501072_0013976 | |||
| 1950 | Ga0501072_0028040 | |||
| 1951 | Ga0501072_0113299 | |||
| 1952 | Ga0501072_0140460 | |||
| 1953 | Ga0501073_0015294 | |||
| 1954 | Ga0501073_0026756 | |||
| 1955 | Ga0501073_0061592 | |||
| 1956 | Ga0501073_0085819 | |||
| 1957 | Ga0501074_0018374 | |||
| 1958 | Ga0501074_0038756 | |||
| 1959 | Ga0501074_0145205 | |||
| 1960 | Ga0501075_0001730 | |||
| 1961 | Ga0501075_0039743 | |||
| 1962 | Ga0501076_0000449 | |||
| 1963 | Ga0501076_0046821 | |||
| 1964 | Ga0501076_0174656 | |||
| 1965 | Ga0501076_0193603 | |||
| 1966 | Ga0501077_0014639 | |||
| 1967 | Ga0501077_0137041 | |||
| 1968 | Ga0501077_0181953 | |||
| 1969 | Ga0501077_0257606 | |||
| 1970 | Ga0501079_0000290 | |||
| 1971 | Ga0501079_0062902 | |||
| 1972 | Ga0501079_0121602 | |||
| 1973 | Ga0501080_0000303 | |||
| 1974 | Ga0501080_0008141 | |||
| 1975 | Ga0501080_0015951 | |||
| 1976 | Ga0501080_0021908 | |||
| 1977 | Ga0501080_0041442 | |||
| 1978 | Ga0501080_0082803 | |||
| 1979 | Ga0501080_0187843 | |||
| 1980 | Ga0501080_0223525 | |||
| 1981 | Ga0501080_0431771 | |||
| 1982 | Ga0501081_0000015 | |||
| 1983 | Ga0501081_0008092 | |||
| 1984 | Ga0501083_0005544 | |||
| 1985 | Ga0501083_0031075 | |||
| 1986 | Ga0501083_0123178 | |||
| 1987 | Ga0501280_000079 | |||
| 1988 | Ga0501282_000175 | |||
| 1989 | Ga0501035_0003154 | |||
| 1990 | Ga0501035_0124515 | |||
| 1991 | Ga0501044_0005761 | |||
| 1992 | Ga0501044_0026745 | |||
| 1993 | Ga0501044_0151903 | |||
| 1994 | Ga0501044_0255676 | |||
| 1995 | Ga0501044_0416253 | |||
| 1996 | Ga0501045_0001840 | |||
| 1997 | Ga0501045_0007052 | |||
| 1998 | Ga0501045_0010494 | |||
| 1999 | Ga0501045_0086403 | |||
| 2000 | nmdc:mga06r32_24033_c1 | |||
| 2001 | nmdc:mga06r32_73299_c1 | |||
| 2002 | Ga0495601_0003744 | |||
| 2003 | Ga0495619_0031028 | |||
| 2004 | Ga0500643_004659 | |||
| 2005 | Ga0500583_0024967 | |||
| 2006 | Ga0500583_0035173 | |||
| 2007 | Ga0500641_0052588 | |||
| 2008 | Ga0500650_0000012 | |||
| 2009 | Ga0500556_0018658 | |||
| 2010 | Ga0500559_0010723 | |||
| 2011 | Ga0500568_0009904 | |||
| 2012 | Ga0500568_0012982 | |||
| 2013 | Ga0500588_0017395 | |||
| 2014 | Ga0500616_0000032 | |||
| 2015 | Ga0500616_0021061 | |||
| 2016 | Ga0500616_0022716 | |||
| 2017 | Ga0500622_0000318 | |||
| 2018 | Ga0500622_0022558 | |||
| 2019 | Ga0500622_0023493 | |||
| 2020 | Ga0500636_0000154 | |||
| 2021 | Ga0500637_0013056 | |||
| 2022 | Ga0500637_0022087 | |||
| 2023 | Ga0500637_0140891 | |||
| 2024 | Ga0500625_018000 | |||
| 2025 | Ga0500645_000509 | |||
| 2026 | Ga0500656_001869 | |||
| 2027 | Ga0501084_0005557 | |||
| 2028 | Ga0501084_0027046 | |||
| 2029 | Ga0501084_0055548 | |||
| 2030 | Ga0501084_0068267 | |||
| 2031 | Ga0501084_0084474 | |||
| 2032 | Ga0501082_0000222 | |||
| 2033 | Ga0501082_0043846 | |||
| 2034 | Ga0501082_0080108 | |||
| 2035 | Ga0501082_0080646 | |||
| 2036 | Ga0530510_0008213 | |||
| 2037 | Ga0530510_0025506 | |||
| 2038 | 2511824167 | |||
| 2039 | 2599994562 | |||
| 2040 | 2624493029 | |||
| 2041 | 2643953834 | |||
| 2042 | 2644021768 | |||
| 2043 | 2644282527 | |||
| 2044 | 2644362658 | |||
| 2045 | 2738717088 | |||
| 2046 | 2794596844 | |||
| 2047 | 2808907836 | |||
| 2048 | 2819565338 | |||
| 2049 | 2860344263 | |||
| 2050 | 2884341053 | |||
| 2051 | 2904466632 | |||
| 2052 | 2919699695 | |||
| 2053 | 2923587925 | |||
| 2054 | 2928519654 | |||
| 2055 | 2931374613 | |||
| 2056 | 2931402994 | |||
| 2057 | 2939671757 | |||
| 2058 | 2941471806 | |||
| 2059 | 8019776034 | |||
| 2060 | 8033233660 | |||
| 2061 | 8054568167 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1cl0-assembly1.cif.gz_A | crystal structure of reduced thioredoxin reductase from escherichia coli. | 0.9583 | 2 | 315 |
| 7e52-assembly1.cif.gz_A-2 | acinetobacter baumannii thioredoxin reductase | 0.9579 | 3 | 315 |
| 1tdf-assembly1.cif.gz_A | crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis | 0.9556 | 2 | 315 |
| 1cl0-assembly1.cif.gz_A | crystal structure of reduced thioredoxin reductase from escherichia coli. | 0.9495 | 2 | 315 |
| 1tdf-assembly1.cif.gz_A | crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis | 0.9468 | 2 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5u63A02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9885 | 117 | 243 | 3.50.50.60 |
| 5u63A02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9809 | 117 | 243 | 3.50.50.60 |
| 3f8rD02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.976 | 117 | 243 | 3.50.50.60 |
| 3f8rD02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9678 | 117 | 243 | 3.50.50.60 |
| 4ykgA03 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9659 | 117 | 243 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E9VPB0-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9835 | 56 | 317 |
GO:0016668
|
| AF-A0A1H9IF96-F1-model_v4 | Thioredoxin reductase (EC 1.8.1.9) | 0.978 | 5 | 315 |
GO:0004791
GO:0005737 GO:0019430 |
| AF-A0A3A3FWL4-F1-model_v4 | Thioredoxin reductase (EC 1.8.1.9) | 0.9767 | 1 | 314 |
GO:0004791
GO:0005737 GO:0019430 |
| AF-A0A1E9VPB0-F1-model_v4 | Thioredoxin-disulfide reductase | 0.9762 | 56 | 317 |
GO:0016668
|
| AF-A0A812VGW4-F1-model_v4 | Thioredoxin reductase (EC 1.8.1.9) | 0.976 | 1 | 315 |
GO:0000155
GO:0004791 GO:0005737 GO:0016020 GO:0019430 |