F488605

General Info

Members Datasets Scaffolds Average Seq Length
1031 499 2062 166

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100031140|Ga0070713_1000311405
Length 191
Sequence MGRSRLLQSGVLPGTSTPRAMQGDGIISQMIETSPTCPRVGSPRGAPARWRRIRAAAAIALLCATLGGCLTGEQFQKGYILPPGALEQIPIGASQDQVLIVMGTPSTVATLNGEVFYYISQRSERPVAFMNQKVVDQRVIAIYFDKNRQVQRLANYGLQDGKIFDFISRTTPTSGQEMSYLTPLFKLLAFH

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
86 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
117 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
118 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
119 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
120 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
190 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
191 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
192 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
202 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
219 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
220 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
221 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
222 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
223 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
230 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
234 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
255 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
258 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
259 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
260 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
261 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
267 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
278 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
279 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
282 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
285 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
286 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
287 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
288 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
303 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
304 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
305 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
308 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
309 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
310 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
311 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
312 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
313 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
319 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
320 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
321 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
335 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
361 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
362 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
367 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
368 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
369 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
370 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
371 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
372 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
376 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
377 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
378 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
379 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
380 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
386 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
387 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
388 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
391 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
392 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
393 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
394 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
395 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
396 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
397 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
398 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
399 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
400 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
401 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
402 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
403 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
404 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
405 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
406 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
407 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
408 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
409 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
410 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
411 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
412 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
413 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
414 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
415 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
416 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
417 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
418 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
419 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
420 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
421 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
422 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
423 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
424 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
425 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
426 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
427 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
428 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
429 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
430 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
431 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
432 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
433 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
434 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
435 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
436 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
437 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
438 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
439 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
440 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
441 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
442 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
443 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
444 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
445 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
446 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
447 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
448 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
449 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
450 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
451 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
452 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
453 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
454 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
455 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
456 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
457 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
458 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
459 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
460 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
461 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
462 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
463 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
464 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
465 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
466 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
467 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
468 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
469 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
470 2904699407
471 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
472 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
473 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
474 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
475 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
476 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
477 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
478 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
479 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
480 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
481 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
482 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
483 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
484 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
485 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
486 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
487 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
488 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
489 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
490 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
491 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
492 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
493 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
494 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
495 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
496 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
497 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
498 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
499 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.2
Metatranscriptomes 0.19
Isolates 6.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.06
Nodule 5.04
Rhizoplane 5.14
Rhizosphere 70.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100031140 3300005436 Bacteria 4246
2 JGI24740J21852_10070463 3300001979 Bacteria 938
3 JGI24735J21928_10044897 3300002067 Bacteria 1284
4 JGI24750J21931_1026917 3300002070 Bacteria 830
5 JGI25153J46596_10005011 3300003215 Bacteria 7023
6 JGI25404J52841_10005727 3300003659 Bacteria 2572
7 JGI25404J52841_10011158 3300003659 Bacteria 1935
8 JGI25404J52841_10135865 3300003659 Bacteria 520
9 Ga0055531_10007161 3300003794 Bacteria 6142
10 Ga0065165_1010981 3300005262 Bacteria 3839
11 Ga0070658_10239457 3300005327 Bacteria 1538
12 Ga0070676_10094448 3300005328 Bacteria 1837
13 Ga0070683_100220944 3300005329 Bacteria 1801
14 Ga0070683_100301476 3300005329 Bacteria 1524
15 Ga0070683_101024038 3300005329 Bacteria 793
16 Ga0070690_100117460 3300005330 Bacteria 1782
17 Ga0070690_100404861 3300005330 Bacteria 1003
18 Ga0070690_100595493 3300005330 Bacteria 839
19 Ga0068869_100346811 3300005334 Bacteria 1209
20 Ga0070680_100083357 3300005336 Bacteria 2640
21 Ga0070680_100162579 3300005336 Bacteria 1876
22 Ga0070680_100372741 3300005336 Bacteria 1215
23 Ga0070682_100034408 3300005337 Bacteria 3086
24 Ga0070682_100392914 3300005337 Bacteria 1047
25 Ga0068868_100168503 3300005338 Bacteria 1812
26 Ga0068868_100653159 3300005338 Bacteria 937
27 Ga0070660_100099615 3300005339 Bacteria 2301
28 Ga0070660_100346871 3300005339 Bacteria 1222
29 Ga0070660_100517355 3300005339 Bacteria 994
30 Ga0070660_100649279 3300005339 Bacteria 884
31 Ga0070689_100253495 3300005340 Bacteria 1453
32 Ga0070689_100568645 3300005340 Bacteria 979
33 Ga0070691_10125140 3300005341 Bacteria 1298
34 Ga0070687_100530383 3300005343 Bacteria 798
35 Ga0070661_100065521 3300005344 Bacteria 2670
36 Ga0070661_100656740 3300005344 Bacteria 852
37 Ga0070661_100717168 3300005344 Bacteria 816
38 Ga0070668_100363642 3300005347 Bacteria 1227
39 Ga0070668_100397989 3300005347 Bacteria 1175
40 Ga0070675_100196040 3300005354 Bacteria 1752
41 Ga0070671_100097150 3300005355 Bacteria 2470
42 Ga0070674_100050504 3300005356 Bacteria 2863
43 Ga0070674_100315373 3300005356 Bacteria 1252
44 Ga0070673_100147480 3300005364 Bacteria 1990
45 Ga0070688_100288588 3300005365 Bacteria 1182
46 Ga0070667_100484616 3300005367 Bacteria 1132
47 Ga0070703_10050936 3300005406 Bacteria 1323
48 Ga0070709_10000814 3300005434 Bacteria 17403
49 Ga0070709_10011971 3300005434 Bacteria 4848
50 Ga0070709_10180509 3300005434 Bacteria 1482
51 Ga0070714_100018170 3300005435 Bacteria 5705
52 Ga0070714_100053554 3300005435 Bacteria 3445
53 Ga0070713_100005532 3300005436 Bacteria 8654
54 Ga0070710_10000766 3300005437 Bacteria 15325
55 Ga0070710_10002013 3300005437 Bacteria 9610
56 Ga0070710_10071677 3300005437 Bacteria 1999
57 Ga0070711_100018829 3300005439 Bacteria 4416
58 Ga0070708_100117564 3300005445 Bacteria 2449
59 Ga0070663_100074137 3300005455 Bacteria 2484
60 Ga0070663_100287348 3300005455 Bacteria 1312
61 Ga0070678_100012203 3300005456 Bacteria 5331
62 Ga0070678_100030444 3300005456 Bacteria 3710
63 Ga0070662_100180912 3300005457 Bacteria 1662
64 Ga0070662_100326999 3300005457 Bacteria 1251
65 Ga0070681_10038316 3300005458 Bacteria 4806
66 Ga0070681_10334290 3300005458 Bacteria 1424
67 Ga0070681_10446149 3300005458 Bacteria 1206
68 Ga0070681_10508912 3300005458 Bacteria 1117
69 Ga0068867_100071840 3300005459 Bacteria 2589
70 Ga0068867_100952322 3300005459 Bacteria 775
71 Ga0070706_100523153 3300005467 Bacteria 1103
72 Ga0070707_100110267 3300005468 Bacteria 2669
73 Ga0070698_100009493 3300005471 Bacteria 10421
74 Ga0070698_100642857 3300005471 Bacteria 1002
75 Ga0070699_100694317 3300005518 Bacteria 930
76 Ga0070679_100030520 3300005530 Bacteria 5321
77 Ga0070679_100394813 3300005530 Bacteria 1329
78 Ga0070679_100722492 3300005530 Bacteria 939
79 Ga0070684_100024950 3300005535 Bacteria 5019
80 Ga0070684_100213837 3300005535 Bacteria 1757
81 Ga0070684_100324299 3300005535 Bacteria 1415
82 Ga0070697_100181154 3300005536 Bacteria 1786
83 Ga0070697_100270438 3300005536 Bacteria 1457
84 Ga0068853_100006610 3300005539 Bacteria 9230
85 Ga0068853_100040318 3300005539 Bacteria 3984
86 Ga0068853_100070318 3300005539 Bacteria 3046
87 Ga0068853_100823560 3300005539 Bacteria 889
88 Ga0068853_101018060 3300005539 Bacteria 798
89 Ga0070686_100306494 3300005544 Bacteria 1179
90 Ga0070696_100086131 3300005546 Bacteria 2230
91 Ga0070693_100234238 3300005547 Bacteria 1210
92 Ga0070693_100242105 3300005547 Bacteria 1192
93 Ga0070693_100338144 3300005547 Bacteria 1027
94 Ga0070693_100673605 3300005547 Bacteria 755
95 Ga0070665_100013374 3300005548 Bacteria 8260
96 Ga0070665_100139727 3300005548 Bacteria 2425
97 Ga0070665_100447269 3300005548 Bacteria 1301
98 Ga0070665_100927098 3300005548 Bacteria 883
99 Ga0070665_101496051 3300005548 Bacteria 684
100 Ga0068855_100035310 3300005563 Bacteria 5955
101 Ga0068855_100116561 3300005563 Bacteria 3061
102 Ga0068855_100252708 3300005563 Bacteria 1966
103 Ga0068855_100687771 3300005563 Bacteria 1096
104 Ga0068855_101034331 3300005563 Bacteria 861
105 Ga0070664_101113871 3300005564 Bacteria 744
106 Ga0068857_100047034 3300005577 Bacteria 3830
107 Ga0068857_100171617 3300005577 Bacteria 1971
108 Ga0068857_100259191 3300005577 Bacteria 1595
109 Ga0068854_100086826 3300005578 Bacteria 2320
110 Ga0068854_100121085 3300005578 Bacteria 1986
111 Ga0068854_100197263 3300005578 Bacteria 1580
112 Ga0068854_100247327 3300005578 Bacteria 1422
113 Ga0068854_100380694 3300005578 Bacteria 1163
114 Ga0068856_100002728 3300005614 Bacteria 18074
115 Ga0068856_100006948 3300005614 Bacteria 11066
116 Ga0068856_100009830 3300005614 Bacteria 9291
117 Ga0068856_100050817 3300005614 Bacteria 4088
118 Ga0068856_100055304 3300005614 Bacteria 3916
119 Ga0068856_100084260 3300005614 Bacteria 3158
120 Ga0068856_100163028 3300005614 Bacteria 2240
121 Ga0068856_100539614 3300005614 Bacteria 1187
122 Ga0068852_100006331 3300005616 Bacteria 8540
123 Ga0068852_100057499 3300005616 Bacteria 3366
124 Ga0068852_100102548 3300005616 Bacteria 2585
125 Ga0068852_100141669 3300005616 Bacteria 2226
126 Ga0068852_100229273 3300005616 Bacteria 1770
127 Ga0068852_100500575 3300005616 Bacteria 1210
128 Ga0068852_100585780 3300005616 Bacteria 1119
129 Ga0068859_100373506 3300005617 Bacteria 1521
130 Ga0068859_100825266 3300005617 Bacteria 1014
131 Ga0068859_101448618 3300005617 Bacteria 758
132 Ga0068864_100007872 3300005618 Bacteria 8782
133 Ga0068864_100589705 3300005618 Bacteria 1078
134 Ga0068866_10059226 3300005718 Bacteria 1981
135 Ga0068861_100187739 3300005719 Bacteria 1725
136 Ga0068851_10064729 3300005834 Bacteria 1879
137 Ga0068851_10149013 3300005834 Bacteria 1278
138 Ga0068863_100022985 3300005841 Bacteria 5959
139 Ga0068863_100978124 3300005841 Bacteria 848
140 Ga0068858_100209905 3300005842 Bacteria 1843
141 Ga0068858_100220864 3300005842 Bacteria 1794
142 Ga0068858_100260645 3300005842 Bacteria 1648
143 Ga0068860_100000058 3300005843 Bacteria 197181
144 Ga0081455_10036644 3300005937 Bacteria 4364
145 Ga0081455_10071579 3300005937 Bacteria 2874
146 Ga0081455_10093901 3300005937 Bacteria 2424
147 Ga0081540_1002578 3300005983 Bacteria 14710
148 Ga0081540_1003795 3300005983 Bacteria 11825
149 Ga0081540_1010920 3300005983 Bacteria 6099
150 Ga0081540_1029209 3300005983 Bacteria 3077
151 Ga0081540_1030142 3300005983 Bacteria 3010
152 Ga0081540_1104243 3300005983 Bacteria 1214
153 Ga0081539_10000231 3300005985 Bacteria 131197
154 Ga0081539_10099315 3300005985 Bacteria 1487
155 Ga0081539_10164992 3300005985 Bacteria 1052
156 Ga0070717_10003916 3300006028 Bacteria 10717
157 Ga0070717_10091940 3300006028 Bacteria 2563
158 Ga0070717_10477246 3300006028 Bacteria 1126
159 Ga0070717_10849833 3300006028 Bacteria 830
160 Ga0070717_10997088 3300006028 Bacteria 763
161 Ga0075365_10144139 3300006038 Bacteria 1654
162 Ga0075368_10026610 3300006042 Bacteria 2225
163 Ga0075368_10108821 3300006042 Bacteria 1142
164 Ga0075363_100015801 3300006048 Bacteria 3718
165 Ga0075363_100298465 3300006048 Bacteria 935
166 Ga0075364_10093420 3300006051 Bacteria 1997
167 Ga0075364_10320340 3300006051 Bacteria 1056
168 Ga0075364_10561077 3300006051 Bacteria 780
169 Ga0070716_100003692 3300006173 Bacteria 7246
170 Ga0070716_100072180 3300006173 Bacteria 2032
171 Ga0070712_100040637 3300006175 Bacteria 3189
172 Ga0070712_100075668 3300006175 Bacteria 2422
173 Ga0070712_100076867 3300006175 Bacteria 2405
174 Ga0070712_100607983 3300006175 Bacteria 926
175 Ga0075362_10305097 3300006177 Bacteria 791
176 Ga0075367_10024577 3300006178 Bacteria 3399
177 Ga0075367_10032897 3300006178 Bacteria 2986
178 Ga0075367_10050395 3300006178 Bacteria 2458
179 Ga0075369_10098588 3300006186 Bacteria 1309
180 Ga0075369_10152075 3300006186 Bacteria 1058
181 Ga0075366_10025623 3300006195 Bacteria 3447
182 Ga0075366_10053358 3300006195 Bacteria 2401
183 Ga0075366_10336458 3300006195 Bacteria 925
184 Ga0075366_10588223 3300006195 Bacteria 690
185 Ga0075370_10032607 3300006353 Bacteria 2913
186 Ga0075370_10040764 3300006353 Bacteria 2620
187 Ga0075370_10069766 3300006353 Bacteria 2009
188 Ga0075370_10135132 3300006353 Bacteria 1440
189 Ga0075370_10171184 3300006353 Bacteria 1276
190 Ga0068871_100145782 3300006358 Bacteria 2015
191 Ga0068865_100049009 3300006881 Bacteria 2909
192 Ga0075436_100162628 3300006914 Bacteria 1574
193 Ga0097620_100373504 3300006931 Bacteria 1521
194 Ga0097620_100825277 3300006931 Bacteria 1014
195 Ga0097620_101448771 3300006931 Bacteria 758
196 Ga0099824_1010180 3300006942 Bacteria 11239
197 Ga0099822_1000628 3300006943 Bacteria 34929
198 Ga0075435_100255419 3300007076 Bacteria 1492
199 Ga0105250_10267511 3300009092 Bacteria 733
200 Ga0105240_10002351 3300009093 Bacteria 30510
201 Ga0105240_10016661 3300009093 Bacteria 9941
202 Ga0105240_10114561 3300009093 Bacteria 3257
203 Ga0105240_10375863 3300009093 Bacteria 1606
204 Ga0111539_11956589 3300009094 Bacteria 680
205 Ga0105245_10220323 3300009098 Bacteria 1830
206 Ga0105245_10638444 3300009098 Bacteria 1094
207 Ga0105247_10053945 3300009101 Bacteria 2480
208 Ga0105243_10026993 3300009148 Bacteria 4397
209 Ga0105241_10009864 3300009174 Bacteria 7018
210 Ga0105241_10025759 3300009174 Bacteria 4372
211 Ga0105241_10239860 3300009174 Bacteria 1532
212 Ga0105241_10471031 3300009174 Bacteria 1115
213 Ga0105241_10504639 3300009174 Bacteria 1079
214 Ga0105242_10691852 3300009176 Bacteria 996
215 Ga0105248_10219140 3300009177 Bacteria 2143
216 Ga0105237_10005556 3300009545 Bacteria 14219
217 Ga0105237_10049350 3300009545 Bacteria 4231
218 Ga0105237_10064509 3300009545 Bacteria 3659
219 Ga0105237_10159230 3300009545 Bacteria 2255
220 Ga0105237_10205574 3300009545 Bacteria 1969
221 Ga0105237_10676546 3300009545 Bacteria 1039
222 Ga0105238_10002811 3300009551 Bacteria 17365
223 Ga0105238_10012890 3300009551 Bacteria 8437
224 Ga0105238_10029984 3300009551 Bacteria 5537
225 Ga0105238_10089121 3300009551 Bacteria 3072
226 Ga0105238_10166380 3300009551 Bacteria 2181
227 Ga0105238_11316535 3300009551 Bacteria 749
228 Ga0105249_10287455 3300009553 Bacteria 1644
229 Ga0105249_10525060 3300009553 Bacteria 1232
230 Ga0105249_10577942 3300009553 Bacteria 1177
231 Ga0099796_10165062 3300010159 Bacteria 880
232 Ga0105239_10042814 3300010375 Bacteria 4962
233 Ga0105239_10149955 3300010375 Bacteria 2602
234 Ga0105239_10182089 3300010375 Bacteria 2351
235 Ga0105239_10948266 3300010375 Bacteria 988
236 Ga0105246_10017342 3300011119 Bacteria 4575
237 Ga0105246_10037124 3300011119 Bacteria 3268
238 Ga0157341_1006635 3300012494 Bacteria 902
239 Ga0157370_10086076 3300013104 Bacteria 2953
240 Ga0157370_10136125 3300013104 Bacteria 2289
241 Ga0157369_10006882 3300013105 Bacteria 13122
242 Ga0157369_10061176 3300013105 Bacteria 4060
243 Ga0157369_10371627 3300013105 Bacteria 1484
244 Ga0157374_10490957 3300013296 Bacteria 1232
245 Ga0157378_10215669 3300013297 Bacteria 1822
246 Ga0163162_10231677 3300013306 Bacteria 1977
247 Ga0163162_10285062 3300013306 Bacteria 1783
248 Ga0163162_10526893 3300013306 Bacteria 1311
249 Ga0157372_10055769 3300013307 Bacteria 4414
250 Ga0157372_10594922 3300013307 Bacteria 1289
251 Ga0157372_10621543 3300013307 Bacteria 1259
252 Ga0157372_10899318 3300013307 Bacteria 1027
253 Ga0157372_11328575 3300013307 Bacteria 829
254 Ga0157375_10044534 3300013308 Bacteria 4312
255 Ga0157375_10214507 3300013308 Bacteria 2082
256 Ga0157375_10478137 3300013308 Bacteria 1411
257 Ga0163163_10042480 3300014325 Bacteria 4453
258 Ga0163163_10293527 3300014325 Bacteria 1678
259 Ga0157379_10103216 3300014968 Bacteria 2558
260 Ga0157376_10009356 3300014969 Bacteria 7120
261 Ga0157376_10351401 3300014969 Bacteria 1411
262 Ga0157376_10513207 3300014969 Bacteria 1180
263 Ga0157376_10977368 3300014969 Bacteria 868
264 Ga0206354_11538885 3300020081 Bacteria 1236
265 Ga0206353_11968516 3300020082 Bacteria 913
266 Ga0214544_1000009 3300021320 Bacteria 285865
267 Ga0214542_1000002 3300021321 Bacteria 720798
268 Ga0214545_1000002 3300021324 Bacteria 727485
269 Ga0214543_1000013 3300021327 Bacteria 329117
270 Ga0213872_10284224 3300021361 Bacteria 690
271 Ga0213876_10305914 3300021384 Bacteria 845
272 Ga0209677_101611 3300025253 Bacteria 9518
273 Ga0209233_1006609 3300025261 Bacteria 3724
274 Ga0209455_1002229 3300025272 Bacteria 7636
275 Ga0207673_1012601 3300025290 Bacteria 1104
276 Ga0209758_1001125 3300025297 Bacteria 34352
277 Ga0209758_1009234 3300025297 Bacteria 6184
278 Ga0209257_1028631 3300025304 Bacteria 1830
279 Ga0207697_10238837 3300025315 Bacteria 803
280 Ga0207656_10024925 3300025321 Bacteria 2424
281 Ga0207656_10055141 3300025321 Bacteria 1729
282 Ga0207653_10065922 3300025885 Bacteria 1230
283 Ga0207692_10001752 3300025898 Bacteria 8233
284 Ga0207692_10005509 3300025898 Bacteria 5078
285 Ga0207642_10048621 3300025899 Bacteria 1902
286 Ga0207688_10002338 3300025901 Bacteria 10187
287 Ga0207688_10052823 3300025901 Bacteria 2278
288 Ga0207680_10274826 3300025903 Bacteria 1169
289 Ga0207680_10677767 3300025903 Bacteria 739
290 Ga0207647_10011930 3300025904 Bacteria 6068
291 Ga0207685_10074666 3300025905 Bacteria 1385
292 Ga0207699_10002559 3300025906 Bacteria 8579
293 Ga0207699_10143709 3300025906 Bacteria 1571
294 Ga0207699_10215811 3300025906 Bacteria 1307
295 Ga0207645_10047651 3300025907 Bacteria 2737
296 Ga0207645_10150153 3300025907 Bacteria 1521
297 Ga0207643_10006512 3300025908 Bacteria 6255
298 Ga0207684_10338263 3300025910 Bacteria 1296
299 Ga0207654_10000968 3300025911 Bacteria 15767
300 Ga0207654_10008714 3300025911 Bacteria 5143
301 Ga0207654_10167707 3300025911 Bacteria 1423
302 Ga0207654_10454345 3300025911 Bacteria 899
303 Ga0207707_10004344 3300025912 Bacteria 12544
304 Ga0207707_10022114 3300025912 Bacteria 5559
305 Ga0207707_10041877 3300025912 Bacteria 3999
306 Ga0207707_10120934 3300025912 Bacteria 2289
307 Ga0207707_10121544 3300025912 Bacteria 2283
308 Ga0207695_10000278 3300025913 Bacteria 127446
309 Ga0207695_10003702 3300025913 Bacteria 21304
310 Ga0207695_10042990 3300025913 Bacteria 4819
311 Ga0207695_10073482 3300025913 Bacteria 3484
312 Ga0207695_10117566 3300025913 Bacteria 2631
313 Ga0207695_10320641 3300025913 Bacteria 1439
314 Ga0207671_10005180 3300025914 Bacteria 12117
315 Ga0207671_10024084 3300025914 Bacteria 4582
316 Ga0207671_10034231 3300025914 Bacteria 3776
317 Ga0207671_10122118 3300025914 Bacteria 1992
318 Ga0207671_10219494 3300025914 Bacteria 1489
319 Ga0207671_10297480 3300025914 Bacteria 1275
320 Ga0207671_10651427 3300025914 Bacteria 839
321 Ga0207671_10887377 3300025914 Bacteria 705
322 Ga0207693_10019182 3300025915 Bacteria 5442
323 Ga0207693_10029736 3300025915 Bacteria 4312
324 Ga0207693_10961866 3300025915 Bacteria 653
325 Ga0207663_10006350 3300025916 Bacteria 6042
326 Ga0207663_10539421 3300025916 Bacteria 911
327 Ga0207663_10848597 3300025916 Bacteria 729
328 Ga0207660_10019474 3300025917 Bacteria 4537
329 Ga0207660_10055543 3300025917 Bacteria 2830
330 Ga0207660_10237183 3300025917 Bacteria 1436
331 Ga0207662_10001714 3300025918 Bacteria 10736
332 Ga0207662_10051728 3300025918 Bacteria 2444
333 Ga0207657_10095539 3300025919 Bacteria 2473
334 Ga0207657_10400965 3300025919 Bacteria 1079
335 Ga0207652_10010300 3300025921 Bacteria 7526
336 Ga0207652_10016438 3300025921 Bacteria 6042
337 Ga0207652_10025314 3300025921 Bacteria 4932
338 Ga0207652_10062600 3300025921 Bacteria 3215
339 Ga0207646_10141577 3300025922 Bacteria 2167
340 Ga0207694_10001639 3300025924 Bacteria 18837
341 Ga0207694_10008346 3300025924 Bacteria 7829
342 Ga0207694_10090314 3300025924 Bacteria 2417
343 Ga0207694_10135367 3300025924 Bacteria 1978
344 Ga0207694_10161031 3300025924 Bacteria 1812
345 Ga0207694_10208163 3300025924 Bacteria 1593
346 Ga0207694_10546820 3300025924 Bacteria 972
347 Ga0207650_11004332 3300025925 Bacteria 710
348 Ga0207687_10032431 3300025927 Bacteria 3538
349 Ga0207687_10476443 3300025927 Bacteria 1039
350 Ga0207687_10492637 3300025927 Bacteria 1022
351 Ga0207687_10864379 3300025927 Bacteria 773
352 Ga0207700_10027152 3300025928 Bacteria 4004
353 Ga0207700_10041009 3300025928 Bacteria 3383
354 Ga0207700_10104431 3300025928 Bacteria 2267
355 Ga0207700_10164085 3300025928 Bacteria 1847
356 Ga0207700_10258994 3300025928 Bacteria 1489
357 Ga0207700_10472986 3300025928 Bacteria 1107
358 Ga0207664_10045700 3300025929 Bacteria 3435
359 Ga0207644_10074379 3300025931 Bacteria 2493
360 Ga0207644_10542107 3300025931 Bacteria 962
361 Ga0207644_10875510 3300025931 Bacteria 752
362 Ga0207690_10135787 3300025932 Bacteria 1806
363 Ga0207706_10113863 3300025933 Bacteria 2379
364 Ga0207706_10140630 3300025933 Bacteria 2123
365 Ga0207706_10187062 3300025933 Bacteria 1818
366 Ga0207706_10398482 3300025933 Bacteria 1193
367 Ga0207706_10888945 3300025933 Bacteria 753
368 Ga0207709_10032468 3300025935 Bacteria 3057
369 Ga0207709_10077357 3300025935 Bacteria 2133
370 Ga0207670_10972371 3300025936 Bacteria 713
371 Ga0207669_10011218 3300025937 Bacteria 4352
372 Ga0207669_10161329 3300025937 Bacteria 1584
373 Ga0207704_10184354 3300025938 Bacteria 1511
374 Ga0207665_10058127 3300025939 Bacteria 2614
375 Ga0207665_10087672 3300025939 Bacteria 2151
376 Ga0207665_10171079 3300025939 Bacteria 1569
377 Ga0207665_10329272 3300025939 Bacteria 1148
378 Ga0207691_10042708 3300025940 Bacteria 4178
379 Ga0207691_10260187 3300025940 Bacteria 1496
380 Ga0207711_10308200 3300025941 Bacteria 1461
381 Ga0207711_11238013 3300025941 Bacteria 688
382 Ga0207689_10095548 3300025942 Bacteria 2441
383 Ga0207661_10017104 3300025944 Bacteria 5358
384 Ga0207661_10186991 3300025944 Bacteria 1813
385 Ga0207661_11014870 3300025944 Bacteria 764
386 Ga0207679_10894640 3300025945 Bacteria 812
387 Ga0207667_10043177 3300025949 Bacteria 4785
388 Ga0207667_10045339 3300025949 Bacteria 4657
389 Ga0207667_10116225 3300025949 Bacteria 2757
390 Ga0207667_10498658 3300025949 Bacteria 1235
391 Ga0207667_10906327 3300025949 Bacteria 873
392 Ga0207651_10109154 3300025960 Bacteria 2072
393 Ga0207651_10314966 3300025960 Bacteria 1306
394 Ga0207651_10805219 3300025960 Bacteria 833
395 Ga0207712_10092332 3300025961 Bacteria 2232
396 Ga0207668_10063562 3300025972 Bacteria 2604
397 Ga0207640_10066703 3300025981 Bacteria 2405
398 Ga0207640_10548566 3300025981 Bacteria 971
399 Ga0207640_10679866 3300025981 Bacteria 880
400 Ga0207640_10886821 3300025981 Bacteria 778
401 Ga0207658_10408125 3300025986 Bacteria 1195
402 Ga0207677_10149600 3300026023 Bacteria 1799
403 Ga0207677_11129860 3300026023 Bacteria 715
404 Ga0207703_10041355 3300026035 Bacteria 3692
405 Ga0207703_10146969 3300026035 Bacteria 2051
406 Ga0207703_10354173 3300026035 Bacteria 1352
407 Ga0207703_10798964 3300026035 Bacteria 901
408 Ga0207639_10006291 3300026041 Bacteria 8064
409 Ga0207639_10019559 3300026041 Bacteria 4831
410 Ga0207639_10045790 3300026041 Bacteria 3297
411 Ga0207639_10229558 3300026041 Bacteria 1608
412 Ga0207678_10043525 3300026067 Bacteria 3885
413 Ga0207678_10054200 3300026067 Bacteria 3453
414 Ga0207678_10087237 3300026067 Bacteria 2667
415 Ga0207678_10160060 3300026067 Bacteria 1923
416 Ga0207678_10185279 3300026067 Bacteria 1778
417 Ga0207678_10227723 3300026067 Bacteria 1596
418 Ga0207708_10004954 3300026075 Bacteria 9817
419 Ga0207702_10000005 3300026078 Bacteria 420296
420 Ga0207702_10000178 3300026078 Bacteria 76683
421 Ga0207702_10027968 3300026078 Bacteria 4685
422 Ga0207702_10067559 3300026078 Bacteria 3068
423 Ga0207702_10070749 3300026078 Bacteria 3001
424 Ga0207702_10272486 3300026078 Bacteria 1597
425 Ga0207702_11062335 3300026078 Bacteria 803
426 Ga0207641_10157159 3300026088 Bacteria 2064
427 Ga0207641_11016159 3300026088 Bacteria 826
428 Ga0207648_10076745 3300026089 Bacteria 2913
429 Ga0207648_11309995 3300026089 Bacteria 681
430 Ga0207676_10947386 3300026095 Bacteria 846
431 Ga0207674_10024477 3300026116 Bacteria 6452
432 Ga0207675_100043261 3300026118 Bacteria 4206
433 Ga0207675_100110343 3300026118 Bacteria 2595
434 Ga0207675_100178189 3300026118 Bacteria 2034
435 Ga0207675_102359260 3300026118 Bacteria 545
436 Ga0207683_10023473 3300026121 Bacteria 5307
437 Ga0207683_10048974 3300026121 Bacteria 3698
438 Ga0207683_10147852 3300026121 Bacteria 2120
439 Ga0207698_10002333 3300026142 Bacteria 11239
440 Ga0207698_10160972 3300026142 Bacteria 1963
441 Ga0207698_10185779 3300026142 Bacteria 1846
442 Ga0207698_10248303 3300026142 Bacteria 1626
443 Ga0207698_10290591 3300026142 Bacteria 1517
444 Ga0207698_10342758 3300026142 Bacteria 1408
445 Ga0207698_10452135 3300026142 Bacteria 1240
446 Ga0209589_1000023 3300027357 Bacteria 177856
447 Ga0209489_100032 3300027361 Bacteria 177856
448 Ga0209700_100040 3300027363 Bacteria 177856
449 Ga0209813_10055693 3300027866 Bacteria 1250
450 Ga0207428_10063792 3300027907 Bacteria 2910
451 Ga0268266_10003342 3300028379 Bacteria 16063
452 Ga0268266_10006607 3300028379 Bacteria 10586
453 Ga0268266_10104930 3300028379 Bacteria 2496
454 Ga0268266_10129995 3300028379 Bacteria 2251
455 Ga0268266_10400565 3300028379 Bacteria 1297
456 Ga0268265_10051933 3300028380 Bacteria 3097
457 Ga0268265_10090144 3300028380 Bacteria 2448
458 Ga0268265_10397904 3300028380 Bacteria 1272
459 Ga0268265_10927663 3300028380 Bacteria 856
460 Ga0268264_10000022 3300028381 Bacteria 476624
461 Ga0265334_10038040 3300028573 Bacteria 1895
462 Ga0307517_10005009 3300028786 Bacteria 20143
463 Ga0307515_10360792 3300028794 Bacteria 1094
464 Ga0307515_10465256 3300028794 Bacteria 878
465 Ga0265338_10011282 3300028800 Bacteria 10340
466 Ga0265324_10075378 3300029957 Bacteria 1148
467 Ga0307511_10049942 3300030521 Bacteria 3376
468 Ga0265332_10010231 3300031238 Bacteria 4176
469 Ga0265332_10041790 3300031238 Bacteria 1983
470 Ga0265332_10091618 3300031238 Bacteria 1285
471 Ga0265328_10031272 3300031239 Bacteria 1979
472 Ga0265325_10042863 3300031241 Bacteria 2363
473 Ga0265325_10055000 3300031241 Bacteria 2036
474 Ga0265340_10035821 3300031247 Bacteria 2462
475 Ga0265339_10000066 3300031249 Bacteria 91908
476 Ga0265339_10064959 3300031249 Bacteria 1957
477 Ga0265331_10012784 3300031250 Bacteria 4535
478 Ga0265331_10166934 3300031250 Bacteria 997
479 Ga0265316_10257402 3300031344 Bacteria 1280
480 Ga0307509_10510207 3300031507 Bacteria 885
481 Ga0307509_10555870 3300031507 Bacteria 825
482 Ga0307509_10588347 3300031507 Bacteria 786
483 Ga0265313_10002033 3300031595 Bacteria 18144
484 Ga0307508_10000009 3300031616 Bacteria 256966
485 Ga0307508_10038432 3300031616 Bacteria 4303
486 Ga0307508_10190796 3300031616 Bacteria 1650
487 Ga0265314_10029611 3300031711 Bacteria 4066
488 Ga0265314_10158677 3300031711 Bacteria 1379
489 Ga0307516_10011105 3300031730 Bacteria 9834
490 Ga0307516_10086685 3300031730 Bacteria 2966
491 Ga0307416_100699828 3300032002 Bacteria 1102
492 Ga0307416_100938635 3300032002 Bacteria 967
493 Ga0307414_10871574 3300032004 Bacteria 824
494 Ga0307415_100050285 3300032126 Bacteria 2823
495 Ga0307507_10025380 3300033179 Bacteria 6430
496 Ga0307510_10008758 3300033180 Bacteria 12062
497 Ga0307510_10053344 3300033180 Bacteria 4251
498 Ga0307510_10095668 3300033180 Bacteria 2789
499 Ga0307510_10161379 3300033180 Bacteria 1838
500 Ga0315911_1000001 3300033442 Bacteria 1088602
501 Ga0316215_1000469 3300033544 Bacteria 4618
502 Ga0373930_0152237 3300034816 Bacteria 581
503 Ga0373950_0091029 3300034818 Bacteria 648
504 Ga0373926_0037844 3300035083 Bacteria 1717
505 Ga0373934_0014733 3300035086 Bacteria 2962
506 Ga0373923_0020753 3300035111 Bacteria 2556
507 Ga0373923_0028095 3300035111 Bacteria 2248
508 Ga0373923_0205205 3300035111 Bacteria 912
509 Ga0373932_0264813 3300035112 Bacteria 631
510 Ga0373936_0011983 3300035113 Bacteria 3291
511 Ga0373936_0089961 3300035113 Bacteria 1286
512 Ga0373945_0005636 3300035116 Bacteria 4014
513 Ga0373953_0000171 3300035117 Bacteria 17129
514 Ga0373953_0049065 3300035117 Bacteria 1702
515 Ga0373954_0001704 3300035118 Bacteria 9020
516 Ga0373956_0024416 3300035119 Bacteria 2604
517 Ga0373957_0000100 3300035120 Bacteria 20828
518 Ga0373957_0058441 3300035120 Bacteria 1490
519 Ga0373960_0329036 3300035121 Bacteria 575
520 Ga0373943_0028011 3300035170 Bacteria 2652
521 Ga0373943_0225514 3300035170 Bacteria 1045
522 Ga0373946_0003172 3300035171 Bacteria 5826
523 Ga0373955_0001365 3300035172 Bacteria 10370
524 Ga0373955_0032088 3300035172 Bacteria 2754
525 Ga0373931_0064956 3300035691 Bacteria 1977
526 Ga0373935_0003830 3300035692 Bacteria 8772
527 Ga0373935_0075594 3300035692 Bacteria 2179
528 Ga0373935_0076730 3300035692 Bacteria 2164
529 Ga0373935_0201660 3300035692 Bacteria 1375
530 Ga0373935_0720647 3300035692 Bacteria 734
531 Ga0373927_0000069 3300035695 Bacteria 74096
532 Ga0373927_0050140 3300035695 Bacteria 2698
533 Ga0373927_0058242 3300035695 Bacteria 2498
534 Ga0373927_0067439 3300035695 Bacteria 2315
535 Ga0373933_0000781 3300035724 Bacteria 19421
536 Ga0373933_0002823 3300035724 Bacteria 9705
537 Ga0373933_0546546 3300035724 Bacteria 760
538 Ga0373947_0008029 3300035725 Bacteria 6088
539 Ga0373947_0012802 3300035725 Bacteria 4808
540 Ga0373947_0034922 3300035725 Bacteria 2975
541 Ga0373947_0500833 3300035725 Bacteria 825
542 Ga0373937_0007517 3300036401 Bacteria 9432
543 Ga0373937_0061733 3300036401 Bacteria 3445
544 Ga0373937_0150934 3300036401 Bacteria 2176
545 Ga0373937_0233024 3300036401 Bacteria 1734
546 Ga0373925_0003396 3300037068 Bacteria 12347
547 Ga0373925_0016611 3300037068 Bacteria 5332
548 Ga0373925_0035208 3300037068 Bacteria 3693
549 Ga0395899_0082407 3300037312 Bacteria 2340
550 Ga0395900_0000860 3300037418 Bacteria 40028
551 Ga0395900_0084203 3300037418 Bacteria 3267
552 Ga0395900_0268294 3300037418 Bacteria 1702
553 Ga0395900_0342245 3300037418 Bacteria 1471
554 Ga0395900_1035212 3300037418 Bacteria 740
555 Ga0395898_0032210 3300037466 Bacteria 5232
556 Ga0395898_0099348 3300037466 Bacteria 2795
557 Ga0395898_0148062 3300037466 Bacteria 2247
558 Ga0395898_0208224 3300037466 Bacteria 1866
559 Ga0395898_0308246 3300037466 Bacteria 1510
560 Ga0395905_0197051 3300037471 Bacteria 1888
561 Ga0395905_0385734 3300037471 Bacteria 1295
562 Ga0395905_0780805 3300037471 Bacteria 858
563 Ga0436364_0066298 3300037853 Bacteria 1971
564 Ga0395901_0041679 3300038443 Bacteria 4759
565 Ga0395901_0092102 3300038443 Bacteria 3173
566 Ga0395901_0444175 3300038443 Bacteria 1327
567 Ga0395901_0896152 3300038443 Bacteria 869
568 Ga0436365_0353234 3300039437 Bacteria 2668
569 Ga0436365_1305911 3300039437 Bacteria 901
570 Ga0436360_1275075 3300039438 Bacteria 670
571 Ga0436360_1278402 3300039438 Bacteria 3589
572 Ga0436361_0305956 3300039447 Bacteria 1898
573 Ga0436361_0472856 3300039447 Bacteria 1649
574 Ga0436363_0184448 3300039450 Bacteria 754
575 Ga0436363_0607928 3300039450 Bacteria 1051
576 Ga0436363_0694729 3300039450 Bacteria 722
577 Ga0436362_0352029 3300039453 Bacteria 1081
578 Ga0436362_0920921 3300039453 Bacteria 617
579 Ga0436362_1022971 3300039453 Bacteria 640
580 Ga0439465_0170381 3300041413 Bacteria 784
581 Ga0451791_0809607 3300041451 Bacteria 545
582 Ga0451793_0170774 3300041452 Bacteria 857
583 Ga0451800_1456892 3300041459 Bacteria 797
584 Ga0451802_1071351 3300041460 Bacteria 540
585 Ga0451804_0302326 3300041463 Bacteria 812
586 Ga0451853_0473357 3300041512 Bacteria 1592
587 Ga0466972_0129401 3300044658 Bacteria 1189
588 Ga0466963_0177299 3300044694 Bacteria 1487
589 Ga0466964_0138432 3300044706 Bacteria 1116
590 Ga0466957_0351794 3300044842 Bacteria 1000
591 Ga0466957_0531114 3300044842 Bacteria 818
592 Ga0466960_0500849 3300044901 Bacteria 712
593 Ga0466959_0167491 3300045049 Bacteria 1542
594 Ga0466958_0102701 3300045836 Bacteria 1779
595 Ga0466967_0031972 3300045976 Bacteria 4438
596 Ga0466967_0044464 3300045976 Bacteria 3853
597 Ga0466967_0287806 3300045976 Bacteria 1578
598 Ga0466967_0667046 3300045976 Bacteria 1029
599 Ga0495592_0000890 3300046454 Bacteria 20716
600 Ga0495592_0011137 3300046454 Bacteria 6792
601 Ga0495592_0217289 3300046454 Bacteria 1280
602 Ga0495603_0001909 3300046455 Bacteria 12296
603 Ga0495603_0014989 3300046455 Bacteria 4687
604 Ga0495603_0019319 3300046455 Bacteria 4124
605 Ga0495603_0057286 3300046455 Bacteria 2306
606 Ga0495603_0076075 3300046455 Bacteria 1970
607 Ga0495629_0000083 3300046459 Bacteria 83715
608 Ga0495629_0001665 3300046459 Bacteria 17436
609 Ga0495629_0093534 3300046459 Bacteria 2098
610 Ga0495629_0152215 3300046459 Bacteria 1608
611 Ga0495638_0344159 3300046460 Bacteria 789
612 Ga0495641_0154902 3300046461 Bacteria 1025
613 Ga0495651_0004120 3300046462 Bacteria 11129
614 Ga0495653_0000905 3300046463 Bacteria 22949
615 Ga0495653_0065868 3300046463 Bacteria 2726
616 Ga0495580_0001769 3300046472 Bacteria 18986
617 Ga0495580_0041958 3300046472 Bacteria 3261
618 Ga0495580_0515331 3300046472 Bacteria 797
619 Ga0495582_0000206 3300046473 Bacteria 32664
620 Ga0495582_0045731 3300046473 Bacteria 2411
621 Ga0495582_0320920 3300046473 Bacteria 891
622 Ga0495639_0000167 3300046475 Bacteria 34509
623 Ga0495639_0034070 3300046475 Bacteria 2277
624 Ga0495639_0158236 3300046475 Bacteria 1095
625 Ga0495639_0349181 3300046475 Bacteria 743
626 Ga0495662_0000457 3300046476 Bacteria 18414
627 Ga0495662_0028582 3300046476 Bacteria 2692
628 Ga0495664_0049306 3300046477 Bacteria 2499
629 Ga0495664_0079556 3300046477 Bacteria 1964
630 Ga0495664_0120092 3300046477 Bacteria 1590
631 Ga0495664_0129718 3300046477 Bacteria 1526
632 Ga0495594_0000838 3300046499 Bacteria 15872
633 Ga0495594_0308187 3300046499 Bacteria 902
634 Ga0495607_0254486 3300046501 Bacteria 844
635 Ga0495606_0028639 3300046507 Bacteria 3925
636 Ga0495606_0190269 3300046507 Bacteria 1177
637 Ga0495608_0005206 3300046511 Bacteria 9295
638 Ga0495610_0029532 3300046512 Bacteria 2885
639 Ga0495618_0053488 3300046514 Bacteria 2553
640 Ga0495618_0124131 3300046514 Bacteria 1653
641 Ga0495628_0013690 3300046516 Bacteria 6816
642 Ga0495628_0046174 3300046516 Bacteria 3460
643 Ga0495628_0106349 3300046516 Bacteria 2161
644 Ga0495628_0250064 3300046516 Bacteria 1324
645 Ga0495628_0337733 3300046516 Bacteria 1109
646 Ga0495630_0015598 3300046517 Bacteria 5552
647 Ga0495630_0286703 3300046517 Bacteria 1258
648 Ga0495631_0042197 3300046518 Bacteria 2016
649 Ga0495631_0204855 3300046518 Bacteria 843
650 Ga0495644_0215235 3300046523 Bacteria 742
651 Ga0495648_0000160 3300046524 Bacteria 80523
652 Ga0495648_0063615 3300046524 Bacteria 2177
653 Ga0495648_0114382 3300046524 Bacteria 1462
654 Ga0495648_0296543 3300046524 Bacteria 759
655 Ga0495666_0116057 3300046526 Bacteria 1256
656 Ga0495652_0006710 3300046529 Bacteria 10684
657 Ga0495652_0086209 3300046529 Bacteria 2579
658 Ga0495665_0000399 3300046531 Bacteria 22087
659 Ga0495665_0094511 3300046531 Bacteria 1570
660 Ga0495640_0002380 3300046533 Bacteria 15099
661 Ga0495640_0006041 3300046533 Bacteria 9605
662 Ga0495640_0022858 3300046533 Bacteria 4565
663 Ga0495587_0001761 3300046536 Bacteria 14465
664 Ga0495597_0108630 3300046542 Bacteria 1165
665 Ga0495645_0011866 3300046543 Bacteria 6139
666 Ga0495645_0099796 3300046543 Bacteria 2065
667 Ga0495622_0031543 3300046557 Bacteria 2476
668 Ga0495622_0117268 3300046557 Bacteria 1217
669 Ga0495622_0157988 3300046557 Bacteria 1023
670 Ga0495667_0008194 3300046559 Bacteria 7092
671 Ga0495667_0023917 3300046559 Bacteria 4115
672 Ga0495667_0323080 3300046559 Bacteria 976
673 Ga0495668_0079059 3300046616 Bacteria 1805
674 Ga0495668_0214909 3300046616 Bacteria 1053
675 Ga0495668_0218941 3300046616 Bacteria 1042
676 Ga0495668_0356803 3300046616 Bacteria 802
677 Ga0495668_0657920 3300046616 Bacteria 579
678 Ga0495634_0001116 3300046642 Bacteria 24891
679 Ga0495634_0033261 3300046642 Bacteria 3543
680 Ga0495634_0068117 3300046642 Bacteria 2352
681 Ga0495634_0317379 3300046642 Bacteria 939
682 Ga0495611_0028869 3300046648 Bacteria 2431
683 Ga0495611_0103977 3300046648 Bacteria 1320
684 Ga0495611_0150371 3300046648 Bacteria 1087
685 Ga0495625_0196711 3300046660 Bacteria 1333
686 Ga0495625_0323566 3300046660 Bacteria 981
687 Ga0495625_0346200 3300046660 Bacteria 940
688 Ga0495635_0001363 3300046663 Bacteria 16259
689 Ga0495635_0008724 3300046663 Bacteria 7079
690 Ga0495635_1027362 3300046663 Bacteria 524
691 Ga0495588_0009937 3300046674 Bacteria 4411
692 Ga0495588_0082817 3300046674 Bacteria 1676
693 Ga0495657_0001869 3300046675 Bacteria 17925
694 Ga0495657_0111900 3300046675 Bacteria 1729
695 Ga0495599_0005931 3300046678 Bacteria 7346
696 Ga0495599_0031077 3300046678 Bacteria 3352
697 Ga0495623_0001546 3300046679 Bacteria 15532
698 Ga0495646_0002015 3300046680 Bacteria 12296
699 Ga0495646_0007314 3300046680 Bacteria 7014
700 Ga0495646_0015020 3300046680 Bacteria 4918
701 Ga0495647_0001461 3300046681 Bacteria 7327
702 Ga0495647_0036068 3300046681 Bacteria 1860
703 Ga0495658_0003680 3300046683 Bacteria 7585
704 Ga0495658_0036491 3300046683 Bacteria 2712
705 Ga0495658_0252632 3300046683 Bacteria 1109
706 Ga0495658_0587486 3300046683 Bacteria 713
707 Ga0495669_0016655 3300046684 Bacteria 3149
708 Ga0495669_0081447 3300046684 Bacteria 1486
709 Ga0495669_0524853 3300046684 Bacteria 576
710 Ga0495613_0002852 3300046689 Bacteria 12940
711 Ga0495613_0114270 3300046689 Bacteria 1943
712 Ga0495624_0000096 3300046690 Bacteria 59307
713 Ga0495624_0055814 3300046690 Bacteria 2487
714 Ga0495624_0093725 3300046690 Bacteria 1851
715 Ga0495670_0059936 3300046691 Bacteria 1911
716 Ga0495670_0238612 3300046691 Bacteria 968
717 Ga0495670_0270909 3300046691 Bacteria 907
718 Ga0495589_0185678 3300046794 Bacteria 985
719 Ga0495589_0400030 3300046794 Bacteria 630
720 Ga0495600_0000380 3300046809 Bacteria 23025
721 Ga0495660_0073144 3300046810 Bacteria 1814
722 Ga0495581_0000311 3300047315 Bacteria 23901
723 Ga0495581_0106091 3300047315 Bacteria 1633
724 Ga0495581_0424159 3300047315 Bacteria 775
725 Ga0495604_0003890 3300047317 Bacteria 11888
726 Ga0495604_0073297 3300047317 Bacteria 2585
727 Ga0495604_0216048 3300047317 Bacteria 1323
728 Ga0495604_0444889 3300047317 Bacteria 847
729 Ga0495674_0007643 3300047319 Bacteria 10324
730 Ga0495674_0038405 3300047319 Bacteria 4297
731 Ga0495674_0694488 3300047319 Bacteria 799
732 Ga0495672_0015084 3300047320 Bacteria 5259
733 Ga0495672_0017739 3300047320 Bacteria 4750
734 Ga0495672_0028548 3300047320 Bacteria 3529
735 Ga0495672_0068505 3300047320 Bacteria 2017
736 Ga0495676_0034547 3300047321 Bacteria 4241
737 Ga0495676_0063854 3300047321 Bacteria 2868
738 Ga0495676_0095342 3300047321 Bacteria 2214
739 Ga0495680_0007705 3300047322 Bacteria 9829
740 Ga0495675_0003666 3300047444 Bacteria 9283
741 Ga0495673_0227490 3300047469 Bacteria 688
742 Ga0495673_0284409 3300047469 Bacteria 596
743 Ga0495684_0000942 3300047471 Bacteria 23681
744 Ga0495684_0042610 3300047471 Bacteria 3476
745 Ga0495684_0531723 3300047471 Bacteria 803
746 Ga0495686_0085195 3300047472 Bacteria 1925
747 Ga0495686_0153957 3300047472 Bacteria 1348
748 Ga0495686_0154539 3300047472 Bacteria 1345
749 Ga0495593_0000071 3300047673 Bacteria 43314
750 Ga0495593_0001112 3300047673 Bacteria 15705
751 Ga0495593_0153866 3300047673 Bacteria 1162
752 Ga0495593_0218642 3300047673 Bacteria 956
753 Ga0495602_0003245 3300048088 Bacteria 16794
754 Ga0495602_0214737 3300048088 Bacteria 1457
755 Ga0495602_0409162 3300048088 Bacteria 966
756 Ga0495602_0530922 3300048088 Bacteria 818
757 Ga0495614_0575855 3300048089 Bacteria 540
758 Ga0495615_0151620 3300048090 Bacteria 690
759 Ga0496100_0515098 3300048903 Bacteria 923
760 Ga0496100_0590269 3300048903 Bacteria 862
761 Ga0496101_0036002 3300048904 Bacteria 3504
762 Ga0496101_0867108 3300048904 Bacteria 711
763 Ga0496102_0001926 3300048905 Bacteria 17867
764 Ga0496102_0103146 3300048905 Bacteria 2652
765 Ga0496102_0289521 3300048905 Bacteria 1544
766 Ga0496102_0303082 3300048905 Bacteria 1506
767 Ga0496102_0822531 3300048905 Bacteria 851
768 Ga0496103_0184487 3300048906 Bacteria 1341
769 Ga0496103_0671138 3300048906 Bacteria 658
770 Ga0496104_0016935 3300048907 Bacteria 6630
771 Ga0496104_0092999 3300048907 Bacteria 2883
772 Ga0496104_0157000 3300048907 Bacteria 2183
773 Ga0496104_0497913 3300048907 Bacteria 1129
774 Ga0496105_0014383 3300048908 Bacteria 6298
775 Ga0496105_0690161 3300048908 Bacteria 785
776 Ga0496106_0001303 3300048909 Bacteria 18732
777 Ga0496106_0007840 3300048909 Bacteria 7905
778 Ga0496106_0015567 3300048909 Bacteria 5625
779 Ga0496106_0178923 3300048909 Bacteria 1683
780 Ga0496106_0282481 3300048909 Bacteria 1330
781 Ga0496106_0369210 3300048909 Bacteria 1153
782 Ga0496108_0031040 3300048911 Bacteria 4430
783 Ga0496108_0056325 3300048911 Bacteria 3302
784 Ga0496109_0028701 3300048912 Bacteria 4980
785 Ga0496109_0112955 3300048912 Bacteria 2526
786 Ga0496109_0164649 3300048912 Bacteria 2078
787 Ga0496109_0589436 3300048912 Bacteria 1048
788 Ga0496110_0020916 3300048913 Bacteria 5528
789 Ga0496110_0035219 3300048913 Bacteria 4342
790 Ga0496110_0036728 3300048913 Bacteria 4256
791 Ga0496110_0627375 3300048913 Bacteria 974
792 Ga0496111_0108132 3300048914 Bacteria 2048
793 Ga0496112_0000079 3300048915 Bacteria 64101
794 Ga0496112_0011862 3300048915 Bacteria 7982
795 Ga0496112_0042624 3300048915 Bacteria 4440
796 Ga0496113_0052259 3300048916 Bacteria 3051
797 Ga0496113_0175600 3300048916 Bacteria 1697
798 Ga0496113_0537317 3300048916 Bacteria 938
799 Ga0496114_0019364 3300048917 Bacteria 5515
800 Ga0496114_0097833 3300048917 Bacteria 2500
801 Ga0496114_0408748 3300048917 Bacteria 1202
802 Ga0496114_1048957 3300048917 Bacteria 699
803 Ga0496115_0001660 3300048918 Bacteria 16005
804 Ga0496115_0021912 3300048918 Bacteria 4941
805 Ga0496115_0170170 3300048918 Bacteria 1802
806 Ga0496115_1009269 3300048918 Bacteria 635
807 Ga0496116_0082894 3300048919 Bacteria 1982
808 Ga0496118_0005806 3300048921 Bacteria 13836
809 Ga0496118_0175041 3300048921 Bacteria 1305
810 Ga0496118_0308421 3300048921 Bacteria 865
811 Ga0496118_0398833 3300048921 Bacteria 715
812 Ga0496119_0093005 3300048922 Bacteria 1709
813 Ga0496119_0161712 3300048922 Bacteria 1190
814 Ga0496119_0424704 3300048922 Bacteria 630
815 Ga0496120_0073316 3300048923 Bacteria 1874
816 Ga0496121_0000456 3300048924 Bacteria 80536
817 Ga0496121_0000495 3300048924 Bacteria 75339
818 Ga0496121_0009589 3300048924 Bacteria 11091
819 Ga0496121_0026710 3300048924 Bacteria 5427
820 Ga0496121_0040184 3300048924 Bacteria 4107
821 Ga0496121_0069554 3300048924 Bacteria 2840
822 Ga0496121_0092008 3300048924 Bacteria 2365
823 Ga0496121_0533999 3300048924 Bacteria 737
824 Ga0496123_0220446 3300048926 Bacteria 957
825 Ga0496124_0001010 3300048927 Bacteria 44569
826 Ga0496125_0004034 3300048928 Bacteria 17214
827 Ga0496125_0018832 3300048928 Bacteria 6538
828 Ga0496125_0244008 3300048928 Bacteria 1138
829 Ga0496125_0414965 3300048928 Bacteria 782
830 Ga0496126_0003586 3300048929 Bacteria 19458
831 Ga0496126_0026206 3300048929 Bacteria 5594
832 Ga0496126_0033722 3300048929 Bacteria 4815
833 Ga0496126_0043395 3300048929 Bacteria 4148
834 Ga0496126_0058174 3300048929 Bacteria 3485
835 Ga0496126_0101712 3300048929 Bacteria 2513
836 Ga0496126_0105811 3300048929 Bacteria 2456
837 Ga0496126_0120484 3300048929 Bacteria 2276
838 Ga0496126_0177663 3300048929 Bacteria 1810
839 Ga0496126_0209658 3300048929 Bacteria 1641
840 Ga0496126_0310794 3300048929 Bacteria 1297
841 Ga0496126_0386040 3300048929 Bacteria 1139
842 Ga0496126_0390660 3300048929 Bacteria 1130
843 Ga0496126_0501252 3300048929 Bacteria 970
844 Ga0495678_153481 3300049459 Bacteria 742
845 Ga0495682_0121922 3300049460 Bacteria 933
846 Ga0501043_0202544 3300049579 Bacteria 1540
847 Ga0501046_0024946 3300049580 Bacteria 4899
848 Ga0501047_0039854 3300049581 Bacteria 4544
849 Ga0501047_0852488 3300049581 Bacteria 725
850 Ga0501048_0667043 3300049582 Bacteria 747
851 Ga0501067_0084969 3300049583 Bacteria 1756
852 Ga0501069_0030878 3300049585 Bacteria 2945
853 Ga0501069_0167132 3300049585 Bacteria 1268
854 Ga0501070_0011268 3300049586 Bacteria 7552
855 Ga0501070_0012856 3300049586 Bacteria 7053
856 Ga0501070_0322394 3300049586 Bacteria 1256
857 Ga0501073_0086110 3300049589 Bacteria 2185
858 Ga0501074_0078168 3300049590 Bacteria 2374
859 Ga0501080_0013807 3300049742 Bacteria 7435
860 Ga0501080_0324053 3300049742 Bacteria 1394
861 Ga0501080_0817263 3300049742 Bacteria 817
862 Ga0501081_0111928 3300049743 Bacteria 1938
863 Ga0501035_0004051 3300049822 Bacteria 13958
864 Ga0501035_0302102 3300049822 Bacteria 1348
865 Ga0501044_0025310 3300049823 Bacteria 6289
866 nmdc:mga03n38_832_c1 3300050490 Bacteria 8253
867 nmdc:mga03n38_97361_c1 3300050490 Bacteria 1413
868 nmdc:mga00v17_115179_c1 3300050491 Bacteria 1708
869 nmdc:mga00v17_345738_c1 3300050491 Bacteria 967
870 nmdc:mga0yw44_237435_c1 3300050492 Bacteria 1211
871 nmdc:mga0yw44_449076_c1 3300050492 Bacteria 874
872 nmdc:mga0yw44_929149_c1 3300050492 Bacteria 590
873 nmdc:mga0k408_328282_c1 3300050493 Bacteria 913
874 nmdc:mga0k408_375096_c1 3300050493 Bacteria 848
875 nmdc:mga06z11_20530_c1 3300050494 Bacteria 3054
876 nmdc:mga06z11_375023_c1 3300050494 Bacteria 854
877 nmdc:mga06z11_663862_c1 3300050494 Bacteria 635
878 nmdc:mga07m45_18553_c1 3300050496 Bacteria 3758
879 nmdc:mga07m45_343080_c1 3300050496 Bacteria 868
880 nmdc:mga07m45_444712_c1 3300050496 Bacteria 752
881 nmdc:mga07m45_7096_c1 3300050496 Bacteria 5705
882 nmdc:mga07m45_88076_c1 3300050496 Bacteria 1777
883 nmdc:mga08y16_39585_c1 3300050511 Bacteria 4946
884 nmdc:mga0n895_287718_c1 3300050512 Bacteria 1666
885 nmdc:mga0n895_332638_c1 3300050512 Bacteria 1539
886 nmdc:mga0rr50_646068_c1 3300050513 Bacteria 903
887 nmdc:mga08x19_143838_c1 3300050514 Bacteria 1612
888 nmdc:mga08x19_40070_c1 3300050514 Bacteria 2980
889 nmdc:mga0sz30_23496_c1 3300050516 Bacteria 2509
890 nmdc:mga0sz30_34029_c1 3300050516 Bacteria 2120
891 Ga0495601_0027779 3300053077 Bacteria 3501
892 Ga0495601_0042600 3300053077 Bacteria 2849
893 Ga0495601_0472647 3300053077 Bacteria 810
894 Ga0500635_0017942 3300053080 Bacteria 2129
895 Ga0495595_0000897 3300053084 Bacteria 11454
896 Ga0495619_0001717 3300053085 Bacteria 14530
897 Ga0495619_0082462 3300053085 Bacteria 2167
898 Ga0495619_0274558 3300053085 Bacteria 1168
899 Ga0500578_0496269 3300053086 Bacteria 687
900 Ga0500643_051488 3300053087 Bacteria 1176
901 Ga0500583_0119420 3300053092 Bacteria 1303
902 Ga0500583_0211573 3300053092 Bacteria 962
903 Ga0500651_0003265 3300053093 Bacteria 8829
904 Ga0500651_0533927 3300053093 Bacteria 643
905 Ga0500566_0000038 3300053094 Bacteria 66925
906 Ga0500566_0016608 3300053094 Bacteria 4321
907 Ga0500566_0256979 3300053094 Bacteria 846
908 Ga0500640_036928 3300053095 Bacteria 2147
909 Ga0500648_222321 3300053097 Bacteria 923
910 Ga0500554_035582 3300053102 Bacteria 1498
911 Ga0500556_0025949 3300053104 Bacteria 1941
912 Ga0500562_025536 3300053108 Bacteria 1546
913 Ga0500572_000010 3300053111 Bacteria 67071
914 Ga0500594_0007902 3300053118 Bacteria 2414
915 Ga0500595_002817 3300053119 Bacteria 8362
916 Ga0500595_002876 3300053119 Bacteria 8254
917 Ga0500595_016482 3300053119 Bacteria 2751
918 Ga0500595_018993 3300053119 Bacteria 2501
919 Ga0500595_063780 3300053119 Bacteria 1106
920 Ga0500595_113097 3300053119 Bacteria 770
921 Ga0500614_000527 3300053123 Bacteria 9848
922 Ga0500614_026458 3300053123 Bacteria 1387
923 Ga0500628_114928 3300053129 Bacteria 726
924 Ga0500642_0088483 3300053130 Bacteria 1429
925 Ga0500658_0180561 3300053134 Bacteria 961
926 Ga0500658_0242075 3300053134 Bacteria 828
927 Ga0500559_0001831 3300053136 Bacteria 11598
928 Ga0500559_0009373 3300053136 Bacteria 4238
929 Ga0500559_0168988 3300053136 Bacteria 1028
930 Ga0500564_112167 3300053138 Bacteria 1196
931 Ga0500568_0001566 3300053139 Bacteria 14459
932 Ga0500573_0179107 3300053140 Bacteria 1140
933 Ga0500588_0080855 3300053146 Bacteria 1087
934 Ga0500588_0187424 3300053146 Bacteria 762
935 Ga0500589_087981 3300053147 Bacteria 1374
936 Ga0500590_145637 3300053148 Bacteria 1076
937 Ga0500603_000506 3300053150 Bacteria 9885
938 Ga0500603_001941 3300053150 Bacteria 4608
939 Ga0500603_020051 3300053150 Bacteria 1629
940 Ga0500603_113949 3300053150 Bacteria 814
941 Ga0500604_0263084 3300053151 Bacteria 597
942 Ga0500622_0244198 3300053156 Bacteria 791
943 Ga0500630_001647 3300053159 Bacteria 10690
944 Ga0500633_0070916 3300053160 Bacteria 1244
945 Ga0500638_006485 3300053162 Bacteria 4793
946 Ga0500638_006620 3300053162 Bacteria 4764
947 Ga0500638_066816 3300053162 Bacteria 1723
948 Ga0500639_000034 3300053163 Bacteria 66994
949 Ga0500636_0276285 3300053177 Bacteria 841
950 Ga0500637_0009537 3300053178 Bacteria 4946
951 Ga0500637_0013593 3300053178 Bacteria 4273
952 Ga0500637_0015460 3300053178 Bacteria 4046
953 Ga0500637_0045452 3300053178 Bacteria 2490
954 Ga0500576_085384 3300053725 Bacteria 1323
955 Ga0500657_106818 3300053728 Bacteria 1141
956 Ga0500552_001545 3300053733 Bacteria 2199
957 Ga0500596_000922 3300053735 Bacteria 5877
958 Ga0500596_008575 3300053735 Bacteria 1626
959 Ga0501084_0093842 3300054114 Bacteria 2520
960 Ga0500661_001416 3300055283 Bacteria 4485
961 Ga0501082_0303607 3300060353 Bacteria 1390
962 Ga0530510_0684805 3300061734 Bacteria 781
963 2513629311 2513237092 Bacteria 8341956
964 2513656574 2513237096 Bacteria 8722461
965 2513672370 2513237098 Bacteria 9902361
966 2513691755 2513237101 Bacteria 7952346
967 2513717523 2513237104 Bacteria 10034502
968 2513859539 2513237137 Bacteria 9558895
969 2513917759 2513237145 Bacteria 8979722
970 2517102100 2517093001 Bacteria 9002274
971 2517893169 2517572143 Bacteria 9484767
972 2524466825 2524023210 Bacteria 9029266
973 2524537280 2524023228 Bacteria 10118060
974 2617376565 2617270741 Bacteria 8201522
975 2728754596 2728368998 Bacteria 8720350
976 2793069963 2791355197 Bacteria 8420563
977 2824619736 2824617872 Bacteria 8814715
978 2824629344 2824626560 Bacteria 8813858
979 2824640778 2824635225 Bacteria 8785348
980 2824647105 2824644064 Bacteria 8743947
981 2824674680 2824671348 Bacteria 8369588
982 2824686418 2824679649 Bacteria 8248951
983 2824692859 2824687955 Bacteria 8360029
984 2824717291 2824714736 Bacteria 8717648
985 2824727491 2824723954 Bacteria 8758240
986 2824737157 2824732956 Bacteria 7810675
987 2824749675 2824746037 Bacteria 7911610
988 2838128602 2838122688 Bacteria 8803140
989 2841947302 2841941048 Bacteria 8688029
990 2841950748 2841949485 Bacteria 8680857
991 2841967062 2841966195 Bacteria 8673214
992 2841991067 2841983080 Bacteria 8395090
993 2847935162 2847930680 Bacteria 9342022
994 2874609519 2874604998 Bacteria 7834745
995 2874612755 2874612657 Bacteria 8252029
996 2876810983 2876808645 Bacteria 8824342
997 2879090126 2879083081 Bacteria 8587928
998 2879115707 2879110137 Bacteria 8907982
999 2885374762 2885374607 Bacteria 8927485
1000 2885391705 2885383462 Bacteria 9473874
1001 2903777840 2903768456 Bacteria 9749579
1002 2904702039
1003 2906640884 2906635258 Bacteria 8601019
1004 2906645835 2906643746 Bacteria 8722424
1005 2906667863 2906660503 Bacteria 8595048
1006 2908760344 2908756301 Bacteria 8864324
1007 2908779330 2908775508 Bacteria 8092255
1008 2922367778 2922361189 Bacteria 7436256
1009 2922392319 2922386360 Bacteria 7017218
1010 2922395542 2922393267 Bacteria 8285685
1011 2932808971 2932801729 Bacteria 7987968
1012 2935634106 2935630451 Bacteria 8169952
1013 2935886684 2935883170 Bacteria 7964738
1014 2941510997 2941507105 Bacteria 8166816
1015 2941518381 2941515067 Bacteria 8166720
1016 2941527356 2941523033 Bacteria 8169134
1017 3005479487 3005474847 Bacteria 9259049
1018 3005489371 3005483717 Bacteria 7877331
1019 3005590915 3005587118 Bacteria 7794411
1020 3005598363 3005594810 Bacteria 8716512
1021 3005721522 3005718088 Bacteria 8283608
1022 8006928272 8006926726 Bacteria 6749210
1023 8006941661 8006933436 Bacteria 10410654
1024 8006971958 8006964411 Bacteria 8966052
1025 8006981371 8006973647 Bacteria 10679141
1026 8006990371 8006984368 Bacteria 9651211
1027 8006996407 8006994254 Bacteria 8309700
1028 8019657420 8019648815 Bacteria 10014479
1029 8056674662 8056673599 Bacteria 7871253
1030 8056688542 8056681323 Bacteria 8472857
1031 8056972649 8056967851 Bacteria 9038162
1032 Ga0070713_100031140
1033 JGI24740J21852_10070463
1034 JGI24735J21928_10044897
1035 JGI24750J21931_1026917
1036 JGI25153J46596_10005011
1037 JGI25404J52841_10005727
1038 JGI25404J52841_10011158
1039 JGI25404J52841_10135865
1040 Ga0055531_10007161
1041 Ga0065165_1010981
1042 Ga0070658_10239457
1043 Ga0070676_10094448
1044 Ga0070683_100220944
1045 Ga0070683_100301476
1046 Ga0070683_101024038
1047 Ga0070690_100117460
1048 Ga0070690_100404861
1049 Ga0070690_100595493
1050 Ga0068869_100346811
1051 Ga0070680_100083357
1052 Ga0070680_100162579
1053 Ga0070680_100372741
1054 Ga0070682_100034408
1055 Ga0070682_100392914
1056 Ga0068868_100168503
1057 Ga0068868_100653159
1058 Ga0070660_100099615
1059 Ga0070660_100346871
1060 Ga0070660_100517355
1061 Ga0070660_100649279
1062 Ga0070689_100253495
1063 Ga0070689_100568645
1064 Ga0070691_10125140
1065 Ga0070687_100530383
1066 Ga0070661_100065521
1067 Ga0070661_100656740
1068 Ga0070661_100717168
1069 Ga0070668_100363642
1070 Ga0070668_100397989
1071 Ga0070675_100196040
1072 Ga0070671_100097150
1073 Ga0070674_100050504
1074 Ga0070674_100315373
1075 Ga0070673_100147480
1076 Ga0070688_100288588
1077 Ga0070667_100484616
1078 Ga0070703_10050936
1079 Ga0070709_10000814
1080 Ga0070709_10011971
1081 Ga0070709_10180509
1082 Ga0070714_100018170
1083 Ga0070714_100053554
1084 Ga0070713_100005532
1085 Ga0070710_10000766
1086 Ga0070710_10002013
1087 Ga0070710_10071677
1088 Ga0070711_100018829
1089 Ga0070708_100117564
1090 Ga0070663_100074137
1091 Ga0070663_100287348
1092 Ga0070678_100012203
1093 Ga0070678_100030444
1094 Ga0070662_100180912
1095 Ga0070662_100326999
1096 Ga0070681_10038316
1097 Ga0070681_10334290
1098 Ga0070681_10446149
1099 Ga0070681_10508912
1100 Ga0068867_100071840
1101 Ga0068867_100952322
1102 Ga0070706_100523153
1103 Ga0070707_100110267
1104 Ga0070698_100009493
1105 Ga0070698_100642857
1106 Ga0070699_100694317
1107 Ga0070679_100030520
1108 Ga0070679_100394813
1109 Ga0070679_100722492
1110 Ga0070684_100024950
1111 Ga0070684_100213837
1112 Ga0070684_100324299
1113 Ga0070697_100181154
1114 Ga0070697_100270438
1115 Ga0068853_100006610
1116 Ga0068853_100040318
1117 Ga0068853_100070318
1118 Ga0068853_100823560
1119 Ga0068853_101018060
1120 Ga0070686_100306494
1121 Ga0070696_100086131
1122 Ga0070693_100234238
1123 Ga0070693_100242105
1124 Ga0070693_100338144
1125 Ga0070693_100673605
1126 Ga0070665_100013374
1127 Ga0070665_100139727
1128 Ga0070665_100447269
1129 Ga0070665_100927098
1130 Ga0070665_101496051
1131 Ga0068855_100035310
1132 Ga0068855_100116561
1133 Ga0068855_100252708
1134 Ga0068855_100687771
1135 Ga0068855_101034331
1136 Ga0070664_101113871
1137 Ga0068857_100047034
1138 Ga0068857_100171617
1139 Ga0068857_100259191
1140 Ga0068854_100086826
1141 Ga0068854_100121085
1142 Ga0068854_100197263
1143 Ga0068854_100247327
1144 Ga0068854_100380694
1145 Ga0068856_100002728
1146 Ga0068856_100006948
1147 Ga0068856_100009830
1148 Ga0068856_100050817
1149 Ga0068856_100055304
1150 Ga0068856_100084260
1151 Ga0068856_100163028
1152 Ga0068856_100539614
1153 Ga0068852_100006331
1154 Ga0068852_100057499
1155 Ga0068852_100102548
1156 Ga0068852_100141669
1157 Ga0068852_100229273
1158 Ga0068852_100500575
1159 Ga0068852_100585780
1160 Ga0068859_100373506
1161 Ga0068859_100825266
1162 Ga0068859_101448618
1163 Ga0068864_100007872
1164 Ga0068864_100589705
1165 Ga0068866_10059226
1166 Ga0068861_100187739
1167 Ga0068851_10064729
1168 Ga0068851_10149013
1169 Ga0068863_100022985
1170 Ga0068863_100978124
1171 Ga0068858_100209905
1172 Ga0068858_100220864
1173 Ga0068858_100260645
1174 Ga0068860_100000058
1175 Ga0081455_10036644
1176 Ga0081455_10071579
1177 Ga0081455_10093901
1178 Ga0081540_1002578
1179 Ga0081540_1003795
1180 Ga0081540_1010920
1181 Ga0081540_1029209
1182 Ga0081540_1030142
1183 Ga0081540_1104243
1184 Ga0081539_10000231
1185 Ga0081539_10099315
1186 Ga0081539_10164992
1187 Ga0070717_10003916
1188 Ga0070717_10091940
1189 Ga0070717_10477246
1190 Ga0070717_10849833
1191 Ga0070717_10997088
1192 Ga0075365_10144139
1193 Ga0075368_10026610
1194 Ga0075368_10108821
1195 Ga0075363_100015801
1196 Ga0075363_100298465
1197 Ga0075364_10093420
1198 Ga0075364_10320340
1199 Ga0075364_10561077
1200 Ga0070716_100003692
1201 Ga0070716_100072180
1202 Ga0070712_100040637
1203 Ga0070712_100075668
1204 Ga0070712_100076867
1205 Ga0070712_100607983
1206 Ga0075362_10305097
1207 Ga0075367_10024577
1208 Ga0075367_10032897
1209 Ga0075367_10050395
1210 Ga0075369_10098588
1211 Ga0075369_10152075
1212 Ga0075366_10025623
1213 Ga0075366_10053358
1214 Ga0075366_10336458
1215 Ga0075366_10588223
1216 Ga0075370_10032607
1217 Ga0075370_10040764
1218 Ga0075370_10069766
1219 Ga0075370_10135132
1220 Ga0075370_10171184
1221 Ga0068871_100145782
1222 Ga0068865_100049009
1223 Ga0075436_100162628
1224 Ga0097620_100373504
1225 Ga0097620_100825277
1226 Ga0097620_101448771
1227 Ga0099824_1010180
1228 Ga0099822_1000628
1229 Ga0075435_100255419
1230 Ga0105250_10267511
1231 Ga0105240_10002351
1232 Ga0105240_10016661
1233 Ga0105240_10114561
1234 Ga0105240_10375863
1235 Ga0111539_11956589
1236 Ga0105245_10220323
1237 Ga0105245_10638444
1238 Ga0105247_10053945
1239 Ga0105243_10026993
1240 Ga0105241_10009864
1241 Ga0105241_10025759
1242 Ga0105241_10239860
1243 Ga0105241_10471031
1244 Ga0105241_10504639
1245 Ga0105242_10691852
1246 Ga0105248_10219140
1247 Ga0105237_10005556
1248 Ga0105237_10049350
1249 Ga0105237_10064509
1250 Ga0105237_10159230
1251 Ga0105237_10205574
1252 Ga0105237_10676546
1253 Ga0105238_10002811
1254 Ga0105238_10012890
1255 Ga0105238_10029984
1256 Ga0105238_10089121
1257 Ga0105238_10166380
1258 Ga0105238_11316535
1259 Ga0105249_10287455
1260 Ga0105249_10525060
1261 Ga0105249_10577942
1262 Ga0099796_10165062
1263 Ga0105239_10042814
1264 Ga0105239_10149955
1265 Ga0105239_10182089
1266 Ga0105239_10948266
1267 Ga0105246_10017342
1268 Ga0105246_10037124
1269 Ga0157341_1006635
1270 Ga0157370_10086076
1271 Ga0157370_10136125
1272 Ga0157369_10006882
1273 Ga0157369_10061176
1274 Ga0157369_10371627
1275 Ga0157374_10490957
1276 Ga0157378_10215669
1277 Ga0163162_10231677
1278 Ga0163162_10285062
1279 Ga0163162_10526893
1280 Ga0157372_10055769
1281 Ga0157372_10594922
1282 Ga0157372_10621543
1283 Ga0157372_10899318
1284 Ga0157372_11328575
1285 Ga0157375_10044534
1286 Ga0157375_10214507
1287 Ga0157375_10478137
1288 Ga0163163_10042480
1289 Ga0163163_10293527
1290 Ga0157379_10103216
1291 Ga0157376_10009356
1292 Ga0157376_10351401
1293 Ga0157376_10513207
1294 Ga0157376_10977368
1295 Ga0206354_11538885
1296 Ga0206353_11968516
1297 Ga0214544_1000009
1298 Ga0214542_1000002
1299 Ga0214545_1000002
1300 Ga0214543_1000013
1301 Ga0213872_10284224
1302 Ga0213876_10305914
1303 Ga0209677_101611
1304 Ga0209233_1006609
1305 Ga0209455_1002229
1306 Ga0207673_1012601
1307 Ga0209758_1001125
1308 Ga0209758_1009234
1309 Ga0209257_1028631
1310 Ga0207697_10238837
1311 Ga0207656_10024925
1312 Ga0207656_10055141
1313 Ga0207653_10065922
1314 Ga0207692_10001752
1315 Ga0207692_10005509
1316 Ga0207642_10048621
1317 Ga0207688_10002338
1318 Ga0207688_10052823
1319 Ga0207680_10274826
1320 Ga0207680_10677767
1321 Ga0207647_10011930
1322 Ga0207685_10074666
1323 Ga0207699_10002559
1324 Ga0207699_10143709
1325 Ga0207699_10215811
1326 Ga0207645_10047651
1327 Ga0207645_10150153
1328 Ga0207643_10006512
1329 Ga0207684_10338263
1330 Ga0207654_10000968
1331 Ga0207654_10008714
1332 Ga0207654_10167707
1333 Ga0207654_10454345
1334 Ga0207707_10004344
1335 Ga0207707_10022114
1336 Ga0207707_10041877
1337 Ga0207707_10120934
1338 Ga0207707_10121544
1339 Ga0207695_10000278
1340 Ga0207695_10003702
1341 Ga0207695_10042990
1342 Ga0207695_10073482
1343 Ga0207695_10117566
1344 Ga0207695_10320641
1345 Ga0207671_10005180
1346 Ga0207671_10024084
1347 Ga0207671_10034231
1348 Ga0207671_10122118
1349 Ga0207671_10219494
1350 Ga0207671_10297480
1351 Ga0207671_10651427
1352 Ga0207671_10887377
1353 Ga0207693_10019182
1354 Ga0207693_10029736
1355 Ga0207693_10961866
1356 Ga0207663_10006350
1357 Ga0207663_10539421
1358 Ga0207663_10848597
1359 Ga0207660_10019474
1360 Ga0207660_10055543
1361 Ga0207660_10237183
1362 Ga0207662_10001714
1363 Ga0207662_10051728
1364 Ga0207657_10095539
1365 Ga0207657_10400965
1366 Ga0207652_10010300
1367 Ga0207652_10016438
1368 Ga0207652_10025314
1369 Ga0207652_10062600
1370 Ga0207646_10141577
1371 Ga0207694_10001639
1372 Ga0207694_10008346
1373 Ga0207694_10090314
1374 Ga0207694_10135367
1375 Ga0207694_10161031
1376 Ga0207694_10208163
1377 Ga0207694_10546820
1378 Ga0207650_11004332
1379 Ga0207687_10032431
1380 Ga0207687_10476443
1381 Ga0207687_10492637
1382 Ga0207687_10864379
1383 Ga0207700_10027152
1384 Ga0207700_10041009
1385 Ga0207700_10104431
1386 Ga0207700_10164085
1387 Ga0207700_10258994
1388 Ga0207700_10472986
1389 Ga0207664_10045700
1390 Ga0207644_10074379
1391 Ga0207644_10542107
1392 Ga0207644_10875510
1393 Ga0207690_10135787
1394 Ga0207706_10113863
1395 Ga0207706_10140630
1396 Ga0207706_10187062
1397 Ga0207706_10398482
1398 Ga0207706_10888945
1399 Ga0207709_10032468
1400 Ga0207709_10077357
1401 Ga0207670_10972371
1402 Ga0207669_10011218
1403 Ga0207669_10161329
1404 Ga0207704_10184354
1405 Ga0207665_10058127
1406 Ga0207665_10087672
1407 Ga0207665_10171079
1408 Ga0207665_10329272
1409 Ga0207691_10042708
1410 Ga0207691_10260187
1411 Ga0207711_10308200
1412 Ga0207711_11238013
1413 Ga0207689_10095548
1414 Ga0207661_10017104
1415 Ga0207661_10186991
1416 Ga0207661_11014870
1417 Ga0207679_10894640
1418 Ga0207667_10043177
1419 Ga0207667_10045339
1420 Ga0207667_10116225
1421 Ga0207667_10498658
1422 Ga0207667_10906327
1423 Ga0207651_10109154
1424 Ga0207651_10314966
1425 Ga0207651_10805219
1426 Ga0207712_10092332
1427 Ga0207668_10063562
1428 Ga0207640_10066703
1429 Ga0207640_10548566
1430 Ga0207640_10679866
1431 Ga0207640_10886821
1432 Ga0207658_10408125
1433 Ga0207677_10149600
1434 Ga0207677_11129860
1435 Ga0207703_10041355
1436 Ga0207703_10146969
1437 Ga0207703_10354173
1438 Ga0207703_10798964
1439 Ga0207639_10006291
1440 Ga0207639_10019559
1441 Ga0207639_10045790
1442 Ga0207639_10229558
1443 Ga0207678_10043525
1444 Ga0207678_10054200
1445 Ga0207678_10087237
1446 Ga0207678_10160060
1447 Ga0207678_10185279
1448 Ga0207678_10227723
1449 Ga0207708_10004954
1450 Ga0207702_10000005
1451 Ga0207702_10000178
1452 Ga0207702_10027968
1453 Ga0207702_10067559
1454 Ga0207702_10070749
1455 Ga0207702_10272486
1456 Ga0207702_11062335
1457 Ga0207641_10157159
1458 Ga0207641_11016159
1459 Ga0207648_10076745
1460 Ga0207648_11309995
1461 Ga0207676_10947386
1462 Ga0207674_10024477
1463 Ga0207675_100043261
1464 Ga0207675_100110343
1465 Ga0207675_100178189
1466 Ga0207675_102359260
1467 Ga0207683_10023473
1468 Ga0207683_10048974
1469 Ga0207683_10147852
1470 Ga0207698_10002333
1471 Ga0207698_10160972
1472 Ga0207698_10185779
1473 Ga0207698_10248303
1474 Ga0207698_10290591
1475 Ga0207698_10342758
1476 Ga0207698_10452135
1477 Ga0209589_1000023
1478 Ga0209489_100032
1479 Ga0209700_100040
1480 Ga0209813_10055693
1481 Ga0207428_10063792
1482 Ga0268266_10003342
1483 Ga0268266_10006607
1484 Ga0268266_10104930
1485 Ga0268266_10129995
1486 Ga0268266_10400565
1487 Ga0268265_10051933
1488 Ga0268265_10090144
1489 Ga0268265_10397904
1490 Ga0268265_10927663
1491 Ga0268264_10000022
1492 Ga0265334_10038040
1493 Ga0307517_10005009
1494 Ga0307515_10360792
1495 Ga0307515_10465256
1496 Ga0265338_10011282
1497 Ga0265324_10075378
1498 Ga0307511_10049942
1499 Ga0265332_10010231
1500 Ga0265332_10041790
1501 Ga0265332_10091618
1502 Ga0265328_10031272
1503 Ga0265325_10042863
1504 Ga0265325_10055000
1505 Ga0265340_10035821
1506 Ga0265339_10000066
1507 Ga0265339_10064959
1508 Ga0265331_10012784
1509 Ga0265331_10166934
1510 Ga0265316_10257402
1511 Ga0307509_10510207
1512 Ga0307509_10555870
1513 Ga0307509_10588347
1514 Ga0265313_10002033
1515 Ga0307508_10000009
1516 Ga0307508_10038432
1517 Ga0307508_10190796
1518 Ga0265314_10029611
1519 Ga0265314_10158677
1520 Ga0307516_10011105
1521 Ga0307516_10086685
1522 Ga0307416_100699828
1523 Ga0307416_100938635
1524 Ga0307414_10871574
1525 Ga0307415_100050285
1526 Ga0307507_10025380
1527 Ga0307510_10008758
1528 Ga0307510_10053344
1529 Ga0307510_10095668
1530 Ga0307510_10161379
1531 Ga0315911_1000001
1532 Ga0316215_1000469
1533 Ga0373930_0152237
1534 Ga0373950_0091029
1535 Ga0373926_0037844
1536 Ga0373934_0014733
1537 Ga0373923_0020753
1538 Ga0373923_0028095
1539 Ga0373923_0205205
1540 Ga0373932_0264813
1541 Ga0373936_0011983
1542 Ga0373936_0089961
1543 Ga0373945_0005636
1544 Ga0373953_0000171
1545 Ga0373953_0049065
1546 Ga0373954_0001704
1547 Ga0373956_0024416
1548 Ga0373957_0000100
1549 Ga0373957_0058441
1550 Ga0373960_0329036
1551 Ga0373943_0028011
1552 Ga0373943_0225514
1553 Ga0373946_0003172
1554 Ga0373955_0001365
1555 Ga0373955_0032088
1556 Ga0373931_0064956
1557 Ga0373935_0003830
1558 Ga0373935_0075594
1559 Ga0373935_0076730
1560 Ga0373935_0201660
1561 Ga0373935_0720647
1562 Ga0373927_0000069
1563 Ga0373927_0050140
1564 Ga0373927_0058242
1565 Ga0373927_0067439
1566 Ga0373933_0000781
1567 Ga0373933_0002823
1568 Ga0373933_0546546
1569 Ga0373947_0008029
1570 Ga0373947_0012802
1571 Ga0373947_0034922
1572 Ga0373947_0500833
1573 Ga0373937_0007517
1574 Ga0373937_0061733
1575 Ga0373937_0150934
1576 Ga0373937_0233024
1577 Ga0373925_0003396
1578 Ga0373925_0016611
1579 Ga0373925_0035208
1580 Ga0395899_0082407
1581 Ga0395900_0000860
1582 Ga0395900_0084203
1583 Ga0395900_0268294
1584 Ga0395900_0342245
1585 Ga0395900_1035212
1586 Ga0395898_0032210
1587 Ga0395898_0099348
1588 Ga0395898_0148062
1589 Ga0395898_0208224
1590 Ga0395898_0308246
1591 Ga0395905_0197051
1592 Ga0395905_0385734
1593 Ga0395905_0780805
1594 Ga0436364_0066298
1595 Ga0395901_0041679
1596 Ga0395901_0092102
1597 Ga0395901_0444175
1598 Ga0395901_0896152
1599 Ga0436365_0353234
1600 Ga0436365_1305911
1601 Ga0436360_1275075
1602 Ga0436360_1278402
1603 Ga0436361_0305956
1604 Ga0436361_0472856
1605 Ga0436363_0184448
1606 Ga0436363_0607928
1607 Ga0436363_0694729
1608 Ga0436362_0352029
1609 Ga0436362_0920921
1610 Ga0436362_1022971
1611 Ga0439465_0170381
1612 Ga0451791_0809607
1613 Ga0451793_0170774
1614 Ga0451800_1456892
1615 Ga0451802_1071351
1616 Ga0451804_0302326
1617 Ga0451853_0473357
1618 Ga0466972_0129401
1619 Ga0466963_0177299
1620 Ga0466964_0138432
1621 Ga0466957_0351794
1622 Ga0466957_0531114
1623 Ga0466960_0500849
1624 Ga0466959_0167491
1625 Ga0466958_0102701
1626 Ga0466967_0031972
1627 Ga0466967_0044464
1628 Ga0466967_0287806
1629 Ga0466967_0667046
1630 Ga0495592_0000890
1631 Ga0495592_0011137
1632 Ga0495592_0217289
1633 Ga0495603_0001909
1634 Ga0495603_0014989
1635 Ga0495603_0019319
1636 Ga0495603_0057286
1637 Ga0495603_0076075
1638 Ga0495629_0000083
1639 Ga0495629_0001665
1640 Ga0495629_0093534
1641 Ga0495629_0152215
1642 Ga0495638_0344159
1643 Ga0495641_0154902
1644 Ga0495651_0004120
1645 Ga0495653_0000905
1646 Ga0495653_0065868
1647 Ga0495580_0001769
1648 Ga0495580_0041958
1649 Ga0495580_0515331
1650 Ga0495582_0000206
1651 Ga0495582_0045731
1652 Ga0495582_0320920
1653 Ga0495639_0000167
1654 Ga0495639_0034070
1655 Ga0495639_0158236
1656 Ga0495639_0349181
1657 Ga0495662_0000457
1658 Ga0495662_0028582
1659 Ga0495664_0049306
1660 Ga0495664_0079556
1661 Ga0495664_0120092
1662 Ga0495664_0129718
1663 Ga0495594_0000838
1664 Ga0495594_0308187
1665 Ga0495607_0254486
1666 Ga0495606_0028639
1667 Ga0495606_0190269
1668 Ga0495608_0005206
1669 Ga0495610_0029532
1670 Ga0495618_0053488
1671 Ga0495618_0124131
1672 Ga0495628_0013690
1673 Ga0495628_0046174
1674 Ga0495628_0106349
1675 Ga0495628_0250064
1676 Ga0495628_0337733
1677 Ga0495630_0015598
1678 Ga0495630_0286703
1679 Ga0495631_0042197
1680 Ga0495631_0204855
1681 Ga0495644_0215235
1682 Ga0495648_0000160
1683 Ga0495648_0063615
1684 Ga0495648_0114382
1685 Ga0495648_0296543
1686 Ga0495666_0116057
1687 Ga0495652_0006710
1688 Ga0495652_0086209
1689 Ga0495665_0000399
1690 Ga0495665_0094511
1691 Ga0495640_0002380
1692 Ga0495640_0006041
1693 Ga0495640_0022858
1694 Ga0495587_0001761
1695 Ga0495597_0108630
1696 Ga0495645_0011866
1697 Ga0495645_0099796
1698 Ga0495622_0031543
1699 Ga0495622_0117268
1700 Ga0495622_0157988
1701 Ga0495667_0008194
1702 Ga0495667_0023917
1703 Ga0495667_0323080
1704 Ga0495668_0079059
1705 Ga0495668_0214909
1706 Ga0495668_0218941
1707 Ga0495668_0356803
1708 Ga0495668_0657920
1709 Ga0495634_0001116
1710 Ga0495634_0033261
1711 Ga0495634_0068117
1712 Ga0495634_0317379
1713 Ga0495611_0028869
1714 Ga0495611_0103977
1715 Ga0495611_0150371
1716 Ga0495625_0196711
1717 Ga0495625_0323566
1718 Ga0495625_0346200
1719 Ga0495635_0001363
1720 Ga0495635_0008724
1721 Ga0495635_1027362
1722 Ga0495588_0009937
1723 Ga0495588_0082817
1724 Ga0495657_0001869
1725 Ga0495657_0111900
1726 Ga0495599_0005931
1727 Ga0495599_0031077
1728 Ga0495623_0001546
1729 Ga0495646_0002015
1730 Ga0495646_0007314
1731 Ga0495646_0015020
1732 Ga0495647_0001461
1733 Ga0495647_0036068
1734 Ga0495658_0003680
1735 Ga0495658_0036491
1736 Ga0495658_0252632
1737 Ga0495658_0587486
1738 Ga0495669_0016655
1739 Ga0495669_0081447
1740 Ga0495669_0524853
1741 Ga0495613_0002852
1742 Ga0495613_0114270
1743 Ga0495624_0000096
1744 Ga0495624_0055814
1745 Ga0495624_0093725
1746 Ga0495670_0059936
1747 Ga0495670_0238612
1748 Ga0495670_0270909
1749 Ga0495589_0185678
1750 Ga0495589_0400030
1751 Ga0495600_0000380
1752 Ga0495660_0073144
1753 Ga0495581_0000311
1754 Ga0495581_0106091
1755 Ga0495581_0424159
1756 Ga0495604_0003890
1757 Ga0495604_0073297
1758 Ga0495604_0216048
1759 Ga0495604_0444889
1760 Ga0495674_0007643
1761 Ga0495674_0038405
1762 Ga0495674_0694488
1763 Ga0495672_0015084
1764 Ga0495672_0017739
1765 Ga0495672_0028548
1766 Ga0495672_0068505
1767 Ga0495676_0034547
1768 Ga0495676_0063854
1769 Ga0495676_0095342
1770 Ga0495680_0007705
1771 Ga0495675_0003666
1772 Ga0495673_0227490
1773 Ga0495673_0284409
1774 Ga0495684_0000942
1775 Ga0495684_0042610
1776 Ga0495684_0531723
1777 Ga0495686_0085195
1778 Ga0495686_0153957
1779 Ga0495686_0154539
1780 Ga0495593_0000071
1781 Ga0495593_0001112
1782 Ga0495593_0153866
1783 Ga0495593_0218642
1784 Ga0495602_0003245
1785 Ga0495602_0214737
1786 Ga0495602_0409162
1787 Ga0495602_0530922
1788 Ga0495614_0575855
1789 Ga0495615_0151620
1790 Ga0496100_0515098
1791 Ga0496100_0590269
1792 Ga0496101_0036002
1793 Ga0496101_0867108
1794 Ga0496102_0001926
1795 Ga0496102_0103146
1796 Ga0496102_0289521
1797 Ga0496102_0303082
1798 Ga0496102_0822531
1799 Ga0496103_0184487
1800 Ga0496103_0671138
1801 Ga0496104_0016935
1802 Ga0496104_0092999
1803 Ga0496104_0157000
1804 Ga0496104_0497913
1805 Ga0496105_0014383
1806 Ga0496105_0690161
1807 Ga0496106_0001303
1808 Ga0496106_0007840
1809 Ga0496106_0015567
1810 Ga0496106_0178923
1811 Ga0496106_0282481
1812 Ga0496106_0369210
1813 Ga0496108_0031040
1814 Ga0496108_0056325
1815 Ga0496109_0028701
1816 Ga0496109_0112955
1817 Ga0496109_0164649
1818 Ga0496109_0589436
1819 Ga0496110_0020916
1820 Ga0496110_0035219
1821 Ga0496110_0036728
1822 Ga0496110_0627375
1823 Ga0496111_0108132
1824 Ga0496112_0000079
1825 Ga0496112_0011862
1826 Ga0496112_0042624
1827 Ga0496113_0052259
1828 Ga0496113_0175600
1829 Ga0496113_0537317
1830 Ga0496114_0019364
1831 Ga0496114_0097833
1832 Ga0496114_0408748
1833 Ga0496114_1048957
1834 Ga0496115_0001660
1835 Ga0496115_0021912
1836 Ga0496115_0170170
1837 Ga0496115_1009269
1838 Ga0496116_0082894
1839 Ga0496118_0005806
1840 Ga0496118_0175041
1841 Ga0496118_0308421
1842 Ga0496118_0398833
1843 Ga0496119_0093005
1844 Ga0496119_0161712
1845 Ga0496119_0424704
1846 Ga0496120_0073316
1847 Ga0496121_0000456
1848 Ga0496121_0000495
1849 Ga0496121_0009589
1850 Ga0496121_0026710
1851 Ga0496121_0040184
1852 Ga0496121_0069554
1853 Ga0496121_0092008
1854 Ga0496121_0533999
1855 Ga0496123_0220446
1856 Ga0496124_0001010
1857 Ga0496125_0004034
1858 Ga0496125_0018832
1859 Ga0496125_0244008
1860 Ga0496125_0414965
1861 Ga0496126_0003586
1862 Ga0496126_0026206
1863 Ga0496126_0033722
1864 Ga0496126_0043395
1865 Ga0496126_0058174
1866 Ga0496126_0101712
1867 Ga0496126_0105811
1868 Ga0496126_0120484
1869 Ga0496126_0177663
1870 Ga0496126_0209658
1871 Ga0496126_0310794
1872 Ga0496126_0386040
1873 Ga0496126_0390660
1874 Ga0496126_0501252
1875 Ga0495678_153481
1876 Ga0495682_0121922
1877 Ga0501043_0202544
1878 Ga0501046_0024946
1879 Ga0501047_0039854
1880 Ga0501047_0852488
1881 Ga0501048_0667043
1882 Ga0501067_0084969
1883 Ga0501069_0030878
1884 Ga0501069_0167132
1885 Ga0501070_0011268
1886 Ga0501070_0012856
1887 Ga0501070_0322394
1888 Ga0501073_0086110
1889 Ga0501074_0078168
1890 Ga0501080_0013807
1891 Ga0501080_0324053
1892 Ga0501080_0817263
1893 Ga0501081_0111928
1894 Ga0501035_0004051
1895 Ga0501035_0302102
1896 Ga0501044_0025310
1897 nmdc:mga03n38_832_c1
1898 nmdc:mga03n38_97361_c1
1899 nmdc:mga00v17_115179_c1
1900 nmdc:mga00v17_345738_c1
1901 nmdc:mga0yw44_237435_c1
1902 nmdc:mga0yw44_449076_c1
1903 nmdc:mga0yw44_929149_c1
1904 nmdc:mga0k408_328282_c1
1905 nmdc:mga0k408_375096_c1
1906 nmdc:mga06z11_20530_c1
1907 nmdc:mga06z11_375023_c1
1908 nmdc:mga06z11_663862_c1
1909 nmdc:mga07m45_18553_c1
1910 nmdc:mga07m45_343080_c1
1911 nmdc:mga07m45_444712_c1
1912 nmdc:mga07m45_7096_c1
1913 nmdc:mga07m45_88076_c1
1914 nmdc:mga08y16_39585_c1
1915 nmdc:mga0n895_287718_c1
1916 nmdc:mga0n895_332638_c1
1917 nmdc:mga0rr50_646068_c1
1918 nmdc:mga08x19_143838_c1
1919 nmdc:mga08x19_40070_c1
1920 nmdc:mga0sz30_23496_c1
1921 nmdc:mga0sz30_34029_c1
1922 Ga0495601_0027779
1923 Ga0495601_0042600
1924 Ga0495601_0472647
1925 Ga0500635_0017942
1926 Ga0495595_0000897
1927 Ga0495619_0001717
1928 Ga0495619_0082462
1929 Ga0495619_0274558
1930 Ga0500578_0496269
1931 Ga0500643_051488
1932 Ga0500583_0119420
1933 Ga0500583_0211573
1934 Ga0500651_0003265
1935 Ga0500651_0533927
1936 Ga0500566_0000038
1937 Ga0500566_0016608
1938 Ga0500566_0256979
1939 Ga0500640_036928
1940 Ga0500648_222321
1941 Ga0500554_035582
1942 Ga0500556_0025949
1943 Ga0500562_025536
1944 Ga0500572_000010
1945 Ga0500594_0007902
1946 Ga0500595_002817
1947 Ga0500595_002876
1948 Ga0500595_016482
1949 Ga0500595_018993
1950 Ga0500595_063780
1951 Ga0500595_113097
1952 Ga0500614_000527
1953 Ga0500614_026458
1954 Ga0500628_114928
1955 Ga0500642_0088483
1956 Ga0500658_0180561
1957 Ga0500658_0242075
1958 Ga0500559_0001831
1959 Ga0500559_0009373
1960 Ga0500559_0168988
1961 Ga0500564_112167
1962 Ga0500568_0001566
1963 Ga0500573_0179107
1964 Ga0500588_0080855
1965 Ga0500588_0187424
1966 Ga0500589_087981
1967 Ga0500590_145637
1968 Ga0500603_000506
1969 Ga0500603_001941
1970 Ga0500603_020051
1971 Ga0500603_113949
1972 Ga0500604_0263084
1973 Ga0500622_0244198
1974 Ga0500630_001647
1975 Ga0500633_0070916
1976 Ga0500638_006485
1977 Ga0500638_006620
1978 Ga0500638_066816
1979 Ga0500639_000034
1980 Ga0500636_0276285
1981 Ga0500637_0009537
1982 Ga0500637_0013593
1983 Ga0500637_0015460
1984 Ga0500637_0045452
1985 Ga0500576_085384
1986 Ga0500657_106818
1987 Ga0500552_001545
1988 Ga0500596_000922
1989 Ga0500596_008575
1990 Ga0501084_0093842
1991 Ga0500661_001416
1992 Ga0501082_0303607
1993 Ga0530510_0684805
1994 2513629311
1995 2513656574
1996 2513672370
1997 2513691755
1998 2513717523
1999 2513859539
2000 2513917759
2001 2517102100
2002 2517893169
2003 2524466825
2004 2524537280
2005 2617376565
2006 2728754596
2007 2793069963
2008 2824619736
2009 2824629344
2010 2824640778
2011 2824647105
2012 2824674680
2013 2824686418
2014 2824692859
2015 2824717291
2016 2824727491
2017 2824737157
2018 2824749675
2019 2838128602
2020 2841947302
2021 2841950748
2022 2841967062
2023 2841991067
2024 2847935162
2025 2874609519
2026 2874612755
2027 2876810983
2028 2879090126
2029 2879115707
2030 2885374762
2031 2885391705
2032 2903777840
2033 2904702039
2034 2906640884
2035 2906645835
2036 2906667863
2037 2908760344
2038 2908779330
2039 2922367778
2040 2922392319
2041 2922395542
2042 2932808971
2043 2935634106
2044 2935886684
2045 2941510997
2046 2941518381
2047 2941527356
2048 3005479487
2049 3005489371
2050 3005590915
2051 3005598363
2052 3005721522
2053 8006928272
2054 8006941661
2055 8006971958
2056 8006981371
2057 8006990371
2058 8006996407
2059 8019657420
2060 8056674662
2061 8056688542
2062 8056972649

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04355

SmpA_OmlA

SmpA / OmlA family

78

154

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i00-assembly2.cif.gz_C crystal structure of acetyltransferase (gnat family) from enterococcus faecalis 0.8141 107 139
3n7z-assembly1.cif.gz_D crystal structure of acetyltransferase from bacillus anthracis 0.8109 107 139
6yoz-assembly2.cif.gz_BBB hicel7b labelled with b-1,4-glucosyl cyclophellitol 0.7529 104 133
2ovw-assembly4.cif.gz_D endoglucanase i complexed with cellobiose 0.7496 100 134
7ri9-assembly1.cif.gz_E the structure of bam in msp1e3d1 at 6.9 angstrom resolution 0.747 42 124
ID Description Score Start End Superfamily
2i00D02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.786 107 139 3.40.630.30
2ovwB00 Mainly Beta;Distorted Sandwich;1,4-Beta-D-Glucan Cellobiohydrolase I; Chain A;Glycoside hydrolase, family 7, domain 0.7499 100 134 2.70.100.10
af_Q9VHT2_8_184_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6811 107 142 2.130.10.10
af_E7EM29_23_395_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.6729 104 134 3.40.50.1240
3gmvX00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;BLIP domain 0.6619 54 124 3.10.450.730
ID Description Score Start End GO Terms
AF-A0A436FCK9-F1-model_v4 Outer membrane protein assembly factor BamE 0.7938 41 141 GO:0030674
GO:0043165
GO:0051205
GO:1990063
AF-A0A258JV05-F1-model_v4 Cell envelope protein SmpA 0.7909 38 140 GO:0030674
GO:0043165
GO:0051205
GO:1990063
AF-A0A6M1SVE7-F1-model_v4 Outer membrane protein assembly factor BamE 0.7421 40 150 GO:0030674
GO:0043165
GO:0051205
GO:1990063
AF-A0A258JV05-F1-model_v4 Cell envelope protein SmpA 0.7342 38 140 GO:0030674
GO:0043165
GO:0051205
GO:1990063
AF-A0A374W7R1-F1-model_v4 T9SS C-terminal target domain-containing protein 0.7331 76 137

Map