F488605
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1031 | 499 | 2062 | 166 |
Family's Representative Sequence
| Representative Sequence | 3300005436|Ga0070713_100031140|Ga0070713_1000311405 |
| Length | 191 |
| Sequence | MGRSRLLQSGVLPGTSTPRAMQGDGIISQMIETSPTCPRVGSPRGAPARWRRIRAAAAIALLCATLGGCLTGEQFQKGYILPPGALEQIPIGASQDQVLIVMGTPSTVATLNGEVFYYISQRSERPVAFMNQKVVDQRVIAIYFDKNRQVQRLANYGLQDGKIFDFISRTTPTSGQEMSYLTPLFKLLAFH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 86 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 117 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 118 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 119 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 120 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 191 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 203 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 219 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 220 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 221 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 222 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 225 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 234 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 254 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 255 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 256 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 257 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 267 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 268 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 339 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 347 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 348 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 352 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 353 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 354 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 355 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 356 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 357 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 358 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 359 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 360 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 376 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 378 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 379 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 380 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 386 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 388 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 391 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 392 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 393 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 394 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 396 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 397 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 398 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 399 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 400 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 404 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 405 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 406 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 408 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 410 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 411 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 412 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 413 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 414 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 416 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 417 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 418 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 419 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 421 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 422 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 423 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 424 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 425 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 426 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 427 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 429 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 431 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 432 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 433 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 434 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 435 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 436 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 437 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 438 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 439 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 440 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 441 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 442 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 443 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 444 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 445 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 446 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 447 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 448 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 449 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 450 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 451 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 452 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 453 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 454 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 455 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 456 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 457 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 458 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 459 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 460 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 461 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 462 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 463 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 464 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 465 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 466 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 467 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 468 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 469 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 470 | 2904699407 | |||
| 471 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 472 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 473 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 474 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 475 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 476 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 477 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 478 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 479 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 480 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 481 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 482 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 483 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 484 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 485 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 486 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 487 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 488 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 489 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 490 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 491 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 492 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 493 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 494 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 495 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 496 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 497 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 498 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 499 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.2 |
| Metatranscriptomes | 0.19 |
| Isolates | 6.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.06 |
| Nodule | 5.04 |
| Rhizoplane | 5.14 |
| Rhizosphere | 70.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070713_100031140 | 3300005436 | Bacteria | 4246 |
| 2 | JGI24740J21852_10070463 | 3300001979 | Bacteria | 938 |
| 3 | JGI24735J21928_10044897 | 3300002067 | Bacteria | 1284 |
| 4 | JGI24750J21931_1026917 | 3300002070 | Bacteria | 830 |
| 5 | JGI25153J46596_10005011 | 3300003215 | Bacteria | 7023 |
| 6 | JGI25404J52841_10005727 | 3300003659 | Bacteria | 2572 |
| 7 | JGI25404J52841_10011158 | 3300003659 | Bacteria | 1935 |
| 8 | JGI25404J52841_10135865 | 3300003659 | Bacteria | 520 |
| 9 | Ga0055531_10007161 | 3300003794 | Bacteria | 6142 |
| 10 | Ga0065165_1010981 | 3300005262 | Bacteria | 3839 |
| 11 | Ga0070658_10239457 | 3300005327 | Bacteria | 1538 |
| 12 | Ga0070676_10094448 | 3300005328 | Bacteria | 1837 |
| 13 | Ga0070683_100220944 | 3300005329 | Bacteria | 1801 |
| 14 | Ga0070683_100301476 | 3300005329 | Bacteria | 1524 |
| 15 | Ga0070683_101024038 | 3300005329 | Bacteria | 793 |
| 16 | Ga0070690_100117460 | 3300005330 | Bacteria | 1782 |
| 17 | Ga0070690_100404861 | 3300005330 | Bacteria | 1003 |
| 18 | Ga0070690_100595493 | 3300005330 | Bacteria | 839 |
| 19 | Ga0068869_100346811 | 3300005334 | Bacteria | 1209 |
| 20 | Ga0070680_100083357 | 3300005336 | Bacteria | 2640 |
| 21 | Ga0070680_100162579 | 3300005336 | Bacteria | 1876 |
| 22 | Ga0070680_100372741 | 3300005336 | Bacteria | 1215 |
| 23 | Ga0070682_100034408 | 3300005337 | Bacteria | 3086 |
| 24 | Ga0070682_100392914 | 3300005337 | Bacteria | 1047 |
| 25 | Ga0068868_100168503 | 3300005338 | Bacteria | 1812 |
| 26 | Ga0068868_100653159 | 3300005338 | Bacteria | 937 |
| 27 | Ga0070660_100099615 | 3300005339 | Bacteria | 2301 |
| 28 | Ga0070660_100346871 | 3300005339 | Bacteria | 1222 |
| 29 | Ga0070660_100517355 | 3300005339 | Bacteria | 994 |
| 30 | Ga0070660_100649279 | 3300005339 | Bacteria | 884 |
| 31 | Ga0070689_100253495 | 3300005340 | Bacteria | 1453 |
| 32 | Ga0070689_100568645 | 3300005340 | Bacteria | 979 |
| 33 | Ga0070691_10125140 | 3300005341 | Bacteria | 1298 |
| 34 | Ga0070687_100530383 | 3300005343 | Bacteria | 798 |
| 35 | Ga0070661_100065521 | 3300005344 | Bacteria | 2670 |
| 36 | Ga0070661_100656740 | 3300005344 | Bacteria | 852 |
| 37 | Ga0070661_100717168 | 3300005344 | Bacteria | 816 |
| 38 | Ga0070668_100363642 | 3300005347 | Bacteria | 1227 |
| 39 | Ga0070668_100397989 | 3300005347 | Bacteria | 1175 |
| 40 | Ga0070675_100196040 | 3300005354 | Bacteria | 1752 |
| 41 | Ga0070671_100097150 | 3300005355 | Bacteria | 2470 |
| 42 | Ga0070674_100050504 | 3300005356 | Bacteria | 2863 |
| 43 | Ga0070674_100315373 | 3300005356 | Bacteria | 1252 |
| 44 | Ga0070673_100147480 | 3300005364 | Bacteria | 1990 |
| 45 | Ga0070688_100288588 | 3300005365 | Bacteria | 1182 |
| 46 | Ga0070667_100484616 | 3300005367 | Bacteria | 1132 |
| 47 | Ga0070703_10050936 | 3300005406 | Bacteria | 1323 |
| 48 | Ga0070709_10000814 | 3300005434 | Bacteria | 17403 |
| 49 | Ga0070709_10011971 | 3300005434 | Bacteria | 4848 |
| 50 | Ga0070709_10180509 | 3300005434 | Bacteria | 1482 |
| 51 | Ga0070714_100018170 | 3300005435 | Bacteria | 5705 |
| 52 | Ga0070714_100053554 | 3300005435 | Bacteria | 3445 |
| 53 | Ga0070713_100005532 | 3300005436 | Bacteria | 8654 |
| 54 | Ga0070710_10000766 | 3300005437 | Bacteria | 15325 |
| 55 | Ga0070710_10002013 | 3300005437 | Bacteria | 9610 |
| 56 | Ga0070710_10071677 | 3300005437 | Bacteria | 1999 |
| 57 | Ga0070711_100018829 | 3300005439 | Bacteria | 4416 |
| 58 | Ga0070708_100117564 | 3300005445 | Bacteria | 2449 |
| 59 | Ga0070663_100074137 | 3300005455 | Bacteria | 2484 |
| 60 | Ga0070663_100287348 | 3300005455 | Bacteria | 1312 |
| 61 | Ga0070678_100012203 | 3300005456 | Bacteria | 5331 |
| 62 | Ga0070678_100030444 | 3300005456 | Bacteria | 3710 |
| 63 | Ga0070662_100180912 | 3300005457 | Bacteria | 1662 |
| 64 | Ga0070662_100326999 | 3300005457 | Bacteria | 1251 |
| 65 | Ga0070681_10038316 | 3300005458 | Bacteria | 4806 |
| 66 | Ga0070681_10334290 | 3300005458 | Bacteria | 1424 |
| 67 | Ga0070681_10446149 | 3300005458 | Bacteria | 1206 |
| 68 | Ga0070681_10508912 | 3300005458 | Bacteria | 1117 |
| 69 | Ga0068867_100071840 | 3300005459 | Bacteria | 2589 |
| 70 | Ga0068867_100952322 | 3300005459 | Bacteria | 775 |
| 71 | Ga0070706_100523153 | 3300005467 | Bacteria | 1103 |
| 72 | Ga0070707_100110267 | 3300005468 | Bacteria | 2669 |
| 73 | Ga0070698_100009493 | 3300005471 | Bacteria | 10421 |
| 74 | Ga0070698_100642857 | 3300005471 | Bacteria | 1002 |
| 75 | Ga0070699_100694317 | 3300005518 | Bacteria | 930 |
| 76 | Ga0070679_100030520 | 3300005530 | Bacteria | 5321 |
| 77 | Ga0070679_100394813 | 3300005530 | Bacteria | 1329 |
| 78 | Ga0070679_100722492 | 3300005530 | Bacteria | 939 |
| 79 | Ga0070684_100024950 | 3300005535 | Bacteria | 5019 |
| 80 | Ga0070684_100213837 | 3300005535 | Bacteria | 1757 |
| 81 | Ga0070684_100324299 | 3300005535 | Bacteria | 1415 |
| 82 | Ga0070697_100181154 | 3300005536 | Bacteria | 1786 |
| 83 | Ga0070697_100270438 | 3300005536 | Bacteria | 1457 |
| 84 | Ga0068853_100006610 | 3300005539 | Bacteria | 9230 |
| 85 | Ga0068853_100040318 | 3300005539 | Bacteria | 3984 |
| 86 | Ga0068853_100070318 | 3300005539 | Bacteria | 3046 |
| 87 | Ga0068853_100823560 | 3300005539 | Bacteria | 889 |
| 88 | Ga0068853_101018060 | 3300005539 | Bacteria | 798 |
| 89 | Ga0070686_100306494 | 3300005544 | Bacteria | 1179 |
| 90 | Ga0070696_100086131 | 3300005546 | Bacteria | 2230 |
| 91 | Ga0070693_100234238 | 3300005547 | Bacteria | 1210 |
| 92 | Ga0070693_100242105 | 3300005547 | Bacteria | 1192 |
| 93 | Ga0070693_100338144 | 3300005547 | Bacteria | 1027 |
| 94 | Ga0070693_100673605 | 3300005547 | Bacteria | 755 |
| 95 | Ga0070665_100013374 | 3300005548 | Bacteria | 8260 |
| 96 | Ga0070665_100139727 | 3300005548 | Bacteria | 2425 |
| 97 | Ga0070665_100447269 | 3300005548 | Bacteria | 1301 |
| 98 | Ga0070665_100927098 | 3300005548 | Bacteria | 883 |
| 99 | Ga0070665_101496051 | 3300005548 | Bacteria | 684 |
| 100 | Ga0068855_100035310 | 3300005563 | Bacteria | 5955 |
| 101 | Ga0068855_100116561 | 3300005563 | Bacteria | 3061 |
| 102 | Ga0068855_100252708 | 3300005563 | Bacteria | 1966 |
| 103 | Ga0068855_100687771 | 3300005563 | Bacteria | 1096 |
| 104 | Ga0068855_101034331 | 3300005563 | Bacteria | 861 |
| 105 | Ga0070664_101113871 | 3300005564 | Bacteria | 744 |
| 106 | Ga0068857_100047034 | 3300005577 | Bacteria | 3830 |
| 107 | Ga0068857_100171617 | 3300005577 | Bacteria | 1971 |
| 108 | Ga0068857_100259191 | 3300005577 | Bacteria | 1595 |
| 109 | Ga0068854_100086826 | 3300005578 | Bacteria | 2320 |
| 110 | Ga0068854_100121085 | 3300005578 | Bacteria | 1986 |
| 111 | Ga0068854_100197263 | 3300005578 | Bacteria | 1580 |
| 112 | Ga0068854_100247327 | 3300005578 | Bacteria | 1422 |
| 113 | Ga0068854_100380694 | 3300005578 | Bacteria | 1163 |
| 114 | Ga0068856_100002728 | 3300005614 | Bacteria | 18074 |
| 115 | Ga0068856_100006948 | 3300005614 | Bacteria | 11066 |
| 116 | Ga0068856_100009830 | 3300005614 | Bacteria | 9291 |
| 117 | Ga0068856_100050817 | 3300005614 | Bacteria | 4088 |
| 118 | Ga0068856_100055304 | 3300005614 | Bacteria | 3916 |
| 119 | Ga0068856_100084260 | 3300005614 | Bacteria | 3158 |
| 120 | Ga0068856_100163028 | 3300005614 | Bacteria | 2240 |
| 121 | Ga0068856_100539614 | 3300005614 | Bacteria | 1187 |
| 122 | Ga0068852_100006331 | 3300005616 | Bacteria | 8540 |
| 123 | Ga0068852_100057499 | 3300005616 | Bacteria | 3366 |
| 124 | Ga0068852_100102548 | 3300005616 | Bacteria | 2585 |
| 125 | Ga0068852_100141669 | 3300005616 | Bacteria | 2226 |
| 126 | Ga0068852_100229273 | 3300005616 | Bacteria | 1770 |
| 127 | Ga0068852_100500575 | 3300005616 | Bacteria | 1210 |
| 128 | Ga0068852_100585780 | 3300005616 | Bacteria | 1119 |
| 129 | Ga0068859_100373506 | 3300005617 | Bacteria | 1521 |
| 130 | Ga0068859_100825266 | 3300005617 | Bacteria | 1014 |
| 131 | Ga0068859_101448618 | 3300005617 | Bacteria | 758 |
| 132 | Ga0068864_100007872 | 3300005618 | Bacteria | 8782 |
| 133 | Ga0068864_100589705 | 3300005618 | Bacteria | 1078 |
| 134 | Ga0068866_10059226 | 3300005718 | Bacteria | 1981 |
| 135 | Ga0068861_100187739 | 3300005719 | Bacteria | 1725 |
| 136 | Ga0068851_10064729 | 3300005834 | Bacteria | 1879 |
| 137 | Ga0068851_10149013 | 3300005834 | Bacteria | 1278 |
| 138 | Ga0068863_100022985 | 3300005841 | Bacteria | 5959 |
| 139 | Ga0068863_100978124 | 3300005841 | Bacteria | 848 |
| 140 | Ga0068858_100209905 | 3300005842 | Bacteria | 1843 |
| 141 | Ga0068858_100220864 | 3300005842 | Bacteria | 1794 |
| 142 | Ga0068858_100260645 | 3300005842 | Bacteria | 1648 |
| 143 | Ga0068860_100000058 | 3300005843 | Bacteria | 197181 |
| 144 | Ga0081455_10036644 | 3300005937 | Bacteria | 4364 |
| 145 | Ga0081455_10071579 | 3300005937 | Bacteria | 2874 |
| 146 | Ga0081455_10093901 | 3300005937 | Bacteria | 2424 |
| 147 | Ga0081540_1002578 | 3300005983 | Bacteria | 14710 |
| 148 | Ga0081540_1003795 | 3300005983 | Bacteria | 11825 |
| 149 | Ga0081540_1010920 | 3300005983 | Bacteria | 6099 |
| 150 | Ga0081540_1029209 | 3300005983 | Bacteria | 3077 |
| 151 | Ga0081540_1030142 | 3300005983 | Bacteria | 3010 |
| 152 | Ga0081540_1104243 | 3300005983 | Bacteria | 1214 |
| 153 | Ga0081539_10000231 | 3300005985 | Bacteria | 131197 |
| 154 | Ga0081539_10099315 | 3300005985 | Bacteria | 1487 |
| 155 | Ga0081539_10164992 | 3300005985 | Bacteria | 1052 |
| 156 | Ga0070717_10003916 | 3300006028 | Bacteria | 10717 |
| 157 | Ga0070717_10091940 | 3300006028 | Bacteria | 2563 |
| 158 | Ga0070717_10477246 | 3300006028 | Bacteria | 1126 |
| 159 | Ga0070717_10849833 | 3300006028 | Bacteria | 830 |
| 160 | Ga0070717_10997088 | 3300006028 | Bacteria | 763 |
| 161 | Ga0075365_10144139 | 3300006038 | Bacteria | 1654 |
| 162 | Ga0075368_10026610 | 3300006042 | Bacteria | 2225 |
| 163 | Ga0075368_10108821 | 3300006042 | Bacteria | 1142 |
| 164 | Ga0075363_100015801 | 3300006048 | Bacteria | 3718 |
| 165 | Ga0075363_100298465 | 3300006048 | Bacteria | 935 |
| 166 | Ga0075364_10093420 | 3300006051 | Bacteria | 1997 |
| 167 | Ga0075364_10320340 | 3300006051 | Bacteria | 1056 |
| 168 | Ga0075364_10561077 | 3300006051 | Bacteria | 780 |
| 169 | Ga0070716_100003692 | 3300006173 | Bacteria | 7246 |
| 170 | Ga0070716_100072180 | 3300006173 | Bacteria | 2032 |
| 171 | Ga0070712_100040637 | 3300006175 | Bacteria | 3189 |
| 172 | Ga0070712_100075668 | 3300006175 | Bacteria | 2422 |
| 173 | Ga0070712_100076867 | 3300006175 | Bacteria | 2405 |
| 174 | Ga0070712_100607983 | 3300006175 | Bacteria | 926 |
| 175 | Ga0075362_10305097 | 3300006177 | Bacteria | 791 |
| 176 | Ga0075367_10024577 | 3300006178 | Bacteria | 3399 |
| 177 | Ga0075367_10032897 | 3300006178 | Bacteria | 2986 |
| 178 | Ga0075367_10050395 | 3300006178 | Bacteria | 2458 |
| 179 | Ga0075369_10098588 | 3300006186 | Bacteria | 1309 |
| 180 | Ga0075369_10152075 | 3300006186 | Bacteria | 1058 |
| 181 | Ga0075366_10025623 | 3300006195 | Bacteria | 3447 |
| 182 | Ga0075366_10053358 | 3300006195 | Bacteria | 2401 |
| 183 | Ga0075366_10336458 | 3300006195 | Bacteria | 925 |
| 184 | Ga0075366_10588223 | 3300006195 | Bacteria | 690 |
| 185 | Ga0075370_10032607 | 3300006353 | Bacteria | 2913 |
| 186 | Ga0075370_10040764 | 3300006353 | Bacteria | 2620 |
| 187 | Ga0075370_10069766 | 3300006353 | Bacteria | 2009 |
| 188 | Ga0075370_10135132 | 3300006353 | Bacteria | 1440 |
| 189 | Ga0075370_10171184 | 3300006353 | Bacteria | 1276 |
| 190 | Ga0068871_100145782 | 3300006358 | Bacteria | 2015 |
| 191 | Ga0068865_100049009 | 3300006881 | Bacteria | 2909 |
| 192 | Ga0075436_100162628 | 3300006914 | Bacteria | 1574 |
| 193 | Ga0097620_100373504 | 3300006931 | Bacteria | 1521 |
| 194 | Ga0097620_100825277 | 3300006931 | Bacteria | 1014 |
| 195 | Ga0097620_101448771 | 3300006931 | Bacteria | 758 |
| 196 | Ga0099824_1010180 | 3300006942 | Bacteria | 11239 |
| 197 | Ga0099822_1000628 | 3300006943 | Bacteria | 34929 |
| 198 | Ga0075435_100255419 | 3300007076 | Bacteria | 1492 |
| 199 | Ga0105250_10267511 | 3300009092 | Bacteria | 733 |
| 200 | Ga0105240_10002351 | 3300009093 | Bacteria | 30510 |
| 201 | Ga0105240_10016661 | 3300009093 | Bacteria | 9941 |
| 202 | Ga0105240_10114561 | 3300009093 | Bacteria | 3257 |
| 203 | Ga0105240_10375863 | 3300009093 | Bacteria | 1606 |
| 204 | Ga0111539_11956589 | 3300009094 | Bacteria | 680 |
| 205 | Ga0105245_10220323 | 3300009098 | Bacteria | 1830 |
| 206 | Ga0105245_10638444 | 3300009098 | Bacteria | 1094 |
| 207 | Ga0105247_10053945 | 3300009101 | Bacteria | 2480 |
| 208 | Ga0105243_10026993 | 3300009148 | Bacteria | 4397 |
| 209 | Ga0105241_10009864 | 3300009174 | Bacteria | 7018 |
| 210 | Ga0105241_10025759 | 3300009174 | Bacteria | 4372 |
| 211 | Ga0105241_10239860 | 3300009174 | Bacteria | 1532 |
| 212 | Ga0105241_10471031 | 3300009174 | Bacteria | 1115 |
| 213 | Ga0105241_10504639 | 3300009174 | Bacteria | 1079 |
| 214 | Ga0105242_10691852 | 3300009176 | Bacteria | 996 |
| 215 | Ga0105248_10219140 | 3300009177 | Bacteria | 2143 |
| 216 | Ga0105237_10005556 | 3300009545 | Bacteria | 14219 |
| 217 | Ga0105237_10049350 | 3300009545 | Bacteria | 4231 |
| 218 | Ga0105237_10064509 | 3300009545 | Bacteria | 3659 |
| 219 | Ga0105237_10159230 | 3300009545 | Bacteria | 2255 |
| 220 | Ga0105237_10205574 | 3300009545 | Bacteria | 1969 |
| 221 | Ga0105237_10676546 | 3300009545 | Bacteria | 1039 |
| 222 | Ga0105238_10002811 | 3300009551 | Bacteria | 17365 |
| 223 | Ga0105238_10012890 | 3300009551 | Bacteria | 8437 |
| 224 | Ga0105238_10029984 | 3300009551 | Bacteria | 5537 |
| 225 | Ga0105238_10089121 | 3300009551 | Bacteria | 3072 |
| 226 | Ga0105238_10166380 | 3300009551 | Bacteria | 2181 |
| 227 | Ga0105238_11316535 | 3300009551 | Bacteria | 749 |
| 228 | Ga0105249_10287455 | 3300009553 | Bacteria | 1644 |
| 229 | Ga0105249_10525060 | 3300009553 | Bacteria | 1232 |
| 230 | Ga0105249_10577942 | 3300009553 | Bacteria | 1177 |
| 231 | Ga0099796_10165062 | 3300010159 | Bacteria | 880 |
| 232 | Ga0105239_10042814 | 3300010375 | Bacteria | 4962 |
| 233 | Ga0105239_10149955 | 3300010375 | Bacteria | 2602 |
| 234 | Ga0105239_10182089 | 3300010375 | Bacteria | 2351 |
| 235 | Ga0105239_10948266 | 3300010375 | Bacteria | 988 |
| 236 | Ga0105246_10017342 | 3300011119 | Bacteria | 4575 |
| 237 | Ga0105246_10037124 | 3300011119 | Bacteria | 3268 |
| 238 | Ga0157341_1006635 | 3300012494 | Bacteria | 902 |
| 239 | Ga0157370_10086076 | 3300013104 | Bacteria | 2953 |
| 240 | Ga0157370_10136125 | 3300013104 | Bacteria | 2289 |
| 241 | Ga0157369_10006882 | 3300013105 | Bacteria | 13122 |
| 242 | Ga0157369_10061176 | 3300013105 | Bacteria | 4060 |
| 243 | Ga0157369_10371627 | 3300013105 | Bacteria | 1484 |
| 244 | Ga0157374_10490957 | 3300013296 | Bacteria | 1232 |
| 245 | Ga0157378_10215669 | 3300013297 | Bacteria | 1822 |
| 246 | Ga0163162_10231677 | 3300013306 | Bacteria | 1977 |
| 247 | Ga0163162_10285062 | 3300013306 | Bacteria | 1783 |
| 248 | Ga0163162_10526893 | 3300013306 | Bacteria | 1311 |
| 249 | Ga0157372_10055769 | 3300013307 | Bacteria | 4414 |
| 250 | Ga0157372_10594922 | 3300013307 | Bacteria | 1289 |
| 251 | Ga0157372_10621543 | 3300013307 | Bacteria | 1259 |
| 252 | Ga0157372_10899318 | 3300013307 | Bacteria | 1027 |
| 253 | Ga0157372_11328575 | 3300013307 | Bacteria | 829 |
| 254 | Ga0157375_10044534 | 3300013308 | Bacteria | 4312 |
| 255 | Ga0157375_10214507 | 3300013308 | Bacteria | 2082 |
| 256 | Ga0157375_10478137 | 3300013308 | Bacteria | 1411 |
| 257 | Ga0163163_10042480 | 3300014325 | Bacteria | 4453 |
| 258 | Ga0163163_10293527 | 3300014325 | Bacteria | 1678 |
| 259 | Ga0157379_10103216 | 3300014968 | Bacteria | 2558 |
| 260 | Ga0157376_10009356 | 3300014969 | Bacteria | 7120 |
| 261 | Ga0157376_10351401 | 3300014969 | Bacteria | 1411 |
| 262 | Ga0157376_10513207 | 3300014969 | Bacteria | 1180 |
| 263 | Ga0157376_10977368 | 3300014969 | Bacteria | 868 |
| 264 | Ga0206354_11538885 | 3300020081 | Bacteria | 1236 |
| 265 | Ga0206353_11968516 | 3300020082 | Bacteria | 913 |
| 266 | Ga0214544_1000009 | 3300021320 | Bacteria | 285865 |
| 267 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 268 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 269 | Ga0214543_1000013 | 3300021327 | Bacteria | 329117 |
| 270 | Ga0213872_10284224 | 3300021361 | Bacteria | 690 |
| 271 | Ga0213876_10305914 | 3300021384 | Bacteria | 845 |
| 272 | Ga0209677_101611 | 3300025253 | Bacteria | 9518 |
| 273 | Ga0209233_1006609 | 3300025261 | Bacteria | 3724 |
| 274 | Ga0209455_1002229 | 3300025272 | Bacteria | 7636 |
| 275 | Ga0207673_1012601 | 3300025290 | Bacteria | 1104 |
| 276 | Ga0209758_1001125 | 3300025297 | Bacteria | 34352 |
| 277 | Ga0209758_1009234 | 3300025297 | Bacteria | 6184 |
| 278 | Ga0209257_1028631 | 3300025304 | Bacteria | 1830 |
| 279 | Ga0207697_10238837 | 3300025315 | Bacteria | 803 |
| 280 | Ga0207656_10024925 | 3300025321 | Bacteria | 2424 |
| 281 | Ga0207656_10055141 | 3300025321 | Bacteria | 1729 |
| 282 | Ga0207653_10065922 | 3300025885 | Bacteria | 1230 |
| 283 | Ga0207692_10001752 | 3300025898 | Bacteria | 8233 |
| 284 | Ga0207692_10005509 | 3300025898 | Bacteria | 5078 |
| 285 | Ga0207642_10048621 | 3300025899 | Bacteria | 1902 |
| 286 | Ga0207688_10002338 | 3300025901 | Bacteria | 10187 |
| 287 | Ga0207688_10052823 | 3300025901 | Bacteria | 2278 |
| 288 | Ga0207680_10274826 | 3300025903 | Bacteria | 1169 |
| 289 | Ga0207680_10677767 | 3300025903 | Bacteria | 739 |
| 290 | Ga0207647_10011930 | 3300025904 | Bacteria | 6068 |
| 291 | Ga0207685_10074666 | 3300025905 | Bacteria | 1385 |
| 292 | Ga0207699_10002559 | 3300025906 | Bacteria | 8579 |
| 293 | Ga0207699_10143709 | 3300025906 | Bacteria | 1571 |
| 294 | Ga0207699_10215811 | 3300025906 | Bacteria | 1307 |
| 295 | Ga0207645_10047651 | 3300025907 | Bacteria | 2737 |
| 296 | Ga0207645_10150153 | 3300025907 | Bacteria | 1521 |
| 297 | Ga0207643_10006512 | 3300025908 | Bacteria | 6255 |
| 298 | Ga0207684_10338263 | 3300025910 | Bacteria | 1296 |
| 299 | Ga0207654_10000968 | 3300025911 | Bacteria | 15767 |
| 300 | Ga0207654_10008714 | 3300025911 | Bacteria | 5143 |
| 301 | Ga0207654_10167707 | 3300025911 | Bacteria | 1423 |
| 302 | Ga0207654_10454345 | 3300025911 | Bacteria | 899 |
| 303 | Ga0207707_10004344 | 3300025912 | Bacteria | 12544 |
| 304 | Ga0207707_10022114 | 3300025912 | Bacteria | 5559 |
| 305 | Ga0207707_10041877 | 3300025912 | Bacteria | 3999 |
| 306 | Ga0207707_10120934 | 3300025912 | Bacteria | 2289 |
| 307 | Ga0207707_10121544 | 3300025912 | Bacteria | 2283 |
| 308 | Ga0207695_10000278 | 3300025913 | Bacteria | 127446 |
| 309 | Ga0207695_10003702 | 3300025913 | Bacteria | 21304 |
| 310 | Ga0207695_10042990 | 3300025913 | Bacteria | 4819 |
| 311 | Ga0207695_10073482 | 3300025913 | Bacteria | 3484 |
| 312 | Ga0207695_10117566 | 3300025913 | Bacteria | 2631 |
| 313 | Ga0207695_10320641 | 3300025913 | Bacteria | 1439 |
| 314 | Ga0207671_10005180 | 3300025914 | Bacteria | 12117 |
| 315 | Ga0207671_10024084 | 3300025914 | Bacteria | 4582 |
| 316 | Ga0207671_10034231 | 3300025914 | Bacteria | 3776 |
| 317 | Ga0207671_10122118 | 3300025914 | Bacteria | 1992 |
| 318 | Ga0207671_10219494 | 3300025914 | Bacteria | 1489 |
| 319 | Ga0207671_10297480 | 3300025914 | Bacteria | 1275 |
| 320 | Ga0207671_10651427 | 3300025914 | Bacteria | 839 |
| 321 | Ga0207671_10887377 | 3300025914 | Bacteria | 705 |
| 322 | Ga0207693_10019182 | 3300025915 | Bacteria | 5442 |
| 323 | Ga0207693_10029736 | 3300025915 | Bacteria | 4312 |
| 324 | Ga0207693_10961866 | 3300025915 | Bacteria | 653 |
| 325 | Ga0207663_10006350 | 3300025916 | Bacteria | 6042 |
| 326 | Ga0207663_10539421 | 3300025916 | Bacteria | 911 |
| 327 | Ga0207663_10848597 | 3300025916 | Bacteria | 729 |
| 328 | Ga0207660_10019474 | 3300025917 | Bacteria | 4537 |
| 329 | Ga0207660_10055543 | 3300025917 | Bacteria | 2830 |
| 330 | Ga0207660_10237183 | 3300025917 | Bacteria | 1436 |
| 331 | Ga0207662_10001714 | 3300025918 | Bacteria | 10736 |
| 332 | Ga0207662_10051728 | 3300025918 | Bacteria | 2444 |
| 333 | Ga0207657_10095539 | 3300025919 | Bacteria | 2473 |
| 334 | Ga0207657_10400965 | 3300025919 | Bacteria | 1079 |
| 335 | Ga0207652_10010300 | 3300025921 | Bacteria | 7526 |
| 336 | Ga0207652_10016438 | 3300025921 | Bacteria | 6042 |
| 337 | Ga0207652_10025314 | 3300025921 | Bacteria | 4932 |
| 338 | Ga0207652_10062600 | 3300025921 | Bacteria | 3215 |
| 339 | Ga0207646_10141577 | 3300025922 | Bacteria | 2167 |
| 340 | Ga0207694_10001639 | 3300025924 | Bacteria | 18837 |
| 341 | Ga0207694_10008346 | 3300025924 | Bacteria | 7829 |
| 342 | Ga0207694_10090314 | 3300025924 | Bacteria | 2417 |
| 343 | Ga0207694_10135367 | 3300025924 | Bacteria | 1978 |
| 344 | Ga0207694_10161031 | 3300025924 | Bacteria | 1812 |
| 345 | Ga0207694_10208163 | 3300025924 | Bacteria | 1593 |
| 346 | Ga0207694_10546820 | 3300025924 | Bacteria | 972 |
| 347 | Ga0207650_11004332 | 3300025925 | Bacteria | 710 |
| 348 | Ga0207687_10032431 | 3300025927 | Bacteria | 3538 |
| 349 | Ga0207687_10476443 | 3300025927 | Bacteria | 1039 |
| 350 | Ga0207687_10492637 | 3300025927 | Bacteria | 1022 |
| 351 | Ga0207687_10864379 | 3300025927 | Bacteria | 773 |
| 352 | Ga0207700_10027152 | 3300025928 | Bacteria | 4004 |
| 353 | Ga0207700_10041009 | 3300025928 | Bacteria | 3383 |
| 354 | Ga0207700_10104431 | 3300025928 | Bacteria | 2267 |
| 355 | Ga0207700_10164085 | 3300025928 | Bacteria | 1847 |
| 356 | Ga0207700_10258994 | 3300025928 | Bacteria | 1489 |
| 357 | Ga0207700_10472986 | 3300025928 | Bacteria | 1107 |
| 358 | Ga0207664_10045700 | 3300025929 | Bacteria | 3435 |
| 359 | Ga0207644_10074379 | 3300025931 | Bacteria | 2493 |
| 360 | Ga0207644_10542107 | 3300025931 | Bacteria | 962 |
| 361 | Ga0207644_10875510 | 3300025931 | Bacteria | 752 |
| 362 | Ga0207690_10135787 | 3300025932 | Bacteria | 1806 |
| 363 | Ga0207706_10113863 | 3300025933 | Bacteria | 2379 |
| 364 | Ga0207706_10140630 | 3300025933 | Bacteria | 2123 |
| 365 | Ga0207706_10187062 | 3300025933 | Bacteria | 1818 |
| 366 | Ga0207706_10398482 | 3300025933 | Bacteria | 1193 |
| 367 | Ga0207706_10888945 | 3300025933 | Bacteria | 753 |
| 368 | Ga0207709_10032468 | 3300025935 | Bacteria | 3057 |
| 369 | Ga0207709_10077357 | 3300025935 | Bacteria | 2133 |
| 370 | Ga0207670_10972371 | 3300025936 | Bacteria | 713 |
| 371 | Ga0207669_10011218 | 3300025937 | Bacteria | 4352 |
| 372 | Ga0207669_10161329 | 3300025937 | Bacteria | 1584 |
| 373 | Ga0207704_10184354 | 3300025938 | Bacteria | 1511 |
| 374 | Ga0207665_10058127 | 3300025939 | Bacteria | 2614 |
| 375 | Ga0207665_10087672 | 3300025939 | Bacteria | 2151 |
| 376 | Ga0207665_10171079 | 3300025939 | Bacteria | 1569 |
| 377 | Ga0207665_10329272 | 3300025939 | Bacteria | 1148 |
| 378 | Ga0207691_10042708 | 3300025940 | Bacteria | 4178 |
| 379 | Ga0207691_10260187 | 3300025940 | Bacteria | 1496 |
| 380 | Ga0207711_10308200 | 3300025941 | Bacteria | 1461 |
| 381 | Ga0207711_11238013 | 3300025941 | Bacteria | 688 |
| 382 | Ga0207689_10095548 | 3300025942 | Bacteria | 2441 |
| 383 | Ga0207661_10017104 | 3300025944 | Bacteria | 5358 |
| 384 | Ga0207661_10186991 | 3300025944 | Bacteria | 1813 |
| 385 | Ga0207661_11014870 | 3300025944 | Bacteria | 764 |
| 386 | Ga0207679_10894640 | 3300025945 | Bacteria | 812 |
| 387 | Ga0207667_10043177 | 3300025949 | Bacteria | 4785 |
| 388 | Ga0207667_10045339 | 3300025949 | Bacteria | 4657 |
| 389 | Ga0207667_10116225 | 3300025949 | Bacteria | 2757 |
| 390 | Ga0207667_10498658 | 3300025949 | Bacteria | 1235 |
| 391 | Ga0207667_10906327 | 3300025949 | Bacteria | 873 |
| 392 | Ga0207651_10109154 | 3300025960 | Bacteria | 2072 |
| 393 | Ga0207651_10314966 | 3300025960 | Bacteria | 1306 |
| 394 | Ga0207651_10805219 | 3300025960 | Bacteria | 833 |
| 395 | Ga0207712_10092332 | 3300025961 | Bacteria | 2232 |
| 396 | Ga0207668_10063562 | 3300025972 | Bacteria | 2604 |
| 397 | Ga0207640_10066703 | 3300025981 | Bacteria | 2405 |
| 398 | Ga0207640_10548566 | 3300025981 | Bacteria | 971 |
| 399 | Ga0207640_10679866 | 3300025981 | Bacteria | 880 |
| 400 | Ga0207640_10886821 | 3300025981 | Bacteria | 778 |
| 401 | Ga0207658_10408125 | 3300025986 | Bacteria | 1195 |
| 402 | Ga0207677_10149600 | 3300026023 | Bacteria | 1799 |
| 403 | Ga0207677_11129860 | 3300026023 | Bacteria | 715 |
| 404 | Ga0207703_10041355 | 3300026035 | Bacteria | 3692 |
| 405 | Ga0207703_10146969 | 3300026035 | Bacteria | 2051 |
| 406 | Ga0207703_10354173 | 3300026035 | Bacteria | 1352 |
| 407 | Ga0207703_10798964 | 3300026035 | Bacteria | 901 |
| 408 | Ga0207639_10006291 | 3300026041 | Bacteria | 8064 |
| 409 | Ga0207639_10019559 | 3300026041 | Bacteria | 4831 |
| 410 | Ga0207639_10045790 | 3300026041 | Bacteria | 3297 |
| 411 | Ga0207639_10229558 | 3300026041 | Bacteria | 1608 |
| 412 | Ga0207678_10043525 | 3300026067 | Bacteria | 3885 |
| 413 | Ga0207678_10054200 | 3300026067 | Bacteria | 3453 |
| 414 | Ga0207678_10087237 | 3300026067 | Bacteria | 2667 |
| 415 | Ga0207678_10160060 | 3300026067 | Bacteria | 1923 |
| 416 | Ga0207678_10185279 | 3300026067 | Bacteria | 1778 |
| 417 | Ga0207678_10227723 | 3300026067 | Bacteria | 1596 |
| 418 | Ga0207708_10004954 | 3300026075 | Bacteria | 9817 |
| 419 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 420 | Ga0207702_10000178 | 3300026078 | Bacteria | 76683 |
| 421 | Ga0207702_10027968 | 3300026078 | Bacteria | 4685 |
| 422 | Ga0207702_10067559 | 3300026078 | Bacteria | 3068 |
| 423 | Ga0207702_10070749 | 3300026078 | Bacteria | 3001 |
| 424 | Ga0207702_10272486 | 3300026078 | Bacteria | 1597 |
| 425 | Ga0207702_11062335 | 3300026078 | Bacteria | 803 |
| 426 | Ga0207641_10157159 | 3300026088 | Bacteria | 2064 |
| 427 | Ga0207641_11016159 | 3300026088 | Bacteria | 826 |
| 428 | Ga0207648_10076745 | 3300026089 | Bacteria | 2913 |
| 429 | Ga0207648_11309995 | 3300026089 | Bacteria | 681 |
| 430 | Ga0207676_10947386 | 3300026095 | Bacteria | 846 |
| 431 | Ga0207674_10024477 | 3300026116 | Bacteria | 6452 |
| 432 | Ga0207675_100043261 | 3300026118 | Bacteria | 4206 |
| 433 | Ga0207675_100110343 | 3300026118 | Bacteria | 2595 |
| 434 | Ga0207675_100178189 | 3300026118 | Bacteria | 2034 |
| 435 | Ga0207675_102359260 | 3300026118 | Bacteria | 545 |
| 436 | Ga0207683_10023473 | 3300026121 | Bacteria | 5307 |
| 437 | Ga0207683_10048974 | 3300026121 | Bacteria | 3698 |
| 438 | Ga0207683_10147852 | 3300026121 | Bacteria | 2120 |
| 439 | Ga0207698_10002333 | 3300026142 | Bacteria | 11239 |
| 440 | Ga0207698_10160972 | 3300026142 | Bacteria | 1963 |
| 441 | Ga0207698_10185779 | 3300026142 | Bacteria | 1846 |
| 442 | Ga0207698_10248303 | 3300026142 | Bacteria | 1626 |
| 443 | Ga0207698_10290591 | 3300026142 | Bacteria | 1517 |
| 444 | Ga0207698_10342758 | 3300026142 | Bacteria | 1408 |
| 445 | Ga0207698_10452135 | 3300026142 | Bacteria | 1240 |
| 446 | Ga0209589_1000023 | 3300027357 | Bacteria | 177856 |
| 447 | Ga0209489_100032 | 3300027361 | Bacteria | 177856 |
| 448 | Ga0209700_100040 | 3300027363 | Bacteria | 177856 |
| 449 | Ga0209813_10055693 | 3300027866 | Bacteria | 1250 |
| 450 | Ga0207428_10063792 | 3300027907 | Bacteria | 2910 |
| 451 | Ga0268266_10003342 | 3300028379 | Bacteria | 16063 |
| 452 | Ga0268266_10006607 | 3300028379 | Bacteria | 10586 |
| 453 | Ga0268266_10104930 | 3300028379 | Bacteria | 2496 |
| 454 | Ga0268266_10129995 | 3300028379 | Bacteria | 2251 |
| 455 | Ga0268266_10400565 | 3300028379 | Bacteria | 1297 |
| 456 | Ga0268265_10051933 | 3300028380 | Bacteria | 3097 |
| 457 | Ga0268265_10090144 | 3300028380 | Bacteria | 2448 |
| 458 | Ga0268265_10397904 | 3300028380 | Bacteria | 1272 |
| 459 | Ga0268265_10927663 | 3300028380 | Bacteria | 856 |
| 460 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 461 | Ga0265334_10038040 | 3300028573 | Bacteria | 1895 |
| 462 | Ga0307517_10005009 | 3300028786 | Bacteria | 20143 |
| 463 | Ga0307515_10360792 | 3300028794 | Bacteria | 1094 |
| 464 | Ga0307515_10465256 | 3300028794 | Bacteria | 878 |
| 465 | Ga0265338_10011282 | 3300028800 | Bacteria | 10340 |
| 466 | Ga0265324_10075378 | 3300029957 | Bacteria | 1148 |
| 467 | Ga0307511_10049942 | 3300030521 | Bacteria | 3376 |
| 468 | Ga0265332_10010231 | 3300031238 | Bacteria | 4176 |
| 469 | Ga0265332_10041790 | 3300031238 | Bacteria | 1983 |
| 470 | Ga0265332_10091618 | 3300031238 | Bacteria | 1285 |
| 471 | Ga0265328_10031272 | 3300031239 | Bacteria | 1979 |
| 472 | Ga0265325_10042863 | 3300031241 | Bacteria | 2363 |
| 473 | Ga0265325_10055000 | 3300031241 | Bacteria | 2036 |
| 474 | Ga0265340_10035821 | 3300031247 | Bacteria | 2462 |
| 475 | Ga0265339_10000066 | 3300031249 | Bacteria | 91908 |
| 476 | Ga0265339_10064959 | 3300031249 | Bacteria | 1957 |
| 477 | Ga0265331_10012784 | 3300031250 | Bacteria | 4535 |
| 478 | Ga0265331_10166934 | 3300031250 | Bacteria | 997 |
| 479 | Ga0265316_10257402 | 3300031344 | Bacteria | 1280 |
| 480 | Ga0307509_10510207 | 3300031507 | Bacteria | 885 |
| 481 | Ga0307509_10555870 | 3300031507 | Bacteria | 825 |
| 482 | Ga0307509_10588347 | 3300031507 | Bacteria | 786 |
| 483 | Ga0265313_10002033 | 3300031595 | Bacteria | 18144 |
| 484 | Ga0307508_10000009 | 3300031616 | Bacteria | 256966 |
| 485 | Ga0307508_10038432 | 3300031616 | Bacteria | 4303 |
| 486 | Ga0307508_10190796 | 3300031616 | Bacteria | 1650 |
| 487 | Ga0265314_10029611 | 3300031711 | Bacteria | 4066 |
| 488 | Ga0265314_10158677 | 3300031711 | Bacteria | 1379 |
| 489 | Ga0307516_10011105 | 3300031730 | Bacteria | 9834 |
| 490 | Ga0307516_10086685 | 3300031730 | Bacteria | 2966 |
| 491 | Ga0307416_100699828 | 3300032002 | Bacteria | 1102 |
| 492 | Ga0307416_100938635 | 3300032002 | Bacteria | 967 |
| 493 | Ga0307414_10871574 | 3300032004 | Bacteria | 824 |
| 494 | Ga0307415_100050285 | 3300032126 | Bacteria | 2823 |
| 495 | Ga0307507_10025380 | 3300033179 | Bacteria | 6430 |
| 496 | Ga0307510_10008758 | 3300033180 | Bacteria | 12062 |
| 497 | Ga0307510_10053344 | 3300033180 | Bacteria | 4251 |
| 498 | Ga0307510_10095668 | 3300033180 | Bacteria | 2789 |
| 499 | Ga0307510_10161379 | 3300033180 | Bacteria | 1838 |
| 500 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 501 | Ga0316215_1000469 | 3300033544 | Bacteria | 4618 |
| 502 | Ga0373930_0152237 | 3300034816 | Bacteria | 581 |
| 503 | Ga0373950_0091029 | 3300034818 | Bacteria | 648 |
| 504 | Ga0373926_0037844 | 3300035083 | Bacteria | 1717 |
| 505 | Ga0373934_0014733 | 3300035086 | Bacteria | 2962 |
| 506 | Ga0373923_0020753 | 3300035111 | Bacteria | 2556 |
| 507 | Ga0373923_0028095 | 3300035111 | Bacteria | 2248 |
| 508 | Ga0373923_0205205 | 3300035111 | Bacteria | 912 |
| 509 | Ga0373932_0264813 | 3300035112 | Bacteria | 631 |
| 510 | Ga0373936_0011983 | 3300035113 | Bacteria | 3291 |
| 511 | Ga0373936_0089961 | 3300035113 | Bacteria | 1286 |
| 512 | Ga0373945_0005636 | 3300035116 | Bacteria | 4014 |
| 513 | Ga0373953_0000171 | 3300035117 | Bacteria | 17129 |
| 514 | Ga0373953_0049065 | 3300035117 | Bacteria | 1702 |
| 515 | Ga0373954_0001704 | 3300035118 | Bacteria | 9020 |
| 516 | Ga0373956_0024416 | 3300035119 | Bacteria | 2604 |
| 517 | Ga0373957_0000100 | 3300035120 | Bacteria | 20828 |
| 518 | Ga0373957_0058441 | 3300035120 | Bacteria | 1490 |
| 519 | Ga0373960_0329036 | 3300035121 | Bacteria | 575 |
| 520 | Ga0373943_0028011 | 3300035170 | Bacteria | 2652 |
| 521 | Ga0373943_0225514 | 3300035170 | Bacteria | 1045 |
| 522 | Ga0373946_0003172 | 3300035171 | Bacteria | 5826 |
| 523 | Ga0373955_0001365 | 3300035172 | Bacteria | 10370 |
| 524 | Ga0373955_0032088 | 3300035172 | Bacteria | 2754 |
| 525 | Ga0373931_0064956 | 3300035691 | Bacteria | 1977 |
| 526 | Ga0373935_0003830 | 3300035692 | Bacteria | 8772 |
| 527 | Ga0373935_0075594 | 3300035692 | Bacteria | 2179 |
| 528 | Ga0373935_0076730 | 3300035692 | Bacteria | 2164 |
| 529 | Ga0373935_0201660 | 3300035692 | Bacteria | 1375 |
| 530 | Ga0373935_0720647 | 3300035692 | Bacteria | 734 |
| 531 | Ga0373927_0000069 | 3300035695 | Bacteria | 74096 |
| 532 | Ga0373927_0050140 | 3300035695 | Bacteria | 2698 |
| 533 | Ga0373927_0058242 | 3300035695 | Bacteria | 2498 |
| 534 | Ga0373927_0067439 | 3300035695 | Bacteria | 2315 |
| 535 | Ga0373933_0000781 | 3300035724 | Bacteria | 19421 |
| 536 | Ga0373933_0002823 | 3300035724 | Bacteria | 9705 |
| 537 | Ga0373933_0546546 | 3300035724 | Bacteria | 760 |
| 538 | Ga0373947_0008029 | 3300035725 | Bacteria | 6088 |
| 539 | Ga0373947_0012802 | 3300035725 | Bacteria | 4808 |
| 540 | Ga0373947_0034922 | 3300035725 | Bacteria | 2975 |
| 541 | Ga0373947_0500833 | 3300035725 | Bacteria | 825 |
| 542 | Ga0373937_0007517 | 3300036401 | Bacteria | 9432 |
| 543 | Ga0373937_0061733 | 3300036401 | Bacteria | 3445 |
| 544 | Ga0373937_0150934 | 3300036401 | Bacteria | 2176 |
| 545 | Ga0373937_0233024 | 3300036401 | Bacteria | 1734 |
| 546 | Ga0373925_0003396 | 3300037068 | Bacteria | 12347 |
| 547 | Ga0373925_0016611 | 3300037068 | Bacteria | 5332 |
| 548 | Ga0373925_0035208 | 3300037068 | Bacteria | 3693 |
| 549 | Ga0395899_0082407 | 3300037312 | Bacteria | 2340 |
| 550 | Ga0395900_0000860 | 3300037418 | Bacteria | 40028 |
| 551 | Ga0395900_0084203 | 3300037418 | Bacteria | 3267 |
| 552 | Ga0395900_0268294 | 3300037418 | Bacteria | 1702 |
| 553 | Ga0395900_0342245 | 3300037418 | Bacteria | 1471 |
| 554 | Ga0395900_1035212 | 3300037418 | Bacteria | 740 |
| 555 | Ga0395898_0032210 | 3300037466 | Bacteria | 5232 |
| 556 | Ga0395898_0099348 | 3300037466 | Bacteria | 2795 |
| 557 | Ga0395898_0148062 | 3300037466 | Bacteria | 2247 |
| 558 | Ga0395898_0208224 | 3300037466 | Bacteria | 1866 |
| 559 | Ga0395898_0308246 | 3300037466 | Bacteria | 1510 |
| 560 | Ga0395905_0197051 | 3300037471 | Bacteria | 1888 |
| 561 | Ga0395905_0385734 | 3300037471 | Bacteria | 1295 |
| 562 | Ga0395905_0780805 | 3300037471 | Bacteria | 858 |
| 563 | Ga0436364_0066298 | 3300037853 | Bacteria | 1971 |
| 564 | Ga0395901_0041679 | 3300038443 | Bacteria | 4759 |
| 565 | Ga0395901_0092102 | 3300038443 | Bacteria | 3173 |
| 566 | Ga0395901_0444175 | 3300038443 | Bacteria | 1327 |
| 567 | Ga0395901_0896152 | 3300038443 | Bacteria | 869 |
| 568 | Ga0436365_0353234 | 3300039437 | Bacteria | 2668 |
| 569 | Ga0436365_1305911 | 3300039437 | Bacteria | 901 |
| 570 | Ga0436360_1275075 | 3300039438 | Bacteria | 670 |
| 571 | Ga0436360_1278402 | 3300039438 | Bacteria | 3589 |
| 572 | Ga0436361_0305956 | 3300039447 | Bacteria | 1898 |
| 573 | Ga0436361_0472856 | 3300039447 | Bacteria | 1649 |
| 574 | Ga0436363_0184448 | 3300039450 | Bacteria | 754 |
| 575 | Ga0436363_0607928 | 3300039450 | Bacteria | 1051 |
| 576 | Ga0436363_0694729 | 3300039450 | Bacteria | 722 |
| 577 | Ga0436362_0352029 | 3300039453 | Bacteria | 1081 |
| 578 | Ga0436362_0920921 | 3300039453 | Bacteria | 617 |
| 579 | Ga0436362_1022971 | 3300039453 | Bacteria | 640 |
| 580 | Ga0439465_0170381 | 3300041413 | Bacteria | 784 |
| 581 | Ga0451791_0809607 | 3300041451 | Bacteria | 545 |
| 582 | Ga0451793_0170774 | 3300041452 | Bacteria | 857 |
| 583 | Ga0451800_1456892 | 3300041459 | Bacteria | 797 |
| 584 | Ga0451802_1071351 | 3300041460 | Bacteria | 540 |
| 585 | Ga0451804_0302326 | 3300041463 | Bacteria | 812 |
| 586 | Ga0451853_0473357 | 3300041512 | Bacteria | 1592 |
| 587 | Ga0466972_0129401 | 3300044658 | Bacteria | 1189 |
| 588 | Ga0466963_0177299 | 3300044694 | Bacteria | 1487 |
| 589 | Ga0466964_0138432 | 3300044706 | Bacteria | 1116 |
| 590 | Ga0466957_0351794 | 3300044842 | Bacteria | 1000 |
| 591 | Ga0466957_0531114 | 3300044842 | Bacteria | 818 |
| 592 | Ga0466960_0500849 | 3300044901 | Bacteria | 712 |
| 593 | Ga0466959_0167491 | 3300045049 | Bacteria | 1542 |
| 594 | Ga0466958_0102701 | 3300045836 | Bacteria | 1779 |
| 595 | Ga0466967_0031972 | 3300045976 | Bacteria | 4438 |
| 596 | Ga0466967_0044464 | 3300045976 | Bacteria | 3853 |
| 597 | Ga0466967_0287806 | 3300045976 | Bacteria | 1578 |
| 598 | Ga0466967_0667046 | 3300045976 | Bacteria | 1029 |
| 599 | Ga0495592_0000890 | 3300046454 | Bacteria | 20716 |
| 600 | Ga0495592_0011137 | 3300046454 | Bacteria | 6792 |
| 601 | Ga0495592_0217289 | 3300046454 | Bacteria | 1280 |
| 602 | Ga0495603_0001909 | 3300046455 | Bacteria | 12296 |
| 603 | Ga0495603_0014989 | 3300046455 | Bacteria | 4687 |
| 604 | Ga0495603_0019319 | 3300046455 | Bacteria | 4124 |
| 605 | Ga0495603_0057286 | 3300046455 | Bacteria | 2306 |
| 606 | Ga0495603_0076075 | 3300046455 | Bacteria | 1970 |
| 607 | Ga0495629_0000083 | 3300046459 | Bacteria | 83715 |
| 608 | Ga0495629_0001665 | 3300046459 | Bacteria | 17436 |
| 609 | Ga0495629_0093534 | 3300046459 | Bacteria | 2098 |
| 610 | Ga0495629_0152215 | 3300046459 | Bacteria | 1608 |
| 611 | Ga0495638_0344159 | 3300046460 | Bacteria | 789 |
| 612 | Ga0495641_0154902 | 3300046461 | Bacteria | 1025 |
| 613 | Ga0495651_0004120 | 3300046462 | Bacteria | 11129 |
| 614 | Ga0495653_0000905 | 3300046463 | Bacteria | 22949 |
| 615 | Ga0495653_0065868 | 3300046463 | Bacteria | 2726 |
| 616 | Ga0495580_0001769 | 3300046472 | Bacteria | 18986 |
| 617 | Ga0495580_0041958 | 3300046472 | Bacteria | 3261 |
| 618 | Ga0495580_0515331 | 3300046472 | Bacteria | 797 |
| 619 | Ga0495582_0000206 | 3300046473 | Bacteria | 32664 |
| 620 | Ga0495582_0045731 | 3300046473 | Bacteria | 2411 |
| 621 | Ga0495582_0320920 | 3300046473 | Bacteria | 891 |
| 622 | Ga0495639_0000167 | 3300046475 | Bacteria | 34509 |
| 623 | Ga0495639_0034070 | 3300046475 | Bacteria | 2277 |
| 624 | Ga0495639_0158236 | 3300046475 | Bacteria | 1095 |
| 625 | Ga0495639_0349181 | 3300046475 | Bacteria | 743 |
| 626 | Ga0495662_0000457 | 3300046476 | Bacteria | 18414 |
| 627 | Ga0495662_0028582 | 3300046476 | Bacteria | 2692 |
| 628 | Ga0495664_0049306 | 3300046477 | Bacteria | 2499 |
| 629 | Ga0495664_0079556 | 3300046477 | Bacteria | 1964 |
| 630 | Ga0495664_0120092 | 3300046477 | Bacteria | 1590 |
| 631 | Ga0495664_0129718 | 3300046477 | Bacteria | 1526 |
| 632 | Ga0495594_0000838 | 3300046499 | Bacteria | 15872 |
| 633 | Ga0495594_0308187 | 3300046499 | Bacteria | 902 |
| 634 | Ga0495607_0254486 | 3300046501 | Bacteria | 844 |
| 635 | Ga0495606_0028639 | 3300046507 | Bacteria | 3925 |
| 636 | Ga0495606_0190269 | 3300046507 | Bacteria | 1177 |
| 637 | Ga0495608_0005206 | 3300046511 | Bacteria | 9295 |
| 638 | Ga0495610_0029532 | 3300046512 | Bacteria | 2885 |
| 639 | Ga0495618_0053488 | 3300046514 | Bacteria | 2553 |
| 640 | Ga0495618_0124131 | 3300046514 | Bacteria | 1653 |
| 641 | Ga0495628_0013690 | 3300046516 | Bacteria | 6816 |
| 642 | Ga0495628_0046174 | 3300046516 | Bacteria | 3460 |
| 643 | Ga0495628_0106349 | 3300046516 | Bacteria | 2161 |
| 644 | Ga0495628_0250064 | 3300046516 | Bacteria | 1324 |
| 645 | Ga0495628_0337733 | 3300046516 | Bacteria | 1109 |
| 646 | Ga0495630_0015598 | 3300046517 | Bacteria | 5552 |
| 647 | Ga0495630_0286703 | 3300046517 | Bacteria | 1258 |
| 648 | Ga0495631_0042197 | 3300046518 | Bacteria | 2016 |
| 649 | Ga0495631_0204855 | 3300046518 | Bacteria | 843 |
| 650 | Ga0495644_0215235 | 3300046523 | Bacteria | 742 |
| 651 | Ga0495648_0000160 | 3300046524 | Bacteria | 80523 |
| 652 | Ga0495648_0063615 | 3300046524 | Bacteria | 2177 |
| 653 | Ga0495648_0114382 | 3300046524 | Bacteria | 1462 |
| 654 | Ga0495648_0296543 | 3300046524 | Bacteria | 759 |
| 655 | Ga0495666_0116057 | 3300046526 | Bacteria | 1256 |
| 656 | Ga0495652_0006710 | 3300046529 | Bacteria | 10684 |
| 657 | Ga0495652_0086209 | 3300046529 | Bacteria | 2579 |
| 658 | Ga0495665_0000399 | 3300046531 | Bacteria | 22087 |
| 659 | Ga0495665_0094511 | 3300046531 | Bacteria | 1570 |
| 660 | Ga0495640_0002380 | 3300046533 | Bacteria | 15099 |
| 661 | Ga0495640_0006041 | 3300046533 | Bacteria | 9605 |
| 662 | Ga0495640_0022858 | 3300046533 | Bacteria | 4565 |
| 663 | Ga0495587_0001761 | 3300046536 | Bacteria | 14465 |
| 664 | Ga0495597_0108630 | 3300046542 | Bacteria | 1165 |
| 665 | Ga0495645_0011866 | 3300046543 | Bacteria | 6139 |
| 666 | Ga0495645_0099796 | 3300046543 | Bacteria | 2065 |
| 667 | Ga0495622_0031543 | 3300046557 | Bacteria | 2476 |
| 668 | Ga0495622_0117268 | 3300046557 | Bacteria | 1217 |
| 669 | Ga0495622_0157988 | 3300046557 | Bacteria | 1023 |
| 670 | Ga0495667_0008194 | 3300046559 | Bacteria | 7092 |
| 671 | Ga0495667_0023917 | 3300046559 | Bacteria | 4115 |
| 672 | Ga0495667_0323080 | 3300046559 | Bacteria | 976 |
| 673 | Ga0495668_0079059 | 3300046616 | Bacteria | 1805 |
| 674 | Ga0495668_0214909 | 3300046616 | Bacteria | 1053 |
| 675 | Ga0495668_0218941 | 3300046616 | Bacteria | 1042 |
| 676 | Ga0495668_0356803 | 3300046616 | Bacteria | 802 |
| 677 | Ga0495668_0657920 | 3300046616 | Bacteria | 579 |
| 678 | Ga0495634_0001116 | 3300046642 | Bacteria | 24891 |
| 679 | Ga0495634_0033261 | 3300046642 | Bacteria | 3543 |
| 680 | Ga0495634_0068117 | 3300046642 | Bacteria | 2352 |
| 681 | Ga0495634_0317379 | 3300046642 | Bacteria | 939 |
| 682 | Ga0495611_0028869 | 3300046648 | Bacteria | 2431 |
| 683 | Ga0495611_0103977 | 3300046648 | Bacteria | 1320 |
| 684 | Ga0495611_0150371 | 3300046648 | Bacteria | 1087 |
| 685 | Ga0495625_0196711 | 3300046660 | Bacteria | 1333 |
| 686 | Ga0495625_0323566 | 3300046660 | Bacteria | 981 |
| 687 | Ga0495625_0346200 | 3300046660 | Bacteria | 940 |
| 688 | Ga0495635_0001363 | 3300046663 | Bacteria | 16259 |
| 689 | Ga0495635_0008724 | 3300046663 | Bacteria | 7079 |
| 690 | Ga0495635_1027362 | 3300046663 | Bacteria | 524 |
| 691 | Ga0495588_0009937 | 3300046674 | Bacteria | 4411 |
| 692 | Ga0495588_0082817 | 3300046674 | Bacteria | 1676 |
| 693 | Ga0495657_0001869 | 3300046675 | Bacteria | 17925 |
| 694 | Ga0495657_0111900 | 3300046675 | Bacteria | 1729 |
| 695 | Ga0495599_0005931 | 3300046678 | Bacteria | 7346 |
| 696 | Ga0495599_0031077 | 3300046678 | Bacteria | 3352 |
| 697 | Ga0495623_0001546 | 3300046679 | Bacteria | 15532 |
| 698 | Ga0495646_0002015 | 3300046680 | Bacteria | 12296 |
| 699 | Ga0495646_0007314 | 3300046680 | Bacteria | 7014 |
| 700 | Ga0495646_0015020 | 3300046680 | Bacteria | 4918 |
| 701 | Ga0495647_0001461 | 3300046681 | Bacteria | 7327 |
| 702 | Ga0495647_0036068 | 3300046681 | Bacteria | 1860 |
| 703 | Ga0495658_0003680 | 3300046683 | Bacteria | 7585 |
| 704 | Ga0495658_0036491 | 3300046683 | Bacteria | 2712 |
| 705 | Ga0495658_0252632 | 3300046683 | Bacteria | 1109 |
| 706 | Ga0495658_0587486 | 3300046683 | Bacteria | 713 |
| 707 | Ga0495669_0016655 | 3300046684 | Bacteria | 3149 |
| 708 | Ga0495669_0081447 | 3300046684 | Bacteria | 1486 |
| 709 | Ga0495669_0524853 | 3300046684 | Bacteria | 576 |
| 710 | Ga0495613_0002852 | 3300046689 | Bacteria | 12940 |
| 711 | Ga0495613_0114270 | 3300046689 | Bacteria | 1943 |
| 712 | Ga0495624_0000096 | 3300046690 | Bacteria | 59307 |
| 713 | Ga0495624_0055814 | 3300046690 | Bacteria | 2487 |
| 714 | Ga0495624_0093725 | 3300046690 | Bacteria | 1851 |
| 715 | Ga0495670_0059936 | 3300046691 | Bacteria | 1911 |
| 716 | Ga0495670_0238612 | 3300046691 | Bacteria | 968 |
| 717 | Ga0495670_0270909 | 3300046691 | Bacteria | 907 |
| 718 | Ga0495589_0185678 | 3300046794 | Bacteria | 985 |
| 719 | Ga0495589_0400030 | 3300046794 | Bacteria | 630 |
| 720 | Ga0495600_0000380 | 3300046809 | Bacteria | 23025 |
| 721 | Ga0495660_0073144 | 3300046810 | Bacteria | 1814 |
| 722 | Ga0495581_0000311 | 3300047315 | Bacteria | 23901 |
| 723 | Ga0495581_0106091 | 3300047315 | Bacteria | 1633 |
| 724 | Ga0495581_0424159 | 3300047315 | Bacteria | 775 |
| 725 | Ga0495604_0003890 | 3300047317 | Bacteria | 11888 |
| 726 | Ga0495604_0073297 | 3300047317 | Bacteria | 2585 |
| 727 | Ga0495604_0216048 | 3300047317 | Bacteria | 1323 |
| 728 | Ga0495604_0444889 | 3300047317 | Bacteria | 847 |
| 729 | Ga0495674_0007643 | 3300047319 | Bacteria | 10324 |
| 730 | Ga0495674_0038405 | 3300047319 | Bacteria | 4297 |
| 731 | Ga0495674_0694488 | 3300047319 | Bacteria | 799 |
| 732 | Ga0495672_0015084 | 3300047320 | Bacteria | 5259 |
| 733 | Ga0495672_0017739 | 3300047320 | Bacteria | 4750 |
| 734 | Ga0495672_0028548 | 3300047320 | Bacteria | 3529 |
| 735 | Ga0495672_0068505 | 3300047320 | Bacteria | 2017 |
| 736 | Ga0495676_0034547 | 3300047321 | Bacteria | 4241 |
| 737 | Ga0495676_0063854 | 3300047321 | Bacteria | 2868 |
| 738 | Ga0495676_0095342 | 3300047321 | Bacteria | 2214 |
| 739 | Ga0495680_0007705 | 3300047322 | Bacteria | 9829 |
| 740 | Ga0495675_0003666 | 3300047444 | Bacteria | 9283 |
| 741 | Ga0495673_0227490 | 3300047469 | Bacteria | 688 |
| 742 | Ga0495673_0284409 | 3300047469 | Bacteria | 596 |
| 743 | Ga0495684_0000942 | 3300047471 | Bacteria | 23681 |
| 744 | Ga0495684_0042610 | 3300047471 | Bacteria | 3476 |
| 745 | Ga0495684_0531723 | 3300047471 | Bacteria | 803 |
| 746 | Ga0495686_0085195 | 3300047472 | Bacteria | 1925 |
| 747 | Ga0495686_0153957 | 3300047472 | Bacteria | 1348 |
| 748 | Ga0495686_0154539 | 3300047472 | Bacteria | 1345 |
| 749 | Ga0495593_0000071 | 3300047673 | Bacteria | 43314 |
| 750 | Ga0495593_0001112 | 3300047673 | Bacteria | 15705 |
| 751 | Ga0495593_0153866 | 3300047673 | Bacteria | 1162 |
| 752 | Ga0495593_0218642 | 3300047673 | Bacteria | 956 |
| 753 | Ga0495602_0003245 | 3300048088 | Bacteria | 16794 |
| 754 | Ga0495602_0214737 | 3300048088 | Bacteria | 1457 |
| 755 | Ga0495602_0409162 | 3300048088 | Bacteria | 966 |
| 756 | Ga0495602_0530922 | 3300048088 | Bacteria | 818 |
| 757 | Ga0495614_0575855 | 3300048089 | Bacteria | 540 |
| 758 | Ga0495615_0151620 | 3300048090 | Bacteria | 690 |
| 759 | Ga0496100_0515098 | 3300048903 | Bacteria | 923 |
| 760 | Ga0496100_0590269 | 3300048903 | Bacteria | 862 |
| 761 | Ga0496101_0036002 | 3300048904 | Bacteria | 3504 |
| 762 | Ga0496101_0867108 | 3300048904 | Bacteria | 711 |
| 763 | Ga0496102_0001926 | 3300048905 | Bacteria | 17867 |
| 764 | Ga0496102_0103146 | 3300048905 | Bacteria | 2652 |
| 765 | Ga0496102_0289521 | 3300048905 | Bacteria | 1544 |
| 766 | Ga0496102_0303082 | 3300048905 | Bacteria | 1506 |
| 767 | Ga0496102_0822531 | 3300048905 | Bacteria | 851 |
| 768 | Ga0496103_0184487 | 3300048906 | Bacteria | 1341 |
| 769 | Ga0496103_0671138 | 3300048906 | Bacteria | 658 |
| 770 | Ga0496104_0016935 | 3300048907 | Bacteria | 6630 |
| 771 | Ga0496104_0092999 | 3300048907 | Bacteria | 2883 |
| 772 | Ga0496104_0157000 | 3300048907 | Bacteria | 2183 |
| 773 | Ga0496104_0497913 | 3300048907 | Bacteria | 1129 |
| 774 | Ga0496105_0014383 | 3300048908 | Bacteria | 6298 |
| 775 | Ga0496105_0690161 | 3300048908 | Bacteria | 785 |
| 776 | Ga0496106_0001303 | 3300048909 | Bacteria | 18732 |
| 777 | Ga0496106_0007840 | 3300048909 | Bacteria | 7905 |
| 778 | Ga0496106_0015567 | 3300048909 | Bacteria | 5625 |
| 779 | Ga0496106_0178923 | 3300048909 | Bacteria | 1683 |
| 780 | Ga0496106_0282481 | 3300048909 | Bacteria | 1330 |
| 781 | Ga0496106_0369210 | 3300048909 | Bacteria | 1153 |
| 782 | Ga0496108_0031040 | 3300048911 | Bacteria | 4430 |
| 783 | Ga0496108_0056325 | 3300048911 | Bacteria | 3302 |
| 784 | Ga0496109_0028701 | 3300048912 | Bacteria | 4980 |
| 785 | Ga0496109_0112955 | 3300048912 | Bacteria | 2526 |
| 786 | Ga0496109_0164649 | 3300048912 | Bacteria | 2078 |
| 787 | Ga0496109_0589436 | 3300048912 | Bacteria | 1048 |
| 788 | Ga0496110_0020916 | 3300048913 | Bacteria | 5528 |
| 789 | Ga0496110_0035219 | 3300048913 | Bacteria | 4342 |
| 790 | Ga0496110_0036728 | 3300048913 | Bacteria | 4256 |
| 791 | Ga0496110_0627375 | 3300048913 | Bacteria | 974 |
| 792 | Ga0496111_0108132 | 3300048914 | Bacteria | 2048 |
| 793 | Ga0496112_0000079 | 3300048915 | Bacteria | 64101 |
| 794 | Ga0496112_0011862 | 3300048915 | Bacteria | 7982 |
| 795 | Ga0496112_0042624 | 3300048915 | Bacteria | 4440 |
| 796 | Ga0496113_0052259 | 3300048916 | Bacteria | 3051 |
| 797 | Ga0496113_0175600 | 3300048916 | Bacteria | 1697 |
| 798 | Ga0496113_0537317 | 3300048916 | Bacteria | 938 |
| 799 | Ga0496114_0019364 | 3300048917 | Bacteria | 5515 |
| 800 | Ga0496114_0097833 | 3300048917 | Bacteria | 2500 |
| 801 | Ga0496114_0408748 | 3300048917 | Bacteria | 1202 |
| 802 | Ga0496114_1048957 | 3300048917 | Bacteria | 699 |
| 803 | Ga0496115_0001660 | 3300048918 | Bacteria | 16005 |
| 804 | Ga0496115_0021912 | 3300048918 | Bacteria | 4941 |
| 805 | Ga0496115_0170170 | 3300048918 | Bacteria | 1802 |
| 806 | Ga0496115_1009269 | 3300048918 | Bacteria | 635 |
| 807 | Ga0496116_0082894 | 3300048919 | Bacteria | 1982 |
| 808 | Ga0496118_0005806 | 3300048921 | Bacteria | 13836 |
| 809 | Ga0496118_0175041 | 3300048921 | Bacteria | 1305 |
| 810 | Ga0496118_0308421 | 3300048921 | Bacteria | 865 |
| 811 | Ga0496118_0398833 | 3300048921 | Bacteria | 715 |
| 812 | Ga0496119_0093005 | 3300048922 | Bacteria | 1709 |
| 813 | Ga0496119_0161712 | 3300048922 | Bacteria | 1190 |
| 814 | Ga0496119_0424704 | 3300048922 | Bacteria | 630 |
| 815 | Ga0496120_0073316 | 3300048923 | Bacteria | 1874 |
| 816 | Ga0496121_0000456 | 3300048924 | Bacteria | 80536 |
| 817 | Ga0496121_0000495 | 3300048924 | Bacteria | 75339 |
| 818 | Ga0496121_0009589 | 3300048924 | Bacteria | 11091 |
| 819 | Ga0496121_0026710 | 3300048924 | Bacteria | 5427 |
| 820 | Ga0496121_0040184 | 3300048924 | Bacteria | 4107 |
| 821 | Ga0496121_0069554 | 3300048924 | Bacteria | 2840 |
| 822 | Ga0496121_0092008 | 3300048924 | Bacteria | 2365 |
| 823 | Ga0496121_0533999 | 3300048924 | Bacteria | 737 |
| 824 | Ga0496123_0220446 | 3300048926 | Bacteria | 957 |
| 825 | Ga0496124_0001010 | 3300048927 | Bacteria | 44569 |
| 826 | Ga0496125_0004034 | 3300048928 | Bacteria | 17214 |
| 827 | Ga0496125_0018832 | 3300048928 | Bacteria | 6538 |
| 828 | Ga0496125_0244008 | 3300048928 | Bacteria | 1138 |
| 829 | Ga0496125_0414965 | 3300048928 | Bacteria | 782 |
| 830 | Ga0496126_0003586 | 3300048929 | Bacteria | 19458 |
| 831 | Ga0496126_0026206 | 3300048929 | Bacteria | 5594 |
| 832 | Ga0496126_0033722 | 3300048929 | Bacteria | 4815 |
| 833 | Ga0496126_0043395 | 3300048929 | Bacteria | 4148 |
| 834 | Ga0496126_0058174 | 3300048929 | Bacteria | 3485 |
| 835 | Ga0496126_0101712 | 3300048929 | Bacteria | 2513 |
| 836 | Ga0496126_0105811 | 3300048929 | Bacteria | 2456 |
| 837 | Ga0496126_0120484 | 3300048929 | Bacteria | 2276 |
| 838 | Ga0496126_0177663 | 3300048929 | Bacteria | 1810 |
| 839 | Ga0496126_0209658 | 3300048929 | Bacteria | 1641 |
| 840 | Ga0496126_0310794 | 3300048929 | Bacteria | 1297 |
| 841 | Ga0496126_0386040 | 3300048929 | Bacteria | 1139 |
| 842 | Ga0496126_0390660 | 3300048929 | Bacteria | 1130 |
| 843 | Ga0496126_0501252 | 3300048929 | Bacteria | 970 |
| 844 | Ga0495678_153481 | 3300049459 | Bacteria | 742 |
| 845 | Ga0495682_0121922 | 3300049460 | Bacteria | 933 |
| 846 | Ga0501043_0202544 | 3300049579 | Bacteria | 1540 |
| 847 | Ga0501046_0024946 | 3300049580 | Bacteria | 4899 |
| 848 | Ga0501047_0039854 | 3300049581 | Bacteria | 4544 |
| 849 | Ga0501047_0852488 | 3300049581 | Bacteria | 725 |
| 850 | Ga0501048_0667043 | 3300049582 | Bacteria | 747 |
| 851 | Ga0501067_0084969 | 3300049583 | Bacteria | 1756 |
| 852 | Ga0501069_0030878 | 3300049585 | Bacteria | 2945 |
| 853 | Ga0501069_0167132 | 3300049585 | Bacteria | 1268 |
| 854 | Ga0501070_0011268 | 3300049586 | Bacteria | 7552 |
| 855 | Ga0501070_0012856 | 3300049586 | Bacteria | 7053 |
| 856 | Ga0501070_0322394 | 3300049586 | Bacteria | 1256 |
| 857 | Ga0501073_0086110 | 3300049589 | Bacteria | 2185 |
| 858 | Ga0501074_0078168 | 3300049590 | Bacteria | 2374 |
| 859 | Ga0501080_0013807 | 3300049742 | Bacteria | 7435 |
| 860 | Ga0501080_0324053 | 3300049742 | Bacteria | 1394 |
| 861 | Ga0501080_0817263 | 3300049742 | Bacteria | 817 |
| 862 | Ga0501081_0111928 | 3300049743 | Bacteria | 1938 |
| 863 | Ga0501035_0004051 | 3300049822 | Bacteria | 13958 |
| 864 | Ga0501035_0302102 | 3300049822 | Bacteria | 1348 |
| 865 | Ga0501044_0025310 | 3300049823 | Bacteria | 6289 |
| 866 | nmdc:mga03n38_832_c1 | 3300050490 | Bacteria | 8253 |
| 867 | nmdc:mga03n38_97361_c1 | 3300050490 | Bacteria | 1413 |
| 868 | nmdc:mga00v17_115179_c1 | 3300050491 | Bacteria | 1708 |
| 869 | nmdc:mga00v17_345738_c1 | 3300050491 | Bacteria | 967 |
| 870 | nmdc:mga0yw44_237435_c1 | 3300050492 | Bacteria | 1211 |
| 871 | nmdc:mga0yw44_449076_c1 | 3300050492 | Bacteria | 874 |
| 872 | nmdc:mga0yw44_929149_c1 | 3300050492 | Bacteria | 590 |
| 873 | nmdc:mga0k408_328282_c1 | 3300050493 | Bacteria | 913 |
| 874 | nmdc:mga0k408_375096_c1 | 3300050493 | Bacteria | 848 |
| 875 | nmdc:mga06z11_20530_c1 | 3300050494 | Bacteria | 3054 |
| 876 | nmdc:mga06z11_375023_c1 | 3300050494 | Bacteria | 854 |
| 877 | nmdc:mga06z11_663862_c1 | 3300050494 | Bacteria | 635 |
| 878 | nmdc:mga07m45_18553_c1 | 3300050496 | Bacteria | 3758 |
| 879 | nmdc:mga07m45_343080_c1 | 3300050496 | Bacteria | 868 |
| 880 | nmdc:mga07m45_444712_c1 | 3300050496 | Bacteria | 752 |
| 881 | nmdc:mga07m45_7096_c1 | 3300050496 | Bacteria | 5705 |
| 882 | nmdc:mga07m45_88076_c1 | 3300050496 | Bacteria | 1777 |
| 883 | nmdc:mga08y16_39585_c1 | 3300050511 | Bacteria | 4946 |
| 884 | nmdc:mga0n895_287718_c1 | 3300050512 | Bacteria | 1666 |
| 885 | nmdc:mga0n895_332638_c1 | 3300050512 | Bacteria | 1539 |
| 886 | nmdc:mga0rr50_646068_c1 | 3300050513 | Bacteria | 903 |
| 887 | nmdc:mga08x19_143838_c1 | 3300050514 | Bacteria | 1612 |
| 888 | nmdc:mga08x19_40070_c1 | 3300050514 | Bacteria | 2980 |
| 889 | nmdc:mga0sz30_23496_c1 | 3300050516 | Bacteria | 2509 |
| 890 | nmdc:mga0sz30_34029_c1 | 3300050516 | Bacteria | 2120 |
| 891 | Ga0495601_0027779 | 3300053077 | Bacteria | 3501 |
| 892 | Ga0495601_0042600 | 3300053077 | Bacteria | 2849 |
| 893 | Ga0495601_0472647 | 3300053077 | Bacteria | 810 |
| 894 | Ga0500635_0017942 | 3300053080 | Bacteria | 2129 |
| 895 | Ga0495595_0000897 | 3300053084 | Bacteria | 11454 |
| 896 | Ga0495619_0001717 | 3300053085 | Bacteria | 14530 |
| 897 | Ga0495619_0082462 | 3300053085 | Bacteria | 2167 |
| 898 | Ga0495619_0274558 | 3300053085 | Bacteria | 1168 |
| 899 | Ga0500578_0496269 | 3300053086 | Bacteria | 687 |
| 900 | Ga0500643_051488 | 3300053087 | Bacteria | 1176 |
| 901 | Ga0500583_0119420 | 3300053092 | Bacteria | 1303 |
| 902 | Ga0500583_0211573 | 3300053092 | Bacteria | 962 |
| 903 | Ga0500651_0003265 | 3300053093 | Bacteria | 8829 |
| 904 | Ga0500651_0533927 | 3300053093 | Bacteria | 643 |
| 905 | Ga0500566_0000038 | 3300053094 | Bacteria | 66925 |
| 906 | Ga0500566_0016608 | 3300053094 | Bacteria | 4321 |
| 907 | Ga0500566_0256979 | 3300053094 | Bacteria | 846 |
| 908 | Ga0500640_036928 | 3300053095 | Bacteria | 2147 |
| 909 | Ga0500648_222321 | 3300053097 | Bacteria | 923 |
| 910 | Ga0500554_035582 | 3300053102 | Bacteria | 1498 |
| 911 | Ga0500556_0025949 | 3300053104 | Bacteria | 1941 |
| 912 | Ga0500562_025536 | 3300053108 | Bacteria | 1546 |
| 913 | Ga0500572_000010 | 3300053111 | Bacteria | 67071 |
| 914 | Ga0500594_0007902 | 3300053118 | Bacteria | 2414 |
| 915 | Ga0500595_002817 | 3300053119 | Bacteria | 8362 |
| 916 | Ga0500595_002876 | 3300053119 | Bacteria | 8254 |
| 917 | Ga0500595_016482 | 3300053119 | Bacteria | 2751 |
| 918 | Ga0500595_018993 | 3300053119 | Bacteria | 2501 |
| 919 | Ga0500595_063780 | 3300053119 | Bacteria | 1106 |
| 920 | Ga0500595_113097 | 3300053119 | Bacteria | 770 |
| 921 | Ga0500614_000527 | 3300053123 | Bacteria | 9848 |
| 922 | Ga0500614_026458 | 3300053123 | Bacteria | 1387 |
| 923 | Ga0500628_114928 | 3300053129 | Bacteria | 726 |
| 924 | Ga0500642_0088483 | 3300053130 | Bacteria | 1429 |
| 925 | Ga0500658_0180561 | 3300053134 | Bacteria | 961 |
| 926 | Ga0500658_0242075 | 3300053134 | Bacteria | 828 |
| 927 | Ga0500559_0001831 | 3300053136 | Bacteria | 11598 |
| 928 | Ga0500559_0009373 | 3300053136 | Bacteria | 4238 |
| 929 | Ga0500559_0168988 | 3300053136 | Bacteria | 1028 |
| 930 | Ga0500564_112167 | 3300053138 | Bacteria | 1196 |
| 931 | Ga0500568_0001566 | 3300053139 | Bacteria | 14459 |
| 932 | Ga0500573_0179107 | 3300053140 | Bacteria | 1140 |
| 933 | Ga0500588_0080855 | 3300053146 | Bacteria | 1087 |
| 934 | Ga0500588_0187424 | 3300053146 | Bacteria | 762 |
| 935 | Ga0500589_087981 | 3300053147 | Bacteria | 1374 |
| 936 | Ga0500590_145637 | 3300053148 | Bacteria | 1076 |
| 937 | Ga0500603_000506 | 3300053150 | Bacteria | 9885 |
| 938 | Ga0500603_001941 | 3300053150 | Bacteria | 4608 |
| 939 | Ga0500603_020051 | 3300053150 | Bacteria | 1629 |
| 940 | Ga0500603_113949 | 3300053150 | Bacteria | 814 |
| 941 | Ga0500604_0263084 | 3300053151 | Bacteria | 597 |
| 942 | Ga0500622_0244198 | 3300053156 | Bacteria | 791 |
| 943 | Ga0500630_001647 | 3300053159 | Bacteria | 10690 |
| 944 | Ga0500633_0070916 | 3300053160 | Bacteria | 1244 |
| 945 | Ga0500638_006485 | 3300053162 | Bacteria | 4793 |
| 946 | Ga0500638_006620 | 3300053162 | Bacteria | 4764 |
| 947 | Ga0500638_066816 | 3300053162 | Bacteria | 1723 |
| 948 | Ga0500639_000034 | 3300053163 | Bacteria | 66994 |
| 949 | Ga0500636_0276285 | 3300053177 | Bacteria | 841 |
| 950 | Ga0500637_0009537 | 3300053178 | Bacteria | 4946 |
| 951 | Ga0500637_0013593 | 3300053178 | Bacteria | 4273 |
| 952 | Ga0500637_0015460 | 3300053178 | Bacteria | 4046 |
| 953 | Ga0500637_0045452 | 3300053178 | Bacteria | 2490 |
| 954 | Ga0500576_085384 | 3300053725 | Bacteria | 1323 |
| 955 | Ga0500657_106818 | 3300053728 | Bacteria | 1141 |
| 956 | Ga0500552_001545 | 3300053733 | Bacteria | 2199 |
| 957 | Ga0500596_000922 | 3300053735 | Bacteria | 5877 |
| 958 | Ga0500596_008575 | 3300053735 | Bacteria | 1626 |
| 959 | Ga0501084_0093842 | 3300054114 | Bacteria | 2520 |
| 960 | Ga0500661_001416 | 3300055283 | Bacteria | 4485 |
| 961 | Ga0501082_0303607 | 3300060353 | Bacteria | 1390 |
| 962 | Ga0530510_0684805 | 3300061734 | Bacteria | 781 |
| 963 | 2513629311 | 2513237092 | Bacteria | 8341956 |
| 964 | 2513656574 | 2513237096 | Bacteria | 8722461 |
| 965 | 2513672370 | 2513237098 | Bacteria | 9902361 |
| 966 | 2513691755 | 2513237101 | Bacteria | 7952346 |
| 967 | 2513717523 | 2513237104 | Bacteria | 10034502 |
| 968 | 2513859539 | 2513237137 | Bacteria | 9558895 |
| 969 | 2513917759 | 2513237145 | Bacteria | 8979722 |
| 970 | 2517102100 | 2517093001 | Bacteria | 9002274 |
| 971 | 2517893169 | 2517572143 | Bacteria | 9484767 |
| 972 | 2524466825 | 2524023210 | Bacteria | 9029266 |
| 973 | 2524537280 | 2524023228 | Bacteria | 10118060 |
| 974 | 2617376565 | 2617270741 | Bacteria | 8201522 |
| 975 | 2728754596 | 2728368998 | Bacteria | 8720350 |
| 976 | 2793069963 | 2791355197 | Bacteria | 8420563 |
| 977 | 2824619736 | 2824617872 | Bacteria | 8814715 |
| 978 | 2824629344 | 2824626560 | Bacteria | 8813858 |
| 979 | 2824640778 | 2824635225 | Bacteria | 8785348 |
| 980 | 2824647105 | 2824644064 | Bacteria | 8743947 |
| 981 | 2824674680 | 2824671348 | Bacteria | 8369588 |
| 982 | 2824686418 | 2824679649 | Bacteria | 8248951 |
| 983 | 2824692859 | 2824687955 | Bacteria | 8360029 |
| 984 | 2824717291 | 2824714736 | Bacteria | 8717648 |
| 985 | 2824727491 | 2824723954 | Bacteria | 8758240 |
| 986 | 2824737157 | 2824732956 | Bacteria | 7810675 |
| 987 | 2824749675 | 2824746037 | Bacteria | 7911610 |
| 988 | 2838128602 | 2838122688 | Bacteria | 8803140 |
| 989 | 2841947302 | 2841941048 | Bacteria | 8688029 |
| 990 | 2841950748 | 2841949485 | Bacteria | 8680857 |
| 991 | 2841967062 | 2841966195 | Bacteria | 8673214 |
| 992 | 2841991067 | 2841983080 | Bacteria | 8395090 |
| 993 | 2847935162 | 2847930680 | Bacteria | 9342022 |
| 994 | 2874609519 | 2874604998 | Bacteria | 7834745 |
| 995 | 2874612755 | 2874612657 | Bacteria | 8252029 |
| 996 | 2876810983 | 2876808645 | Bacteria | 8824342 |
| 997 | 2879090126 | 2879083081 | Bacteria | 8587928 |
| 998 | 2879115707 | 2879110137 | Bacteria | 8907982 |
| 999 | 2885374762 | 2885374607 | Bacteria | 8927485 |
| 1000 | 2885391705 | 2885383462 | Bacteria | 9473874 |
| 1001 | 2903777840 | 2903768456 | Bacteria | 9749579 |
| 1002 | 2904702039 | |||
| 1003 | 2906640884 | 2906635258 | Bacteria | 8601019 |
| 1004 | 2906645835 | 2906643746 | Bacteria | 8722424 |
| 1005 | 2906667863 | 2906660503 | Bacteria | 8595048 |
| 1006 | 2908760344 | 2908756301 | Bacteria | 8864324 |
| 1007 | 2908779330 | 2908775508 | Bacteria | 8092255 |
| 1008 | 2922367778 | 2922361189 | Bacteria | 7436256 |
| 1009 | 2922392319 | 2922386360 | Bacteria | 7017218 |
| 1010 | 2922395542 | 2922393267 | Bacteria | 8285685 |
| 1011 | 2932808971 | 2932801729 | Bacteria | 7987968 |
| 1012 | 2935634106 | 2935630451 | Bacteria | 8169952 |
| 1013 | 2935886684 | 2935883170 | Bacteria | 7964738 |
| 1014 | 2941510997 | 2941507105 | Bacteria | 8166816 |
| 1015 | 2941518381 | 2941515067 | Bacteria | 8166720 |
| 1016 | 2941527356 | 2941523033 | Bacteria | 8169134 |
| 1017 | 3005479487 | 3005474847 | Bacteria | 9259049 |
| 1018 | 3005489371 | 3005483717 | Bacteria | 7877331 |
| 1019 | 3005590915 | 3005587118 | Bacteria | 7794411 |
| 1020 | 3005598363 | 3005594810 | Bacteria | 8716512 |
| 1021 | 3005721522 | 3005718088 | Bacteria | 8283608 |
| 1022 | 8006928272 | 8006926726 | Bacteria | 6749210 |
| 1023 | 8006941661 | 8006933436 | Bacteria | 10410654 |
| 1024 | 8006971958 | 8006964411 | Bacteria | 8966052 |
| 1025 | 8006981371 | 8006973647 | Bacteria | 10679141 |
| 1026 | 8006990371 | 8006984368 | Bacteria | 9651211 |
| 1027 | 8006996407 | 8006994254 | Bacteria | 8309700 |
| 1028 | 8019657420 | 8019648815 | Bacteria | 10014479 |
| 1029 | 8056674662 | 8056673599 | Bacteria | 7871253 |
| 1030 | 8056688542 | 8056681323 | Bacteria | 8472857 |
| 1031 | 8056972649 | 8056967851 | Bacteria | 9038162 |
| 1032 | Ga0070713_100031140 | |||
| 1033 | JGI24740J21852_10070463 | |||
| 1034 | JGI24735J21928_10044897 | |||
| 1035 | JGI24750J21931_1026917 | |||
| 1036 | JGI25153J46596_10005011 | |||
| 1037 | JGI25404J52841_10005727 | |||
| 1038 | JGI25404J52841_10011158 | |||
| 1039 | JGI25404J52841_10135865 | |||
| 1040 | Ga0055531_10007161 | |||
| 1041 | Ga0065165_1010981 | |||
| 1042 | Ga0070658_10239457 | |||
| 1043 | Ga0070676_10094448 | |||
| 1044 | Ga0070683_100220944 | |||
| 1045 | Ga0070683_100301476 | |||
| 1046 | Ga0070683_101024038 | |||
| 1047 | Ga0070690_100117460 | |||
| 1048 | Ga0070690_100404861 | |||
| 1049 | Ga0070690_100595493 | |||
| 1050 | Ga0068869_100346811 | |||
| 1051 | Ga0070680_100083357 | |||
| 1052 | Ga0070680_100162579 | |||
| 1053 | Ga0070680_100372741 | |||
| 1054 | Ga0070682_100034408 | |||
| 1055 | Ga0070682_100392914 | |||
| 1056 | Ga0068868_100168503 | |||
| 1057 | Ga0068868_100653159 | |||
| 1058 | Ga0070660_100099615 | |||
| 1059 | Ga0070660_100346871 | |||
| 1060 | Ga0070660_100517355 | |||
| 1061 | Ga0070660_100649279 | |||
| 1062 | Ga0070689_100253495 | |||
| 1063 | Ga0070689_100568645 | |||
| 1064 | Ga0070691_10125140 | |||
| 1065 | Ga0070687_100530383 | |||
| 1066 | Ga0070661_100065521 | |||
| 1067 | Ga0070661_100656740 | |||
| 1068 | Ga0070661_100717168 | |||
| 1069 | Ga0070668_100363642 | |||
| 1070 | Ga0070668_100397989 | |||
| 1071 | Ga0070675_100196040 | |||
| 1072 | Ga0070671_100097150 | |||
| 1073 | Ga0070674_100050504 | |||
| 1074 | Ga0070674_100315373 | |||
| 1075 | Ga0070673_100147480 | |||
| 1076 | Ga0070688_100288588 | |||
| 1077 | Ga0070667_100484616 | |||
| 1078 | Ga0070703_10050936 | |||
| 1079 | Ga0070709_10000814 | |||
| 1080 | Ga0070709_10011971 | |||
| 1081 | Ga0070709_10180509 | |||
| 1082 | Ga0070714_100018170 | |||
| 1083 | Ga0070714_100053554 | |||
| 1084 | Ga0070713_100005532 | |||
| 1085 | Ga0070710_10000766 | |||
| 1086 | Ga0070710_10002013 | |||
| 1087 | Ga0070710_10071677 | |||
| 1088 | Ga0070711_100018829 | |||
| 1089 | Ga0070708_100117564 | |||
| 1090 | Ga0070663_100074137 | |||
| 1091 | Ga0070663_100287348 | |||
| 1092 | Ga0070678_100012203 | |||
| 1093 | Ga0070678_100030444 | |||
| 1094 | Ga0070662_100180912 | |||
| 1095 | Ga0070662_100326999 | |||
| 1096 | Ga0070681_10038316 | |||
| 1097 | Ga0070681_10334290 | |||
| 1098 | Ga0070681_10446149 | |||
| 1099 | Ga0070681_10508912 | |||
| 1100 | Ga0068867_100071840 | |||
| 1101 | Ga0068867_100952322 | |||
| 1102 | Ga0070706_100523153 | |||
| 1103 | Ga0070707_100110267 | |||
| 1104 | Ga0070698_100009493 | |||
| 1105 | Ga0070698_100642857 | |||
| 1106 | Ga0070699_100694317 | |||
| 1107 | Ga0070679_100030520 | |||
| 1108 | Ga0070679_100394813 | |||
| 1109 | Ga0070679_100722492 | |||
| 1110 | Ga0070684_100024950 | |||
| 1111 | Ga0070684_100213837 | |||
| 1112 | Ga0070684_100324299 | |||
| 1113 | Ga0070697_100181154 | |||
| 1114 | Ga0070697_100270438 | |||
| 1115 | Ga0068853_100006610 | |||
| 1116 | Ga0068853_100040318 | |||
| 1117 | Ga0068853_100070318 | |||
| 1118 | Ga0068853_100823560 | |||
| 1119 | Ga0068853_101018060 | |||
| 1120 | Ga0070686_100306494 | |||
| 1121 | Ga0070696_100086131 | |||
| 1122 | Ga0070693_100234238 | |||
| 1123 | Ga0070693_100242105 | |||
| 1124 | Ga0070693_100338144 | |||
| 1125 | Ga0070693_100673605 | |||
| 1126 | Ga0070665_100013374 | |||
| 1127 | Ga0070665_100139727 | |||
| 1128 | Ga0070665_100447269 | |||
| 1129 | Ga0070665_100927098 | |||
| 1130 | Ga0070665_101496051 | |||
| 1131 | Ga0068855_100035310 | |||
| 1132 | Ga0068855_100116561 | |||
| 1133 | Ga0068855_100252708 | |||
| 1134 | Ga0068855_100687771 | |||
| 1135 | Ga0068855_101034331 | |||
| 1136 | Ga0070664_101113871 | |||
| 1137 | Ga0068857_100047034 | |||
| 1138 | Ga0068857_100171617 | |||
| 1139 | Ga0068857_100259191 | |||
| 1140 | Ga0068854_100086826 | |||
| 1141 | Ga0068854_100121085 | |||
| 1142 | Ga0068854_100197263 | |||
| 1143 | Ga0068854_100247327 | |||
| 1144 | Ga0068854_100380694 | |||
| 1145 | Ga0068856_100002728 | |||
| 1146 | Ga0068856_100006948 | |||
| 1147 | Ga0068856_100009830 | |||
| 1148 | Ga0068856_100050817 | |||
| 1149 | Ga0068856_100055304 | |||
| 1150 | Ga0068856_100084260 | |||
| 1151 | Ga0068856_100163028 | |||
| 1152 | Ga0068856_100539614 | |||
| 1153 | Ga0068852_100006331 | |||
| 1154 | Ga0068852_100057499 | |||
| 1155 | Ga0068852_100102548 | |||
| 1156 | Ga0068852_100141669 | |||
| 1157 | Ga0068852_100229273 | |||
| 1158 | Ga0068852_100500575 | |||
| 1159 | Ga0068852_100585780 | |||
| 1160 | Ga0068859_100373506 | |||
| 1161 | Ga0068859_100825266 | |||
| 1162 | Ga0068859_101448618 | |||
| 1163 | Ga0068864_100007872 | |||
| 1164 | Ga0068864_100589705 | |||
| 1165 | Ga0068866_10059226 | |||
| 1166 | Ga0068861_100187739 | |||
| 1167 | Ga0068851_10064729 | |||
| 1168 | Ga0068851_10149013 | |||
| 1169 | Ga0068863_100022985 | |||
| 1170 | Ga0068863_100978124 | |||
| 1171 | Ga0068858_100209905 | |||
| 1172 | Ga0068858_100220864 | |||
| 1173 | Ga0068858_100260645 | |||
| 1174 | Ga0068860_100000058 | |||
| 1175 | Ga0081455_10036644 | |||
| 1176 | Ga0081455_10071579 | |||
| 1177 | Ga0081455_10093901 | |||
| 1178 | Ga0081540_1002578 | |||
| 1179 | Ga0081540_1003795 | |||
| 1180 | Ga0081540_1010920 | |||
| 1181 | Ga0081540_1029209 | |||
| 1182 | Ga0081540_1030142 | |||
| 1183 | Ga0081540_1104243 | |||
| 1184 | Ga0081539_10000231 | |||
| 1185 | Ga0081539_10099315 | |||
| 1186 | Ga0081539_10164992 | |||
| 1187 | Ga0070717_10003916 | |||
| 1188 | Ga0070717_10091940 | |||
| 1189 | Ga0070717_10477246 | |||
| 1190 | Ga0070717_10849833 | |||
| 1191 | Ga0070717_10997088 | |||
| 1192 | Ga0075365_10144139 | |||
| 1193 | Ga0075368_10026610 | |||
| 1194 | Ga0075368_10108821 | |||
| 1195 | Ga0075363_100015801 | |||
| 1196 | Ga0075363_100298465 | |||
| 1197 | Ga0075364_10093420 | |||
| 1198 | Ga0075364_10320340 | |||
| 1199 | Ga0075364_10561077 | |||
| 1200 | Ga0070716_100003692 | |||
| 1201 | Ga0070716_100072180 | |||
| 1202 | Ga0070712_100040637 | |||
| 1203 | Ga0070712_100075668 | |||
| 1204 | Ga0070712_100076867 | |||
| 1205 | Ga0070712_100607983 | |||
| 1206 | Ga0075362_10305097 | |||
| 1207 | Ga0075367_10024577 | |||
| 1208 | Ga0075367_10032897 | |||
| 1209 | Ga0075367_10050395 | |||
| 1210 | Ga0075369_10098588 | |||
| 1211 | Ga0075369_10152075 | |||
| 1212 | Ga0075366_10025623 | |||
| 1213 | Ga0075366_10053358 | |||
| 1214 | Ga0075366_10336458 | |||
| 1215 | Ga0075366_10588223 | |||
| 1216 | Ga0075370_10032607 | |||
| 1217 | Ga0075370_10040764 | |||
| 1218 | Ga0075370_10069766 | |||
| 1219 | Ga0075370_10135132 | |||
| 1220 | Ga0075370_10171184 | |||
| 1221 | Ga0068871_100145782 | |||
| 1222 | Ga0068865_100049009 | |||
| 1223 | Ga0075436_100162628 | |||
| 1224 | Ga0097620_100373504 | |||
| 1225 | Ga0097620_100825277 | |||
| 1226 | Ga0097620_101448771 | |||
| 1227 | Ga0099824_1010180 | |||
| 1228 | Ga0099822_1000628 | |||
| 1229 | Ga0075435_100255419 | |||
| 1230 | Ga0105250_10267511 | |||
| 1231 | Ga0105240_10002351 | |||
| 1232 | Ga0105240_10016661 | |||
| 1233 | Ga0105240_10114561 | |||
| 1234 | Ga0105240_10375863 | |||
| 1235 | Ga0111539_11956589 | |||
| 1236 | Ga0105245_10220323 | |||
| 1237 | Ga0105245_10638444 | |||
| 1238 | Ga0105247_10053945 | |||
| 1239 | Ga0105243_10026993 | |||
| 1240 | Ga0105241_10009864 | |||
| 1241 | Ga0105241_10025759 | |||
| 1242 | Ga0105241_10239860 | |||
| 1243 | Ga0105241_10471031 | |||
| 1244 | Ga0105241_10504639 | |||
| 1245 | Ga0105242_10691852 | |||
| 1246 | Ga0105248_10219140 | |||
| 1247 | Ga0105237_10005556 | |||
| 1248 | Ga0105237_10049350 | |||
| 1249 | Ga0105237_10064509 | |||
| 1250 | Ga0105237_10159230 | |||
| 1251 | Ga0105237_10205574 | |||
| 1252 | Ga0105237_10676546 | |||
| 1253 | Ga0105238_10002811 | |||
| 1254 | Ga0105238_10012890 | |||
| 1255 | Ga0105238_10029984 | |||
| 1256 | Ga0105238_10089121 | |||
| 1257 | Ga0105238_10166380 | |||
| 1258 | Ga0105238_11316535 | |||
| 1259 | Ga0105249_10287455 | |||
| 1260 | Ga0105249_10525060 | |||
| 1261 | Ga0105249_10577942 | |||
| 1262 | Ga0099796_10165062 | |||
| 1263 | Ga0105239_10042814 | |||
| 1264 | Ga0105239_10149955 | |||
| 1265 | Ga0105239_10182089 | |||
| 1266 | Ga0105239_10948266 | |||
| 1267 | Ga0105246_10017342 | |||
| 1268 | Ga0105246_10037124 | |||
| 1269 | Ga0157341_1006635 | |||
| 1270 | Ga0157370_10086076 | |||
| 1271 | Ga0157370_10136125 | |||
| 1272 | Ga0157369_10006882 | |||
| 1273 | Ga0157369_10061176 | |||
| 1274 | Ga0157369_10371627 | |||
| 1275 | Ga0157374_10490957 | |||
| 1276 | Ga0157378_10215669 | |||
| 1277 | Ga0163162_10231677 | |||
| 1278 | Ga0163162_10285062 | |||
| 1279 | Ga0163162_10526893 | |||
| 1280 | Ga0157372_10055769 | |||
| 1281 | Ga0157372_10594922 | |||
| 1282 | Ga0157372_10621543 | |||
| 1283 | Ga0157372_10899318 | |||
| 1284 | Ga0157372_11328575 | |||
| 1285 | Ga0157375_10044534 | |||
| 1286 | Ga0157375_10214507 | |||
| 1287 | Ga0157375_10478137 | |||
| 1288 | Ga0163163_10042480 | |||
| 1289 | Ga0163163_10293527 | |||
| 1290 | Ga0157379_10103216 | |||
| 1291 | Ga0157376_10009356 | |||
| 1292 | Ga0157376_10351401 | |||
| 1293 | Ga0157376_10513207 | |||
| 1294 | Ga0157376_10977368 | |||
| 1295 | Ga0206354_11538885 | |||
| 1296 | Ga0206353_11968516 | |||
| 1297 | Ga0214544_1000009 | |||
| 1298 | Ga0214542_1000002 | |||
| 1299 | Ga0214545_1000002 | |||
| 1300 | Ga0214543_1000013 | |||
| 1301 | Ga0213872_10284224 | |||
| 1302 | Ga0213876_10305914 | |||
| 1303 | Ga0209677_101611 | |||
| 1304 | Ga0209233_1006609 | |||
| 1305 | Ga0209455_1002229 | |||
| 1306 | Ga0207673_1012601 | |||
| 1307 | Ga0209758_1001125 | |||
| 1308 | Ga0209758_1009234 | |||
| 1309 | Ga0209257_1028631 | |||
| 1310 | Ga0207697_10238837 | |||
| 1311 | Ga0207656_10024925 | |||
| 1312 | Ga0207656_10055141 | |||
| 1313 | Ga0207653_10065922 | |||
| 1314 | Ga0207692_10001752 | |||
| 1315 | Ga0207692_10005509 | |||
| 1316 | Ga0207642_10048621 | |||
| 1317 | Ga0207688_10002338 | |||
| 1318 | Ga0207688_10052823 | |||
| 1319 | Ga0207680_10274826 | |||
| 1320 | Ga0207680_10677767 | |||
| 1321 | Ga0207647_10011930 | |||
| 1322 | Ga0207685_10074666 | |||
| 1323 | Ga0207699_10002559 | |||
| 1324 | Ga0207699_10143709 | |||
| 1325 | Ga0207699_10215811 | |||
| 1326 | Ga0207645_10047651 | |||
| 1327 | Ga0207645_10150153 | |||
| 1328 | Ga0207643_10006512 | |||
| 1329 | Ga0207684_10338263 | |||
| 1330 | Ga0207654_10000968 | |||
| 1331 | Ga0207654_10008714 | |||
| 1332 | Ga0207654_10167707 | |||
| 1333 | Ga0207654_10454345 | |||
| 1334 | Ga0207707_10004344 | |||
| 1335 | Ga0207707_10022114 | |||
| 1336 | Ga0207707_10041877 | |||
| 1337 | Ga0207707_10120934 | |||
| 1338 | Ga0207707_10121544 | |||
| 1339 | Ga0207695_10000278 | |||
| 1340 | Ga0207695_10003702 | |||
| 1341 | Ga0207695_10042990 | |||
| 1342 | Ga0207695_10073482 | |||
| 1343 | Ga0207695_10117566 | |||
| 1344 | Ga0207695_10320641 | |||
| 1345 | Ga0207671_10005180 | |||
| 1346 | Ga0207671_10024084 | |||
| 1347 | Ga0207671_10034231 | |||
| 1348 | Ga0207671_10122118 | |||
| 1349 | Ga0207671_10219494 | |||
| 1350 | Ga0207671_10297480 | |||
| 1351 | Ga0207671_10651427 | |||
| 1352 | Ga0207671_10887377 | |||
| 1353 | Ga0207693_10019182 | |||
| 1354 | Ga0207693_10029736 | |||
| 1355 | Ga0207693_10961866 | |||
| 1356 | Ga0207663_10006350 | |||
| 1357 | Ga0207663_10539421 | |||
| 1358 | Ga0207663_10848597 | |||
| 1359 | Ga0207660_10019474 | |||
| 1360 | Ga0207660_10055543 | |||
| 1361 | Ga0207660_10237183 | |||
| 1362 | Ga0207662_10001714 | |||
| 1363 | Ga0207662_10051728 | |||
| 1364 | Ga0207657_10095539 | |||
| 1365 | Ga0207657_10400965 | |||
| 1366 | Ga0207652_10010300 | |||
| 1367 | Ga0207652_10016438 | |||
| 1368 | Ga0207652_10025314 | |||
| 1369 | Ga0207652_10062600 | |||
| 1370 | Ga0207646_10141577 | |||
| 1371 | Ga0207694_10001639 | |||
| 1372 | Ga0207694_10008346 | |||
| 1373 | Ga0207694_10090314 | |||
| 1374 | Ga0207694_10135367 | |||
| 1375 | Ga0207694_10161031 | |||
| 1376 | Ga0207694_10208163 | |||
| 1377 | Ga0207694_10546820 | |||
| 1378 | Ga0207650_11004332 | |||
| 1379 | Ga0207687_10032431 | |||
| 1380 | Ga0207687_10476443 | |||
| 1381 | Ga0207687_10492637 | |||
| 1382 | Ga0207687_10864379 | |||
| 1383 | Ga0207700_10027152 | |||
| 1384 | Ga0207700_10041009 | |||
| 1385 | Ga0207700_10104431 | |||
| 1386 | Ga0207700_10164085 | |||
| 1387 | Ga0207700_10258994 | |||
| 1388 | Ga0207700_10472986 | |||
| 1389 | Ga0207664_10045700 | |||
| 1390 | Ga0207644_10074379 | |||
| 1391 | Ga0207644_10542107 | |||
| 1392 | Ga0207644_10875510 | |||
| 1393 | Ga0207690_10135787 | |||
| 1394 | Ga0207706_10113863 | |||
| 1395 | Ga0207706_10140630 | |||
| 1396 | Ga0207706_10187062 | |||
| 1397 | Ga0207706_10398482 | |||
| 1398 | Ga0207706_10888945 | |||
| 1399 | Ga0207709_10032468 | |||
| 1400 | Ga0207709_10077357 | |||
| 1401 | Ga0207670_10972371 | |||
| 1402 | Ga0207669_10011218 | |||
| 1403 | Ga0207669_10161329 | |||
| 1404 | Ga0207704_10184354 | |||
| 1405 | Ga0207665_10058127 | |||
| 1406 | Ga0207665_10087672 | |||
| 1407 | Ga0207665_10171079 | |||
| 1408 | Ga0207665_10329272 | |||
| 1409 | Ga0207691_10042708 | |||
| 1410 | Ga0207691_10260187 | |||
| 1411 | Ga0207711_10308200 | |||
| 1412 | Ga0207711_11238013 | |||
| 1413 | Ga0207689_10095548 | |||
| 1414 | Ga0207661_10017104 | |||
| 1415 | Ga0207661_10186991 | |||
| 1416 | Ga0207661_11014870 | |||
| 1417 | Ga0207679_10894640 | |||
| 1418 | Ga0207667_10043177 | |||
| 1419 | Ga0207667_10045339 | |||
| 1420 | Ga0207667_10116225 | |||
| 1421 | Ga0207667_10498658 | |||
| 1422 | Ga0207667_10906327 | |||
| 1423 | Ga0207651_10109154 | |||
| 1424 | Ga0207651_10314966 | |||
| 1425 | Ga0207651_10805219 | |||
| 1426 | Ga0207712_10092332 | |||
| 1427 | Ga0207668_10063562 | |||
| 1428 | Ga0207640_10066703 | |||
| 1429 | Ga0207640_10548566 | |||
| 1430 | Ga0207640_10679866 | |||
| 1431 | Ga0207640_10886821 | |||
| 1432 | Ga0207658_10408125 | |||
| 1433 | Ga0207677_10149600 | |||
| 1434 | Ga0207677_11129860 | |||
| 1435 | Ga0207703_10041355 | |||
| 1436 | Ga0207703_10146969 | |||
| 1437 | Ga0207703_10354173 | |||
| 1438 | Ga0207703_10798964 | |||
| 1439 | Ga0207639_10006291 | |||
| 1440 | Ga0207639_10019559 | |||
| 1441 | Ga0207639_10045790 | |||
| 1442 | Ga0207639_10229558 | |||
| 1443 | Ga0207678_10043525 | |||
| 1444 | Ga0207678_10054200 | |||
| 1445 | Ga0207678_10087237 | |||
| 1446 | Ga0207678_10160060 | |||
| 1447 | Ga0207678_10185279 | |||
| 1448 | Ga0207678_10227723 | |||
| 1449 | Ga0207708_10004954 | |||
| 1450 | Ga0207702_10000005 | |||
| 1451 | Ga0207702_10000178 | |||
| 1452 | Ga0207702_10027968 | |||
| 1453 | Ga0207702_10067559 | |||
| 1454 | Ga0207702_10070749 | |||
| 1455 | Ga0207702_10272486 | |||
| 1456 | Ga0207702_11062335 | |||
| 1457 | Ga0207641_10157159 | |||
| 1458 | Ga0207641_11016159 | |||
| 1459 | Ga0207648_10076745 | |||
| 1460 | Ga0207648_11309995 | |||
| 1461 | Ga0207676_10947386 | |||
| 1462 | Ga0207674_10024477 | |||
| 1463 | Ga0207675_100043261 | |||
| 1464 | Ga0207675_100110343 | |||
| 1465 | Ga0207675_100178189 | |||
| 1466 | Ga0207675_102359260 | |||
| 1467 | Ga0207683_10023473 | |||
| 1468 | Ga0207683_10048974 | |||
| 1469 | Ga0207683_10147852 | |||
| 1470 | Ga0207698_10002333 | |||
| 1471 | Ga0207698_10160972 | |||
| 1472 | Ga0207698_10185779 | |||
| 1473 | Ga0207698_10248303 | |||
| 1474 | Ga0207698_10290591 | |||
| 1475 | Ga0207698_10342758 | |||
| 1476 | Ga0207698_10452135 | |||
| 1477 | Ga0209589_1000023 | |||
| 1478 | Ga0209489_100032 | |||
| 1479 | Ga0209700_100040 | |||
| 1480 | Ga0209813_10055693 | |||
| 1481 | Ga0207428_10063792 | |||
| 1482 | Ga0268266_10003342 | |||
| 1483 | Ga0268266_10006607 | |||
| 1484 | Ga0268266_10104930 | |||
| 1485 | Ga0268266_10129995 | |||
| 1486 | Ga0268266_10400565 | |||
| 1487 | Ga0268265_10051933 | |||
| 1488 | Ga0268265_10090144 | |||
| 1489 | Ga0268265_10397904 | |||
| 1490 | Ga0268265_10927663 | |||
| 1491 | Ga0268264_10000022 | |||
| 1492 | Ga0265334_10038040 | |||
| 1493 | Ga0307517_10005009 | |||
| 1494 | Ga0307515_10360792 | |||
| 1495 | Ga0307515_10465256 | |||
| 1496 | Ga0265338_10011282 | |||
| 1497 | Ga0265324_10075378 | |||
| 1498 | Ga0307511_10049942 | |||
| 1499 | Ga0265332_10010231 | |||
| 1500 | Ga0265332_10041790 | |||
| 1501 | Ga0265332_10091618 | |||
| 1502 | Ga0265328_10031272 | |||
| 1503 | Ga0265325_10042863 | |||
| 1504 | Ga0265325_10055000 | |||
| 1505 | Ga0265340_10035821 | |||
| 1506 | Ga0265339_10000066 | |||
| 1507 | Ga0265339_10064959 | |||
| 1508 | Ga0265331_10012784 | |||
| 1509 | Ga0265331_10166934 | |||
| 1510 | Ga0265316_10257402 | |||
| 1511 | Ga0307509_10510207 | |||
| 1512 | Ga0307509_10555870 | |||
| 1513 | Ga0307509_10588347 | |||
| 1514 | Ga0265313_10002033 | |||
| 1515 | Ga0307508_10000009 | |||
| 1516 | Ga0307508_10038432 | |||
| 1517 | Ga0307508_10190796 | |||
| 1518 | Ga0265314_10029611 | |||
| 1519 | Ga0265314_10158677 | |||
| 1520 | Ga0307516_10011105 | |||
| 1521 | Ga0307516_10086685 | |||
| 1522 | Ga0307416_100699828 | |||
| 1523 | Ga0307416_100938635 | |||
| 1524 | Ga0307414_10871574 | |||
| 1525 | Ga0307415_100050285 | |||
| 1526 | Ga0307507_10025380 | |||
| 1527 | Ga0307510_10008758 | |||
| 1528 | Ga0307510_10053344 | |||
| 1529 | Ga0307510_10095668 | |||
| 1530 | Ga0307510_10161379 | |||
| 1531 | Ga0315911_1000001 | |||
| 1532 | Ga0316215_1000469 | |||
| 1533 | Ga0373930_0152237 | |||
| 1534 | Ga0373950_0091029 | |||
| 1535 | Ga0373926_0037844 | |||
| 1536 | Ga0373934_0014733 | |||
| 1537 | Ga0373923_0020753 | |||
| 1538 | Ga0373923_0028095 | |||
| 1539 | Ga0373923_0205205 | |||
| 1540 | Ga0373932_0264813 | |||
| 1541 | Ga0373936_0011983 | |||
| 1542 | Ga0373936_0089961 | |||
| 1543 | Ga0373945_0005636 | |||
| 1544 | Ga0373953_0000171 | |||
| 1545 | Ga0373953_0049065 | |||
| 1546 | Ga0373954_0001704 | |||
| 1547 | Ga0373956_0024416 | |||
| 1548 | Ga0373957_0000100 | |||
| 1549 | Ga0373957_0058441 | |||
| 1550 | Ga0373960_0329036 | |||
| 1551 | Ga0373943_0028011 | |||
| 1552 | Ga0373943_0225514 | |||
| 1553 | Ga0373946_0003172 | |||
| 1554 | Ga0373955_0001365 | |||
| 1555 | Ga0373955_0032088 | |||
| 1556 | Ga0373931_0064956 | |||
| 1557 | Ga0373935_0003830 | |||
| 1558 | Ga0373935_0075594 | |||
| 1559 | Ga0373935_0076730 | |||
| 1560 | Ga0373935_0201660 | |||
| 1561 | Ga0373935_0720647 | |||
| 1562 | Ga0373927_0000069 | |||
| 1563 | Ga0373927_0050140 | |||
| 1564 | Ga0373927_0058242 | |||
| 1565 | Ga0373927_0067439 | |||
| 1566 | Ga0373933_0000781 | |||
| 1567 | Ga0373933_0002823 | |||
| 1568 | Ga0373933_0546546 | |||
| 1569 | Ga0373947_0008029 | |||
| 1570 | Ga0373947_0012802 | |||
| 1571 | Ga0373947_0034922 | |||
| 1572 | Ga0373947_0500833 | |||
| 1573 | Ga0373937_0007517 | |||
| 1574 | Ga0373937_0061733 | |||
| 1575 | Ga0373937_0150934 | |||
| 1576 | Ga0373937_0233024 | |||
| 1577 | Ga0373925_0003396 | |||
| 1578 | Ga0373925_0016611 | |||
| 1579 | Ga0373925_0035208 | |||
| 1580 | Ga0395899_0082407 | |||
| 1581 | Ga0395900_0000860 | |||
| 1582 | Ga0395900_0084203 | |||
| 1583 | Ga0395900_0268294 | |||
| 1584 | Ga0395900_0342245 | |||
| 1585 | Ga0395900_1035212 | |||
| 1586 | Ga0395898_0032210 | |||
| 1587 | Ga0395898_0099348 | |||
| 1588 | Ga0395898_0148062 | |||
| 1589 | Ga0395898_0208224 | |||
| 1590 | Ga0395898_0308246 | |||
| 1591 | Ga0395905_0197051 | |||
| 1592 | Ga0395905_0385734 | |||
| 1593 | Ga0395905_0780805 | |||
| 1594 | Ga0436364_0066298 | |||
| 1595 | Ga0395901_0041679 | |||
| 1596 | Ga0395901_0092102 | |||
| 1597 | Ga0395901_0444175 | |||
| 1598 | Ga0395901_0896152 | |||
| 1599 | Ga0436365_0353234 | |||
| 1600 | Ga0436365_1305911 | |||
| 1601 | Ga0436360_1275075 | |||
| 1602 | Ga0436360_1278402 | |||
| 1603 | Ga0436361_0305956 | |||
| 1604 | Ga0436361_0472856 | |||
| 1605 | Ga0436363_0184448 | |||
| 1606 | Ga0436363_0607928 | |||
| 1607 | Ga0436363_0694729 | |||
| 1608 | Ga0436362_0352029 | |||
| 1609 | Ga0436362_0920921 | |||
| 1610 | Ga0436362_1022971 | |||
| 1611 | Ga0439465_0170381 | |||
| 1612 | Ga0451791_0809607 | |||
| 1613 | Ga0451793_0170774 | |||
| 1614 | Ga0451800_1456892 | |||
| 1615 | Ga0451802_1071351 | |||
| 1616 | Ga0451804_0302326 | |||
| 1617 | Ga0451853_0473357 | |||
| 1618 | Ga0466972_0129401 | |||
| 1619 | Ga0466963_0177299 | |||
| 1620 | Ga0466964_0138432 | |||
| 1621 | Ga0466957_0351794 | |||
| 1622 | Ga0466957_0531114 | |||
| 1623 | Ga0466960_0500849 | |||
| 1624 | Ga0466959_0167491 | |||
| 1625 | Ga0466958_0102701 | |||
| 1626 | Ga0466967_0031972 | |||
| 1627 | Ga0466967_0044464 | |||
| 1628 | Ga0466967_0287806 | |||
| 1629 | Ga0466967_0667046 | |||
| 1630 | Ga0495592_0000890 | |||
| 1631 | Ga0495592_0011137 | |||
| 1632 | Ga0495592_0217289 | |||
| 1633 | Ga0495603_0001909 | |||
| 1634 | Ga0495603_0014989 | |||
| 1635 | Ga0495603_0019319 | |||
| 1636 | Ga0495603_0057286 | |||
| 1637 | Ga0495603_0076075 | |||
| 1638 | Ga0495629_0000083 | |||
| 1639 | Ga0495629_0001665 | |||
| 1640 | Ga0495629_0093534 | |||
| 1641 | Ga0495629_0152215 | |||
| 1642 | Ga0495638_0344159 | |||
| 1643 | Ga0495641_0154902 | |||
| 1644 | Ga0495651_0004120 | |||
| 1645 | Ga0495653_0000905 | |||
| 1646 | Ga0495653_0065868 | |||
| 1647 | Ga0495580_0001769 | |||
| 1648 | Ga0495580_0041958 | |||
| 1649 | Ga0495580_0515331 | |||
| 1650 | Ga0495582_0000206 | |||
| 1651 | Ga0495582_0045731 | |||
| 1652 | Ga0495582_0320920 | |||
| 1653 | Ga0495639_0000167 | |||
| 1654 | Ga0495639_0034070 | |||
| 1655 | Ga0495639_0158236 | |||
| 1656 | Ga0495639_0349181 | |||
| 1657 | Ga0495662_0000457 | |||
| 1658 | Ga0495662_0028582 | |||
| 1659 | Ga0495664_0049306 | |||
| 1660 | Ga0495664_0079556 | |||
| 1661 | Ga0495664_0120092 | |||
| 1662 | Ga0495664_0129718 | |||
| 1663 | Ga0495594_0000838 | |||
| 1664 | Ga0495594_0308187 | |||
| 1665 | Ga0495607_0254486 | |||
| 1666 | Ga0495606_0028639 | |||
| 1667 | Ga0495606_0190269 | |||
| 1668 | Ga0495608_0005206 | |||
| 1669 | Ga0495610_0029532 | |||
| 1670 | Ga0495618_0053488 | |||
| 1671 | Ga0495618_0124131 | |||
| 1672 | Ga0495628_0013690 | |||
| 1673 | Ga0495628_0046174 | |||
| 1674 | Ga0495628_0106349 | |||
| 1675 | Ga0495628_0250064 | |||
| 1676 | Ga0495628_0337733 | |||
| 1677 | Ga0495630_0015598 | |||
| 1678 | Ga0495630_0286703 | |||
| 1679 | Ga0495631_0042197 | |||
| 1680 | Ga0495631_0204855 | |||
| 1681 | Ga0495644_0215235 | |||
| 1682 | Ga0495648_0000160 | |||
| 1683 | Ga0495648_0063615 | |||
| 1684 | Ga0495648_0114382 | |||
| 1685 | Ga0495648_0296543 | |||
| 1686 | Ga0495666_0116057 | |||
| 1687 | Ga0495652_0006710 | |||
| 1688 | Ga0495652_0086209 | |||
| 1689 | Ga0495665_0000399 | |||
| 1690 | Ga0495665_0094511 | |||
| 1691 | Ga0495640_0002380 | |||
| 1692 | Ga0495640_0006041 | |||
| 1693 | Ga0495640_0022858 | |||
| 1694 | Ga0495587_0001761 | |||
| 1695 | Ga0495597_0108630 | |||
| 1696 | Ga0495645_0011866 | |||
| 1697 | Ga0495645_0099796 | |||
| 1698 | Ga0495622_0031543 | |||
| 1699 | Ga0495622_0117268 | |||
| 1700 | Ga0495622_0157988 | |||
| 1701 | Ga0495667_0008194 | |||
| 1702 | Ga0495667_0023917 | |||
| 1703 | Ga0495667_0323080 | |||
| 1704 | Ga0495668_0079059 | |||
| 1705 | Ga0495668_0214909 | |||
| 1706 | Ga0495668_0218941 | |||
| 1707 | Ga0495668_0356803 | |||
| 1708 | Ga0495668_0657920 | |||
| 1709 | Ga0495634_0001116 | |||
| 1710 | Ga0495634_0033261 | |||
| 1711 | Ga0495634_0068117 | |||
| 1712 | Ga0495634_0317379 | |||
| 1713 | Ga0495611_0028869 | |||
| 1714 | Ga0495611_0103977 | |||
| 1715 | Ga0495611_0150371 | |||
| 1716 | Ga0495625_0196711 | |||
| 1717 | Ga0495625_0323566 | |||
| 1718 | Ga0495625_0346200 | |||
| 1719 | Ga0495635_0001363 | |||
| 1720 | Ga0495635_0008724 | |||
| 1721 | Ga0495635_1027362 | |||
| 1722 | Ga0495588_0009937 | |||
| 1723 | Ga0495588_0082817 | |||
| 1724 | Ga0495657_0001869 | |||
| 1725 | Ga0495657_0111900 | |||
| 1726 | Ga0495599_0005931 | |||
| 1727 | Ga0495599_0031077 | |||
| 1728 | Ga0495623_0001546 | |||
| 1729 | Ga0495646_0002015 | |||
| 1730 | Ga0495646_0007314 | |||
| 1731 | Ga0495646_0015020 | |||
| 1732 | Ga0495647_0001461 | |||
| 1733 | Ga0495647_0036068 | |||
| 1734 | Ga0495658_0003680 | |||
| 1735 | Ga0495658_0036491 | |||
| 1736 | Ga0495658_0252632 | |||
| 1737 | Ga0495658_0587486 | |||
| 1738 | Ga0495669_0016655 | |||
| 1739 | Ga0495669_0081447 | |||
| 1740 | Ga0495669_0524853 | |||
| 1741 | Ga0495613_0002852 | |||
| 1742 | Ga0495613_0114270 | |||
| 1743 | Ga0495624_0000096 | |||
| 1744 | Ga0495624_0055814 | |||
| 1745 | Ga0495624_0093725 | |||
| 1746 | Ga0495670_0059936 | |||
| 1747 | Ga0495670_0238612 | |||
| 1748 | Ga0495670_0270909 | |||
| 1749 | Ga0495589_0185678 | |||
| 1750 | Ga0495589_0400030 | |||
| 1751 | Ga0495600_0000380 | |||
| 1752 | Ga0495660_0073144 | |||
| 1753 | Ga0495581_0000311 | |||
| 1754 | Ga0495581_0106091 | |||
| 1755 | Ga0495581_0424159 | |||
| 1756 | Ga0495604_0003890 | |||
| 1757 | Ga0495604_0073297 | |||
| 1758 | Ga0495604_0216048 | |||
| 1759 | Ga0495604_0444889 | |||
| 1760 | Ga0495674_0007643 | |||
| 1761 | Ga0495674_0038405 | |||
| 1762 | Ga0495674_0694488 | |||
| 1763 | Ga0495672_0015084 | |||
| 1764 | Ga0495672_0017739 | |||
| 1765 | Ga0495672_0028548 | |||
| 1766 | Ga0495672_0068505 | |||
| 1767 | Ga0495676_0034547 | |||
| 1768 | Ga0495676_0063854 | |||
| 1769 | Ga0495676_0095342 | |||
| 1770 | Ga0495680_0007705 | |||
| 1771 | Ga0495675_0003666 | |||
| 1772 | Ga0495673_0227490 | |||
| 1773 | Ga0495673_0284409 | |||
| 1774 | Ga0495684_0000942 | |||
| 1775 | Ga0495684_0042610 | |||
| 1776 | Ga0495684_0531723 | |||
| 1777 | Ga0495686_0085195 | |||
| 1778 | Ga0495686_0153957 | |||
| 1779 | Ga0495686_0154539 | |||
| 1780 | Ga0495593_0000071 | |||
| 1781 | Ga0495593_0001112 | |||
| 1782 | Ga0495593_0153866 | |||
| 1783 | Ga0495593_0218642 | |||
| 1784 | Ga0495602_0003245 | |||
| 1785 | Ga0495602_0214737 | |||
| 1786 | Ga0495602_0409162 | |||
| 1787 | Ga0495602_0530922 | |||
| 1788 | Ga0495614_0575855 | |||
| 1789 | Ga0495615_0151620 | |||
| 1790 | Ga0496100_0515098 | |||
| 1791 | Ga0496100_0590269 | |||
| 1792 | Ga0496101_0036002 | |||
| 1793 | Ga0496101_0867108 | |||
| 1794 | Ga0496102_0001926 | |||
| 1795 | Ga0496102_0103146 | |||
| 1796 | Ga0496102_0289521 | |||
| 1797 | Ga0496102_0303082 | |||
| 1798 | Ga0496102_0822531 | |||
| 1799 | Ga0496103_0184487 | |||
| 1800 | Ga0496103_0671138 | |||
| 1801 | Ga0496104_0016935 | |||
| 1802 | Ga0496104_0092999 | |||
| 1803 | Ga0496104_0157000 | |||
| 1804 | Ga0496104_0497913 | |||
| 1805 | Ga0496105_0014383 | |||
| 1806 | Ga0496105_0690161 | |||
| 1807 | Ga0496106_0001303 | |||
| 1808 | Ga0496106_0007840 | |||
| 1809 | Ga0496106_0015567 | |||
| 1810 | Ga0496106_0178923 | |||
| 1811 | Ga0496106_0282481 | |||
| 1812 | Ga0496106_0369210 | |||
| 1813 | Ga0496108_0031040 | |||
| 1814 | Ga0496108_0056325 | |||
| 1815 | Ga0496109_0028701 | |||
| 1816 | Ga0496109_0112955 | |||
| 1817 | Ga0496109_0164649 | |||
| 1818 | Ga0496109_0589436 | |||
| 1819 | Ga0496110_0020916 | |||
| 1820 | Ga0496110_0035219 | |||
| 1821 | Ga0496110_0036728 | |||
| 1822 | Ga0496110_0627375 | |||
| 1823 | Ga0496111_0108132 | |||
| 1824 | Ga0496112_0000079 | |||
| 1825 | Ga0496112_0011862 | |||
| 1826 | Ga0496112_0042624 | |||
| 1827 | Ga0496113_0052259 | |||
| 1828 | Ga0496113_0175600 | |||
| 1829 | Ga0496113_0537317 | |||
| 1830 | Ga0496114_0019364 | |||
| 1831 | Ga0496114_0097833 | |||
| 1832 | Ga0496114_0408748 | |||
| 1833 | Ga0496114_1048957 | |||
| 1834 | Ga0496115_0001660 | |||
| 1835 | Ga0496115_0021912 | |||
| 1836 | Ga0496115_0170170 | |||
| 1837 | Ga0496115_1009269 | |||
| 1838 | Ga0496116_0082894 | |||
| 1839 | Ga0496118_0005806 | |||
| 1840 | Ga0496118_0175041 | |||
| 1841 | Ga0496118_0308421 | |||
| 1842 | Ga0496118_0398833 | |||
| 1843 | Ga0496119_0093005 | |||
| 1844 | Ga0496119_0161712 | |||
| 1845 | Ga0496119_0424704 | |||
| 1846 | Ga0496120_0073316 | |||
| 1847 | Ga0496121_0000456 | |||
| 1848 | Ga0496121_0000495 | |||
| 1849 | Ga0496121_0009589 | |||
| 1850 | Ga0496121_0026710 | |||
| 1851 | Ga0496121_0040184 | |||
| 1852 | Ga0496121_0069554 | |||
| 1853 | Ga0496121_0092008 | |||
| 1854 | Ga0496121_0533999 | |||
| 1855 | Ga0496123_0220446 | |||
| 1856 | Ga0496124_0001010 | |||
| 1857 | Ga0496125_0004034 | |||
| 1858 | Ga0496125_0018832 | |||
| 1859 | Ga0496125_0244008 | |||
| 1860 | Ga0496125_0414965 | |||
| 1861 | Ga0496126_0003586 | |||
| 1862 | Ga0496126_0026206 | |||
| 1863 | Ga0496126_0033722 | |||
| 1864 | Ga0496126_0043395 | |||
| 1865 | Ga0496126_0058174 | |||
| 1866 | Ga0496126_0101712 | |||
| 1867 | Ga0496126_0105811 | |||
| 1868 | Ga0496126_0120484 | |||
| 1869 | Ga0496126_0177663 | |||
| 1870 | Ga0496126_0209658 | |||
| 1871 | Ga0496126_0310794 | |||
| 1872 | Ga0496126_0386040 | |||
| 1873 | Ga0496126_0390660 | |||
| 1874 | Ga0496126_0501252 | |||
| 1875 | Ga0495678_153481 | |||
| 1876 | Ga0495682_0121922 | |||
| 1877 | Ga0501043_0202544 | |||
| 1878 | Ga0501046_0024946 | |||
| 1879 | Ga0501047_0039854 | |||
| 1880 | Ga0501047_0852488 | |||
| 1881 | Ga0501048_0667043 | |||
| 1882 | Ga0501067_0084969 | |||
| 1883 | Ga0501069_0030878 | |||
| 1884 | Ga0501069_0167132 | |||
| 1885 | Ga0501070_0011268 | |||
| 1886 | Ga0501070_0012856 | |||
| 1887 | Ga0501070_0322394 | |||
| 1888 | Ga0501073_0086110 | |||
| 1889 | Ga0501074_0078168 | |||
| 1890 | Ga0501080_0013807 | |||
| 1891 | Ga0501080_0324053 | |||
| 1892 | Ga0501080_0817263 | |||
| 1893 | Ga0501081_0111928 | |||
| 1894 | Ga0501035_0004051 | |||
| 1895 | Ga0501035_0302102 | |||
| 1896 | Ga0501044_0025310 | |||
| 1897 | nmdc:mga03n38_832_c1 | |||
| 1898 | nmdc:mga03n38_97361_c1 | |||
| 1899 | nmdc:mga00v17_115179_c1 | |||
| 1900 | nmdc:mga00v17_345738_c1 | |||
| 1901 | nmdc:mga0yw44_237435_c1 | |||
| 1902 | nmdc:mga0yw44_449076_c1 | |||
| 1903 | nmdc:mga0yw44_929149_c1 | |||
| 1904 | nmdc:mga0k408_328282_c1 | |||
| 1905 | nmdc:mga0k408_375096_c1 | |||
| 1906 | nmdc:mga06z11_20530_c1 | |||
| 1907 | nmdc:mga06z11_375023_c1 | |||
| 1908 | nmdc:mga06z11_663862_c1 | |||
| 1909 | nmdc:mga07m45_18553_c1 | |||
| 1910 | nmdc:mga07m45_343080_c1 | |||
| 1911 | nmdc:mga07m45_444712_c1 | |||
| 1912 | nmdc:mga07m45_7096_c1 | |||
| 1913 | nmdc:mga07m45_88076_c1 | |||
| 1914 | nmdc:mga08y16_39585_c1 | |||
| 1915 | nmdc:mga0n895_287718_c1 | |||
| 1916 | nmdc:mga0n895_332638_c1 | |||
| 1917 | nmdc:mga0rr50_646068_c1 | |||
| 1918 | nmdc:mga08x19_143838_c1 | |||
| 1919 | nmdc:mga08x19_40070_c1 | |||
| 1920 | nmdc:mga0sz30_23496_c1 | |||
| 1921 | nmdc:mga0sz30_34029_c1 | |||
| 1922 | Ga0495601_0027779 | |||
| 1923 | Ga0495601_0042600 | |||
| 1924 | Ga0495601_0472647 | |||
| 1925 | Ga0500635_0017942 | |||
| 1926 | Ga0495595_0000897 | |||
| 1927 | Ga0495619_0001717 | |||
| 1928 | Ga0495619_0082462 | |||
| 1929 | Ga0495619_0274558 | |||
| 1930 | Ga0500578_0496269 | |||
| 1931 | Ga0500643_051488 | |||
| 1932 | Ga0500583_0119420 | |||
| 1933 | Ga0500583_0211573 | |||
| 1934 | Ga0500651_0003265 | |||
| 1935 | Ga0500651_0533927 | |||
| 1936 | Ga0500566_0000038 | |||
| 1937 | Ga0500566_0016608 | |||
| 1938 | Ga0500566_0256979 | |||
| 1939 | Ga0500640_036928 | |||
| 1940 | Ga0500648_222321 | |||
| 1941 | Ga0500554_035582 | |||
| 1942 | Ga0500556_0025949 | |||
| 1943 | Ga0500562_025536 | |||
| 1944 | Ga0500572_000010 | |||
| 1945 | Ga0500594_0007902 | |||
| 1946 | Ga0500595_002817 | |||
| 1947 | Ga0500595_002876 | |||
| 1948 | Ga0500595_016482 | |||
| 1949 | Ga0500595_018993 | |||
| 1950 | Ga0500595_063780 | |||
| 1951 | Ga0500595_113097 | |||
| 1952 | Ga0500614_000527 | |||
| 1953 | Ga0500614_026458 | |||
| 1954 | Ga0500628_114928 | |||
| 1955 | Ga0500642_0088483 | |||
| 1956 | Ga0500658_0180561 | |||
| 1957 | Ga0500658_0242075 | |||
| 1958 | Ga0500559_0001831 | |||
| 1959 | Ga0500559_0009373 | |||
| 1960 | Ga0500559_0168988 | |||
| 1961 | Ga0500564_112167 | |||
| 1962 | Ga0500568_0001566 | |||
| 1963 | Ga0500573_0179107 | |||
| 1964 | Ga0500588_0080855 | |||
| 1965 | Ga0500588_0187424 | |||
| 1966 | Ga0500589_087981 | |||
| 1967 | Ga0500590_145637 | |||
| 1968 | Ga0500603_000506 | |||
| 1969 | Ga0500603_001941 | |||
| 1970 | Ga0500603_020051 | |||
| 1971 | Ga0500603_113949 | |||
| 1972 | Ga0500604_0263084 | |||
| 1973 | Ga0500622_0244198 | |||
| 1974 | Ga0500630_001647 | |||
| 1975 | Ga0500633_0070916 | |||
| 1976 | Ga0500638_006485 | |||
| 1977 | Ga0500638_006620 | |||
| 1978 | Ga0500638_066816 | |||
| 1979 | Ga0500639_000034 | |||
| 1980 | Ga0500636_0276285 | |||
| 1981 | Ga0500637_0009537 | |||
| 1982 | Ga0500637_0013593 | |||
| 1983 | Ga0500637_0015460 | |||
| 1984 | Ga0500637_0045452 | |||
| 1985 | Ga0500576_085384 | |||
| 1986 | Ga0500657_106818 | |||
| 1987 | Ga0500552_001545 | |||
| 1988 | Ga0500596_000922 | |||
| 1989 | Ga0500596_008575 | |||
| 1990 | Ga0501084_0093842 | |||
| 1991 | Ga0500661_001416 | |||
| 1992 | Ga0501082_0303607 | |||
| 1993 | Ga0530510_0684805 | |||
| 1994 | 2513629311 | |||
| 1995 | 2513656574 | |||
| 1996 | 2513672370 | |||
| 1997 | 2513691755 | |||
| 1998 | 2513717523 | |||
| 1999 | 2513859539 | |||
| 2000 | 2513917759 | |||
| 2001 | 2517102100 | |||
| 2002 | 2517893169 | |||
| 2003 | 2524466825 | |||
| 2004 | 2524537280 | |||
| 2005 | 2617376565 | |||
| 2006 | 2728754596 | |||
| 2007 | 2793069963 | |||
| 2008 | 2824619736 | |||
| 2009 | 2824629344 | |||
| 2010 | 2824640778 | |||
| 2011 | 2824647105 | |||
| 2012 | 2824674680 | |||
| 2013 | 2824686418 | |||
| 2014 | 2824692859 | |||
| 2015 | 2824717291 | |||
| 2016 | 2824727491 | |||
| 2017 | 2824737157 | |||
| 2018 | 2824749675 | |||
| 2019 | 2838128602 | |||
| 2020 | 2841947302 | |||
| 2021 | 2841950748 | |||
| 2022 | 2841967062 | |||
| 2023 | 2841991067 | |||
| 2024 | 2847935162 | |||
| 2025 | 2874609519 | |||
| 2026 | 2874612755 | |||
| 2027 | 2876810983 | |||
| 2028 | 2879090126 | |||
| 2029 | 2879115707 | |||
| 2030 | 2885374762 | |||
| 2031 | 2885391705 | |||
| 2032 | 2903777840 | |||
| 2033 | 2904702039 | |||
| 2034 | 2906640884 | |||
| 2035 | 2906645835 | |||
| 2036 | 2906667863 | |||
| 2037 | 2908760344 | |||
| 2038 | 2908779330 | |||
| 2039 | 2922367778 | |||
| 2040 | 2922392319 | |||
| 2041 | 2922395542 | |||
| 2042 | 2932808971 | |||
| 2043 | 2935634106 | |||
| 2044 | 2935886684 | |||
| 2045 | 2941510997 | |||
| 2046 | 2941518381 | |||
| 2047 | 2941527356 | |||
| 2048 | 3005479487 | |||
| 2049 | 3005489371 | |||
| 2050 | 3005590915 | |||
| 2051 | 3005598363 | |||
| 2052 | 3005721522 | |||
| 2053 | 8006928272 | |||
| 2054 | 8006941661 | |||
| 2055 | 8006971958 | |||
| 2056 | 8006981371 | |||
| 2057 | 8006990371 | |||
| 2058 | 8006996407 | |||
| 2059 | 8019657420 | |||
| 2060 | 8056674662 | |||
| 2061 | 8056688542 | |||
| 2062 | 8056972649 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i00-assembly2.cif.gz_C | crystal structure of acetyltransferase (gnat family) from enterococcus faecalis | 0.8141 | 107 | 139 |
| 3n7z-assembly1.cif.gz_D | crystal structure of acetyltransferase from bacillus anthracis | 0.8109 | 107 | 139 |
| 6yoz-assembly2.cif.gz_BBB | hicel7b labelled with b-1,4-glucosyl cyclophellitol | 0.7529 | 104 | 133 |
| 2ovw-assembly4.cif.gz_D | endoglucanase i complexed with cellobiose | 0.7496 | 100 | 134 |
| 7ri9-assembly1.cif.gz_E | the structure of bam in msp1e3d1 at 6.9 angstrom resolution | 0.747 | 42 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2i00D02 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.786 | 107 | 139 | 3.40.630.30 |
| 2ovwB00 | Mainly Beta;Distorted Sandwich;1,4-Beta-D-Glucan Cellobiohydrolase I; Chain A;Glycoside hydrolase, family 7, domain | 0.7499 | 100 | 134 | 2.70.100.10 |
| af_Q9VHT2_8_184_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6811 | 107 | 142 | 2.130.10.10 |
| af_E7EM29_23_395_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.6729 | 104 | 134 | 3.40.50.1240 |
| 3gmvX00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;BLIP domain | 0.6619 | 54 | 124 | 3.10.450.730 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436FCK9-F1-model_v4 | Outer membrane protein assembly factor BamE | 0.7938 | 41 | 141 |
GO:0030674
GO:0043165 GO:0051205 GO:1990063 |
| AF-A0A258JV05-F1-model_v4 | Cell envelope protein SmpA | 0.7909 | 38 | 140 |
GO:0030674
GO:0043165 GO:0051205 GO:1990063 |
| AF-A0A6M1SVE7-F1-model_v4 | Outer membrane protein assembly factor BamE | 0.7421 | 40 | 150 |
GO:0030674
GO:0043165 GO:0051205 GO:1990063 |
| AF-A0A258JV05-F1-model_v4 | Cell envelope protein SmpA | 0.7342 | 38 | 140 |
GO:0030674
GO:0043165 GO:0051205 GO:1990063 |
| AF-A0A374W7R1-F1-model_v4 | T9SS C-terminal target domain-containing protein | 0.7331 | 76 | 137 |
|