F488643

General Info

Members Datasets Scaffolds Average Seq Length
1032 421 2064 413

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0117384|Ga0501034_0117384_96_1451
Length 451
Sequence MRQICIRLARNRTLDVHAHAALHPNAPGFPPQQEHLMILADDRGLSEEQRMMRDTCRAFVNEHVIPFTRQHWKREWIMTPEERLPAKILEIADAIGIRTIGIPEEFGGITLDPKTEVQTLALIAEEIARGDSGLADKLVQVWKISKLLKVIAPRHLQEYWFPRIVADPSFLLAHCSTEPRGASDRWLGYDTPETAFQTKAVLKGDEWIINGRKQFVSNGYDAQLYVVYANSRPGVKMAEGTSSFLIPRGTPGFSIARCNETMGGRFMNNGEMVFEDCRVPRDHCLVENEALARRAGHYALPGRIIQTSKNIGIGIAAFERTADYVQNYVQGGRILIKHQVVASRLADMATRICAVRSILKDASRAVDEGSPDADYLCSMAKLFASEEILKVCQNAVELHGGNGTMLDFGIEKLYRDAMMFLHMDGTVDITRFKIIKNLFPQTAGKYAGPEA

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
98 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
229 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
230 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
231 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
232 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
233 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
234 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
235 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
236 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
237 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
243 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
244 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
245 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
246 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
247 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
248 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
249 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
250 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
251 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
252 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
253 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
256 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
258 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
259 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
260 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
261 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
262 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
263 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
264 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
269 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
270 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
271 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
272 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
274 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
275 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
285 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
286 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
287 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
288 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
289 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
290 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
296 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
297 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
298 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
309 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
310 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
313 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
314 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
315 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
316 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
317 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
318 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
322 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
323 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
327 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
328 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
329 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
330 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
331 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
332 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
333 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
336 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
337 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
338 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
339 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
340 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
341 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
342 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
345 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
346 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
347 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
348 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
349 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
350 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
351 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
352 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
353 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
354 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
355 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
356 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
357 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
358 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
359 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
366 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
380 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
381 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
382 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
383 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
387 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
394 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
406 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
407 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
408 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
409 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
413 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
414 2643221557 Ensifer sp. Root558 Isolate Unclassified
415 2643221610 Ensifer sp. Root74 Isolate Unclassified
416 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
417 2643221668 Ensifer sp. Root423 Isolate Unclassified
418 2643221675 Ensifer sp. Root1298 Isolate Unclassified
419 2643221680 Ensifer sp. Root1312 Isolate Unclassified
420 2643221726 Ensifer sp. Root954 Isolate Unclassified
421 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 7.36
Rhizosphere 89.05
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0117384 3300049571 Unclassified 2648
2 2214856314 2209111006 Bacteria 8020
3 ARcpr5oldR_c000046 3300000041 Bacteria 22854
4 ARSoilYngRDRAFT_c00078 3300000042 Bacteria 16119
5 ARcpr5yngRDRAFT_c000072 3300000043 Bacteria 16816
6 ARSoilOldRDRAFT_c000019 3300000044 Bacteria 37577
7 ARCol0oldRDRAFT_c00019 3300000045 Bacteria 12070
8 ARCol0yngRDRAFT_1000004 3300000652 Bacteria 52222
9 JGI24746J21847_1000147 3300001977 Bacteria 8859
10 JGI24746J21847_1003854 3300001977 Bacteria 2369
11 JGI24747J21853_1000217 3300001978 Bacteria 3101
12 JGI24739J22299_10010699 3300001989 Bacteria 3402
13 JGI24737J22298_10002058 3300001990 Bacteria 7196
14 JGI24737J22298_10003740 3300001990 Bacteria 5356
15 JGI24737J22298_10023198 3300001990 Bacteria 1969
16 JGI24743J22301_10003718 3300001991 Bacteria 2435
17 JGI24750J21931_1000430 3300002070 Bacteria 6827
18 JGI24750J21931_1002146 3300002070 Bacteria 2393
19 JGI24745J21846_1001132 3300002073 Bacteria 2537
20 JGI24748J21848_1000555 3300002074 Bacteria 4040
21 JGI24738J21930_10004182 3300002075 Bacteria 3559
22 JGI24744J21845_10000132 3300002077 Bacteria 10427
23 JGI24034J26672_10002921 3300002239 Bacteria 2366
24 JGI24034J26672_10005798 3300002239 Bacteria 1775
25 JGI24742J22300_10000106 3300002244 Bacteria 11917
26 JGI24742J22300_10000483 3300002244 Bacteria 5928
27 Ga0055524_1001448 3300003775 Bacteria 13592
28 JGI25405J52794_10000722 3300003911 Bacteria 5036
29 JGI25405J52794_10002175 3300003911 Bacteria 3340
30 JGI25405J52794_10009788 3300003911 Bacteria 1815
31 Ga0065704_10075977 3300005289 Bacteria 5320
32 Ga0065715_10091019 3300005293 Bacteria 6205
33 Ga0070658_10022611 3300005327 Bacteria 5045
34 Ga0070658_10042393 3300005327 Bacteria 3676
35 Ga0070658_10145210 3300005327 Bacteria 1983
36 Ga0070676_10102718 3300005328 Bacteria 1769
37 Ga0070683_100001872 3300005329 Bacteria 16425
38 Ga0070683_100110942 3300005329 Bacteria 2588
39 Ga0070683_100329083 3300005329 Bacteria 1455
40 Ga0070690_100027115 3300005330 Bacteria 3540
41 Ga0070670_100005524 3300005331 Bacteria 10669
42 Ga0070670_100040546 3300005331 Bacteria 4002
43 Ga0070670_100138127 3300005331 Bacteria 2107
44 Ga0070677_10000429 3300005333 Bacteria 14486
45 Ga0068869_100004944 3300005334 Bacteria 8338
46 Ga0068869_100113167 3300005334 Bacteria 2067
47 Ga0070680_100016120 3300005336 Bacteria 5873
48 Ga0070680_100018787 3300005336 Bacteria 5470
49 Ga0070680_100076342 3300005336 Bacteria 2758
50 Ga0070680_100258243 3300005336 Bacteria 1473
51 Ga0070680_100284952 3300005336 Bacteria 1400
52 Ga0070682_100000695 3300005337 Bacteria 20200
53 Ga0068868_100004036 3300005338 Bacteria 10230
54 Ga0068868_100087923 3300005338 Bacteria 2500
55 Ga0070660_100001014 3300005339 Bacteria 18890
56 Ga0070660_100046044 3300005339 Bacteria 3342
57 Ga0070660_100072432 3300005339 Bacteria 2693
58 Ga0070660_100116389 3300005339 Bacteria 2132
59 Ga0070689_100012268 3300005340 Bacteria 6167
60 Ga0070689_100114941 3300005340 Bacteria 2144
61 Ga0070691_10011581 3300005341 Bacteria 4030
62 Ga0070691_10065025 3300005341 Bacteria 1761
63 Ga0070687_100112257 3300005343 Bacteria 1545
64 Ga0070661_100011491 3300005344 Bacteria 6167
65 Ga0070692_10002719 3300005345 Bacteria 6941
66 Ga0070668_100058985 3300005347 Bacteria 2970
67 Ga0070668_100128540 3300005347 Bacteria 2031
68 Ga0070669_100015276 3300005353 Bacteria 5470
69 Ga0070675_100000240 3300005354 Bacteria 35499
70 Ga0070675_100014864 3300005354 Bacteria 6144
71 Ga0070671_100015801 3300005355 Bacteria 6098
72 Ga0070671_100094737 3300005355 Bacteria 2503
73 Ga0070674_100013342 3300005356 Bacteria 5076
74 Ga0070674_100013446 3300005356 Bacteria 5062
75 Ga0070673_100007045 3300005364 Bacteria 7375
76 Ga0070688_100001905 3300005365 Bacteria 10468
77 Ga0070688_100049110 3300005365 Bacteria 2624
78 Ga0070659_100007610 3300005366 Bacteria 7873
79 Ga0070659_100010913 3300005366 Bacteria 6703
80 Ga0070667_100005456 3300005367 Bacteria 10623
81 Ga0070667_100020849 3300005367 Bacteria 5443
82 Ga0070667_100159811 3300005367 Bacteria 1984
83 Ga0070709_10000363 3300005434 Bacteria 28041
84 Ga0070709_10033820 3300005434 Bacteria 3094
85 Ga0070714_100000833 3300005435 Bacteria 21830
86 Ga0070714_100056156 3300005435 Bacteria 3367
87 Ga0070714_100094014 3300005435 Bacteria 2631
88 Ga0070713_100000381 3300005436 Bacteria 28351
89 Ga0070713_100003768 3300005436 Bacteria 10039
90 Ga0070713_100019401 3300005436 Bacteria 5190
91 Ga0070713_100097676 3300005436 Bacteria 2538
92 Ga0070710_10000226 3300005437 Bacteria 26288
93 Ga0070710_10004588 3300005437 Bacteria 6527
94 Ga0070710_10076967 3300005437 Bacteria 1937
95 Ga0070711_100001128 3300005439 Bacteria 14280
96 Ga0070705_100000612 3300005440 Bacteria 20651
97 Ga0070705_100027104 3300005440 Bacteria 3125
98 Ga0070700_100009080 3300005441 Bacteria 5449
99 Ga0070700_100027831 3300005441 Bacteria 3356
100 Ga0070694_100001207 3300005444 Bacteria 14909
101 Ga0070694_100002780 3300005444 Bacteria 10387
102 Ga0070694_100065749 3300005444 Bacteria 2485
103 Ga0070708_100074687 3300005445 Bacteria 3058
104 Ga0070708_100141210 3300005445 Bacteria 2233
105 Ga0070663_100015442 3300005455 Bacteria 4930
106 Ga0070663_100025552 3300005455 Bacteria 3989
107 Ga0070663_100040436 3300005455 Bacteria 3264
108 Ga0070662_100013532 3300005457 Bacteria 5430
109 Ga0070662_100028585 3300005457 Bacteria 3881
110 Ga0070662_100080215 3300005457 Bacteria 2429
111 Ga0070662_100204883 3300005457 Bacteria 1567
112 Ga0070662_100261831 3300005457 Bacteria 1393
113 Ga0070681_10011673 3300005458 Bacteria 8700
114 Ga0070681_10019315 3300005458 Bacteria 6820
115 Ga0070681_10096828 3300005458 Bacteria 2899
116 Ga0070681_10146679 3300005458 Bacteria 2288
117 Ga0070681_10244126 3300005458 Bacteria 1709
118 Ga0070681_10252357 3300005458 Bacteria 1676
119 Ga0068867_100132721 3300005459 Bacteria 1937
120 Ga0070685_10014546 3300005466 Bacteria 4171
121 Ga0070685_10040164 3300005466 Bacteria 2662
122 Ga0070685_10051505 3300005466 Bacteria 2380
123 Ga0070706_100040997 3300005467 Bacteria 4274
124 Ga0070707_100053998 3300005468 Bacteria 3852
125 Ga0070707_100193638 3300005468 Bacteria 1982
126 Ga0070698_100185928 3300005471 Bacteria 2015
127 Ga0070699_100002532 3300005518 Bacteria 16418
128 Ga0070699_100073539 3300005518 Bacteria 2974
129 Ga0070679_100023238 3300005530 Bacteria 6066
130 Ga0070679_100034205 3300005530 Bacteria 5036
131 Ga0070679_100040675 3300005530 Bacteria 4625
132 Ga0070679_100063861 3300005530 Bacteria 3670
133 Ga0070679_100084499 3300005530 Bacteria 3162
134 Ga0070684_100009261 3300005535 Bacteria 7750
135 Ga0070684_100062206 3300005535 Bacteria 3269
136 Ga0070684_100118724 3300005535 Bacteria 2378
137 Ga0070697_100039102 3300005536 Bacteria 3835
138 Ga0070697_100091058 3300005536 Bacteria 2521
139 Ga0068853_100009694 3300005539 Bacteria 7766
140 Ga0068853_100069407 3300005539 Bacteria 3065
141 Ga0070672_100001847 3300005543 Bacteria 13222
142 Ga0070672_100068241 3300005543 Bacteria 2820
143 Ga0070686_100008725 3300005544 Bacteria 5681
144 Ga0070686_100010163 3300005544 Bacteria 5296
145 Ga0070686_100038773 3300005544 Bacteria 2964
146 Ga0070695_100000054 3300005545 Bacteria 45999
147 Ga0070695_100029614 3300005545 Bacteria 3402
148 Ga0070695_100039414 3300005545 Bacteria 2986
149 Ga0070696_100000931 3300005546 Bacteria 18952
150 Ga0070696_100004350 3300005546 Bacteria 9440
151 Ga0070696_100038185 3300005546 Bacteria 3314
152 Ga0070704_100000180 3300005549 Bacteria 25489
153 Ga0070704_100004531 3300005549 Bacteria 8025
154 Ga0068855_100014855 3300005563 Bacteria 9377
155 Ga0068855_100017390 3300005563 Bacteria 8651
156 Ga0068855_100045702 3300005563 Bacteria 5178
157 Ga0068855_100091933 3300005563 Bacteria 3500
158 Ga0068855_100215519 3300005563 Bacteria 2155
159 Ga0070664_100001002 3300005564 Bacteria 22163
160 Ga0070664_100058640 3300005564 Bacteria 3274
161 Ga0068857_100131016 3300005577 Bacteria 2262
162 Ga0068857_100229267 3300005577 Bacteria 1698
163 Ga0068856_100023460 3300005614 Bacteria 5998
164 Ga0070702_100019293 3300005615 Bacteria 3554
165 Ga0070702_100096972 3300005615 Bacteria 1801
166 Ga0068852_100004985 3300005616 Bacteria 9446
167 Ga0068852_100047574 3300005616 Bacteria 3659
168 Ga0068859_100000494 3300005617 Bacteria 38849
169 Ga0068859_100010808 3300005617 Bacteria 9190
170 Ga0068859_100075191 3300005617 Bacteria 3418
171 Ga0068864_100003922 3300005618 Bacteria 12254
172 Ga0068864_100075630 3300005618 Bacteria 2941
173 Ga0068864_100105666 3300005618 Bacteria 2502
174 Ga0068861_100003710 3300005719 Bacteria 10192
175 Ga0068861_100014951 3300005719 Bacteria 5458
176 Ga0068861_100023937 3300005719 Bacteria 4410
177 Ga0068870_10000157 3300005840 Bacteria 23872
178 Ga0068870_10072506 3300005840 Bacteria 1882
179 Ga0068863_100000674 3300005841 Bacteria 34508
180 Ga0068858_100091776 3300005842 Bacteria 2826
181 Ga0068860_100001274 3300005843 Bacteria 27410
182 Ga0068860_100012435 3300005843 Bacteria 8381
183 Ga0068860_100045880 3300005843 Bacteria 4167
184 Ga0068860_100130650 3300005843 Bacteria 2409
185 Ga0068860_100188969 3300005843 Bacteria 1993
186 Ga0068862_100000795 3300005844 Bacteria 31295
187 Ga0068862_100070320 3300005844 Bacteria 3021
188 Ga0081455_10000059 3300005937 Bacteria 119148
189 Ga0081455_10002427 3300005937 Bacteria 22238
190 Ga0081455_10003542 3300005937 Bacteria 17909
191 Ga0081455_10004480 3300005937 Bacteria 15632
192 Ga0081455_10006602 3300005937 Bacteria 12413
193 Ga0081455_10169619 3300005937 Bacteria 1664
194 Ga0081538_10007110 3300005981 Bacteria 9723
195 Ga0081538_10051140 3300005981 Bacteria 2485
196 Ga0081538_10070167 3300005981 Bacteria 1936
197 Ga0081540_1002311 3300005983 Bacteria 15633
198 Ga0081540_1003101 3300005983 Bacteria 13314
199 Ga0081540_1008452 3300005983 Bacteria 7190
200 Ga0081540_1012205 3300005983 Bacteria 5681
201 Ga0081540_1014938 3300005983 Bacteria 4939
202 Ga0081540_1021121 3300005983 Bacteria 3890
203 Ga0070717_10000161 3300006028 Bacteria 50633
204 Ga0070717_10002481 3300006028 Bacteria 13029
205 Ga0070717_10063658 3300006028 Bacteria 3062
206 Ga0070717_10080835 3300006028 Bacteria 2728
207 Ga0070717_10115314 3300006028 Bacteria 2296
208 Ga0075365_10065661 3300006038 Bacteria 2432
209 Ga0075368_10025334 3300006042 Bacteria 2276
210 Ga0075432_10032964 3300006058 Bacteria 1795
211 Ga0070715_10014168 3300006163 Bacteria 2946
212 Ga0070715_10041416 3300006163 Bacteria 1930
213 Ga0070716_100000149 3300006173 Bacteria 28054
214 Ga0070716_100011064 3300006173 Bacteria 4538
215 Ga0070716_100045195 3300006173 Bacteria 2471
216 Ga0070712_100000413 3300006175 Bacteria 24419
217 Ga0070712_100022489 3300006175 Bacteria 4154
218 Ga0070712_100140207 3300006175 Bacteria 1844
219 Ga0075362_10026782 3300006177 Bacteria 2465
220 Ga0075367_10010139 3300006178 Bacteria 4941
221 Ga0075367_10026188 3300006178 Bacteria 3305
222 Ga0075367_10068531 3300006178 Bacteria 2128
223 Ga0075369_10017707 3300006186 Bacteria 2893
224 Ga0075366_10021275 3300006195 Bacteria 3770
225 Ga0075370_10072975 3300006353 Bacteria 1965
226 Ga0068871_100001066 3300006358 Bacteria 18401
227 Ga0075428_100038761 3300006844 Bacteria 5244
228 Ga0075428_100049877 3300006844 Bacteria 4592
229 Ga0075428_100088746 3300006844 Bacteria 3373
230 Ga0075428_100157176 3300006844 Bacteria 2469
231 Ga0075430_100000015 3300006846 Bacteria 89952
232 Ga0075430_100000070 3300006846 Bacteria 55805
233 Ga0075430_100001098 3300006846 Bacteria 21488
234 Ga0075430_100002472 3300006846 Bacteria 15389
235 Ga0075430_100006043 3300006846 Bacteria 10210
236 Ga0075430_100031115 3300006846 Bacteria 4530
237 Ga0075431_100001221 3300006847 Bacteria 23276
238 Ga0075431_100004759 3300006847 Bacteria 13347
239 Ga0075431_100011228 3300006847 Bacteria 9022
240 Ga0075431_100018201 3300006847 Bacteria 7149
241 Ga0075431_100098881 3300006847 Bacteria 3011
242 Ga0075433_10008464 3300006852 Bacteria 8210
243 Ga0075433_10010476 3300006852 Bacteria 7442
244 Ga0075433_10109013 3300006852 Unclassified 2456
245 Ga0075434_100000212 3300006871 Bacteria 39628
246 Ga0075434_100016655 3300006871 Bacteria 7069
247 Ga0075434_100037805 3300006871 Bacteria 4778
248 Ga0075434_100048636 3300006871 Bacteria 4208
249 Ga0075434_100060574 3300006871 Bacteria 3765
250 Ga0075434_100084707 3300006871 Bacteria 3168
251 Ga0075434_100090220 3300006871 Bacteria 3067
252 Ga0075434_100090704 3300006871 Bacteria 3057
253 Ga0075429_100003999 3300006880 Bacteria 12622
254 Ga0075429_100021829 3300006880 Bacteria 5550
255 Ga0075429_100250984 3300006880 Bacteria 1549
256 Ga0068865_100000131 3300006881 Bacteria 38862
257 Ga0075436_100143097 3300006914 Bacteria 1681
258 Ga0097620_100000494 3300006931 Bacteria 38849
259 Ga0097620_100010810 3300006931 Bacteria 9190
260 Ga0097620_100075191 3300006931 Bacteria 3418
261 Ga0075435_100034976 3300007076 Bacteria 3985
262 Ga0075435_100065898 3300007076 Bacteria 2945
263 Ga0075435_100077055 3300007076 Bacteria 2733
264 Ga0075435_100121660 3300007076 Bacteria 2178
265 Ga0099794_10008099 3300007265 Bacteria 4352
266 Ga0099794_10014325 3300007265 Bacteria 3472
267 Ga0099794_10043551 3300007265 Bacteria 2143
268 Ga0105240_10054986 3300009093 Bacteria 4985
269 Ga0111539_10000138 3300009094 Bacteria 82968
270 Ga0111539_10028951 3300009094 Bacteria 6755
271 Ga0111539_10039247 3300009094 Bacteria 5708
272 Ga0111539_10058878 3300009094 Bacteria 4557
273 Ga0111539_10064307 3300009094 Bacteria 4340
274 Ga0111539_10245411 3300009094 Bacteria 2085
275 Ga0105245_10011704 3300009098 Bacteria 7635
276 Ga0105245_10045266 3300009098 Bacteria 3930
277 Ga0105245_10059696 3300009098 Bacteria 3434
278 Ga0105245_10122401 3300009098 Bacteria 2431
279 Ga0105245_10175167 3300009098 Bacteria 2045
280 Ga0105247_10042379 3300009101 Bacteria 2788
281 Ga0105247_10042433 3300009101 Bacteria 2786
282 Ga0114129_10002312 3300009147 Bacteria 26434
283 Ga0114129_10003950 3300009147 Bacteria 20934
284 Ga0114129_10027223 3300009147 Bacteria 8094
285 Ga0114129_10102152 3300009147 Bacteria 3966
286 Ga0114129_10110227 3300009147 Bacteria 3799
287 Ga0114129_10110393 3300009147 Bacteria 3796
288 Ga0114129_10330175 3300009147 Bacteria 2025
289 Ga0105243_10006299 3300009148 Bacteria 9170
290 Ga0105243_10032492 3300009148 Bacteria 4033
291 Ga0105243_10091087 3300009148 Bacteria 2511
292 Ga0105243_10127230 3300009148 Bacteria 2157
293 Ga0105243_10176009 3300009148 Bacteria 1857
294 Ga0105243_10184399 3300009148 Bacteria 1817
295 Ga0105241_10056240 3300009174 Bacteria 3016
296 Ga0105241_10064613 3300009174 Bacteria 2826
297 Ga0105242_10078215 3300009176 Bacteria 2761
298 Ga0105242_10177574 3300009176 Bacteria 1876
299 Ga0105248_10002392 3300009177 Bacteria 20840
300 Ga0105248_10012777 3300009177 Bacteria 9265
301 Ga0105248_10013552 3300009177 Bacteria 8976
302 Ga0105237_10018866 3300009545 Bacteria 7132
303 Ga0105237_10042427 3300009545 Bacteria 4587
304 Ga0105238_10060021 3300009551 Bacteria 3809
305 Ga0105249_10001029 3300009553 Bacteria 24663
306 Ga0105249_10017439 3300009553 Bacteria 6373
307 Ga0105249_10024785 3300009553 Bacteria 5394
308 Ga0099796_10001372 3300010159 Bacteria 4859
309 Ga0105239_10043450 3300010375 Bacteria 4926
310 Ga0105239_10112207 3300010375 Bacteria 3023
311 Ga0105246_10022164 3300011119 Bacteria 4097
312 Ga0105246_10027151 3300011119 Bacteria 3748
313 Ga0157371_10030802 3300013102 Bacteria 3867
314 Ga0157374_10000671 3300013296 Bacteria 30150
315 Ga0157378_10088364 3300013297 Bacteria 2812
316 Ga0157378_10150135 3300013297 Bacteria 2171
317 Ga0157378_10411027 3300013297 Bacteria 1336
318 Ga0163162_10177606 3300013306 Bacteria 2255
319 Ga0157375_10002908 3300013308 Bacteria 14847
320 Ga0157375_10028268 3300013308 Bacteria 5254
321 Ga0157375_10110039 3300013308 Bacteria 2852
322 Ga0163163_10004312 3300014325 Bacteria 12118
323 Ga0163163_10010637 3300014325 Bacteria 8290
324 Ga0163163_10033625 3300014325 Bacteria 4961
325 Ga0157380_10005886 3300014326 Bacteria 8579
326 Ga0157380_10132662 3300014326 Bacteria 2127
327 Ga0157377_10000570 3300014745 Bacteria 15436
328 Ga0157379_10000345 3300014968 Bacteria 37352
329 Ga0157379_10033827 3300014968 Bacteria 4558
330 Ga0157379_10133620 3300014968 Bacteria 2235
331 Ga0157376_10025542 3300014969 Bacteria 4654
332 Ga0157376_10039773 3300014969 Bacteria 3838
333 Ga0157376_10098105 3300014969 Bacteria 2554
334 Ga0163161_10004669 3300017792 Bacteria 9525
335 Ga0163161_10037669 3300017792 Bacteria 3467
336 Ga0213875_10080492 3300021388 Bacteria 1520
337 Ga0207666_1000069 3300025271 Bacteria 17953
338 Ga0207666_1001040 3300025271 Bacteria 3294
339 Ga0207673_1007066 3300025290 Bacteria 1401
340 Ga0209256_1000073 3300025299 Bacteria 237553
341 Ga0207697_10000390 3300025315 Bacteria 24639
342 Ga0207697_10006568 3300025315 Bacteria 5248
343 Ga0207713_1036708 3300025735 Bacteria 2099
344 Ga0207653_10024508 3300025885 Bacteria 1926
345 Ga0207682_10000048 3300025893 Bacteria 50998
346 Ga0207682_10008138 3300025893 Bacteria 4157
347 Ga0207692_10000966 3300025898 Bacteria 10455
348 Ga0207692_10005320 3300025898 Bacteria 5150
349 Ga0207710_10022873 3300025900 Bacteria 2683
350 Ga0207688_10001496 3300025901 Bacteria 12264
351 Ga0207688_10004951 3300025901 Bacteria 7249
352 Ga0207680_10045613 3300025903 Bacteria 2585
353 Ga0207647_10013329 3300025904 Bacteria 5705
354 Ga0207647_10014742 3300025904 Bacteria 5380
355 Ga0207685_10004104 3300025905 Bacteria 3651
356 Ga0207699_10000366 3300025906 Bacteria 23940
357 Ga0207699_10074768 3300025906 Bacteria 2082
358 Ga0207645_10012526 3300025907 Bacteria 5751
359 Ga0207645_10030390 3300025907 Bacteria 3480
360 Ga0207643_10000581 3300025908 Bacteria 23180
361 Ga0207643_10007658 3300025908 Bacteria 5800
362 Ga0207705_10024062 3300025909 Bacteria 4345
363 Ga0207684_10023396 3300025910 Bacteria 5276
364 Ga0207684_10117905 3300025910 Bacteria 2274
365 Ga0207654_10004716 3300025911 Bacteria 6899
366 Ga0207707_10007064 3300025912 Bacteria 9788
367 Ga0207707_10016616 3300025912 Bacteria 6416
368 Ga0207707_10018671 3300025912 Bacteria 6047
369 Ga0207707_10048473 3300025912 Bacteria 3700
370 Ga0207707_10150622 3300025912 Bacteria 2034
371 Ga0207707_10169353 3300025912 Bacteria 1909
372 Ga0207695_10037025 3300025913 Bacteria 5267
373 Ga0207671_10011618 3300025914 Bacteria 7146
374 Ga0207693_10002752 3300025915 Bacteria 15229
375 Ga0207693_10010010 3300025915 Bacteria 7706
376 Ga0207693_10011653 3300025915 Bacteria 7112
377 Ga0207693_10072370 3300025915 Bacteria 2699
378 Ga0207663_10006969 3300025916 Bacteria 5827
379 Ga0207663_10058549 3300025916 Bacteria 2432
380 Ga0207663_10070026 3300025916 Bacteria 2259
381 Ga0207663_10127598 3300025916 Bacteria 1752
382 Ga0207660_10000192 3300025917 Bacteria 38947
383 Ga0207660_10009267 3300025917 Bacteria 6372
384 Ga0207662_10000647 3300025918 Bacteria 15732
385 Ga0207657_10038177 3300025919 Bacteria 4279
386 Ga0207657_10091226 3300025919 Bacteria 2541
387 Ga0207657_10094982 3300025919 Bacteria 2481
388 Ga0207649_10000141 3300025920 Bacteria 60047
389 Ga0207649_10045728 3300025920 Bacteria 2685
390 Ga0207649_10083443 3300025920 Bacteria 2074
391 Ga0207649_10163154 3300025920 Bacteria 1546
392 Ga0207652_10004519 3300025921 Bacteria 11293
393 Ga0207652_10151345 3300025921 Bacteria 2077
394 Ga0207652_10253216 3300025921 Bacteria 1588
395 Ga0207646_10057861 3300025922 Bacteria 3464
396 Ga0207646_10068130 3300025922 Bacteria 3178
397 Ga0207681_10000359 3300025923 Bacteria 32485
398 Ga0207681_10159118 3300025923 Bacteria 1700
399 Ga0207694_10035789 3300025924 Bacteria 3809
400 Ga0207650_10004853 3300025925 Bacteria 9185
401 Ga0207650_10006280 3300025925 Bacteria 8096
402 Ga0207650_10105022 3300025925 Bacteria 2180
403 Ga0207659_10000052 3300025926 Bacteria 79692
404 Ga0207659_10023639 3300025926 Bacteria 4105
405 Ga0207659_10249098 3300025926 Bacteria 1441
406 Ga0207687_10000097 3300025927 Bacteria 64441
407 Ga0207687_10069568 3300025927 Bacteria 2511
408 Ga0207687_10082051 3300025927 Bacteria 2332
409 Ga0207700_10000437 3300025928 Bacteria 24528
410 Ga0207700_10000673 3300025928 Bacteria 19951
411 Ga0207700_10032842 3300025928 Bacteria 3707
412 Ga0207664_10000416 3300025929 Bacteria 30401
413 Ga0207664_10137780 3300025929 Bacteria 2061
414 Ga0207664_10235823 3300025929 Bacteria 1592
415 Ga0207644_10002956 3300025931 Bacteria 10949
416 Ga0207644_10033370 3300025931 Bacteria 3596
417 Ga0207690_10000278 3300025932 Bacteria 36244
418 Ga0207706_10003979 3300025933 Bacteria 14003
419 Ga0207706_10036851 3300025933 Bacteria 4344
420 Ga0207706_10136791 3300025933 Bacteria 2155
421 Ga0207686_10000850 3300025934 Bacteria 18532
422 Ga0207686_10008904 3300025934 Bacteria 5430
423 Ga0207686_10210075 3300025934 Bacteria 1399
424 Ga0207709_10000349 3300025935 Bacteria 47453
425 Ga0207709_10014956 3300025935 Bacteria 4295
426 Ga0207709_10067541 3300025935 Bacteria 2256
427 Ga0207670_10000781 3300025936 Bacteria 16732
428 Ga0207670_10075180 3300025936 Bacteria 2347
429 Ga0207669_10000168 3300025937 Bacteria 30867
430 Ga0207704_10000704 3300025938 Bacteria 14739
431 Ga0207704_10153219 3300025938 Bacteria 1629
432 Ga0207665_10000234 3300025939 Bacteria 37889
433 Ga0207665_10000248 3300025939 Bacteria 37228
434 Ga0207665_10011501 3300025939 Bacteria 5814
435 Ga0207665_10074219 3300025939 Bacteria 2328
436 Ga0207691_10003348 3300025940 Bacteria 15596
437 Ga0207691_10006839 3300025940 Bacteria 11004
438 Ga0207711_10006180 3300025941 Bacteria 10120
439 Ga0207711_10012455 3300025941 Bacteria 7068
440 Ga0207711_10042109 3300025941 Bacteria 3890
441 Ga0207711_10119131 3300025941 Bacteria 2355
442 Ga0207711_10172471 3300025941 Bacteria 1963
443 Ga0207689_10012368 3300025942 Bacteria 7300
444 Ga0207689_10030358 3300025942 Bacteria 4504
445 Ga0207689_10117472 3300025942 Bacteria 2187
446 Ga0207661_10000143 3300025944 Bacteria 45329
447 Ga0207661_10049496 3300025944 Bacteria 3345
448 Ga0207661_10076338 3300025944 Bacteria 2752
449 Ga0207661_10110264 3300025944 Bacteria 2326
450 Ga0207661_10250242 3300025944 Bacteria 1575
451 Ga0207679_10000035 3300025945 Bacteria 144173
452 Ga0207679_10022285 3300025945 Bacteria 4311
453 Ga0207679_10179254 3300025945 Bacteria 1751
454 Ga0207667_10031667 3300025949 Bacteria 5707
455 Ga0207667_10043263 3300025949 Bacteria 4780
456 Ga0207651_10000080 3300025960 Bacteria 42826
457 Ga0207651_10018003 3300025960 Bacteria 4191
458 Ga0207712_10003380 3300025961 Bacteria 10087
459 Ga0207712_10065930 3300025961 Bacteria 2587
460 Ga0207668_10007588 3300025972 Bacteria 6457
461 Ga0207668_10109764 3300025972 Bacteria 2067
462 Ga0207640_10015424 3300025981 Bacteria 4422
463 Ga0207640_10092226 3300025981 Bacteria 2101
464 Ga0207658_10022910 3300025986 Bacteria 4352
465 Ga0207658_10137366 3300025986 Bacteria 1973
466 Ga0207677_10000614 3300026023 Bacteria 21876
467 Ga0207677_10033362 3300026023 Bacteria 3321
468 Ga0207703_10022821 3300026035 Bacteria 4915
469 Ga0207703_10033869 3300026035 Bacteria 4051
470 Ga0207703_10063034 3300026035 Bacteria 3038
471 Ga0207678_10005116 3300026067 Bacteria 11764
472 Ga0207678_10010214 3300026067 Bacteria 8241
473 Ga0207678_10044487 3300026067 Bacteria 3840
474 Ga0207678_10045206 3300026067 Bacteria 3808
475 Ga0207708_10008117 3300026075 Bacteria 7775
476 Ga0207708_10013232 3300026075 Bacteria 6160
477 Ga0207702_10001956 3300026078 Bacteria 20052
478 Ga0207702_10106726 3300026078 Bacteria 2482
479 Ga0207702_10116525 3300026078 Bacteria 2384
480 Ga0207702_10121704 3300026078 Bacteria 2336
481 Ga0207641_10009143 3300026088 Bacteria 8183
482 Ga0207641_10010400 3300026088 Bacteria 7646
483 Ga0207641_10276984 3300026088 Bacteria 1576
484 Ga0207648_10234244 3300026089 Bacteria 1634
485 Ga0207676_10001840 3300026095 Bacteria 15541
486 Ga0207676_10066563 3300026095 Bacteria 2874
487 Ga0207674_10002206 3300026116 Bacteria 24670
488 Ga0207674_10014002 3300026116 Bacteria 8866
489 Ga0207674_10139845 3300026116 Bacteria 2381
490 Ga0207675_100003721 3300026118 Bacteria 14854
491 Ga0207675_100012148 3300026118 Bacteria 8044
492 Ga0207675_100103227 3300026118 Bacteria 2686
493 Ga0207683_10002096 3300026121 Bacteria 17563
494 Ga0207683_10003030 3300026121 Bacteria 14680
495 Ga0207683_10013315 3300026121 Bacteria 7013
496 Ga0207683_10031288 3300026121 Bacteria 4618
497 Ga0207683_10047844 3300026121 Bacteria 3745
498 Ga0207698_10003387 3300026142 Bacteria 9597
499 Ga0207698_10006421 3300026142 Bacteria 7336
500 Ga0207698_10027888 3300026142 Bacteria 4017
501 Ga0209969_1000387 3300027360 Bacteria 5867
502 Ga0209981_1001997 3300027378 Bacteria 2610
503 Ga0210000_1001517 3300027462 Bacteria 3275
504 Ga0209999_1003848 3300027543 Bacteria 2698
505 Ga0209999_1006386 3300027543 Bacteria 2118
506 Ga0210002_1000400 3300027617 Bacteria 5929
507 Ga0209983_1005796 3300027665 Bacteria 2551
508 Ga0209588_1001621 3300027671 Bacteria 5917
509 Ga0209966_1002841 3300027695 Bacteria 2906
510 Ga0209998_10000497 3300027717 Bacteria 10801
511 Ga0209998_10001108 3300027717 Bacteria 6727
512 Ga0209974_10002609 3300027876 Bacteria 6539
513 Ga0209974_10003968 3300027876 Bacteria 5296
514 Ga0209974_10005545 3300027876 Bacteria 4432
515 Ga0207428_10000075 3300027907 Bacteria 137887
516 Ga0207428_10000428 3300027907 Bacteria 51964
517 Ga0207428_10001396 3300027907 Bacteria 25497
518 Ga0268266_10024188 3300028379 Bacteria 5169
519 Ga0268266_10159053 3300028379 Bacteria 2042
520 Ga0268265_10000528 3300028380 Bacteria 39003
521 Ga0268265_10003048 3300028380 Bacteria 12223
522 Ga0268265_10017602 3300028380 Bacteria 4936
523 Ga0268264_10001145 3300028381 Bacteria 25934
524 Ga0268264_10001265 3300028381 Bacteria 24009
525 Ga0268264_10045961 3300028381 Bacteria 3626
526 Ga0268264_10159119 3300028381 Bacteria 2033
527 Ga0265337_1000182 3300028556 Bacteria 33103
528 Ga0265338_10030715 3300028800 Bacteria 5283
529 Ga0265338_10056170 3300028800 Bacteria 3494
530 Ga0265332_10002169 3300031238 Bacteria 10111
531 Ga0265325_10000034 3300031241 Bacteria 99371
532 Ga0265325_10001708 3300031241 Bacteria 15269
533 Ga0265325_10008595 3300031241 Bacteria 6015
534 Ga0265325_10038458 3300031241 Bacteria 2525
535 Ga0265340_10009089 3300031247 Bacteria 5343
536 Ga0265340_10039523 3300031247 Bacteria 2328
537 Ga0265339_10000091 3300031249 Bacteria 75937
538 Ga0265339_10001994 3300031249 Bacteria 14995
539 Ga0265339_10019021 3300031249 Bacteria 4038
540 Ga0265339_10037911 3300031249 Bacteria 2691
541 Ga0265331_10075347 3300031250 Bacteria 1573
542 Ga0265316_10043894 3300031344 Bacteria 3559
543 Ga0265316_10108022 3300031344 Bacteria 2109
544 Ga0307408_100035017 3300031548 Bacteria 3521
545 Ga0265313_10000176 3300031595 Bacteria 68037
546 Ga0265313_10000260 3300031595 Bacteria 57581
547 Ga0265313_10004374 3300031595 Bacteria 10905
548 Ga0265313_10006492 3300031595 Bacteria 8266
549 Ga0265313_10014189 3300031595 Bacteria 4724
550 Ga0265314_10118885 3300031711 Bacteria 1667
551 Ga0265342_10000175 3300031712 Bacteria 71083
552 Ga0265342_10000203 3300031712 Bacteria 66540
553 Ga0265342_10029297 3300031712 Bacteria 3419
554 Ga0265342_10081644 3300031712 Bacteria 1866
555 Ga0307413_10031388 3300031824 Bacteria 2998
556 Ga0307409_100195505 3300031995 Bacteria 1805
557 Ga0373930_0001646 3300034816 Bacteria 3373
558 Ga0373948_0000065 3300034817 Bacteria 11046
559 Ga0373950_0003576 3300034818 Bacteria 2229
560 Ga0373938_0004428 3300034957 Bacteria 2347
561 Ga0373928_0000172 3300035084 Bacteria 12512
562 Ga0373929_0000721 3300035085 Bacteria 6391
563 Ga0373929_0002547 3300035085 Bacteria 3349
564 Ga0373929_0011884 3300035085 Bacteria 1647
565 Ga0373934_0018951 3300035086 Bacteria 2637
566 Ga0373934_0026576 3300035086 Bacteria 2246
567 Ga0373934_0061335 3300035086 Bacteria 1498
568 Ga0373940_0002918 3300035088 Bacteria 3409
569 Ga0373940_0007065 3300035088 Bacteria 2519
570 Ga0373944_0000062 3300035089 Bacteria 17879
571 Ga0373949_0001909 3300035090 Bacteria 5630
572 Ga0373949_0002539 3300035090 Bacteria 4645
573 Ga0373951_0003492 3300035091 Bacteria 3801
574 Ga0373951_0013765 3300035091 Bacteria 1817
575 Ga0373952_0010979 3300035092 Bacteria 1759
576 Ga0373923_0000277 3300035111 Bacteria 11228
577 Ga0373932_0002445 3300035112 Bacteria 4704
578 Ga0373932_0004031 3300035112 Bacteria 3497
579 Ga0373932_0006012 3300035112 Bacteria 2863
580 Ga0373936_0000954 3300035113 Bacteria 10327
581 Ga0373936_0017031 3300035113 Bacteria 2795
582 Ga0373936_0079517 3300035113 Bacteria 1363
583 Ga0373939_0001215 3300035114 Bacteria 6289
584 Ga0373939_0004375 3300035114 Bacteria 3337
585 Ga0373941_0000106 3300035115 Bacteria 14078
586 Ga0373941_0000814 3300035115 Bacteria 6401
587 Ga0373945_0000711 3300035116 Bacteria 9681
588 Ga0373945_0000835 3300035116 Bacteria 9062
589 Ga0373953_0000627 3300035117 Bacteria 9775
590 Ga0373953_0001395 3300035117 Bacteria 6962
591 Ga0373954_0001186 3300035118 Bacteria 10453
592 Ga0373954_0009787 3300035118 Bacteria 4219
593 Ga0373954_0013490 3300035118 Bacteria 3642
594 Ga0373956_0001511 3300035119 Bacteria 9610
595 Ga0373956_0035086 3300035119 Bacteria 2211
596 Ga0373957_0006048 3300035120 Bacteria 3791
597 Ga0373957_0053769 3300035120 Bacteria 1545
598 Ga0373960_0001001 3300035121 Bacteria 6073
599 Ga0373960_0001059 3300035121 Bacteria 5930
600 Ga0373960_0001694 3300035121 Bacteria 4938
601 Ga0373943_0050497 3300035170 Bacteria 2044
602 Ga0373946_0006149 3300035171 Bacteria 4349
603 Ga0373946_0026717 3300035171 Bacteria 2279
604 Ga0373955_0000171 3300035172 Bacteria 26571
605 Ga0373955_0000366 3300035172 Bacteria 19051
606 Ga0373955_0002392 3300035172 Bacteria 8177
607 Ga0373955_0005170 3300035172 Bacteria 5838
608 Ga0373955_0007870 3300035172 Bacteria 4917
609 Ga0373955_0019223 3300035172 Bacteria 3410
610 Ga0373955_0049790 3300035172 Bacteria 2276
611 Ga0373942_0001640 3300035207 Bacteria 5693
612 Ga0373942_0007471 3300035207 Bacteria 2535
613 Ga0373961_0002190 3300035241 Bacteria 5183
614 Ga0373961_0002208 3300035241 Bacteria 5150
615 Ga0373961_0003616 3300035241 Bacteria 3805
616 Ga0373924_0004372 3300035410 Bacteria 4933
617 Ga0373924_0006448 3300035410 Bacteria 4205
618 Ga0373931_0002810 3300035691 Bacteria 7754
619 Ga0373931_0015349 3300035691 Bacteria 3755
620 Ga0373931_0023899 3300035691 Bacteria 3089
621 Ga0373935_0000218 3300035692 Bacteria 27678
622 Ga0373935_0046824 3300035692 Bacteria 2732
623 Ga0373927_0005034 3300035695 Bacteria 9145
624 Ga0373927_0006149 3300035695 Bacteria 8208
625 Ga0373927_0024309 3300035695 Bacteria 3964
626 Ga0373927_0030075 3300035695 Bacteria 3543
627 Ga0373927_0059760 3300035695 Bacteria 2465
628 Ga0373933_0002037 3300035724 Bacteria 11624
629 Ga0373933_0004945 3300035724 Bacteria 7264
630 Ga0373933_0005704 3300035724 Bacteria 6775
631 Ga0373933_0007851 3300035724 Bacteria 5828
632 Ga0373933_0018662 3300035724 Bacteria 3903
633 Ga0373933_0026475 3300035724 Bacteria 3330
634 Ga0373947_0000364 3300035725 Bacteria 25577
635 Ga0373947_0008074 3300035725 Bacteria 6069
636 Ga0373947_0041308 3300035725 Bacteria 2749
637 Ga0373947_0044583 3300035725 Bacteria 2652
638 Ga0373937_0000009 3300036401 Bacteria 169521
639 Ga0373937_0002001 3300036401 Bacteria 17037
640 Ga0373937_0028762 3300036401 Bacteria 5031
641 Ga0373937_0042381 3300036401 Bacteria 4152
642 Ga0373937_0046498 3300036401 Bacteria 3969
643 Ga0373925_0011407 3300037068 Bacteria 6440
644 Ga0373925_0025151 3300037068 Bacteria 4347
645 Ga0395899_0008445 3300037312 Bacteria 7934
646 Ga0395900_0085702 3300037418 Bacteria 3237
647 Ga0395900_0208999 3300037418 Bacteria 1971
648 Ga0395898_0009233 3300037466 Bacteria 10375
649 Ga0395898_0018005 3300037466 Bacteria 7207
650 Ga0436364_1509239 3300037853 Bacteria 3583
651 Ga0395901_0102406 3300038443 Bacteria 3005
652 Ga0436365_0394656 3300039437 Bacteria 2210
653 Ga0436363_1044488 3300039450 Bacteria 1996
654 Ga0439455_0011454 3300042012 Bacteria 1971
655 Ga0439435_0021157 3300042436 Bacteria 1686
656 Ga0451577_0158790 3300042876 Bacteria 2036
657 Ga0453683_0000494 3300044673 Bacteria 45120
658 Ga0466961_0043875 3300044693 Bacteria 2863
659 Ga0466963_0037241 3300044694 Bacteria 3175
660 Ga0466963_0088567 3300044694 Bacteria 2106
661 Ga0466963_0144356 3300044694 Bacteria 1650
662 Ga0466957_0109914 3300044842 Bacteria 1747
663 Ga0451576_0001638 3300045051 Bacteria 37426
664 Ga0451576_0077714 3300045051 Bacteria 3454
665 Ga0495592_0000422 3300046454 Bacteria 32126
666 Ga0495592_0004523 3300046454 Bacteria 10182
667 Ga0495592_0007319 3300046454 Bacteria 8256
668 Ga0495603_0010842 3300046455 Bacteria 5529
669 Ga0495603_0072826 3300046455 Bacteria 2018
670 Ga0495629_0002524 3300046459 Bacteria 14035
671 Ga0495629_0016178 3300046459 Bacteria 5354
672 Ga0495629_0018816 3300046459 Bacteria 4937
673 Ga0495629_0079774 3300046459 Bacteria 2285
674 Ga0495641_0076011 3300046461 Bacteria 1505
675 Ga0495651_0000300 3300046462 Bacteria 38562
676 Ga0495651_0000764 3300046462 Bacteria 24894
677 Ga0495651_0001150 3300046462 Bacteria 20444
678 Ga0495651_0003637 3300046462 Bacteria 11807
679 Ga0495651_0032821 3300046462 Bacteria 4049
680 Ga0495653_0000032 3300046463 Bacteria 132763
681 Ga0495653_0001957 3300046463 Bacteria 16221
682 Ga0495653_0031725 3300046463 Bacteria 4198
683 Ga0495580_0001416 3300046472 Bacteria 21075
684 Ga0495580_0021728 3300046472 Bacteria 4733
685 Ga0495580_0179816 3300046472 Bacteria 1461
686 Ga0495582_0029211 3300046473 Bacteria 3026
687 Ga0495582_0083985 3300046473 Bacteria 1769
688 Ga0495582_0163013 3300046473 Bacteria 1268
689 Ga0495639_0006262 3300046475 Bacteria 5111
690 Ga0495662_0002039 3300046476 Bacteria 10119
691 Ga0495662_0038622 3300046476 Bacteria 2308
692 Ga0495662_0097550 3300046476 Bacteria 1437
693 Ga0495664_0000010 3300046477 Bacteria 268381
694 Ga0495664_0000178 3300046477 Bacteria 31382
695 Ga0495664_0034739 3300046477 Bacteria 2966
696 Ga0495584_0006106 3300046491 Bacteria 6339
697 Ga0495584_0022637 3300046491 Bacteria 3188
698 Ga0495584_0112931 3300046491 Bacteria 1375
699 Ga0495585_0015366 3300046492 Bacteria 4448
700 Ga0495594_0010424 3300046499 Bacteria 4820
701 Ga0495594_0052866 3300046499 Bacteria 2236
702 Ga0495608_0000008 3300046511 Bacteria 268629
703 Ga0495608_0001671 3300046511 Bacteria 15955
704 Ga0495608_0025139 3300046511 Bacteria 4066
705 Ga0495608_0041070 3300046511 Bacteria 3097
706 Ga0495618_0000002 3300046514 Bacteria 271353
707 Ga0495618_0003686 3300046514 Bacteria 9495
708 Ga0495618_0025323 3300046514 Bacteria 3681
709 Ga0495628_0000009 3300046516 Bacteria 237611
710 Ga0495628_0001448 3300046516 Bacteria 21780
711 Ga0495628_0007599 3300046516 Bacteria 9369
712 Ga0495628_0020094 3300046516 Bacteria 5512
713 Ga0495630_0002397 3300046517 Bacteria 13021
714 Ga0495630_0242314 3300046517 Bacteria 1377
715 Ga0495644_0012384 3300046523 Bacteria 3280
716 Ga0495666_0000187 3300046526 Bacteria 26576
717 Ga0495666_0035568 3300046526 Bacteria 2428
718 Ga0495666_0087444 3300046526 Bacteria 1472
719 Ga0495652_0000011 3300046529 Bacteria 255329
720 Ga0495652_0032696 3300046529 Bacteria 4547
721 Ga0495652_0090939 3300046529 Bacteria 2496
722 Ga0495652_0091221 3300046529 Bacteria 2491
723 Ga0495665_0006213 3300046531 Bacteria 6450
724 Ga0495640_0000094 3300046533 Bacteria 51238
725 Ga0495640_0023352 3300046533 Bacteria 4506
726 Ga0495586_0002551 3300046535 Bacteria 9858
727 Ga0495587_0000086 3300046536 Bacteria 72022
728 Ga0495587_0002720 3300046536 Bacteria 11797
729 Ga0495598_0008090 3300046537 Bacteria 2438
730 Ga0495598_0043017 3300046537 Bacteria 1328
731 Ga0495645_0000010 3300046543 Bacteria 238337
732 Ga0495622_0001697 3300046557 Bacteria 10892
733 Ga0495633_0018667 3300046558 Bacteria 3519
734 Ga0495667_0000005 3300046559 Bacteria 268252
735 Ga0495667_0002931 3300046559 Bacteria 11450
736 Ga0495667_0004110 3300046559 Bacteria 9783
737 Ga0495667_0048018 3300046559 Bacteria 2819
738 Ga0495667_0063532 3300046559 Bacteria 2416
739 Ga0495667_0085337 3300046559 Bacteria 2049
740 Ga0495634_0000936 3300046642 Bacteria 27662
741 Ga0495634_0042214 3300046642 Bacteria 3094
742 Ga0495634_0048272 3300046642 Bacteria 2866
743 Ga0495611_0006806 3300046648 Bacteria 4857
744 Ga0495635_0000008 3300046663 Bacteria 268349
745 Ga0495635_0001359 3300046663 Bacteria 16270
746 Ga0495635_0011040 3300046663 Bacteria 6333
747 Ga0495635_0123563 3300046663 Bacteria 1765
748 Ga0495659_0005492 3300046664 Bacteria 3987
749 Ga0495659_0006098 3300046664 Bacteria 3810
750 Ga0495588_0001695 3300046674 Bacteria 9374
751 Ga0495657_0000296 3300046675 Bacteria 45380
752 Ga0495657_0003184 3300046675 Bacteria 13516
753 Ga0495657_0027472 3300046675 Bacteria 4015
754 Ga0495599_0000007 3300046678 Bacteria 236638
755 Ga0495599_0000806 3300046678 Bacteria 17617
756 Ga0495599_0085910 3300046678 Bacteria 1964
757 Ga0495623_0000085 3300046679 Bacteria 55527
758 Ga0495623_0010359 3300046679 Bacteria 6036
759 Ga0495623_0015361 3300046679 Bacteria 4948
760 Ga0495646_0000021 3300046680 Bacteria 115358
761 Ga0495646_0033722 3300046680 Bacteria 3182
762 Ga0495647_0000638 3300046681 Bacteria 10362
763 Ga0495647_0036177 3300046681 Bacteria 1857
764 Ga0495658_0004284 3300046683 Bacteria 7024
765 Ga0495658_0035163 3300046683 Bacteria 2754
766 Ga0495613_0012243 3300046689 Bacteria 6376
767 Ga0495613_0023597 3300046689 Bacteria 4584
768 Ga0495613_0057153 3300046689 Bacteria 2864
769 Ga0495624_0015494 3300046690 Bacteria 5144
770 Ga0495624_0109220 3300046690 Bacteria 1701
771 Ga0495600_0000001 3300046809 Bacteria 214870
772 Ga0495600_0001998 3300046809 Bacteria 11466
773 Ga0495600_0006193 3300046809 Bacteria 7256
774 Ga0495600_0006357 3300046809 Bacteria 7187
775 Ga0495581_0014671 3300047315 Bacteria 4543
776 Ga0495581_0039846 3300047315 Bacteria 2720
777 Ga0495604_0000012 3300047317 Bacteria 268341
778 Ga0495604_0001423 3300047317 Bacteria 19641
779 Ga0495604_0005209 3300047317 Bacteria 10301
780 Ga0495604_0016854 3300047317 Bacteria 5844
781 Ga0495604_0023581 3300047317 Bacteria 4909
782 Ga0495604_0039078 3300047317 Bacteria 3731
783 Ga0495604_0094830 3300047317 Bacteria 2205
784 Ga0495636_0057011 3300047318 Bacteria 1645
785 Ga0495674_0000011 3300047319 Bacteria 270911
786 Ga0495674_0042009 3300047319 Bacteria 4081
787 Ga0495674_0081140 3300047319 Bacteria 2782
788 Ga0495674_0209301 3300047319 Bacteria 1616
789 Ga0495676_0011575 3300047321 Bacteria 7958
790 Ga0495676_0098773 3300047321 Bacteria 2165
791 Ga0495680_0000245 3300047322 Bacteria 59987
792 Ga0495680_0001491 3300047322 Bacteria 25179
793 Ga0495680_0007295 3300047322 Bacteria 10175
794 Ga0495680_0013705 3300047322 Bacteria 7058
795 Ga0495680_0028576 3300047322 Bacteria 4571
796 Ga0495680_0032027 3300047322 Bacteria 4272
797 Ga0495680_0209411 3300047322 Bacteria 1396
798 Ga0495675_0000657 3300047444 Bacteria 21846
799 Ga0495677_0080450 3300047445 Bacteria 1221
800 Ga0495679_031124 3300047446 Bacteria 1724
801 Ga0495685_027707 3300047447 Bacteria 1949
802 Ga0495684_0000084 3300047471 Bacteria 65600
803 Ga0495684_0000711 3300047471 Bacteria 26762
804 Ga0495684_0040689 3300047471 Bacteria 3563
805 Ga0495684_0072546 3300047471 Bacteria 2616
806 Ga0495593_0000309 3300047673 Bacteria 26737
807 Ga0495593_0018863 3300047673 Bacteria 3871
808 Ga0495593_0036157 3300047673 Bacteria 2679
809 Ga0495602_0000073 3300048088 Bacteria 98745
810 Ga0495602_0029432 3300048088 Bacteria 5229
811 Ga0495602_0202511 3300048088 Bacteria 1513
812 Ga0495614_0003292 3300048089 Bacteria 7220
813 Ga0495614_0033747 3300048089 Bacteria 2201
814 Ga0496100_0000203 3300048903 Bacteria 32744
815 Ga0496100_0016419 3300048903 Bacteria 4348
816 Ga0496100_0033208 3300048903 Bacteria 3227
817 Ga0496100_0072383 3300048903 Bacteria 2304
818 Ga0496101_0002812 3300048904 Bacteria 10691
819 Ga0496101_0013528 3300048904 Bacteria 5470
820 Ga0496102_0000871 3300048905 Bacteria 28857
821 Ga0496102_0004838 3300048905 Bacteria 11387
822 Ga0496102_0006598 3300048905 Bacteria 9912
823 Ga0496102_0051348 3300048905 Bacteria 3757
824 Ga0496102_0106206 3300048905 Bacteria 2613
825 Ga0496102_0118468 3300048905 Bacteria 2471
826 Ga0496103_0001365 3300048906 Bacteria 16458
827 Ga0496103_0001529 3300048906 Bacteria 15450
828 Ga0496103_0002881 3300048906 Bacteria 10676
829 Ga0496103_0009792 3300048906 Bacteria 5675
830 Ga0496104_0000317 3300048907 Bacteria 42918
831 Ga0496104_0000709 3300048907 Bacteria 28655
832 Ga0496104_0000873 3300048907 Bacteria 25934
833 Ga0496104_0026931 3300048907 Bacteria 5315
834 Ga0496104_0050532 3300048907 Bacteria 3922
835 Ga0496104_0063751 3300048907 Bacteria 3496
836 Ga0496104_0099435 3300048907 Bacteria 2785
837 Ga0496104_0110898 3300048907 Bacteria 2630
838 Ga0496105_0000485 3300048908 Bacteria 26121
839 Ga0496105_0000514 3300048908 Bacteria 25562
840 Ga0496105_0070606 3300048908 Bacteria 2887
841 Ga0496105_0118973 3300048908 Bacteria 2179
842 Ga0496105_0124352 3300048908 Bacteria 2126
843 Ga0496105_0178987 3300048908 Bacteria 1736
844 Ga0496106_0002909 3300048909 Bacteria 12739
845 Ga0496106_0035978 3300048909 Bacteria 3703
846 Ga0496106_0037687 3300048909 Bacteria 3617
847 Ga0496106_0065636 3300048909 Bacteria 2763
848 Ga0496106_0086525 3300048909 Bacteria 2414
849 Ga0496106_0146967 3300048909 Bacteria 1857
850 Ga0496107_0000268 3300048910 Bacteria 27611
851 Ga0496107_0002119 3300048910 Bacteria 12722
852 Ga0496107_0027599 3300048910 Bacteria 4031
853 Ga0496107_0046893 3300048910 Bacteria 3111
854 Ga0496107_0053932 3300048910 Bacteria 2900
855 Ga0496107_0126850 3300048910 Bacteria 1882
856 Ga0496108_0010827 3300048911 Bacteria 7404
857 Ga0496108_0012976 3300048911 Bacteria 6788
858 Ga0496108_0019125 3300048911 Bacteria 5620
859 Ga0496108_0089330 3300048911 Bacteria 2618
860 Ga0496108_0263702 3300048911 Bacteria 1499
861 Ga0496109_0000836 3300048912 Bacteria 25684
862 Ga0496109_0006654 3300048912 Bacteria 9730
863 Ga0496109_0033888 3300048912 Bacteria 4597
864 Ga0496109_0074422 3300048912 Bacteria 3122
865 Ga0496109_0118772 3300048912 Bacteria 2461
866 Ga0496110_0001539 3300048913 Bacteria 16772
867 Ga0496110_0006117 3300048913 Bacteria 9487
868 Ga0496110_0016005 3300048913 Bacteria 6254
869 Ga0496110_0035409 3300048913 Bacteria 4330
870 Ga0496111_0000072 3300048914 Bacteria 41891
871 Ga0496111_0000657 3300048914 Bacteria 18179
872 Ga0496111_0092260 3300048914 Bacteria 2219
873 Ga0496111_0114447 3300048914 Bacteria 1988
874 Ga0496111_0256702 3300048914 Bacteria 1297
875 Ga0496112_0000112 3300048915 Bacteria 50370
876 Ga0496112_0028569 3300048915 Bacteria 5385
877 Ga0496112_0032191 3300048915 Bacteria 5090
878 Ga0496112_0115043 3300048915 Bacteria 2660
879 Ga0496113_0000058 3300048916 Bacteria 47947
880 Ga0496113_0004401 3300048916 Bacteria 8645
881 Ga0496113_0050519 3300048916 Bacteria 3100
882 Ga0496113_0060873 3300048916 Bacteria 2847
883 Ga0496114_0019587 3300048917 Bacteria 5483
884 Ga0496114_0021043 3300048917 Bacteria 5302
885 Ga0496114_0075626 3300048917 Bacteria 2837
886 Ga0496114_0115053 3300048917 Bacteria 2307
887 Ga0496114_0190865 3300048917 Bacteria 1792
888 Ga0496115_0015922 3300048918 Bacteria 5715
889 Ga0496121_0094938 3300048924 Bacteria 2319
890 Ga0501032_0052536 3300049569 Bacteria 2746
891 Ga0501032_0108458 3300049569 Bacteria 1838
892 Ga0501033_0054431 3300049570 Bacteria 2960
893 Ga0501034_0001131 3300049571 Bacteria 37119
894 Ga0501034_0020143 3300049571 Bacteria 6810
895 Ga0501037_0050195 3300049573 Bacteria 3054
896 Ga0501038_0069228 3300049574 Bacteria 2998
897 Ga0501038_0079380 3300049574 Bacteria 2767
898 Ga0501041_0137266 3300049577 Bacteria 1524
899 Ga0501042_0013021 3300049578 Bacteria 5652
900 Ga0501042_0094044 3300049578 Bacteria 2153
901 Ga0501042_0131480 3300049578 Bacteria 1804
902 Ga0501046_0040702 3300049580 Bacteria 3712
903 Ga0501046_0105009 3300049580 Bacteria 2164
904 Ga0501047_0042592 3300049581 Bacteria 4387
905 Ga0501047_0181929 3300049581 Bacteria 1968
906 Ga0501070_0015997 3300049586 Bacteria 6304
907 Ga0501070_0035326 3300049586 Bacteria 4177
908 Ga0501070_0221956 3300049586 Bacteria 1549
909 Ga0501072_0026826 3300049588 Bacteria 4494
910 Ga0501072_0064450 3300049588 Bacteria 2890
911 Ga0501074_0173560 3300049590 Bacteria 1538
912 Ga0501075_0036972 3300049591 Bacteria 3645
913 Ga0501075_0087388 3300049591 Bacteria 2363
914 Ga0501075_0098582 3300049591 Bacteria 2219
915 Ga0501076_0006327 3300049592 Bacteria 8581
916 Ga0501076_0194418 3300049592 Bacteria 1656
917 Ga0501076_0239822 3300049592 Bacteria 1483
918 Ga0501077_0005796 3300049593 Bacteria 7525
919 Ga0501077_0009236 3300049593 Bacteria 6121
920 Ga0501077_0023243 3300049593 Bacteria 3930
921 Ga0501077_0121159 3300049593 Bacteria 1658
922 Ga0501079_0045484 3300049741 Bacteria 3388
923 Ga0501079_0074222 3300049741 Bacteria 2629
924 Ga0501079_0090839 3300049741 Bacteria 2366
925 Ga0501081_0003672 3300049743 Bacteria 9825
926 Ga0501081_0021499 3300049743 Bacteria 4307
927 Ga0501081_0035300 3300049743 Bacteria 3404
928 Ga0501081_0042931 3300049743 Bacteria 3100
929 Ga0501081_0043775 3300049743 Bacteria 3072
930 Ga0501035_0080515 3300049822 Bacteria 2875
931 Ga0501044_0071243 3300049823 Bacteria 3535
932 Ga0501045_0128811 3300049824 Bacteria 1881
933 nmdc:mga03683_20430_c1 3300050489 Bacteria 2541
934 nmdc:mga03n38_77818_c1 3300050490 Bacteria 1551
935 nmdc:mga03n38_99201_c1 3300050490 Bacteria 1402
936 nmdc:mga0yw44_35704_c1 3300050492 Bacteria 2924
937 nmdc:mga0k408_173380_c1 3300050493 Bacteria 1286
938 nmdc:mga0k408_80396_c1 3300050493 Bacteria 1908
939 nmdc:mga06z11_51201_c1 3300050494 Bacteria 2114
940 nmdc:mga05p37_17539_c1 3300050507 Bacteria 8643
941 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
942 nmdc:mga05p37_34120_c1 3300050507 Bacteria 6233
943 nmdc:mga05p37_4606_c1 3300050507 Bacteria 16121
944 nmdc:mga05p37_66833_c1 3300050507 Bacteria 4422
945 nmdc:mga05p37_89534_c1 3300050507 Bacteria 3793
946 nmdc:mga05p37_90816_c1 3300050507 Bacteria 3764
947 nmdc:mga09592_37123_c1 3300050508 Bacteria 4085
948 nmdc:mga09592_6535_c1 3300050508 Bacteria 9497
949 nmdc:mga0qj67_110767_c1 3300050509 Bacteria 2216
950 nmdc:mga0qj67_157763_c1 3300050509 Bacteria 1842
951 nmdc:mga0qj67_168_c1 3300050509 Bacteria 43793
952 nmdc:mga0qj67_29510_c1 3300050509 Bacteria 4260
953 nmdc:mga0qj67_355_c1 3300050509 Bacteria 31660
954 nmdc:mga0qj67_733_c1 3300050509 Bacteria 22325
955 nmdc:mga0qj67_74589_c1 3300050509 Bacteria 2711
956 nmdc:mga06r32_13222_c1 3300050510 Bacteria 7474
957 nmdc:mga06r32_16922_c1 3300050510 Bacteria 6652
958 nmdc:mga06r32_21130_c1 3300050510 Bacteria 6006
959 nmdc:mga06r32_5297_c1 3300050510 Bacteria 11609
960 nmdc:mga06r32_57806_c1 3300050510 Bacteria 3726
961 nmdc:mga06r32_68764_c1 3300050510 Bacteria 3422
962 nmdc:mga06r32_91319_c1 3300050510 Bacteria 2976
963 nmdc:mga08y16_102392_c1 3300050511 Bacteria 2981
964 nmdc:mga08y16_132898_c1 3300050511 Bacteria 2587
965 nmdc:mga08y16_171996_c1 3300050511 Bacteria 2250
966 nmdc:mga08y16_19018_c1 3300050511 Bacteria 7235
967 nmdc:mga08y16_2238_c1 3300050511 Bacteria 19836
968 nmdc:mga08y16_424126_c1 3300050511 Bacteria 1359
969 nmdc:mga08y16_58180_c1 3300050511 Bacteria 4038
970 nmdc:mga08y16_6098_c1 3300050511 Bacteria 12643
971 nmdc:mga0n895_121400_c1 3300050512 Bacteria 2634
972 nmdc:mga0n895_14134_c1 3300050512 Bacteria 7238
973 nmdc:mga0n895_15498_c1 3300050512 Bacteria 6953
974 nmdc:mga0n895_547_c1 3300050512 Bacteria 25755
975 nmdc:mga0n895_55820_c1 3300050512 Bacteria 3888
976 nmdc:mga0n895_77179_c1 3300050512 Bacteria 3313
977 nmdc:mga0n895_79500_c1 3300050512 Bacteria 3266
978 nmdc:mga0n895_8451_c1 3300050512 Bacteria 8914
979 nmdc:mga0n895_88591_c1 3300050512 Bacteria 3095
980 nmdc:mga0n895_91342_c1 3300050512 Bacteria 3047
981 nmdc:mga0rr50_148620_c1 3300050513 Bacteria 1891
982 nmdc:mga0rr50_21144_c1 3300050513 Bacteria 4436
983 nmdc:mga0rr50_73282_c1 3300050513 Bacteria 2618
984 nmdc:mga0rr50_78412_c1 3300050513 Bacteria 2542
985 nmdc:mga08x19_54912_c1 3300050514 Bacteria 2565
986 nmdc:mga08x19_76395_c1 3300050514 Bacteria 2191
987 nmdc:mga0a205_117187_c1 3300050515 Bacteria 2562
988 nmdc:mga0a205_12457_c1 3300050515 Bacteria 7868
989 nmdc:mga0a205_53544_c1 3300050515 Bacteria 3895
990 nmdc:mga0a205_6205_c1 3300050515 Bacteria 10788
991 nmdc:mga0a205_629_c1 3300050515 Bacteria 28029
992 nmdc:mga0a205_71570_c1 3300050515 Bacteria 3349
993 Ga0495601_0000009 3300053077 Bacteria 270622
994 Ga0495601_0000521 3300053077 Bacteria 20312
995 Ga0495601_0014254 3300053077 Bacteria 4789
996 Ga0495601_0031312 3300053077 Bacteria 3305
997 Ga0495601_0073246 3300053077 Bacteria 2189
998 Ga0495601_0077801 3300053077 Bacteria 2124
999 Ga0495612_0000019 3300053078 Bacteria 137844
1000 Ga0495612_0001070 3300053078 Bacteria 11208
1001 Ga0495612_0002143 3300053078 Bacteria 8120
1002 Ga0495612_0008371 3300053078 Bacteria 4195
1003 Ga0495595_0000015 3300053084 Bacteria 144946
1004 Ga0495595_0001827 3300053084 Bacteria 8280
1005 Ga0495595_0002555 3300053084 Bacteria 7144
1006 Ga0495595_0013740 3300053084 Bacteria 3424
1007 Ga0495619_0000012 3300053085 Bacteria 268349
1008 Ga0495619_0000016 3300053085 Bacteria 231442
1009 Ga0495619_0000670 3300053085 Bacteria 22463
1010 Ga0495619_0002830 3300053085 Bacteria 11300
1011 Ga0495619_0022668 3300053085 Bacteria 4021
1012 Ga0495619_0078577 3300053085 Bacteria 2218
1013 Ga0500644_0001393 3300053088 Bacteria 6442
1014 Ga0500641_0004145 3300053096 Bacteria 5119
1015 Ga0500595_000010 3300053119 Bacteria 275806
1016 Ga0500595_039632 3300053119 Bacteria 1523
1017 Ga0500616_0000001 3300053153 Bacteria 1986011
1018 Ga0500645_000051 3300053730 Bacteria 98521
1019 Ga0501084_0009054 3300054114 Bacteria 8236
1020 Ga0501082_0044681 3300060353 Bacteria 3821
1021 Ga0501082_0046745 3300060353 Bacteria 3730
1022 Ga0501082_0164976 3300060353 Bacteria 1925
1023 Ga0530510_0055169 3300061734 Bacteria 2871
1024 2600197099 2599185352 Bacteria 7228948
1025 2643804639 2643221557 Bacteria 7184309
1026 2644064002 2643221610 Bacteria 7480339
1027 2644133472 2643221623 Bacteria 5239945
1028 2644375608 2643221668 Bacteria 7306521
1029 2644415834 2643221675 Bacteria 7473456
1030 2644448874 2643221680 Bacteria 7473610
1031 2644686601 2643221726 Bacteria 7455827
1032 2989352684 2989349275 Bacteria 6349068
1033 Ga0501034_0117384
1034 2214856314
1035 ARcpr5oldR_c000046
1036 ARSoilYngRDRAFT_c00078
1037 ARcpr5yngRDRAFT_c000072
1038 ARSoilOldRDRAFT_c000019
1039 ARCol0oldRDRAFT_c00019
1040 ARCol0yngRDRAFT_1000004
1041 JGI24746J21847_1000147
1042 JGI24746J21847_1003854
1043 JGI24747J21853_1000217
1044 JGI24739J22299_10010699
1045 JGI24737J22298_10002058
1046 JGI24737J22298_10003740
1047 JGI24737J22298_10023198
1048 JGI24743J22301_10003718
1049 JGI24750J21931_1000430
1050 JGI24750J21931_1002146
1051 JGI24745J21846_1001132
1052 JGI24748J21848_1000555
1053 JGI24738J21930_10004182
1054 JGI24744J21845_10000132
1055 JGI24034J26672_10002921
1056 JGI24034J26672_10005798
1057 JGI24742J22300_10000106
1058 JGI24742J22300_10000483
1059 Ga0055524_1001448
1060 JGI25405J52794_10000722
1061 JGI25405J52794_10002175
1062 JGI25405J52794_10009788
1063 Ga0065704_10075977
1064 Ga0065715_10091019
1065 Ga0070658_10022611
1066 Ga0070658_10042393
1067 Ga0070658_10145210
1068 Ga0070676_10102718
1069 Ga0070683_100001872
1070 Ga0070683_100110942
1071 Ga0070683_100329083
1072 Ga0070690_100027115
1073 Ga0070670_100005524
1074 Ga0070670_100040546
1075 Ga0070670_100138127
1076 Ga0070677_10000429
1077 Ga0068869_100004944
1078 Ga0068869_100113167
1079 Ga0070680_100016120
1080 Ga0070680_100018787
1081 Ga0070680_100076342
1082 Ga0070680_100258243
1083 Ga0070680_100284952
1084 Ga0070682_100000695
1085 Ga0068868_100004036
1086 Ga0068868_100087923
1087 Ga0070660_100001014
1088 Ga0070660_100046044
1089 Ga0070660_100072432
1090 Ga0070660_100116389
1091 Ga0070689_100012268
1092 Ga0070689_100114941
1093 Ga0070691_10011581
1094 Ga0070691_10065025
1095 Ga0070687_100112257
1096 Ga0070661_100011491
1097 Ga0070692_10002719
1098 Ga0070668_100058985
1099 Ga0070668_100128540
1100 Ga0070669_100015276
1101 Ga0070675_100000240
1102 Ga0070675_100014864
1103 Ga0070671_100015801
1104 Ga0070671_100094737
1105 Ga0070674_100013342
1106 Ga0070674_100013446
1107 Ga0070673_100007045
1108 Ga0070688_100001905
1109 Ga0070688_100049110
1110 Ga0070659_100007610
1111 Ga0070659_100010913
1112 Ga0070667_100005456
1113 Ga0070667_100020849
1114 Ga0070667_100159811
1115 Ga0070709_10000363
1116 Ga0070709_10033820
1117 Ga0070714_100000833
1118 Ga0070714_100056156
1119 Ga0070714_100094014
1120 Ga0070713_100000381
1121 Ga0070713_100003768
1122 Ga0070713_100019401
1123 Ga0070713_100097676
1124 Ga0070710_10000226
1125 Ga0070710_10004588
1126 Ga0070710_10076967
1127 Ga0070711_100001128
1128 Ga0070705_100000612
1129 Ga0070705_100027104
1130 Ga0070700_100009080
1131 Ga0070700_100027831
1132 Ga0070694_100001207
1133 Ga0070694_100002780
1134 Ga0070694_100065749
1135 Ga0070708_100074687
1136 Ga0070708_100141210
1137 Ga0070663_100015442
1138 Ga0070663_100025552
1139 Ga0070663_100040436
1140 Ga0070662_100013532
1141 Ga0070662_100028585
1142 Ga0070662_100080215
1143 Ga0070662_100204883
1144 Ga0070662_100261831
1145 Ga0070681_10011673
1146 Ga0070681_10019315
1147 Ga0070681_10096828
1148 Ga0070681_10146679
1149 Ga0070681_10244126
1150 Ga0070681_10252357
1151 Ga0068867_100132721
1152 Ga0070685_10014546
1153 Ga0070685_10040164
1154 Ga0070685_10051505
1155 Ga0070706_100040997
1156 Ga0070707_100053998
1157 Ga0070707_100193638
1158 Ga0070698_100185928
1159 Ga0070699_100002532
1160 Ga0070699_100073539
1161 Ga0070679_100023238
1162 Ga0070679_100034205
1163 Ga0070679_100040675
1164 Ga0070679_100063861
1165 Ga0070679_100084499
1166 Ga0070684_100009261
1167 Ga0070684_100062206
1168 Ga0070684_100118724
1169 Ga0070697_100039102
1170 Ga0070697_100091058
1171 Ga0068853_100009694
1172 Ga0068853_100069407
1173 Ga0070672_100001847
1174 Ga0070672_100068241
1175 Ga0070686_100008725
1176 Ga0070686_100010163
1177 Ga0070686_100038773
1178 Ga0070695_100000054
1179 Ga0070695_100029614
1180 Ga0070695_100039414
1181 Ga0070696_100000931
1182 Ga0070696_100004350
1183 Ga0070696_100038185
1184 Ga0070704_100000180
1185 Ga0070704_100004531
1186 Ga0068855_100014855
1187 Ga0068855_100017390
1188 Ga0068855_100045702
1189 Ga0068855_100091933
1190 Ga0068855_100215519
1191 Ga0070664_100001002
1192 Ga0070664_100058640
1193 Ga0068857_100131016
1194 Ga0068857_100229267
1195 Ga0068856_100023460
1196 Ga0070702_100019293
1197 Ga0070702_100096972
1198 Ga0068852_100004985
1199 Ga0068852_100047574
1200 Ga0068859_100000494
1201 Ga0068859_100010808
1202 Ga0068859_100075191
1203 Ga0068864_100003922
1204 Ga0068864_100075630
1205 Ga0068864_100105666
1206 Ga0068861_100003710
1207 Ga0068861_100014951
1208 Ga0068861_100023937
1209 Ga0068870_10000157
1210 Ga0068870_10072506
1211 Ga0068863_100000674
1212 Ga0068858_100091776
1213 Ga0068860_100001274
1214 Ga0068860_100012435
1215 Ga0068860_100045880
1216 Ga0068860_100130650
1217 Ga0068860_100188969
1218 Ga0068862_100000795
1219 Ga0068862_100070320
1220 Ga0081455_10000059
1221 Ga0081455_10002427
1222 Ga0081455_10003542
1223 Ga0081455_10004480
1224 Ga0081455_10006602
1225 Ga0081455_10169619
1226 Ga0081538_10007110
1227 Ga0081538_10051140
1228 Ga0081538_10070167
1229 Ga0081540_1002311
1230 Ga0081540_1003101
1231 Ga0081540_1008452
1232 Ga0081540_1012205
1233 Ga0081540_1014938
1234 Ga0081540_1021121
1235 Ga0070717_10000161
1236 Ga0070717_10002481
1237 Ga0070717_10063658
1238 Ga0070717_10080835
1239 Ga0070717_10115314
1240 Ga0075365_10065661
1241 Ga0075368_10025334
1242 Ga0075432_10032964
1243 Ga0070715_10014168
1244 Ga0070715_10041416
1245 Ga0070716_100000149
1246 Ga0070716_100011064
1247 Ga0070716_100045195
1248 Ga0070712_100000413
1249 Ga0070712_100022489
1250 Ga0070712_100140207
1251 Ga0075362_10026782
1252 Ga0075367_10010139
1253 Ga0075367_10026188
1254 Ga0075367_10068531
1255 Ga0075369_10017707
1256 Ga0075366_10021275
1257 Ga0075370_10072975
1258 Ga0068871_100001066
1259 Ga0075428_100038761
1260 Ga0075428_100049877
1261 Ga0075428_100088746
1262 Ga0075428_100157176
1263 Ga0075430_100000015
1264 Ga0075430_100000070
1265 Ga0075430_100001098
1266 Ga0075430_100002472
1267 Ga0075430_100006043
1268 Ga0075430_100031115
1269 Ga0075431_100001221
1270 Ga0075431_100004759
1271 Ga0075431_100011228
1272 Ga0075431_100018201
1273 Ga0075431_100098881
1274 Ga0075433_10008464
1275 Ga0075433_10010476
1276 Ga0075433_10109013
1277 Ga0075434_100000212
1278 Ga0075434_100016655
1279 Ga0075434_100037805
1280 Ga0075434_100048636
1281 Ga0075434_100060574
1282 Ga0075434_100084707
1283 Ga0075434_100090220
1284 Ga0075434_100090704
1285 Ga0075429_100003999
1286 Ga0075429_100021829
1287 Ga0075429_100250984
1288 Ga0068865_100000131
1289 Ga0075436_100143097
1290 Ga0097620_100000494
1291 Ga0097620_100010810
1292 Ga0097620_100075191
1293 Ga0075435_100034976
1294 Ga0075435_100065898
1295 Ga0075435_100077055
1296 Ga0075435_100121660
1297 Ga0099794_10008099
1298 Ga0099794_10014325
1299 Ga0099794_10043551
1300 Ga0105240_10054986
1301 Ga0111539_10000138
1302 Ga0111539_10028951
1303 Ga0111539_10039247
1304 Ga0111539_10058878
1305 Ga0111539_10064307
1306 Ga0111539_10245411
1307 Ga0105245_10011704
1308 Ga0105245_10045266
1309 Ga0105245_10059696
1310 Ga0105245_10122401
1311 Ga0105245_10175167
1312 Ga0105247_10042379
1313 Ga0105247_10042433
1314 Ga0114129_10002312
1315 Ga0114129_10003950
1316 Ga0114129_10027223
1317 Ga0114129_10102152
1318 Ga0114129_10110227
1319 Ga0114129_10110393
1320 Ga0114129_10330175
1321 Ga0105243_10006299
1322 Ga0105243_10032492
1323 Ga0105243_10091087
1324 Ga0105243_10127230
1325 Ga0105243_10176009
1326 Ga0105243_10184399
1327 Ga0105241_10056240
1328 Ga0105241_10064613
1329 Ga0105242_10078215
1330 Ga0105242_10177574
1331 Ga0105248_10002392
1332 Ga0105248_10012777
1333 Ga0105248_10013552
1334 Ga0105237_10018866
1335 Ga0105237_10042427
1336 Ga0105238_10060021
1337 Ga0105249_10001029
1338 Ga0105249_10017439
1339 Ga0105249_10024785
1340 Ga0099796_10001372
1341 Ga0105239_10043450
1342 Ga0105239_10112207
1343 Ga0105246_10022164
1344 Ga0105246_10027151
1345 Ga0157371_10030802
1346 Ga0157374_10000671
1347 Ga0157378_10088364
1348 Ga0157378_10150135
1349 Ga0157378_10411027
1350 Ga0163162_10177606
1351 Ga0157375_10002908
1352 Ga0157375_10028268
1353 Ga0157375_10110039
1354 Ga0163163_10004312
1355 Ga0163163_10010637
1356 Ga0163163_10033625
1357 Ga0157380_10005886
1358 Ga0157380_10132662
1359 Ga0157377_10000570
1360 Ga0157379_10000345
1361 Ga0157379_10033827
1362 Ga0157379_10133620
1363 Ga0157376_10025542
1364 Ga0157376_10039773
1365 Ga0157376_10098105
1366 Ga0163161_10004669
1367 Ga0163161_10037669
1368 Ga0213875_10080492
1369 Ga0207666_1000069
1370 Ga0207666_1001040
1371 Ga0207673_1007066
1372 Ga0209256_1000073
1373 Ga0207697_10000390
1374 Ga0207697_10006568
1375 Ga0207713_1036708
1376 Ga0207653_10024508
1377 Ga0207682_10000048
1378 Ga0207682_10008138
1379 Ga0207692_10000966
1380 Ga0207692_10005320
1381 Ga0207710_10022873
1382 Ga0207688_10001496
1383 Ga0207688_10004951
1384 Ga0207680_10045613
1385 Ga0207647_10013329
1386 Ga0207647_10014742
1387 Ga0207685_10004104
1388 Ga0207699_10000366
1389 Ga0207699_10074768
1390 Ga0207645_10012526
1391 Ga0207645_10030390
1392 Ga0207643_10000581
1393 Ga0207643_10007658
1394 Ga0207705_10024062
1395 Ga0207684_10023396
1396 Ga0207684_10117905
1397 Ga0207654_10004716
1398 Ga0207707_10007064
1399 Ga0207707_10016616
1400 Ga0207707_10018671
1401 Ga0207707_10048473
1402 Ga0207707_10150622
1403 Ga0207707_10169353
1404 Ga0207695_10037025
1405 Ga0207671_10011618
1406 Ga0207693_10002752
1407 Ga0207693_10010010
1408 Ga0207693_10011653
1409 Ga0207693_10072370
1410 Ga0207663_10006969
1411 Ga0207663_10058549
1412 Ga0207663_10070026
1413 Ga0207663_10127598
1414 Ga0207660_10000192
1415 Ga0207660_10009267
1416 Ga0207662_10000647
1417 Ga0207657_10038177
1418 Ga0207657_10091226
1419 Ga0207657_10094982
1420 Ga0207649_10000141
1421 Ga0207649_10045728
1422 Ga0207649_10083443
1423 Ga0207649_10163154
1424 Ga0207652_10004519
1425 Ga0207652_10151345
1426 Ga0207652_10253216
1427 Ga0207646_10057861
1428 Ga0207646_10068130
1429 Ga0207681_10000359
1430 Ga0207681_10159118
1431 Ga0207694_10035789
1432 Ga0207650_10004853
1433 Ga0207650_10006280
1434 Ga0207650_10105022
1435 Ga0207659_10000052
1436 Ga0207659_10023639
1437 Ga0207659_10249098
1438 Ga0207687_10000097
1439 Ga0207687_10069568
1440 Ga0207687_10082051
1441 Ga0207700_10000437
1442 Ga0207700_10000673
1443 Ga0207700_10032842
1444 Ga0207664_10000416
1445 Ga0207664_10137780
1446 Ga0207664_10235823
1447 Ga0207644_10002956
1448 Ga0207644_10033370
1449 Ga0207690_10000278
1450 Ga0207706_10003979
1451 Ga0207706_10036851
1452 Ga0207706_10136791
1453 Ga0207686_10000850
1454 Ga0207686_10008904
1455 Ga0207686_10210075
1456 Ga0207709_10000349
1457 Ga0207709_10014956
1458 Ga0207709_10067541
1459 Ga0207670_10000781
1460 Ga0207670_10075180
1461 Ga0207669_10000168
1462 Ga0207704_10000704
1463 Ga0207704_10153219
1464 Ga0207665_10000234
1465 Ga0207665_10000248
1466 Ga0207665_10011501
1467 Ga0207665_10074219
1468 Ga0207691_10003348
1469 Ga0207691_10006839
1470 Ga0207711_10006180
1471 Ga0207711_10012455
1472 Ga0207711_10042109
1473 Ga0207711_10119131
1474 Ga0207711_10172471
1475 Ga0207689_10012368
1476 Ga0207689_10030358
1477 Ga0207689_10117472
1478 Ga0207661_10000143
1479 Ga0207661_10049496
1480 Ga0207661_10076338
1481 Ga0207661_10110264
1482 Ga0207661_10250242
1483 Ga0207679_10000035
1484 Ga0207679_10022285
1485 Ga0207679_10179254
1486 Ga0207667_10031667
1487 Ga0207667_10043263
1488 Ga0207651_10000080
1489 Ga0207651_10018003
1490 Ga0207712_10003380
1491 Ga0207712_10065930
1492 Ga0207668_10007588
1493 Ga0207668_10109764
1494 Ga0207640_10015424
1495 Ga0207640_10092226
1496 Ga0207658_10022910
1497 Ga0207658_10137366
1498 Ga0207677_10000614
1499 Ga0207677_10033362
1500 Ga0207703_10022821
1501 Ga0207703_10033869
1502 Ga0207703_10063034
1503 Ga0207678_10005116
1504 Ga0207678_10010214
1505 Ga0207678_10044487
1506 Ga0207678_10045206
1507 Ga0207708_10008117
1508 Ga0207708_10013232
1509 Ga0207702_10001956
1510 Ga0207702_10106726
1511 Ga0207702_10116525
1512 Ga0207702_10121704
1513 Ga0207641_10009143
1514 Ga0207641_10010400
1515 Ga0207641_10276984
1516 Ga0207648_10234244
1517 Ga0207676_10001840
1518 Ga0207676_10066563
1519 Ga0207674_10002206
1520 Ga0207674_10014002
1521 Ga0207674_10139845
1522 Ga0207675_100003721
1523 Ga0207675_100012148
1524 Ga0207675_100103227
1525 Ga0207683_10002096
1526 Ga0207683_10003030
1527 Ga0207683_10013315
1528 Ga0207683_10031288
1529 Ga0207683_10047844
1530 Ga0207698_10003387
1531 Ga0207698_10006421
1532 Ga0207698_10027888
1533 Ga0209969_1000387
1534 Ga0209981_1001997
1535 Ga0210000_1001517
1536 Ga0209999_1003848
1537 Ga0209999_1006386
1538 Ga0210002_1000400
1539 Ga0209983_1005796
1540 Ga0209588_1001621
1541 Ga0209966_1002841
1542 Ga0209998_10000497
1543 Ga0209998_10001108
1544 Ga0209974_10002609
1545 Ga0209974_10003968
1546 Ga0209974_10005545
1547 Ga0207428_10000075
1548 Ga0207428_10000428
1549 Ga0207428_10001396
1550 Ga0268266_10024188
1551 Ga0268266_10159053
1552 Ga0268265_10000528
1553 Ga0268265_10003048
1554 Ga0268265_10017602
1555 Ga0268264_10001145
1556 Ga0268264_10001265
1557 Ga0268264_10045961
1558 Ga0268264_10159119
1559 Ga0265337_1000182
1560 Ga0265338_10030715
1561 Ga0265338_10056170
1562 Ga0265332_10002169
1563 Ga0265325_10000034
1564 Ga0265325_10001708
1565 Ga0265325_10008595
1566 Ga0265325_10038458
1567 Ga0265340_10009089
1568 Ga0265340_10039523
1569 Ga0265339_10000091
1570 Ga0265339_10001994
1571 Ga0265339_10019021
1572 Ga0265339_10037911
1573 Ga0265331_10075347
1574 Ga0265316_10043894
1575 Ga0265316_10108022
1576 Ga0307408_100035017
1577 Ga0265313_10000176
1578 Ga0265313_10000260
1579 Ga0265313_10004374
1580 Ga0265313_10006492
1581 Ga0265313_10014189
1582 Ga0265314_10118885
1583 Ga0265342_10000175
1584 Ga0265342_10000203
1585 Ga0265342_10029297
1586 Ga0265342_10081644
1587 Ga0307413_10031388
1588 Ga0307409_100195505
1589 Ga0373930_0001646
1590 Ga0373948_0000065
1591 Ga0373950_0003576
1592 Ga0373938_0004428
1593 Ga0373928_0000172
1594 Ga0373929_0000721
1595 Ga0373929_0002547
1596 Ga0373929_0011884
1597 Ga0373934_0018951
1598 Ga0373934_0026576
1599 Ga0373934_0061335
1600 Ga0373940_0002918
1601 Ga0373940_0007065
1602 Ga0373944_0000062
1603 Ga0373949_0001909
1604 Ga0373949_0002539
1605 Ga0373951_0003492
1606 Ga0373951_0013765
1607 Ga0373952_0010979
1608 Ga0373923_0000277
1609 Ga0373932_0002445
1610 Ga0373932_0004031
1611 Ga0373932_0006012
1612 Ga0373936_0000954
1613 Ga0373936_0017031
1614 Ga0373936_0079517
1615 Ga0373939_0001215
1616 Ga0373939_0004375
1617 Ga0373941_0000106
1618 Ga0373941_0000814
1619 Ga0373945_0000711
1620 Ga0373945_0000835
1621 Ga0373953_0000627
1622 Ga0373953_0001395
1623 Ga0373954_0001186
1624 Ga0373954_0009787
1625 Ga0373954_0013490
1626 Ga0373956_0001511
1627 Ga0373956_0035086
1628 Ga0373957_0006048
1629 Ga0373957_0053769
1630 Ga0373960_0001001
1631 Ga0373960_0001059
1632 Ga0373960_0001694
1633 Ga0373943_0050497
1634 Ga0373946_0006149
1635 Ga0373946_0026717
1636 Ga0373955_0000171
1637 Ga0373955_0000366
1638 Ga0373955_0002392
1639 Ga0373955_0005170
1640 Ga0373955_0007870
1641 Ga0373955_0019223
1642 Ga0373955_0049790
1643 Ga0373942_0001640
1644 Ga0373942_0007471
1645 Ga0373961_0002190
1646 Ga0373961_0002208
1647 Ga0373961_0003616
1648 Ga0373924_0004372
1649 Ga0373924_0006448
1650 Ga0373931_0002810
1651 Ga0373931_0015349
1652 Ga0373931_0023899
1653 Ga0373935_0000218
1654 Ga0373935_0046824
1655 Ga0373927_0005034
1656 Ga0373927_0006149
1657 Ga0373927_0024309
1658 Ga0373927_0030075
1659 Ga0373927_0059760
1660 Ga0373933_0002037
1661 Ga0373933_0004945
1662 Ga0373933_0005704
1663 Ga0373933_0007851
1664 Ga0373933_0018662
1665 Ga0373933_0026475
1666 Ga0373947_0000364
1667 Ga0373947_0008074
1668 Ga0373947_0041308
1669 Ga0373947_0044583
1670 Ga0373937_0000009
1671 Ga0373937_0002001
1672 Ga0373937_0028762
1673 Ga0373937_0042381
1674 Ga0373937_0046498
1675 Ga0373925_0011407
1676 Ga0373925_0025151
1677 Ga0395899_0008445
1678 Ga0395900_0085702
1679 Ga0395900_0208999
1680 Ga0395898_0009233
1681 Ga0395898_0018005
1682 Ga0436364_1509239
1683 Ga0395901_0102406
1684 Ga0436365_0394656
1685 Ga0436363_1044488
1686 Ga0439455_0011454
1687 Ga0439435_0021157
1688 Ga0451577_0158790
1689 Ga0453683_0000494
1690 Ga0466961_0043875
1691 Ga0466963_0037241
1692 Ga0466963_0088567
1693 Ga0466963_0144356
1694 Ga0466957_0109914
1695 Ga0451576_0001638
1696 Ga0451576_0077714
1697 Ga0495592_0000422
1698 Ga0495592_0004523
1699 Ga0495592_0007319
1700 Ga0495603_0010842
1701 Ga0495603_0072826
1702 Ga0495629_0002524
1703 Ga0495629_0016178
1704 Ga0495629_0018816
1705 Ga0495629_0079774
1706 Ga0495641_0076011
1707 Ga0495651_0000300
1708 Ga0495651_0000764
1709 Ga0495651_0001150
1710 Ga0495651_0003637
1711 Ga0495651_0032821
1712 Ga0495653_0000032
1713 Ga0495653_0001957
1714 Ga0495653_0031725
1715 Ga0495580_0001416
1716 Ga0495580_0021728
1717 Ga0495580_0179816
1718 Ga0495582_0029211
1719 Ga0495582_0083985
1720 Ga0495582_0163013
1721 Ga0495639_0006262
1722 Ga0495662_0002039
1723 Ga0495662_0038622
1724 Ga0495662_0097550
1725 Ga0495664_0000010
1726 Ga0495664_0000178
1727 Ga0495664_0034739
1728 Ga0495584_0006106
1729 Ga0495584_0022637
1730 Ga0495584_0112931
1731 Ga0495585_0015366
1732 Ga0495594_0010424
1733 Ga0495594_0052866
1734 Ga0495608_0000008
1735 Ga0495608_0001671
1736 Ga0495608_0025139
1737 Ga0495608_0041070
1738 Ga0495618_0000002
1739 Ga0495618_0003686
1740 Ga0495618_0025323
1741 Ga0495628_0000009
1742 Ga0495628_0001448
1743 Ga0495628_0007599
1744 Ga0495628_0020094
1745 Ga0495630_0002397
1746 Ga0495630_0242314
1747 Ga0495644_0012384
1748 Ga0495666_0000187
1749 Ga0495666_0035568
1750 Ga0495666_0087444
1751 Ga0495652_0000011
1752 Ga0495652_0032696
1753 Ga0495652_0090939
1754 Ga0495652_0091221
1755 Ga0495665_0006213
1756 Ga0495640_0000094
1757 Ga0495640_0023352
1758 Ga0495586_0002551
1759 Ga0495587_0000086
1760 Ga0495587_0002720
1761 Ga0495598_0008090
1762 Ga0495598_0043017
1763 Ga0495645_0000010
1764 Ga0495622_0001697
1765 Ga0495633_0018667
1766 Ga0495667_0000005
1767 Ga0495667_0002931
1768 Ga0495667_0004110
1769 Ga0495667_0048018
1770 Ga0495667_0063532
1771 Ga0495667_0085337
1772 Ga0495634_0000936
1773 Ga0495634_0042214
1774 Ga0495634_0048272
1775 Ga0495611_0006806
1776 Ga0495635_0000008
1777 Ga0495635_0001359
1778 Ga0495635_0011040
1779 Ga0495635_0123563
1780 Ga0495659_0005492
1781 Ga0495659_0006098
1782 Ga0495588_0001695
1783 Ga0495657_0000296
1784 Ga0495657_0003184
1785 Ga0495657_0027472
1786 Ga0495599_0000007
1787 Ga0495599_0000806
1788 Ga0495599_0085910
1789 Ga0495623_0000085
1790 Ga0495623_0010359
1791 Ga0495623_0015361
1792 Ga0495646_0000021
1793 Ga0495646_0033722
1794 Ga0495647_0000638
1795 Ga0495647_0036177
1796 Ga0495658_0004284
1797 Ga0495658_0035163
1798 Ga0495613_0012243
1799 Ga0495613_0023597
1800 Ga0495613_0057153
1801 Ga0495624_0015494
1802 Ga0495624_0109220
1803 Ga0495600_0000001
1804 Ga0495600_0001998
1805 Ga0495600_0006193
1806 Ga0495600_0006357
1807 Ga0495581_0014671
1808 Ga0495581_0039846
1809 Ga0495604_0000012
1810 Ga0495604_0001423
1811 Ga0495604_0005209
1812 Ga0495604_0016854
1813 Ga0495604_0023581
1814 Ga0495604_0039078
1815 Ga0495604_0094830
1816 Ga0495636_0057011
1817 Ga0495674_0000011
1818 Ga0495674_0042009
1819 Ga0495674_0081140
1820 Ga0495674_0209301
1821 Ga0495676_0011575
1822 Ga0495676_0098773
1823 Ga0495680_0000245
1824 Ga0495680_0001491
1825 Ga0495680_0007295
1826 Ga0495680_0013705
1827 Ga0495680_0028576
1828 Ga0495680_0032027
1829 Ga0495680_0209411
1830 Ga0495675_0000657
1831 Ga0495677_0080450
1832 Ga0495679_031124
1833 Ga0495685_027707
1834 Ga0495684_0000084
1835 Ga0495684_0000711
1836 Ga0495684_0040689
1837 Ga0495684_0072546
1838 Ga0495593_0000309
1839 Ga0495593_0018863
1840 Ga0495593_0036157
1841 Ga0495602_0000073
1842 Ga0495602_0029432
1843 Ga0495602_0202511
1844 Ga0495614_0003292
1845 Ga0495614_0033747
1846 Ga0496100_0000203
1847 Ga0496100_0016419
1848 Ga0496100_0033208
1849 Ga0496100_0072383
1850 Ga0496101_0002812
1851 Ga0496101_0013528
1852 Ga0496102_0000871
1853 Ga0496102_0004838
1854 Ga0496102_0006598
1855 Ga0496102_0051348
1856 Ga0496102_0106206
1857 Ga0496102_0118468
1858 Ga0496103_0001365
1859 Ga0496103_0001529
1860 Ga0496103_0002881
1861 Ga0496103_0009792
1862 Ga0496104_0000317
1863 Ga0496104_0000709
1864 Ga0496104_0000873
1865 Ga0496104_0026931
1866 Ga0496104_0050532
1867 Ga0496104_0063751
1868 Ga0496104_0099435
1869 Ga0496104_0110898
1870 Ga0496105_0000485
1871 Ga0496105_0000514
1872 Ga0496105_0070606
1873 Ga0496105_0118973
1874 Ga0496105_0124352
1875 Ga0496105_0178987
1876 Ga0496106_0002909
1877 Ga0496106_0035978
1878 Ga0496106_0037687
1879 Ga0496106_0065636
1880 Ga0496106_0086525
1881 Ga0496106_0146967
1882 Ga0496107_0000268
1883 Ga0496107_0002119
1884 Ga0496107_0027599
1885 Ga0496107_0046893
1886 Ga0496107_0053932
1887 Ga0496107_0126850
1888 Ga0496108_0010827
1889 Ga0496108_0012976
1890 Ga0496108_0019125
1891 Ga0496108_0089330
1892 Ga0496108_0263702
1893 Ga0496109_0000836
1894 Ga0496109_0006654
1895 Ga0496109_0033888
1896 Ga0496109_0074422
1897 Ga0496109_0118772
1898 Ga0496110_0001539
1899 Ga0496110_0006117
1900 Ga0496110_0016005
1901 Ga0496110_0035409
1902 Ga0496111_0000072
1903 Ga0496111_0000657
1904 Ga0496111_0092260
1905 Ga0496111_0114447
1906 Ga0496111_0256702
1907 Ga0496112_0000112
1908 Ga0496112_0028569
1909 Ga0496112_0032191
1910 Ga0496112_0115043
1911 Ga0496113_0000058
1912 Ga0496113_0004401
1913 Ga0496113_0050519
1914 Ga0496113_0060873
1915 Ga0496114_0019587
1916 Ga0496114_0021043
1917 Ga0496114_0075626
1918 Ga0496114_0115053
1919 Ga0496114_0190865
1920 Ga0496115_0015922
1921 Ga0496121_0094938
1922 Ga0501032_0052536
1923 Ga0501032_0108458
1924 Ga0501033_0054431
1925 Ga0501034_0001131
1926 Ga0501034_0020143
1927 Ga0501037_0050195
1928 Ga0501038_0069228
1929 Ga0501038_0079380
1930 Ga0501041_0137266
1931 Ga0501042_0013021
1932 Ga0501042_0094044
1933 Ga0501042_0131480
1934 Ga0501046_0040702
1935 Ga0501046_0105009
1936 Ga0501047_0042592
1937 Ga0501047_0181929
1938 Ga0501070_0015997
1939 Ga0501070_0035326
1940 Ga0501070_0221956
1941 Ga0501072_0026826
1942 Ga0501072_0064450
1943 Ga0501074_0173560
1944 Ga0501075_0036972
1945 Ga0501075_0087388
1946 Ga0501075_0098582
1947 Ga0501076_0006327
1948 Ga0501076_0194418
1949 Ga0501076_0239822
1950 Ga0501077_0005796
1951 Ga0501077_0009236
1952 Ga0501077_0023243
1953 Ga0501077_0121159
1954 Ga0501079_0045484
1955 Ga0501079_0074222
1956 Ga0501079_0090839
1957 Ga0501081_0003672
1958 Ga0501081_0021499
1959 Ga0501081_0035300
1960 Ga0501081_0042931
1961 Ga0501081_0043775
1962 Ga0501035_0080515
1963 Ga0501044_0071243
1964 Ga0501045_0128811
1965 nmdc:mga03683_20430_c1
1966 nmdc:mga03n38_77818_c1
1967 nmdc:mga03n38_99201_c1
1968 nmdc:mga0yw44_35704_c1
1969 nmdc:mga0k408_173380_c1
1970 nmdc:mga0k408_80396_c1
1971 nmdc:mga06z11_51201_c1
1972 nmdc:mga05p37_17539_c1
1973 nmdc:mga05p37_32_c1
1974 nmdc:mga05p37_34120_c1
1975 nmdc:mga05p37_4606_c1
1976 nmdc:mga05p37_66833_c1
1977 nmdc:mga05p37_89534_c1
1978 nmdc:mga05p37_90816_c1
1979 nmdc:mga09592_37123_c1
1980 nmdc:mga09592_6535_c1
1981 nmdc:mga0qj67_110767_c1
1982 nmdc:mga0qj67_157763_c1
1983 nmdc:mga0qj67_168_c1
1984 nmdc:mga0qj67_29510_c1
1985 nmdc:mga0qj67_355_c1
1986 nmdc:mga0qj67_733_c1
1987 nmdc:mga0qj67_74589_c1
1988 nmdc:mga06r32_13222_c1
1989 nmdc:mga06r32_16922_c1
1990 nmdc:mga06r32_21130_c1
1991 nmdc:mga06r32_5297_c1
1992 nmdc:mga06r32_57806_c1
1993 nmdc:mga06r32_68764_c1
1994 nmdc:mga06r32_91319_c1
1995 nmdc:mga08y16_102392_c1
1996 nmdc:mga08y16_132898_c1
1997 nmdc:mga08y16_171996_c1
1998 nmdc:mga08y16_19018_c1
1999 nmdc:mga08y16_2238_c1
2000 nmdc:mga08y16_424126_c1
2001 nmdc:mga08y16_58180_c1
2002 nmdc:mga08y16_6098_c1
2003 nmdc:mga0n895_121400_c1
2004 nmdc:mga0n895_14134_c1
2005 nmdc:mga0n895_15498_c1
2006 nmdc:mga0n895_547_c1
2007 nmdc:mga0n895_55820_c1
2008 nmdc:mga0n895_77179_c1
2009 nmdc:mga0n895_79500_c1
2010 nmdc:mga0n895_8451_c1
2011 nmdc:mga0n895_88591_c1
2012 nmdc:mga0n895_91342_c1
2013 nmdc:mga0rr50_148620_c1
2014 nmdc:mga0rr50_21144_c1
2015 nmdc:mga0rr50_73282_c1
2016 nmdc:mga0rr50_78412_c1
2017 nmdc:mga08x19_54912_c1
2018 nmdc:mga08x19_76395_c1
2019 nmdc:mga0a205_117187_c1
2020 nmdc:mga0a205_12457_c1
2021 nmdc:mga0a205_53544_c1
2022 nmdc:mga0a205_6205_c1
2023 nmdc:mga0a205_629_c1
2024 nmdc:mga0a205_71570_c1
2025 Ga0495601_0000009
2026 Ga0495601_0000521
2027 Ga0495601_0014254
2028 Ga0495601_0031312
2029 Ga0495601_0073246
2030 Ga0495601_0077801
2031 Ga0495612_0000019
2032 Ga0495612_0001070
2033 Ga0495612_0002143
2034 Ga0495612_0008371
2035 Ga0495595_0000015
2036 Ga0495595_0001827
2037 Ga0495595_0002555
2038 Ga0495595_0013740
2039 Ga0495619_0000012
2040 Ga0495619_0000016
2041 Ga0495619_0000670
2042 Ga0495619_0002830
2043 Ga0495619_0022668
2044 Ga0495619_0078577
2045 Ga0500644_0001393
2046 Ga0500641_0004145
2047 Ga0500595_000010
2048 Ga0500595_039632
2049 Ga0500616_0000001
2050 Ga0500645_000051
2051 Ga0501084_0009054
2052 Ga0501082_0044681
2053 Ga0501082_0046745
2054 Ga0501082_0164976
2055 Ga0530510_0055169
2056 2600197099
2057 2643804639
2058 2644064002
2059 2644133472
2060 2644375608
2061 2644415834
2062 2644448874
2063 2644686601
2064 2989352684

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

297

439

0.97

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

304

423

0.93

PF21343

ACAD9-ACADV_C

ACAD9/ACADV, C-terminal domain

306

412

0.86

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

173

277

0.81

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

46

167

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kto-assembly1.cif.gz_A crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021 0.9347 11 406
4kto-assembly1.cif.gz_D crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021 0.9328 11 404
3mdd-assembly1.cif.gz_A crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate 0.9303 11 405
7w0j-assembly1.cif.gz_F acyl-coa dehydrogenase, tfu_1647 0.9288 12 403
7w0j-assembly1.cif.gz_A acyl-coa dehydrogenase, tfu_1647 0.9282 12 403
ID Description Score Start End Superfamily
af_P96397_240_357_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9773 264 377 1.20.140.10
af_I6Y0W5_249_394_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9667 265 403 1.20.140.10
1jqiA03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9629 265 403 1.20.140.10
1jqiB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9624 265 403 1.20.140.10
1bucB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.962 265 403 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A2R6I637-F1-model_v4 Acyl-CoA dehydrogenase 0.9769 283 403 GO:0003995
AF-A0A3S2AM29-F1-model_v4 Acyl-CoA dehydrogenase 0.9602 239 404 GO:0003995
AF-A0A5R2MXK0-F1-model_v4 Acyl-CoA dehydrogenase 0.9568 241 356 GO:0016627
AF-A0A3M1F165-F1-model_v4 Acyl-CoA dehydrogenase 0.952 162 403 GO:0003995
GO:0033539
GO:0046359
AF-A0A7W0Y2I1-F1-model_v4 Acyl-CoA dehydrogenase 0.9507 258 389 GO:0003995

Map