F488663

General Info

Members Datasets Scaffolds Average Seq Length
1033 350 1033 288

Family's Representative Sequence

Representative Sequence 3300028573|Ga0265334_10062399|Ga0265334_100623992
Length 304
Sequence MVDLAGVEPPWAPHVPRYYREMPELNVSFRPTLRRPVLVAAFRGWNDGGQGASLGGGYLAKQWQATRFAEIEPEGFYDFQATRPHVSLVDGITRQLDWPENAFFHATIPGTDRDAIVLLGVEPNLRWKTFSGLVLDLAQDLGVEMLVTFGSLLADVPHTRAAPVTGAATDPALVEELGLEPSRYEGPTGIVGVVHDACRAADIRSVSLWAAVPHYVSLAPSPRAALSLVRRFGELMHVDIDLAELEQASDEYAAYVEELERRVDMLEAADDLPSGDTLAAELTRFLRERDEADESDLGPDGPAV

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
157 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
162 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
163 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
164 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
186 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
187 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
188 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
189 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
190 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
203 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
219 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
220 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
221 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
222 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
275 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
282 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
329 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
332 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
333 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
337 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
338 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
339 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
340 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
341 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
345 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
350 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 1.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 9.1
Rhizosphere 90.51
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10007465 3300003373 Bacteria 2739
2 Ga0070658_10003082 3300005327 Bacteria 13757
3 Ga0070658_10007291 3300005327 Bacteria 8927
4 Ga0070658_10086715 3300005327 Bacteria 2575
5 Ga0070658_10112980 3300005327 Bacteria 2252
6 Ga0070683_100026294 3300005329 Bacteria 5238
7 Ga0070683_100026519 3300005329 Bacteria 5219
8 Ga0070683_100059085 3300005329 Bacteria 3562
9 Ga0070683_100098610 3300005329 Bacteria 2750
10 Ga0070683_100111524 3300005329 Bacteria 2580
11 Ga0070683_100252667 3300005329 Bacteria 1677
12 Ga0070690_100026749 3300005330 Bacteria 3562
13 Ga0070680_100022930 3300005336 Bacteria 4974
14 Ga0070680_100026140 3300005336 Bacteria 4668
15 Ga0070680_100038676 3300005336 Bacteria 3859
16 Ga0070680_100189518 3300005336 Bacteria 1733
17 Ga0070682_100134503 3300005337 Bacteria 1677
18 Ga0070682_100199876 3300005337 Bacteria 1409
19 Ga0068868_100042943 3300005338 Bacteria 3531
20 Ga0070660_100049573 3300005339 Bacteria 3228
21 Ga0070660_100069829 3300005339 Bacteria 2740
22 Ga0070691_10040050 3300005341 Bacteria 2214
23 Ga0070691_10068193 3300005341 Bacteria 1722
24 Ga0070687_100042135 3300005343 Bacteria 2312
25 Ga0070661_100164052 3300005344 Bacteria 1684
26 Ga0070692_10061013 3300005345 Bacteria 1987
27 Ga0070668_100099447 3300005347 Bacteria 2303
28 Ga0070668_100107211 3300005347 Bacteria 2221
29 Ga0070669_100061721 3300005353 Bacteria 2755
30 Ga0070671_100019046 3300005355 Bacteria 5583
31 Ga0070673_100407496 3300005364 Bacteria 1217
32 Ga0070659_100013732 3300005366 Bacteria 6038
33 Ga0070659_100041418 3300005366 Bacteria 3600
34 Ga0070659_100067593 3300005366 Bacteria 2834
35 Ga0070659_100082730 3300005366 Bacteria 2565
36 Ga0070667_100513408 3300005367 Bacteria 1099
37 Ga0070709_10026418 3300005434 Bacteria 3441
38 Ga0070709_10069679 3300005434 Bacteria 2266
39 Ga0070709_10112469 3300005434 Bacteria 1832
40 Ga0070709_10138958 3300005434 Bacteria 1667
41 Ga0070709_10177128 3300005434 Bacteria 1495
42 Ga0070714_100013212 3300005435 Bacteria 6609
43 Ga0070714_100014958 3300005435 Bacteria 6237
44 Ga0070714_100024655 3300005435 Bacteria 4956
45 Ga0070714_100024816 3300005435 Bacteria 4941
46 Ga0070714_100050308 3300005435 Bacteria 3549
47 Ga0070714_100055758 3300005435 Bacteria 3379
48 Ga0070714_100088439 3300005435 Bacteria 2710
49 Ga0070714_100098020 3300005435 Bacteria 2578
50 Ga0070714_100435120 3300005435 Bacteria 1244
51 Ga0070713_100011866 3300005436 Bacteria 6368
52 Ga0070713_100043209 3300005436 Bacteria 3683
53 Ga0070713_100067966 3300005436 Bacteria 3002
54 Ga0070713_100080971 3300005436 Bacteria 2770
55 Ga0070713_100153066 3300005436 Bacteria 2053
56 Ga0070710_10003409 3300005437 Bacteria 7531
57 Ga0070710_10020879 3300005437 Bacteria 3404
58 Ga0070710_10024050 3300005437 Bacteria 3209
59 Ga0070710_10071628 3300005437 Bacteria 1999
60 Ga0070711_100011594 3300005439 Bacteria 5478
61 Ga0070711_100021763 3300005439 Bacteria 4149
62 Ga0070711_100045049 3300005439 Bacteria 2997
63 Ga0070711_100203315 3300005439 Unclassified 1530
64 Ga0070711_100243066 3300005439 Bacteria 1408
65 Ga0070711_100267971 3300005439 Bacteria 1346
66 Ga0070711_100282579 3300005439 Bacteria 1313
67 Ga0070705_100002740 3300005440 Bacteria 8790
68 Ga0070705_100023412 3300005440 Bacteria 3316
69 Ga0070700_100038446 3300005441 Bacteria 2916
70 Ga0070700_100317621 3300005441 Bacteria 1143
71 Ga0070694_100010676 3300005444 Bacteria 5675
72 Ga0070694_100047568 3300005444 Bacteria 2883
73 Ga0070694_100104451 3300005444 Bacteria 2009
74 Ga0070708_100010130 3300005445 Bacteria 7628
75 Ga0070708_100078706 3300005445 Bacteria 2980
76 Ga0070708_100317867 3300005445 Bacteria 1466
77 Ga0070663_100095759 3300005455 Bacteria 2207
78 Ga0070663_100403726 3300005455 Bacteria 1118
79 Ga0070678_100039031 3300005456 Bacteria 3347
80 Ga0070678_100189116 3300005456 Bacteria 1691
81 Ga0070678_100507236 3300005456 Bacteria 1065
82 Ga0070681_10018844 3300005458 Bacteria 6906
83 Ga0070681_10053300 3300005458 Bacteria 4031
84 Ga0070681_10058249 3300005458 Bacteria 3843
85 Ga0070681_10060073 3300005458 Bacteria 3780
86 Ga0070681_10121004 3300005458 Bacteria 2553
87 Ga0070681_10299753 3300005458 Bacteria 1517
88 Ga0070681_10435258 3300005458 Bacteria 1223
89 Ga0068867_100009137 3300005459 Bacteria 6993
90 Ga0070706_100019076 3300005467 Bacteria 6327
91 Ga0070706_100179072 3300005467 Bacteria 1979
92 Ga0070706_100240140 3300005467 Bacteria 1692
93 Ga0070706_100482644 3300005467 Bacteria 1153
94 Ga0070707_100001067 3300005468 Bacteria 27041
95 Ga0070707_100012755 3300005468 Bacteria 7848
96 Ga0070707_100024924 3300005468 Bacteria 5671
97 Ga0070707_100072210 3300005468 Bacteria 3326
98 Ga0070707_100179368 3300005468 Bacteria 2065
99 Ga0070707_100271698 3300005468 Bacteria 1648
100 Ga0070698_100042244 3300005471 Bacteria 4676
101 Ga0070698_100127089 3300005471 Bacteria 2506
102 Ga0070698_100185561 3300005471 Bacteria 2018
103 Ga0070698_100257731 3300005471 Bacteria 1676
104 Ga0070698_100323680 3300005471 Bacteria 1472
105 Ga0070698_100468510 3300005471 Bacteria 1196
106 Ga0070699_100034351 3300005518 Bacteria 4383
107 Ga0070699_100042226 3300005518 Bacteria 3945
108 Ga0070699_100134460 3300005518 Bacteria 2181
109 Ga0070699_100403485 3300005518 Bacteria 1236
110 Ga0070679_100084278 3300005530 Bacteria 3167
111 Ga0070679_100156125 3300005530 Bacteria 2257
112 Ga0070679_100211271 3300005530 Bacteria 1904
113 Ga0070679_100395319 3300005530 Bacteria 1328
114 Ga0070684_100015547 3300005535 Bacteria 6201
115 Ga0070684_100031140 3300005535 Bacteria 4539
116 Ga0070684_100038193 3300005535 Bacteria 4123
117 Ga0070684_100051304 3300005535 Bacteria 3583
118 Ga0070684_100108789 3300005535 Bacteria 2484
119 Ga0070684_100177024 3300005535 Bacteria 1939
120 Ga0070684_100354122 3300005535 Bacteria 1350
121 Ga0070697_100163675 3300005536 Bacteria 1880
122 Ga0068853_100040622 3300005539 Bacteria 3970
123 Ga0068853_100182407 3300005539 Bacteria 1904
124 Ga0070686_100049581 3300005544 Bacteria 2665
125 Ga0070686_100164479 3300005544 Bacteria 1565
126 Ga0070686_100344612 3300005544 Bacteria 1117
127 Ga0070695_100000028 3300005545 Bacteria 53880
128 Ga0070695_100059393 3300005545 Bacteria 2475
129 Ga0070695_100106805 3300005545 Bacteria 1893
130 Ga0070696_100007393 3300005546 Bacteria 7340
131 Ga0070696_100023241 3300005546 Bacteria 4213
132 Ga0070696_100024291 3300005546 Bacteria 4119
133 Ga0070693_100002395 3300005547 Bacteria 8627
134 Ga0070693_100025670 3300005547 Bacteria 3173
135 Ga0070693_100051817 3300005547 Bacteria 2351
136 Ga0070693_100052885 3300005547 Bacteria 2330
137 Ga0070704_100030744 3300005549 Bacteria 3602
138 Ga0070704_100070682 3300005549 Bacteria 2533
139 Ga0070704_100296520 3300005549 Bacteria 1345
140 Ga0068855_100005058 3300005563 Bacteria 16092
141 Ga0068855_100085831 3300005563 Bacteria 3641
142 Ga0070664_100038075 3300005564 Bacteria 4047
143 Ga0070664_100534444 3300005564 Bacteria 1083
144 Ga0068857_100002049 3300005577 Bacteria 16363
145 Ga0068854_100015581 3300005578 Bacteria 5040
146 Ga0068854_100037319 3300005578 Bacteria 3410
147 Ga0068854_100095963 3300005578 Bacteria 2214
148 Ga0068856_100046531 3300005614 Bacteria 4273
149 Ga0068856_100076345 3300005614 Bacteria 3320
150 Ga0068856_100152871 3300005614 Bacteria 2317
151 Ga0068856_100210424 3300005614 Bacteria 1960
152 Ga0068856_100312703 3300005614 Bacteria 1588
153 Ga0070702_100007186 3300005615 Bacteria 5319
154 Ga0068852_100462689 3300005616 Bacteria 1258
155 Ga0068864_100284927 3300005618 Bacteria 1543
156 Ga0068862_100193412 3300005844 Bacteria 1832
157 Ga0081455_10005241 3300005937 Bacteria 14252
158 Ga0081455_10010754 3300005937 Bacteria 9253
159 Ga0081455_10028050 3300005937 Bacteria 5148
160 Ga0081455_10067713 3300005937 Bacteria 2974
161 Ga0081455_10079678 3300005937 Bacteria 2688
162 Ga0081538_10005878 3300005981 Bacteria 10932
163 Ga0081538_10016944 3300005981 Bacteria 5558
164 Ga0081538_10084936 3300005981 Bacteria 1665
165 Ga0081538_10101850 3300005981 Bacteria 1443
166 Ga0081540_1001832 3300005983 Bacteria 17820
167 Ga0081540_1003731 3300005983 Bacteria 11937
168 Ga0081540_1009956 3300005983 Bacteria 6483
169 Ga0081540_1017483 3300005983 Bacteria 4438
170 Ga0070717_10001757 3300006028 Bacteria 15091
171 Ga0070717_10017134 3300006028 Bacteria 5629
172 Ga0070717_10034875 3300006028 Bacteria 4069
173 Ga0070717_10060586 3300006028 Bacteria 3134
174 Ga0070717_10128226 3300006028 Bacteria 2180
175 Ga0070717_10138621 3300006028 Bacteria 2097
176 Ga0070717_10491595 3300006028 Bacteria 1108
177 Ga0075364_10272592 3300006051 Bacteria 1151
178 Ga0075432_10011481 3300006058 Bacteria 3010
179 Ga0070715_10001705 3300006163 Bacteria 6533
180 Ga0070715_10003612 3300006163 Bacteria 4958
181 Ga0070716_100000830 3300006173 Bacteria 13319
182 Ga0070716_100001535 3300006173 Bacteria 10347
183 Ga0070716_100123972 3300006173 Unclassified 1622
184 Ga0070716_100306096 3300006173 Bacteria 1107
185 Ga0070712_100004474 3300006175 Bacteria 8629
186 Ga0070712_100013288 3300006175 Bacteria 5259
187 Ga0070712_100019657 3300006175 Bacteria 4410
188 Ga0070712_100024636 3300006175 Bacteria 3990
189 Ga0070712_100079294 3300006175 Bacteria 2373
190 Ga0070712_100234681 3300006175 Bacteria 1458
191 Ga0097621_100018984 3300006237 Bacteria 5269
192 Ga0068871_100157329 3300006358 Bacteria 1941
193 Ga0068871_100227165 3300006358 Bacteria 1619
194 Ga0075428_100030779 3300006844 Bacteria 5934
195 Ga0075430_100071532 3300006846 Bacteria 2910
196 Ga0075431_100030600 3300006847 Bacteria 5545
197 Ga0075431_100102635 3300006847 Bacteria 2952
198 Ga0075433_10021680 3300006852 Bacteria 5388
199 Ga0075433_10053501 3300006852 Bacteria 3520
200 Ga0075433_10507689 3300006852 Bacteria 1061
201 Ga0075434_100099755 3300006871 Bacteria 2909
202 Ga0075434_100113694 3300006871 Bacteria 2719
203 Ga0068865_100016700 3300006881 Bacteria 4703
204 Ga0075436_100006811 3300006914 Bacteria 7822
205 Ga0075436_100024507 3300006914 Bacteria 4147
206 Ga0075436_100206907 3300006914 Bacteria 1390
207 Ga0075435_100228597 3300007076 Bacteria 1580
208 Ga0075435_100425225 3300007076 Bacteria 1144
209 Ga0075435_100530932 3300007076 Bacteria 1018
210 Ga0105240_10065989 3300009093 Bacteria 4491
211 Ga0105240_10094971 3300009093 Bacteria 3636
212 Ga0105240_10186695 3300009093 Bacteria 2441
213 Ga0105240_10359770 3300009093 Bacteria 1649
214 Ga0105240_10565926 3300009093 Bacteria 1256
215 Ga0111539_10029561 3300009094 Bacteria 6671
216 Ga0111539_10123999 3300009094 Bacteria 3028
217 Ga0111539_11053667 3300009094 Bacteria 945
218 Ga0105245_10066994 3300009098 Bacteria 3251
219 Ga0105247_10049845 3300009101 Bacteria 2576
220 Ga0114129_10017054 3300009147 Bacteria 10340
221 Ga0114129_10048955 3300009147 Bacteria 5940
222 Ga0114129_10374721 3300009147 Bacteria 1881
223 Ga0114129_10481359 3300009147 Bacteria 1624
224 Ga0105243_10113711 3300009148 Bacteria 2270
225 Ga0105243_10320362 3300009148 Bacteria 1412
226 Ga0105241_10019064 3300009174 Bacteria 5059
227 Ga0105241_10074742 3300009174 Bacteria 2639
228 Ga0105241_10152458 3300009174 Bacteria 1892
229 Ga0105241_10556005 3300009174 Bacteria 1031
230 Ga0105242_10028569 3300009176 Bacteria 4442
231 Ga0105242_10058539 3300009176 Bacteria 3159
232 Ga0105242_10185869 3300009176 Bacteria 1836
233 Ga0105248_10352222 3300009177 Bacteria 1658
234 Ga0105238_10257767 3300009551 Bacteria 1723
235 Ga0105249_10052496 3300009553 Bacteria 3723
236 Ga0105249_10056772 3300009553 Bacteria 3585
237 Ga0099796_10025949 3300010159 Bacteria 1856
238 Ga0105239_10036040 3300010375 Bacteria 5431
239 Ga0105239_10037540 3300010375 Bacteria 5309
240 Ga0105239_10240441 3300010375 Bacteria 2032
241 Ga0157373_10082421 3300013100 Bacteria 2267
242 Ga0157373_10121168 3300013100 Bacteria 1838
243 Ga0157373_10179650 3300013100 Bacteria 1490
244 Ga0157371_10152118 3300013102 Bacteria 1650
245 Ga0157370_10014977 3300013104 Bacteria 7906
246 Ga0157370_10064257 3300013104 Bacteria 3475
247 Ga0157370_10118798 3300013104 Bacteria 2469
248 Ga0157369_10079582 3300013105 Bacteria 3510
249 Ga0157369_10088380 3300013105 Bacteria 3307
250 Ga0157374_10060145 3300013296 Bacteria 3555
251 Ga0163162_10315006 3300013306 Bacteria 1697
252 Ga0163162_10440117 3300013306 Bacteria 1436
253 Ga0157372_10066175 3300013307 Bacteria 4060
254 Ga0157372_10306046 3300013307 Bacteria 1849
255 Ga0157372_10417496 3300013307 Bacteria 1563
256 Ga0157375_10056902 3300013308 Bacteria 3863
257 Ga0163163_10050648 3300014325 Bacteria 4090
258 Ga0182008_10003241 3300014497 Bacteria 9946
259 Ga0182008_10053879 3300014497 Unclassified 1991
260 Ga0157377_10029358 3300014745 Bacteria 2968
261 Ga0157379_10297547 3300014968 Bacteria 1470
262 Ga0157376_10055099 3300014969 Bacteria 3317
263 Ga0157376_10078082 3300014969 Bacteria 2834
264 Ga0157376_10270227 3300014969 Bacteria 1597
265 Ga0182006_1020518 3300015261 Bacteria 2768
266 Ga0197907_11090182 3300020069 Bacteria 2587
267 Ga0197907_11177942 3300020069 Bacteria 1095
268 Ga0206356_10423288 3300020070 Bacteria 3027
269 Ga0206356_10497752 3300020070 Bacteria 1728
270 Ga0206352_10445858 3300020078 Bacteria 1080
271 Ga0206354_10463591 3300020081 Bacteria 2015
272 Ga0206353_10028453 3300020082 Bacteria 12119
273 Ga0206353_10670244 3300020082 Bacteria 1233
274 Ga0206353_11330602 3300020082 Bacteria 1031
275 Ga0206353_11481888 3300020082 Bacteria 4198
276 Ga0213871_10026056 3300021441 Bacteria 1493
277 Ga0224712_10146589 3300022467 Bacteria 1043
278 Ga0207653_10011312 3300025885 Bacteria 2786
279 Ga0207692_10023153 3300025898 Bacteria 2869
280 Ga0207692_10044508 3300025898 Bacteria 2215
281 Ga0207710_10074222 3300025900 Bacteria 1565
282 Ga0207688_10018666 3300025901 Bacteria 3771
283 Ga0207647_10002020 3300025904 Bacteria 15521
284 Ga0207685_10045598 3300025905 Bacteria 1663
285 Ga0207699_10037107 3300025906 Bacteria 2783
286 Ga0207699_10047467 3300025906 Bacteria 2518
287 Ga0207699_10091303 3300025906 Bacteria 1912
288 Ga0207699_10114712 3300025906 Bacteria 1733
289 Ga0207699_10135583 3300025906 Bacteria 1612
290 Ga0207705_10034013 3300025909 Bacteria 3643
291 Ga0207705_10105746 3300025909 Bacteria 2075
292 Ga0207705_10157899 3300025909 Bacteria 1702
293 Ga0207684_10008644 3300025910 Bacteria 9045
294 Ga0207684_10133559 3300025910 Bacteria 2130
295 Ga0207684_10274939 3300025910 Bacteria 1453
296 Ga0207654_10020346 3300025911 Bacteria 3517
297 Ga0207654_10179479 3300025911 Bacteria 1380
298 Ga0207707_10029476 3300025912 Bacteria 4798
299 Ga0207707_10035228 3300025912 Bacteria 4377
300 Ga0207707_10108051 3300025912 Bacteria 2432
301 Ga0207707_10204089 3300025912 Bacteria 1723
302 Ga0207707_10457140 3300025912 Bacteria 1092
303 Ga0207695_10004382 3300025913 Bacteria 19305
304 Ga0207695_10185683 3300025913 Bacteria 1998
305 Ga0207671_10004661 3300025914 Bacteria 12974
306 Ga0207671_10224856 3300025914 Bacteria 1471
307 Ga0207693_10000126 3300025915 Bacteria 68560
308 Ga0207693_10000586 3300025915 Bacteria 32620
309 Ga0207693_10001266 3300025915 Bacteria 22523
310 Ga0207693_10004553 3300025915 Bacteria 11703
311 Ga0207693_10066768 3300025915 Bacteria 2816
312 Ga0207693_10168483 3300025915 Bacteria 1725
313 Ga0207693_10276878 3300025915 Bacteria 1315
314 Ga0207663_10015092 3300025916 Bacteria 4252
315 Ga0207663_10035912 3300025916 Bacteria 2977
316 Ga0207663_10047454 3300025916 Bacteria 2651
317 Ga0207663_10092737 3300025916 Bacteria 2008
318 Ga0207663_10094468 3300025916 Bacteria 1992
319 Ga0207663_10260222 3300025916 Bacteria 1281
320 Ga0207663_10333105 3300025916 Bacteria 1144
321 Ga0207660_10066539 3300025917 Bacteria 2607
322 Ga0207660_10274374 3300025917 Bacteria 1336
323 Ga0207662_10026623 3300025918 Bacteria 3336
324 Ga0207657_10003276 3300025919 Bacteria 17325
325 Ga0207657_10013935 3300025919 Bacteria 7866
326 Ga0207657_10013989 3300025919 Bacteria 7851
327 Ga0207657_10186486 3300025919 Bacteria 1675
328 Ga0207652_10056227 3300025921 Bacteria 3387
329 Ga0207652_10085686 3300025921 Bacteria 2761
330 Ga0207652_10339305 3300025921 Bacteria 1356
331 Ga0207646_10007593 3300025922 Bacteria 10986
332 Ga0207646_10013769 3300025922 Bacteria 7719
333 Ga0207646_10112691 3300025922 Bacteria 2441
334 Ga0207646_10237744 3300025922 Bacteria 1646
335 Ga0207694_10007484 3300025924 Bacteria 8279
336 Ga0207694_10368117 3300025924 Bacteria 1192
337 Ga0207694_10578222 3300025924 Bacteria 944
338 Ga0207687_10023728 3300025927 Bacteria 4091
339 Ga0207687_10065695 3300025927 Bacteria 2576
340 Ga0207687_10067416 3300025927 Bacteria 2546
341 Ga0207687_10252775 3300025927 Bacteria 1402
342 Ga0207700_10010214 3300025928 Bacteria 5908
343 Ga0207700_10030891 3300025928 Bacteria 3799
344 Ga0207700_10074122 3300025928 Bacteria 2631
345 Ga0207700_10170157 3300025928 Bacteria 1817
346 Ga0207700_10197544 3300025928 Bacteria 1693
347 Ga0207700_10307581 3300025928 Bacteria 1370
348 Ga0207664_10002009 3300025929 Bacteria 13400
349 Ga0207664_10003758 3300025929 Bacteria 10197
350 Ga0207664_10007986 3300025929 Bacteria 7357
351 Ga0207664_10024595 3300025929 Bacteria 4527
352 Ga0207664_10038872 3300025929 Bacteria 3691
353 Ga0207664_10039781 3300025929 Bacteria 3651
354 Ga0207664_10053180 3300025929 Bacteria 3204
355 Ga0207664_10102183 3300025929 Bacteria 2370
356 Ga0207664_10130266 3300025929 Bacteria 2117
357 Ga0207664_10144588 3300025929 Bacteria 2015
358 Ga0207664_10152646 3300025929 Bacteria 1963
359 Ga0207664_10575544 3300025929 Bacteria 1011
360 Ga0207664_10591130 3300025929 Bacteria 997
361 Ga0207690_10053416 3300025932 Bacteria 2711
362 Ga0207706_10037819 3300025933 Bacteria 4283
363 Ga0207706_10328655 3300025933 Bacteria 1330
364 Ga0207686_10365457 3300025934 Bacteria 1090
365 Ga0207709_10067404 3300025935 Bacteria 2258
366 Ga0207670_10096891 3300025936 Bacteria 2099
367 Ga0207669_10037693 3300025937 Bacteria 2777
368 Ga0207704_10031842 3300025938 Bacteria 2976
369 Ga0207665_10000494 3300025939 Bacteria 26650
370 Ga0207665_10000793 3300025939 Bacteria 21330
371 Ga0207665_10022156 3300025939 Bacteria 4177
372 Ga0207665_10112145 3300025939 Bacteria 1917
373 Ga0207711_10242658 3300025941 Bacteria 1652
374 Ga0207711_10577988 3300025941 Bacteria 1048
375 Ga0207661_10019465 3300025944 Bacteria 5062
376 Ga0207661_10038781 3300025944 Bacteria 3736
377 Ga0207661_10059310 3300025944 Bacteria 3083
378 Ga0207661_10073908 3300025944 Bacteria 2793
379 Ga0207661_10080393 3300025944 Bacteria 2690
380 Ga0207661_10127929 3300025944 Bacteria 2172
381 Ga0207661_10279814 3300025944 Bacteria 1491
382 Ga0207667_10157764 3300025949 Bacteria 2334
383 Ga0207667_10618635 3300025949 Bacteria 1091
384 Ga0207651_10114056 3300025960 Bacteria 2035
385 Ga0207651_10353079 3300025960 Bacteria 1239
386 Ga0207668_10043093 3300025972 Bacteria 3060
387 Ga0207668_10229799 3300025972 Bacteria 1495
388 Ga0207640_10076784 3300025981 Bacteria 2269
389 Ga0207640_10233176 3300025981 Bacteria 1417
390 Ga0207677_10121005 3300026023 Bacteria 1969
391 Ga0207639_10299849 3300026041 Bacteria 1420
392 Ga0207639_10415883 3300026041 Bacteria 1214
393 Ga0207678_10023982 3300026067 Bacteria 5333
394 Ga0207678_10080789 3300026067 Bacteria 2783
395 Ga0207708_10036774 3300026075 Bacteria 3729
396 Ga0207702_10022381 3300026078 Bacteria 5240
397 Ga0207702_10315948 3300026078 Bacteria 1486
398 Ga0207648_10003750 3300026089 Bacteria 15885
399 Ga0207648_10098634 3300026089 Unclassified 2558
400 Ga0207674_10003294 3300026116 Bacteria 19867
401 Ga0207675_100010036 3300026118 Bacteria 8877
402 Ga0207683_10000425 3300026121 Bacteria 38973
403 Ga0207683_10003390 3300026121 Bacteria 13894
404 Ga0207683_10114597 3300026121 Bacteria 2415
405 Ga0207683_10367784 3300026121 Bacteria 1321
406 Ga0207698_10735967 3300026142 Bacteria 984
407 Ga0207428_10012037 3300027907 Bacteria 7613
408 Ga0265337_1025049 3300028556 Bacteria 1819
409 Ga0265326_10051843 3300028558 Bacteria 1162
410 Ga0265319_1003192 3300028563 Bacteria 8622
411 Ga0265319_1051171 3300028563 Bacteria 1362
412 Ga0265334_10006423 3300028573 Bacteria 5065
413 Ga0265334_10062399 3300028573 Bacteria 1403
414 Ga0265334_10079001 3300028573 Bacteria 1214
415 Ga0265318_10000315 3300028577 Bacteria 38724
416 Ga0265318_10003754 3300028577 Bacteria 7557
417 Ga0265322_10025979 3300028654 Bacteria 1674
418 Ga0265322_10027343 3300028654 Bacteria 1630
419 Ga0265336_10003988 3300028666 Bacteria 5649
420 Ga0265336_10028972 3300028666 Bacteria 1728
421 Ga0265338_10003714 3300028800 Bacteria 21233
422 Ga0265338_10011694 3300028800 Bacteria 10105
423 Ga0265338_10014556 3300028800 Bacteria 8738
424 Ga0265338_10025017 3300028800 Bacteria 6078
425 Ga0265338_10065694 3300028800 Bacteria 3144
426 Ga0265338_10177402 3300028800 Bacteria 1627
427 Ga0265324_10016427 3300029957 Bacteria 2702
428 Ga0265330_10151185 3300031235 Bacteria 986
429 Ga0265332_10006779 3300031238 Bacteria 5190
430 Ga0265328_10003597 3300031239 Bacteria 6837
431 Ga0265320_10007161 3300031240 Bacteria 6950
432 Ga0265320_10016743 3300031240 Bacteria 4097
433 Ga0265320_10057555 3300031240 Bacteria 1864
434 Ga0265325_10000170 3300031241 Bacteria 46230
435 Ga0265325_10005433 3300031241 Bacteria 7865
436 Ga0265325_10033619 3300031241 Bacteria 2733
437 Ga0265329_10020907 3300031242 Bacteria 2204
438 Ga0265329_10089138 3300031242 Bacteria 978
439 Ga0265340_10061620 3300031247 Bacteria 1794
440 Ga0265340_10075987 3300031247 Bacteria 1586
441 Ga0265339_10001965 3300031249 Bacteria 15100
442 Ga0265339_10026079 3300031249 Bacteria 3350
443 Ga0265339_10030019 3300031249 Bacteria 3080
444 Ga0265339_10031373 3300031249 Bacteria 3003
445 Ga0265331_10001277 3300031250 Bacteria 18778
446 Ga0265331_10123830 3300031250 Bacteria 1181
447 Ga0265327_10007023 3300031251 Bacteria 8826
448 Ga0265327_10039105 3300031251 Bacteria 2579
449 Ga0265327_10074592 3300031251 Bacteria 1689
450 Ga0265327_10112388 3300031251 Bacteria 1300
451 Ga0265316_10006316 3300031344 Bacteria 11343
452 Ga0265316_10009416 3300031344 Bacteria 8999
453 Ga0265316_10011381 3300031344 Bacteria 8028
454 Ga0307408_100054954 3300031548 Bacteria 2881
455 Ga0265313_10004551 3300031595 Bacteria 10575
456 Ga0265313_10014891 3300031595 Bacteria 4565
457 Ga0265313_10030777 3300031595 Bacteria 2758
458 Ga0265314_10002877 3300031711 Bacteria 17091
459 Ga0265314_10018847 3300031711 Bacteria 5361
460 Ga0265314_10020861 3300031711 Bacteria 5051
461 Ga0265342_10005444 3300031712 Bacteria 9701
462 Ga0265342_10006088 3300031712 Bacteria 9053
463 Ga0265342_10043074 3300031712 Bacteria 2725
464 Ga0265342_10055751 3300031712 Bacteria 2345
465 Ga0307407_10023778 3300031903 Bacteria 3202
466 Ga0307409_100044618 3300031995 Bacteria 3341
467 Ga0307409_100125795 3300031995 Bacteria 2180
468 Ga0307409_100138894 3300031995 Bacteria 2090
469 Ga0307416_100045473 3300032002 Bacteria 3457
470 Ga0307416_100122315 3300032002 Bacteria 2323
471 Ga0307416_100172879 3300032002 Bacteria 2014
472 Ga0307411_10432514 3300032005 Bacteria 1096
473 Ga0307415_100001487 3300032126 Bacteria 11236
474 Ga0307415_100138683 3300032126 Bacteria 1854
475 Ga0307507_10102391 3300033179 Bacteria 2389
476 Ga0373948_0009199 3300034817 Bacteria 1700
477 Ga0373950_0004352 3300034818 Bacteria 2072
478 Ga0373958_0003682 3300034819 Bacteria 2228
479 Ga0373958_0008772 3300034819 Bacteria 1647
480 Ga0373959_0010585 3300034820 Bacteria 1614
481 Ga0373926_0004191 3300035083 Bacteria 4705
482 Ga0373929_0004041 3300035085 Bacteria 2629
483 Ga0373940_0010255 3300035088 Bacteria 2198
484 Ga0373949_0004829 3300035090 Bacteria 3054
485 Ga0373949_0025914 3300035090 Bacteria 1371
486 Ga0373951_0006426 3300035091 Bacteria 2688
487 Ga0373941_0014138 3300035115 Bacteria 2126
488 Ga0373945_0012531 3300035116 Bacteria 2818
489 Ga0373956_0098723 3300035119 Bacteria 1353
490 Ga0373960_0021080 3300035121 Bacteria 1729
491 Ga0373960_0022792 3300035121 Bacteria 1681
492 Ga0373943_0000485 3300035170 Bacteria 16976
493 Ga0373943_0007678 3300035170 Bacteria 4845
494 Ga0373946_0014141 3300035171 Bacteria 3007
495 Ga0373955_0056223 3300035172 Bacteria 2158
496 Ga0373942_0009194 3300035207 Bacteria 2310
497 Ga0373962_0015267 3300035242 Bacteria 1967
498 Ga0373962_0026692 3300035242 Bacteria 1558
499 Ga0373924_0111493 3300035410 Bacteria 1183
500 Ga0373931_0024091 3300035691 Bacteria 3079
501 Ga0373931_0055222 3300035691 Bacteria 2124
502 Ga0373931_0063205 3300035691 Bacteria 2000
503 Ga0373935_0017406 3300035692 Bacteria 4361
504 Ga0373935_0020284 3300035692 Bacteria 4060
505 Ga0373935_0049449 3300035692 Bacteria 2665
506 Ga0373935_0176799 3300035692 Bacteria 1463
507 Ga0373935_0201190 3300035692 Bacteria 1376
508 Ga0373933_0028542 3300035724 Bacteria 3220
509 Ga0373933_0075786 3300035724 Bacteria 2054
510 Ga0373933_0136809 3300035724 Bacteria 1544
511 Ga0373947_0002997 3300035725 Bacteria 10071
512 Ga0373947_0019181 3300035725 Bacteria 3942
513 Ga0373947_0038498 3300035725 Bacteria 2841
514 Ga0373937_0003925 3300036401 Bacteria 12581
515 Ga0373925_0009978 3300037068 Bacteria 6897
516 Ga0373925_0026517 3300037068 Bacteria 4240
517 Ga0395899_0004010 3300037312 Bacteria 11605
518 Ga0395899_0006507 3300037312 Bacteria 9051
519 Ga0395899_0006761 3300037312 Bacteria 8881
520 Ga0395899_0011275 3300037312 Bacteria 6846
521 Ga0395899_0014532 3300037312 Bacteria 6011
522 Ga0395899_0025260 3300037312 Bacteria 4485
523 Ga0395899_0025933 3300037312 Bacteria 4424
524 Ga0395899_0036950 3300037312 Bacteria 3662
525 Ga0395899_0061735 3300037312 Bacteria 2760
526 Ga0395899_0115104 3300037312 Bacteria 1930
527 Ga0395899_0129833 3300037312 Bacteria 1800
528 Ga0395900_0002828 3300037418 Bacteria 18940
529 Ga0395900_0003593 3300037418 Bacteria 16669
530 Ga0395900_0004234 3300037418 Bacteria 15230
531 Ga0395900_0006278 3300037418 Bacteria 12400
532 Ga0395900_0033157 3300037418 Bacteria 5315
533 Ga0395900_0061528 3300037418 Bacteria 3860
534 Ga0395900_0080687 3300037418 Bacteria 3343
535 Ga0395900_0093962 3300037418 Bacteria 3080
536 Ga0395900_0122367 3300037418 Bacteria 2669
537 Ga0395900_0165520 3300037418 Bacteria 2254
538 Ga0395900_0172585 3300037418 Bacteria 2200
539 Ga0395900_0192711 3300037418 Bacteria 2066
540 Ga0395900_0276367 3300037418 Bacteria 1673
541 Ga0395900_0331965 3300037418 Bacteria 1498
542 Ga0395900_0589635 3300037418 Bacteria 1053
543 Ga0395898_0001134 3300037466 Bacteria 40919
544 Ga0395898_0005553 3300037466 Bacteria 13601
545 Ga0395898_0007704 3300037466 Bacteria 11433
546 Ga0395898_0013807 3300037466 Bacteria 8303
547 Ga0395898_0019229 3300037466 Bacteria 6953
548 Ga0395898_0027207 3300037466 Bacteria 5744
549 Ga0395898_0049785 3300037466 Bacteria 4104
550 Ga0395898_0053081 3300037466 Bacteria 3959
551 Ga0395898_0061284 3300037466 Bacteria 3654
552 Ga0395898_0072008 3300037466 Bacteria 3339
553 Ga0395898_0109197 3300037466 Bacteria 2652
554 Ga0395898_0152234 3300037466 Bacteria 2212
555 Ga0395898_0158144 3300037466 Bacteria 2167
556 Ga0395898_0316661 3300037466 Bacteria 1488
557 Ga0395898_0710203 3300037466 Bacteria 947
558 Ga0395905_0002236 3300037471 Bacteria 21813
559 Ga0395905_0006381 3300037471 Bacteria 11885
560 Ga0395905_0010133 3300037471 Bacteria 9187
561 Ga0395905_0012265 3300037471 Bacteria 8255
562 Ga0395905_0018237 3300037471 Bacteria 6662
563 Ga0395905_0023180 3300037471 Bacteria 5869
564 Ga0395905_0025136 3300037471 Bacteria 5617
565 Ga0395905_0052866 3300037471 Bacteria 3802
566 Ga0395905_0056536 3300037471 Bacteria 3670
567 Ga0395905_0057121 3300037471 Bacteria 3650
568 Ga0395905_0068620 3300037471 Bacteria 3320
569 Ga0395905_0192110 3300037471 Bacteria 1915
570 Ga0395905_0221312 3300037471 Bacteria 1771
571 Ga0395905_0364826 3300037471 Bacteria 1337
572 Ga0395901_0006426 3300038443 Bacteria 11911
573 Ga0395901_0018217 3300038443 Bacteria 7169
574 Ga0395901_0020672 3300038443 Bacteria 6737
575 Ga0395901_0030818 3300038443 Bacteria 5527
576 Ga0395901_0040926 3300038443 Bacteria 4800
577 Ga0395901_0049417 3300038443 Bacteria 4369
578 Ga0395901_0058774 3300038443 Bacteria 3999
579 Ga0395901_0060585 3300038443 Bacteria 3938
580 Ga0395901_0122764 3300038443 Bacteria 2730
581 Ga0395901_0126537 3300038443 Bacteria 2685
582 Ga0395901_0133811 3300038443 Bacteria 2605
583 Ga0395901_0136438 3300038443 Bacteria 2578
584 Ga0395901_0145677 3300038443 Bacteria 2489
585 Ga0395901_0180719 3300038443 Bacteria 2212
586 Ga0395901_0359095 3300038443 Bacteria 1502
587 Ga0436360_0394144 3300039438 Bacteria 1935
588 Ga0436360_0881869 3300039438 Bacteria 5939
589 Ga0436363_0255584 3300039450 Bacteria 3141
590 Ga0439441_017247 3300042001 Bacteria 1294
591 Ga0439450_014406 3300042008 Bacteria 1604
592 Ga0439456_024456 3300042013 Bacteria 1281
593 Ga0450907_015470 3300042146 Bacteria 1273
594 Ga0439446_0049625 3300042156 Bacteria 1251
595 Ga0439434_0075977 3300042435 Bacteria 1062
596 Ga0466969_0000749 3300044656 Bacteria 17589
597 Ga0466969_0007379 3300044656 Bacteria 5845
598 Ga0466969_0073565 3300044656 Bacteria 1640
599 Ga0466965_0013039 3300044683 Bacteria 3916
600 Ga0466965_0065176 3300044683 Bacteria 1825
601 Ga0466965_0138536 3300044683 Bacteria 1265
602 Ga0466966_0039970 3300044684 Bacteria 3019
603 Ga0466966_0103162 3300044684 Bacteria 1762
604 Ga0466961_0000560 3300044693 Bacteria 23625
605 Ga0466961_0014772 3300044693 Bacteria 5017
606 Ga0466961_0029685 3300044693 Bacteria 3513
607 Ga0466961_0076948 3300044693 Bacteria 2114
608 Ga0466961_0097789 3300044693 Bacteria 1850
609 Ga0466961_0196251 3300044693 Bacteria 1249
610 Ga0466961_0203402 3300044693 Bacteria 1224
611 Ga0466963_0000355 3300044694 Bacteria 20745
612 Ga0466963_0001329 3300044694 Bacteria 13167
613 Ga0466963_0001715 3300044694 Bacteria 11927
614 Ga0466963_0005352 3300044694 Bacteria 7508
615 Ga0466963_0007445 3300044694 Bacteria 6527
616 Ga0466963_0012463 3300044694 Bacteria 5204
617 Ga0466963_0012733 3300044694 Bacteria 5151
618 Ga0466963_0012911 3300044694 Bacteria 5119
619 Ga0466963_0013492 3300044694 Bacteria 5017
620 Ga0466963_0020303 3300044694 Bacteria 4177
621 Ga0466963_0033509 3300044694 Bacteria 3336
622 Ga0466963_0038888 3300044694 Bacteria 3113
623 Ga0466963_0049915 3300044694 Bacteria 2768
624 Ga0466963_0055778 3300044694 Bacteria 2628
625 Ga0466963_0056151 3300044694 Bacteria 2619
626 Ga0466963_0059013 3300044694 Bacteria 2560
627 Ga0466963_0063714 3300044694 Unclassified 2468
628 Ga0466963_0078684 3300044694 Bacteria 2229
629 Ga0466963_0095686 3300044694 Bacteria 2027
630 Ga0466963_0292901 3300044694 Bacteria 1144
631 Ga0466964_0000982 3300044706 Bacteria 9450
632 Ga0466964_0024366 3300044706 Bacteria 2358
633 Ga0466964_0024881 3300044706 Bacteria 2335
634 Ga0466964_0025736 3300044706 Bacteria 2300
635 Ga0466964_0027129 3300044706 Bacteria 2247
636 Ga0466964_0037728 3300044706 Bacteria 1941
637 Ga0466964_0042827 3300044706 Bacteria 1835
638 Ga0466971_0003347 3300044719 Bacteria 6845
639 Ga0466971_0005127 3300044719 Bacteria 5674
640 Ga0466971_0007091 3300044719 Bacteria 4878
641 Ga0466971_0007850 3300044719 Bacteria 4648
642 Ga0466971_0017867 3300044719 Bacteria 3141
643 Ga0466971_0077790 3300044719 Bacteria 1511
644 Ga0466968_0000662 3300044735 Bacteria 11788
645 Ga0466968_0005087 3300044735 Bacteria 4921
646 Ga0466968_0032397 3300044735 Bacteria 2174
647 Ga0466970_0006693 3300044765 Bacteria 5766
648 Ga0466970_0010391 3300044765 Bacteria 4726
649 Ga0466970_0135172 3300044765 Bacteria 1356
650 Ga0466957_0004105 3300044842 Bacteria 8067
651 Ga0466957_0021190 3300044842 Bacteria 3829
652 Ga0466957_0027919 3300044842 Bacteria 3356
653 Ga0466957_0032093 3300044842 Bacteria 3143
654 Ga0466957_0105532 3300044842 Bacteria 1781
655 Ga0466957_0112142 3300044842 Bacteria 1730
656 Ga0466957_0227357 3300044842 Bacteria 1234
657 Ga0466957_0321994 3300044842 Bacteria 1043
658 Ga0466960_0012397 3300044901 Bacteria 3596
659 Ga0466960_0040342 3300044901 Bacteria 2207
660 Ga0466960_0143022 3300044901 Bacteria 1272
661 Ga0466959_0001794 3300045049 Bacteria 13421
662 Ga0466959_0005411 3300045049 Bacteria 8739
663 Ga0466959_0019863 3300045049 Bacteria 4943
664 Ga0466959_0033367 3300045049 Bacteria 3806
665 Ga0466959_0082665 3300045049 Bacteria 2313
666 Ga0466959_0104340 3300045049 Bacteria 2028
667 Ga0451576_0262200 3300045051 Bacteria 1806
668 Ga0451576_0283072 3300045051 Bacteria 1734
669 Ga0466958_0000655 3300045836 Bacteria 14950
670 Ga0466958_0001851 3300045836 Bacteria 10308
671 Ga0466958_0007203 3300045836 Bacteria 6097
672 Ga0466958_0007899 3300045836 Bacteria 5880
673 Ga0466958_0014393 3300045836 Bacteria 4518
674 Ga0466958_0014823 3300045836 Bacteria 4456
675 Ga0466958_0019682 3300045836 Bacteria 3929
676 Ga0466958_0021267 3300045836 Bacteria 3789
677 Ga0466958_0031370 3300045836 Bacteria 3158
678 Ga0466958_0032176 3300045836 Bacteria 3119
679 Ga0466958_0058286 3300045836 Bacteria 2348
680 Ga0466958_0067638 3300045836 Bacteria 2182
681 Ga0466958_0077428 3300045836 Bacteria 2042
682 Ga0466967_0000219 3300045976 Bacteria 24460
683 Ga0466967_0002872 3300045976 Bacteria 10954
684 Ga0466967_0003820 3300045976 Bacteria 9965
685 Ga0466967_0008229 3300045976 Bacteria 7619
686 Ga0466967_0012380 3300045976 Bacteria 6521
687 Ga0466967_0017082 3300045976 Bacteria 5746
688 Ga0466967_0022408 3300045976 Bacteria 5153
689 Ga0466967_0026636 3300045976 Bacteria 4792
690 Ga0466967_0027483 3300045976 Bacteria 4734
691 Ga0466967_0027813 3300045976 Bacteria 4709
692 Ga0466967_0035678 3300045976 Bacteria 4236
693 Ga0466967_0044675 3300045976 Bacteria 3844
694 Ga0466967_0068385 3300045976 Bacteria 3171
695 Ga0466967_0081285 3300045976 Bacteria 2926
696 Ga0466967_0086585 3300045976 Bacteria 2839
697 Ga0466967_0098881 3300045976 Bacteria 2664
698 Ga0466967_0101661 3300045976 Bacteria 2628
699 Ga0466967_0102031 3300045976 Bacteria 2624
700 Ga0466967_0126011 3300045976 Bacteria 2372
701 Ga0466967_0137409 3300045976 Bacteria 2273
702 Ga0466967_0170459 3300045976 Bacteria 2047
703 Ga0466967_0203006 3300045976 Bacteria 1878
704 Ga0466967_0258890 3300045976 Bacteria 1664
705 Ga0466967_0274350 3300045976 Bacteria 1616
706 Ga0466967_0383746 3300045976 Unclassified 1364
707 Ga0495592_0001003 3300046454 Bacteria 19611
708 Ga0495592_0002313 3300046454 Bacteria 13442
709 Ga0495592_0054383 3300046454 Bacteria 2966
710 Ga0495592_0112200 3300046454 Bacteria 1928
711 Ga0495603_0000062 3300046455 Bacteria 46880
712 Ga0495603_0007259 3300046455 Bacteria 6656
713 Ga0495603_0076911 3300046455 Bacteria 1958
714 Ga0495629_0017474 3300046459 Bacteria 5139
715 Ga0495629_0050680 3300046459 Bacteria 2907
716 Ga0495629_0090116 3300046459 Bacteria 2139
717 Ga0495629_0120735 3300046459 Bacteria 1826
718 Ga0495629_0222685 3300046459 Bacteria 1301
719 Ga0495641_0008094 3300046461 Bacteria 6458
720 Ga0495641_0011742 3300046461 Bacteria 4958
721 Ga0495641_0028643 3300046461 Bacteria 2693
722 Ga0495651_0000038 3300046462 Bacteria 97248
723 Ga0495651_0054468 3300046462 Bacteria 3076
724 Ga0495651_0075725 3300046462 Bacteria 2550
725 Ga0495651_0106769 3300046462 Bacteria 2075
726 Ga0495653_0014400 3300046463 Bacteria 6453
727 Ga0495653_0017311 3300046463 Bacteria 5862
728 Ga0495653_0069725 3300046463 Bacteria 2632
729 Ga0495580_0037730 3300046472 Bacteria 3465
730 Ga0495580_0063357 3300046472 Bacteria 2593
731 Ga0495582_0000560 3300046473 Bacteria 20576
732 Ga0495582_0008803 3300046473 Bacteria 5565
733 Ga0495582_0020372 3300046473 Bacteria 3630
734 Ga0495639_0000517 3300046475 Bacteria 18127
735 Ga0495639_0090749 3300046475 Bacteria 1433
736 Ga0495639_0162252 3300046475 Bacteria 1082
737 Ga0495662_0028122 3300046476 Bacteria 2714
738 Ga0495662_0102568 3300046476 Bacteria 1400
739 Ga0495664_0136747 3300046477 Bacteria 1485
740 Ga0495584_0163131 3300046491 Bacteria 1133
741 Ga0495594_0000447 3300046499 Bacteria 20925
742 Ga0495596_0069062 3300046500 Unclassified 1373
743 Ga0495607_0060191 3300046501 Bacteria 2163
744 Ga0495607_0096921 3300046501 Bacteria 1587
745 Ga0495607_0166365 3300046501 Bacteria 1117
746 Ga0495608_0002720 3300046511 Bacteria 12708
747 Ga0495608_0019558 3300046511 Bacteria 4660
748 Ga0495618_0001861 3300046514 Bacteria 13905
749 Ga0495618_0038908 3300046514 Bacteria 2990
750 Ga0495628_0000025 3300046516 Bacteria 127935
751 Ga0495628_0034135 3300046516 Bacteria 4095
752 Ga0495628_0037003 3300046516 Bacteria 3914
753 Ga0495630_0001418 3300046517 Bacteria 16580
754 Ga0495630_0009799 3300046517 Bacteria 6898
755 Ga0495630_0066996 3300046517 Bacteria 2699
756 Ga0495630_0231149 3300046517 Bacteria 1413
757 Ga0495644_0002988 3300046523 Bacteria 6696
758 Ga0495666_0000186 3300046526 Bacteria 26616
759 Ga0495652_0000088 3300046529 Bacteria 98865
760 Ga0495652_0019058 3300046529 Bacteria 6112
761 Ga0495652_0041133 3300046529 Bacteria 3991
762 Ga0495652_0043635 3300046529 Bacteria 3861
763 Ga0495652_0214915 3300046529 Bacteria 1449
764 Ga0495652_0227150 3300046529 Bacteria 1399
765 Ga0495652_0229632 3300046529 Bacteria 1389
766 Ga0495665_0035777 3300046531 Bacteria 2651
767 Ga0495665_0129482 3300046531 Bacteria 1321
768 Ga0495640_0028051 3300046533 Bacteria 4055
769 Ga0495640_0160401 3300046533 Bacteria 1441
770 Ga0495586_0020074 3300046535 Bacteria 3559
771 Ga0495586_0085483 3300046535 Bacteria 1738
772 Ga0495587_0002637 3300046536 Bacteria 11988
773 Ga0495587_0108668 3300046536 Bacteria 1594
774 Ga0495587_0116283 3300046536 Bacteria 1534
775 Ga0495609_0062728 3300046538 Bacteria 1641
776 Ga0495645_0000024 3300046543 Bacteria 125065
777 Ga0495645_0009655 3300046543 Bacteria 6748
778 Ga0495645_0055960 3300046543 Bacteria 2864
779 Ga0495622_0098689 3300046557 Bacteria 1339
780 Ga0495667_0002973 3300046559 Bacteria 11364
781 Ga0495667_0033428 3300046559 Bacteria 3442
782 Ga0495667_0041717 3300046559 Bacteria 3043
783 Ga0495667_0081995 3300046559 Bacteria 2096
784 Ga0495667_0129403 3300046559 Bacteria 1629
785 Ga0495656_0001592 3300046615 Bacteria 7433
786 Ga0495656_0092264 3300046615 Bacteria 1387
787 Ga0495656_0140061 3300046615 Bacteria 1159
788 Ga0495634_0031612 3300046642 Bacteria 3644
789 Ga0495634_0033819 3300046642 Bacteria 3510
790 Ga0495634_0052255 3300046642 Bacteria 2739
791 Ga0495634_0246242 3300046642 Unclassified 1095
792 Ga0495635_0015180 3300046663 Bacteria 5388
793 Ga0495588_0000632 3300046674 Bacteria 16378
794 Ga0495588_0114027 3300046674 Bacteria 1424
795 Ga0495657_0022864 3300046675 Bacteria 4473
796 Ga0495657_0038995 3300046675 Bacteria 3266
797 Ga0495657_0159811 3300046675 Bacteria 1395
798 Ga0495599_0000019 3300046678 Bacteria 141108
799 Ga0495599_0117614 3300046678 Bacteria 1653
800 Ga0495623_0000032 3300046679 Bacteria 84435
801 Ga0495623_0082329 3300046679 Bacteria 1989
802 Ga0495646_0087168 3300046680 Bacteria 1809
803 Ga0495647_0000811 3300046681 Bacteria 9345
804 Ga0495647_0021859 3300046681 Bacteria 2307
805 Ga0495647_0022573 3300046681 Bacteria 2274
806 Ga0495647_0031045 3300046681 Bacteria 1986
807 Ga0495647_0070639 3300046681 Bacteria 1397
808 Ga0495658_0001241 3300046683 Bacteria 13401
809 Ga0495658_0015566 3300046683 Bacteria 3903
810 Ga0495658_0029375 3300046683 Bacteria 2976
811 Ga0495658_0075027 3300046683 Bacteria 1972
812 Ga0495613_0017903 3300046689 Bacteria 5282
813 Ga0495613_0026998 3300046689 Bacteria 4274
814 Ga0495613_0110740 3300046689 Bacteria 1978
815 Ga0495613_0326211 3300046689 Bacteria 1059
816 Ga0495624_0008189 3300046690 Bacteria 7311
817 Ga0495624_0070883 3300046690 Bacteria 2169
818 Ga0495671_0046187 3300046692 Bacteria 2178
819 Ga0495589_0045883 3300046794 Bacteria 2170
820 Ga0495600_0034542 3300046809 Bacteria 3283
821 Ga0495600_0123192 3300046809 Bacteria 1686
822 Ga0495600_0143721 3300046809 Bacteria 1547
823 Ga0495600_0182927 3300046809 Bacteria 1350
824 Ga0495581_0002069 3300047315 Bacteria 11286
825 Ga0495581_0003648 3300047315 Bacteria 8866
826 Ga0495581_0099162 3300047315 Bacteria 1692
827 Ga0495604_0000128 3300047317 Bacteria 63743
828 Ga0495604_0086098 3300047317 Bacteria 2344
829 Ga0495604_0183546 3300047317 Bacteria 1462
830 Ga0495674_0032285 3300047319 Bacteria 4750
831 Ga0495674_0065311 3300047319 Bacteria 3161
832 Ga0495674_0080843 3300047319 Bacteria 2788
833 Ga0495676_0000253 3300047321 Bacteria 43107
834 Ga0495676_0018217 3300047321 Bacteria 6193
835 Ga0495676_0075731 3300047321 Bacteria 2572
836 Ga0495676_0134668 3300047321 Bacteria 1778
837 Ga0495676_0140450 3300047321 Bacteria 1732
838 Ga0495680_0002766 3300047322 Bacteria 17688
839 Ga0495680_0018043 3300047322 Bacteria 6005
840 Ga0495680_0018302 3300047322 Bacteria 5952
841 Ga0495680_0044914 3300047322 Bacteria 3491
842 Ga0495680_0188464 3300047322 Bacteria 1485
843 Ga0495680_0256521 3300047322 Bacteria 1238
844 Ga0495675_0000007 3300047444 Bacteria 162640
845 Ga0495684_0019114 3300047471 Bacteria 5275
846 Ga0495684_0027520 3300047471 Bacteria 4365
847 Ga0495684_0029481 3300047471 Bacteria 4211
848 Ga0495593_0000358 3300047673 Bacteria 25227
849 Ga0495602_0000246 3300048088 Bacteria 50728
850 Ga0495602_0062805 3300048088 Bacteria 3221
851 Ga0495602_0121928 3300048088 Bacteria 2096
852 Ga0496100_0076117 3300048903 Bacteria 2252
853 Ga0496100_0143962 3300048903 Bacteria 1693
854 Ga0496100_0194042 3300048903 Bacteria 1476
855 Ga0496100_0199318 3300048903 Bacteria 1458
856 Ga0496100_0287729 3300048903 Bacteria 1227
857 Ga0496101_0076125 3300048904 Bacteria 2471
858 Ga0496101_0156241 3300048904 Bacteria 1747
859 Ga0496102_0015928 3300048905 Bacteria 6560
860 Ga0496102_0044862 3300048905 Bacteria 4012
861 Ga0496102_0148864 3300048905 Bacteria 2198
862 Ga0496102_0272646 3300048905 Bacteria 1595
863 Ga0496102_0300361 3300048905 Bacteria 1513
864 Ga0496103_0005447 3300048906 Bacteria 7613
865 Ga0496103_0012699 3300048906 Bacteria 4996
866 Ga0496103_0031665 3300048906 Bacteria 3224
867 Ga0496103_0043277 3300048906 Bacteria 2772
868 Ga0496104_0002359 3300048907 Bacteria 16318
869 Ga0496104_0003973 3300048907 Bacteria 12803
870 Ga0496104_0007410 3300048907 Bacteria 9695
871 Ga0496104_0047719 3300048907 Bacteria 4037
872 Ga0496104_0136424 3300048907 Bacteria 2357
873 Ga0496104_0205254 3300048907 Bacteria 1882
874 Ga0496105_0000042 3300048908 Bacteria 114886
875 Ga0496105_0003530 3300048908 Bacteria 11596
876 Ga0496105_0018165 3300048908 Bacteria 5646
877 Ga0496105_0103642 3300048908 Bacteria 2349
878 Ga0496105_0153980 3300048908 Bacteria 1888
879 Ga0496105_0172311 3300048908 Bacteria 1774
880 Ga0496105_0429524 3300048908 Bacteria 1045
881 Ga0496106_0003639 3300048909 Bacteria 11495
882 Ga0496106_0014103 3300048909 Bacteria 5905
883 Ga0496106_0016966 3300048909 Bacteria 5389
884 Ga0496106_0039400 3300048909 Bacteria 3539
885 Ga0496106_0100183 3300048909 Bacteria 2246
886 Ga0496106_0160704 3300048909 Bacteria 1776
887 Ga0496107_0003668 3300048910 Bacteria 10322
888 Ga0496107_0016603 3300048910 Bacteria 5173
889 Ga0496107_0022333 3300048910 Bacteria 4471
890 Ga0496107_0088641 3300048910 Bacteria 2258
891 Ga0496107_0206775 3300048910 Bacteria 1459
892 Ga0496108_0001658 3300048911 Bacteria 17647
893 Ga0496108_0016705 3300048911 Bacteria 5995
894 Ga0496108_0018902 3300048911 Bacteria 5651
895 Ga0496108_0024398 3300048911 Bacteria 4978
896 Ga0496108_0102798 3300048911 Bacteria 2438
897 Ga0496108_0128285 3300048911 Bacteria 2179
898 Ga0496108_0305360 3300048911 Bacteria 1386
899 Ga0496109_0001544 3300048912 Bacteria 19145
900 Ga0496109_0033522 3300048912 Bacteria 4620
901 Ga0496109_0044409 3300048912 Bacteria 4031
902 Ga0496109_0055983 3300048912 Bacteria 3598
903 Ga0496109_0113334 3300048912 Bacteria 2522
904 Ga0496109_0138252 3300048912 Bacteria 2277
905 Ga0496109_0205551 3300048912 Bacteria 1851
906 Ga0496109_0279857 3300048912 Bacteria 1572
907 Ga0496110_0000050 3300048913 Bacteria 59023
908 Ga0496110_0011943 3300048913 Bacteria 7135
909 Ga0496110_0090840 3300048913 Bacteria 2731
910 Ga0496110_0156666 3300048913 Bacteria 2063
911 Ga0496110_0171147 3300048913 Bacteria 1970
912 Ga0496110_0204690 3300048913 Bacteria 1793
913 Ga0496110_0372610 3300048913 Bacteria 1301
914 Ga0496110_0608915 3300048913 Bacteria 990
915 Ga0496111_0000439 3300048914 Bacteria 21067
916 Ga0496111_0000734 3300048914 Bacteria 17468
917 Ga0496111_0007486 3300048914 Bacteria 7162
918 Ga0496111_0057934 3300048914 Bacteria 2804
919 Ga0496111_0071315 3300048914 Bacteria 2528
920 Ga0496111_0073513 3300048914 Bacteria 2489
921 Ga0496111_0120089 3300048914 Bacteria 1941
922 Ga0496111_0241902 3300048914 Bacteria 1340
923 Ga0496112_0003989 3300048915 Bacteria 12369
924 Ga0496112_0028410 3300048915 Bacteria 5398
925 Ga0496112_0032775 3300048915 Bacteria 5045
926 Ga0496112_0090149 3300048915 Bacteria 3035
927 Ga0496112_0206812 3300048915 Bacteria 1920
928 Ga0496112_0239766 3300048915 Bacteria 1766
929 Ga0496112_0342378 3300048915 Bacteria 1438
930 Ga0496113_0000348 3300048916 Bacteria 22048
931 Ga0496113_0029569 3300048916 Bacteria 3959
932 Ga0496113_0041307 3300048916 Bacteria 3403
933 Ga0496114_0011285 3300048917 Bacteria 7135
934 Ga0496114_0021288 3300048917 Bacteria 5273
935 Ga0496114_0067293 3300048917 Bacteria 3005
936 Ga0496114_0119631 3300048917 Bacteria 2264
937 Ga0496114_0131769 3300048917 Bacteria 2159
938 Ga0496114_0158162 3300048917 Bacteria 1969
939 Ga0496114_0209371 3300048917 Bacteria 1710
940 Ga0496114_0228206 3300048917 Bacteria 1635
941 Ga0496115_0024979 3300048918 Bacteria 4648
942 Ga0496115_0105449 3300048918 Bacteria 2313
943 Ga0496115_0159740 3300048918 Bacteria 1862
944 Ga0496115_0377945 3300048918 Bacteria 1152
945 Ga0496115_0415806 3300048918 Bacteria 1090
946 Ga0501031_0008119 3300049568 Bacteria 6837
947 Ga0501033_0073085 3300049570 Bacteria 2518
948 Ga0501036_0026468 3300049572 Bacteria 4896
949 Ga0501039_0025405 3300049575 Bacteria 4551
950 Ga0501039_0421906 3300049575 Bacteria 1048
951 Ga0501040_0035637 3300049576 Bacteria 3375
952 Ga0501041_0002691 3300049577 Bacteria 10137
953 Ga0501041_0172052 3300049577 Bacteria 1355
954 Ga0501042_0006512 3300049578 Bacteria 7586
955 Ga0501046_0111991 3300049580 Bacteria 2084
956 Ga0501047_0053297 3300049581 Bacteria 3911
957 Ga0501047_0247748 3300049581 Bacteria 1631
958 Ga0501048_0012008 3300049582 Bacteria 6455
959 Ga0501067_0014659 3300049583 Bacteria 4339
960 Ga0501067_0113394 3300049583 Bacteria 1507
961 Ga0501069_0050934 3300049585 Bacteria 2303
962 Ga0501069_0099886 3300049585 Bacteria 1647
963 Ga0501070_0076082 3300049586 Bacteria 2779
964 Ga0501070_0206354 3300049586 Bacteria 1613
965 Ga0501071_0090727 3300049587 Bacteria 2244
966 Ga0501072_0002912 3300049588 Bacteria 12879
967 Ga0501072_0008797 3300049588 Bacteria 7667
968 Ga0501072_0083649 3300049588 Bacteria 2530
969 Ga0501073_0121549 3300049589 Bacteria 1810
970 Ga0501074_0146850 3300049590 Bacteria 1686
971 Ga0501075_0011065 3300049591 Bacteria 6368
972 Ga0501075_0258859 3300049591 Bacteria 1326
973 Ga0501076_0002641 3300049592 Bacteria 12370
974 Ga0501076_0119311 3300049592 Bacteria 2136
975 Ga0501077_0001491 3300049593 Bacteria 14106
976 Ga0501077_0014568 3300049593 Bacteria 4943
977 Ga0501077_0146994 3300049593 Bacteria 1495
978 Ga0501079_0078856 3300049741 Bacteria 2547
979 Ga0501079_0107983 3300049741 Bacteria 2160
980 Ga0501080_0017611 3300049742 Bacteria 6606
981 Ga0501080_0050844 3300049742 Bacteria 3856
982 Ga0501081_0024489 3300049743 Bacteria 4052
983 Ga0501081_0047735 3300049743 Bacteria 2946
984 Ga0501081_0055592 3300049743 Bacteria 2735
985 Ga0501083_0001129 3300049744 Bacteria 17880
986 Ga0501044_0226877 3300049823 Bacteria 1817
987 nmdc:mga00v17_273990_c1 3300050491 Bacteria 1095
988 nmdc:mga05p37_108574_c1 3300050507 Bacteria 3413
989 nmdc:mga05p37_172030_c1 3300050507 Bacteria 2641
990 nmdc:mga05p37_24422_c1 3300050507 Bacteria 7346
991 nmdc:mga05p37_270310_c1 3300050507 Bacteria 2031
992 nmdc:mga05p37_315261_c1 3300050507 Bacteria 1853
993 nmdc:mga0qj67_27729_c1 3300050509 Bacteria 4391
994 nmdc:mga06r32_110320_c1 3300050510 Bacteria 2706
995 nmdc:mga08y16_112699_c1 3300050511 Bacteria 2831
996 nmdc:mga08y16_159191_c1 3300050511 Bacteria 2346
997 nmdc:mga0n895_168363_c1 3300050512 Bacteria 2223
998 nmdc:mga0n895_926965_c1 3300050512 Bacteria 855
999 nmdc:mga0rr50_11827_c1 3300050513 Bacteria 5605
1000 nmdc:mga0rr50_133887_c1 3300050513 Bacteria 1987
1001 nmdc:mga0rr50_215803_c1 3300050513 Bacteria 1583
1002 nmdc:mga0rr50_98139_c1 3300050513 Bacteria 2296
1003 nmdc:mga08x19_123982_c1 3300050514 Bacteria 1734
1004 nmdc:mga08x19_22289_c1 3300050514 Bacteria 3922
1005 nmdc:mga0a205_123064_c1 3300050515 Bacteria 2494
1006 nmdc:mga0a205_93530_c1 3300050515 Bacteria 2904
1007 Ga0495601_0000313 3300053077 Bacteria 25734
1008 Ga0495601_0016312 3300053077 Bacteria 4501
1009 Ga0495601_0022926 3300053077 Bacteria 3836
1010 Ga0495601_0050349 3300053077 Bacteria 2627
1011 Ga0495601_0064330 3300053077 Bacteria 2332
1012 Ga0495601_0106150 3300053077 Bacteria 1816
1013 Ga0495601_0180865 3300053077 Bacteria 1379
1014 Ga0495612_0037473 3300053078 Bacteria 1969
1015 Ga0495612_0040271 3300053078 Bacteria 1903
1016 Ga0495612_0074261 3300053078 Bacteria 1421
1017 Ga0495612_0088157 3300053078 Bacteria 1310
1018 Ga0495619_0005391 3300053085 Bacteria 8102
1019 Ga0495619_0006346 3300053085 Bacteria 7495
1020 Ga0495619_0031125 3300053085 Bacteria 3456
1021 Ga0495619_0138371 3300053085 Bacteria 1675
1022 Ga0495619_0186611 3300053085 Bacteria 1435
1023 Ga0501084_0036663 3300054114 Bacteria 4096
1024 Ga0590077_022636 3300059426 Bacteria 1342
1025 Ga0501082_0037979 3300060353 Bacteria 4153
1026 Ga0501082_0218065 3300060353 Bacteria 1660
1027 Ga0466962_0004666 3300061719 Bacteria 6580
1028 Ga0466962_0006290 3300061719 Bacteria 5705
1029 Ga0466962_0012287 3300061719 Bacteria 4116
1030 Ga0466962_0035560 3300061719 Bacteria 2385
1031 Ga0530510_0005837 3300061734 Bacteria 8532
1032 Ga0530510_0123401 3300061734 Bacteria 1903
1033 Ga0530510_0167468 3300061734 Bacteria 1627

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_10367784 Ga0207683_103677842 238
2 3300050512 nmdc:mga0n895_926965_c1 nmdc:mga0n895_926965_c1_11_778 240
3 3300044694 Ga0466963_0020303 Ga0466963_0020303_1815_2654 241
4 3300047321 Ga0495676_0140450 Ga0495676_0140450_371_1264 251
5 3300009093 Ga0105240_10094971 Ga0105240_100949712 252
6 3300025913 Ga0207695_10185683 Ga0207695_101856832 252
7 3300035172 Ga0373955_0056223 Ga0373955_0056223_1191_2039 252
8 3300035724 Ga0373933_0028542 Ga0373933_0028542_1242_2090 252
9 3300046511 Ga0495608_0002720 Ga0495608_0002720_3692_4540 252
10 3300046514 Ga0495618_0038908 Ga0495618_0038908_1223_2071 252
11 3300047322 Ga0495680_0002766 Ga0495680_0002766_1340_2188 252
12 3300047471 Ga0495684_0027520 Ga0495684_0027520_1560_2408 252
13 3300005329 Ga0070683_100026294 Ga0070683_1000262943 254
14 3300005535 Ga0070684_100031140 Ga0070684_1000311403 254
15 3300009148 Ga0105243_10320362 Ga0105243_103203622 254
16 3300010375 Ga0105239_10037540 Ga0105239_100375402 254
17 3300025901 Ga0207688_10018666 Ga0207688_100186662 254
18 3300025927 Ga0207687_10067416 Ga0207687_100674162 254
19 3300048912 Ga0496109_0055983 Ga0496109_0055983_2035_2925 254
20 3300044693 Ga0466961_0196251 Ga0466961_0196251_252_1136 255
21 3300006051 Ga0075364_10272592 Ga0075364_102725922 256
22 3300050491 nmdc:mga00v17_273990_c1 nmdc:mga00v17_273990_c1_106_993 256
23 3300037466 Ga0395898_0710203 Ga0395898_0710203_94_930 257
24 3300045976 Ga0466967_0086585 Ga0466967_0086585_1583_2476 257
25 3300006846 Ga0075430_100071532 Ga0075430_1000715323 259
26 3300006852 Ga0075433_10507689 Ga0075433_105076891 259
27 3300009093 Ga0105240_10359770 Ga0105240_103597702 259
28 3300009147 Ga0114129_10481359 Ga0114129_104813592 259
29 3300037312 Ga0395899_0014532 Ga0395899_0014532_1267_2154 259
30 3300037312 Ga0395899_0129833 Ga0395899_0129833_199_1086 259
31 3300037418 Ga0395900_0093962 Ga0395900_0093962_1209_2096 259
32 3300037418 Ga0395900_0122367 Ga0395900_0122367_1046_1933 259
33 3300037466 Ga0395898_0013807 Ga0395898_0013807_608_1495 259
34 3300037466 Ga0395898_0061284 Ga0395898_0061284_1609_2496 259
35 3300037471 Ga0395905_0052866 Ga0395905_0052866_2083_2970 259
36 3300038443 Ga0395901_0006426 Ga0395901_0006426_3122_4009 259
37 3300038443 Ga0395901_0359095 Ga0395901_0359095_77_964 259
38 3300046455 Ga0495603_0076911 Ga0495603_0076911_52_939 259
39 3300046500 Ga0495596_0069062 Ga0495596_0069062_23_910 259
40 3300046501 Ga0495607_0060191 Ga0495607_0060191_642_1529 259
41 3300046501 Ga0495607_0166365 Ga0495607_0166365_207_1094 259
42 3300046615 Ga0495656_0092264 Ga0495656_0092264_34_921 259
43 3300046615 Ga0495656_0140061 Ga0495656_0140061_61_948 259
44 3300046674 Ga0495588_0114027 Ga0495588_0114027_257_1144 259
45 3300046692 Ga0495671_0046187 Ga0495671_0046187_626_1513 259
46 3300050507 nmdc:mga05p37_172030_c1 nmdc:mga05p37_172030_c1_455_1354 259
47 3300050509 nmdc:mga0qj67_27729_c1 nmdc:mga0qj67_27729_c1_3134_4033 259
48 3300050515 nmdc:mga0a205_93530_c1 nmdc:mga0a205_93530_c1_484_1371 259
49 3300005329 Ga0070683_100026519 Ga0070683_1000265194 260
50 3300005439 Ga0070711_100203315 Ga0070711_1002033152 260
51 3300005535 Ga0070684_100015547 Ga0070684_1000155473 260
52 3300005564 Ga0070664_100038075 Ga0070664_1000380753 260
53 3300005577 Ga0068857_100002049 Ga0068857_1000020494 260
54 3300025916 Ga0207663_10035912 Ga0207663_100359122 260
55 3300025944 Ga0207661_10059310 Ga0207661_100593102 260
56 3300026116 Ga0207674_10003294 Ga0207674_100032945 260
57 3300046459 Ga0495629_0120735 Ga0495629_0120735_920_1813 260
58 3300047322 Ga0495680_0188464 Ga0495680_0188464_435_1328 260
59 3300005329 Ga0070683_100059085 Ga0070683_1000590852 261
60 3300005347 Ga0070668_100099447 Ga0070668_1000994472 261
61 3300005436 Ga0070713_100153066 Ga0070713_1001530661 261
62 3300005439 Ga0070711_100267971 Ga0070711_1002679712 261
63 3300005518 Ga0070699_100403485 Ga0070699_1004034851 261
64 3300005535 Ga0070684_100177024 Ga0070684_1001770242 261
65 3300005614 Ga0068856_100152871 Ga0068856_1001528712 261
66 3300006028 Ga0070717_10060586 Ga0070717_100605863 261
67 3300025916 Ga0207663_10092737 Ga0207663_100927373 261
68 3300025928 Ga0207700_10010214 Ga0207700_100102143 261
69 3300025929 Ga0207664_10002009 Ga0207664_100020099 261
70 3300025944 Ga0207661_10073908 Ga0207661_100739082 261
71 3300025972 Ga0207668_10229799 Ga0207668_102297992 261
72 3300026078 Ga0207702_10315948 Ga0207702_103159482 261
73 3300035692 Ga0373935_0017406 Ga0373935_0017406_1607_2497 261
74 3300046473 Ga0495582_0008803 Ga0495582_0008803_3138_4028 261
75 3300046531 Ga0495665_0129482 Ga0495665_0129482_116_1006 261
76 3300046535 Ga0495586_0085483 Ga0495586_0085483_410_1300 261
77 3300046681 Ga0495647_0031045 Ga0495647_0031045_516_1406 261
78 3300046689 Ga0495613_0026998 Ga0495613_0026998_2084_2974 261
79 3300046690 Ga0495624_0070883 Ga0495624_0070883_856_1746 261
80 3300047315 Ga0495581_0002069 Ga0495581_0002069_4597_5487 261
81 3300047321 Ga0495676_0018217 Ga0495676_0018217_1256_2146 261
82 3300031242 Ga0265329_10089138 Ga0265329_100891381 262
83 3300046529 Ga0495652_0214915 Ga0495652_0214915_77_970 262
84 3300031251 Ga0265327_10074592 Ga0265327_100745922 263
85 3300035410 Ga0373924_0111493 Ga0373924_0111493_175_1026 263
86 3300046529 Ga0495652_0229632 Ga0495652_0229632_352_1242 263
87 3300025934 Ga0207686_10365457 Ga0207686_103654572 264
88 3300026089 Ga0207648_10098634 Ga0207648_100986343 264
89 3300025933 Ga0207706_10328655 Ga0207706_103286552 265
90 3300028800 Ga0265338_10011694 Ga0265338_100116947 267
91 3300031251 Ga0265327_10007023 Ga0265327_100070234 267
92 3300039438 Ga0436360_0394144 Ga0436360_0394144_392_1285 267
93 3300035724 Ga0373933_0136809 Ga0373933_0136809_55_948 268
94 3300049583 Ga0501067_0014659 Ga0501067_0014659_620_1507 268
95 3300049585 Ga0501069_0099886 Ga0501069_0099886_337_1224 268
96 3300006847 Ga0075431_100030600 Ga0075431_1000306002 269
97 3300028563 Ga0265319_1003192 Ga0265319_10031921 269
98 3300028573 Ga0265334_10079001 Ga0265334_100790012 269
99 3300028577 Ga0265318_10003754 Ga0265318_100037547 269
100 3300028654 Ga0265322_10027343 Ga0265322_100273431 269
101 3300028800 Ga0265338_10014556 Ga0265338_100145561 269
102 3300031235 Ga0265330_10151185 Ga0265330_101511851 269
103 3300031240 Ga0265320_10007161 Ga0265320_100071615 269
104 3300031241 Ga0265325_10005433 Ga0265325_100054335 269
105 3300031247 Ga0265340_10061620 Ga0265340_100616202 269
106 3300031249 Ga0265339_10026079 Ga0265339_100260792 269
107 3300031344 Ga0265316_10011381 Ga0265316_1001138110 269
108 3300031711 Ga0265314_10018847 Ga0265314_100188474 269
109 3300031712 Ga0265342_10005444 Ga0265342_100054445 269
110 3300032126 Ga0307415_100138683 Ga0307415_1001386832 269
111 3300042013 Ga0439456_024456 Ga0439456_024456_90_971 269
112 3300050507 nmdc:mga05p37_108574_c1 nmdc:mga05p37_108574_c1_1357_2238 269
113 3300005434 Ga0070709_10069679 Ga0070709_100696792 270
114 3300005435 Ga0070714_100013212 Ga0070714_1000132122 270
115 3300006173 Ga0070716_100123972 Ga0070716_1001239722 270
116 3300009147 Ga0114129_10374721 Ga0114129_103747212 270
117 3300028558 Ga0265326_10051843 Ga0265326_100518431 270
118 3300028563 Ga0265319_1051171 Ga0265319_10511712 270
119 3300028573 Ga0265334_10006423 Ga0265334_100064234 270
120 3300028577 Ga0265318_10000315 Ga0265318_100003152 270
121 3300028654 Ga0265322_10025979 Ga0265322_100259792 270
122 3300028800 Ga0265338_10065694 Ga0265338_100656942 270
123 3300031238 Ga0265332_10006779 Ga0265332_100067791 270
124 3300031239 Ga0265328_10003597 Ga0265328_100035975 270
125 3300031240 Ga0265320_10057555 Ga0265320_100575552 270
126 3300031241 Ga0265325_10000170 Ga0265325_100001702 270
127 3300031242 Ga0265329_10020907 Ga0265329_100209071 270
128 3300031247 Ga0265340_10075987 Ga0265340_100759872 270
129 3300031249 Ga0265339_10030019 Ga0265339_100300192 270
130 3300031250 Ga0265331_10001277 Ga0265331_1000127713 270
131 3300031251 Ga0265327_10039105 Ga0265327_100391052 270
132 3300031344 Ga0265316_10009416 Ga0265316_100094161 270
133 3300031712 Ga0265342_10006088 Ga0265342_100060881 270
134 3300046517 Ga0495630_0009799 Ga0495630_0009799_3316_4224 270
135 3300046535 Ga0495586_0020074 Ga0495586_0020074_2461_3369 270
136 3300046642 Ga0495634_0031612 Ga0495634_0031612_970_1878 270
137 3300046683 Ga0495658_0015566 Ga0495658_0015566_1182_2090 270
138 3300046689 Ga0495613_0110740 Ga0495613_0110740_886_1794 270
139 3300047319 Ga0495674_0032285 Ga0495674_0032285_3256_4164 270
140 3300048906 Ga0496103_0005447 Ga0496103_0005447_362_1210 272
141 3300048913 Ga0496110_0011943 Ga0496110_0011943_6273_7121 272
142 3300049581 Ga0501047_0247748 Ga0501047_0247748_300_1193 272
143 3300049586 Ga0501070_0206354 Ga0501070_0206354_254_1147 272
144 3300049588 Ga0501072_0002912 Ga0501072_0002912_2447_3340 272
145 3300049590 Ga0501074_0146850 Ga0501074_0146850_380_1273 272
146 3300049741 Ga0501079_0078856 Ga0501079_0078856_423_1316 272
147 3300049742 Ga0501080_0017611 Ga0501080_0017611_1885_2778 272
148 3300049744 Ga0501083_0001129 Ga0501083_0001129_588_1481 272
149 3300005327 Ga0070658_10112980 Ga0070658_101129802 273
150 3300025909 Ga0207705_10105746 Ga0207705_101057462 273
151 3300031995 Ga0307409_100138894 Ga0307409_1001388942 273
152 3300032002 Ga0307416_100045473 Ga0307416_1000454732 273
153 3300032005 Ga0307411_10432514 Ga0307411_104325142 273
154 3300032126 Ga0307415_100001487 Ga0307415_1000014878 273
155 3300037312 Ga0395899_0025933 Ga0395899_0025933_3030_3917 273
156 3300037418 Ga0395900_0033157 Ga0395900_0033157_3282_4124 273
157 3300037418 Ga0395900_0080687 Ga0395900_0080687_1463_2350 273
158 3300037466 Ga0395898_0007704 Ga0395898_0007704_2297_3184 273
159 3300037466 Ga0395898_0316661 Ga0395898_0316661_12_854 273
160 3300037471 Ga0395905_0006381 Ga0395905_0006381_9449_10291 273
161 3300037471 Ga0395905_0023180 Ga0395905_0023180_1463_2350 273
162 3300038443 Ga0395901_0058774 Ga0395901_0058774_1852_2694 273
163 3300038443 Ga0395901_0126537 Ga0395901_0126537_47_934 273
164 3300049575 Ga0501039_0421906 Ga0501039_0421906_171_1001 273
165 3300049593 Ga0501077_0146994 Ga0501077_0146994_620_1450 273
166 3300005327 Ga0070658_10003082 Ga0070658_1000308210 274
167 3300005435 Ga0070714_100435120 Ga0070714_1004351201 274
168 3300005563 Ga0068855_100085831 Ga0068855_1000858313 274
169 3300005614 Ga0068856_100210424 Ga0068856_1002104242 274
170 3300006175 Ga0070712_100079294 Ga0070712_1000792942 274
171 3300009093 Ga0105240_10186695 Ga0105240_101866952 274
172 3300013100 Ga0157373_10121168 Ga0157373_101211681 274
173 3300013104 Ga0157370_10064257 Ga0157370_100642572 274
174 3300013104 Ga0157370_10118798 Ga0157370_101187982 274
175 3300013105 Ga0157369_10088380 Ga0157369_100883803 274
176 3300020069 Ga0197907_11090182 Ga0197907_110901822 274
177 3300020070 Ga0206356_10497752 Ga0206356_104977521 274
178 3300020082 Ga0206353_10670244 Ga0206353_106702442 274
179 3300025909 Ga0207705_10157899 Ga0207705_101578992 274
180 3300025915 Ga0207693_10276878 Ga0207693_102768782 274
181 3300025919 Ga0207657_10013989 Ga0207657_100139895 274
182 3300025924 Ga0207694_10368117 Ga0207694_103681171 274
183 3300037466 Ga0395898_0053081 Ga0395898_0053081_407_1303 274
184 3300037471 Ga0395905_0018237 Ga0395905_0018237_5205_6101 274
185 3300038443 Ga0395901_0018217 Ga0395901_0018217_6130_7026 274
186 3300048915 Ga0496112_0239766 Ga0496112_0239766_218_1114 274
187 3300005327 Ga0070658_10007291 Ga0070658_100072917 275
188 3300005337 Ga0070682_100134503 Ga0070682_1001345032 275
189 3300025909 Ga0207705_10034013 Ga0207705_100340133 275
190 3300025949 Ga0207667_10157764 Ga0207667_101577641 275
191 3300031240 Ga0265320_10016743 Ga0265320_100167432 275
192 3300031249 Ga0265339_10031373 Ga0265339_100313732 275
193 3300031711 Ga0265314_10020861 Ga0265314_100208613 275
194 3300031712 Ga0265342_10055751 Ga0265342_100557512 275
195 3300032002 Ga0307416_100122315 Ga0307416_1001223153 275
196 3300042146 Ga0450907_015470 Ga0450907_015470_338_1237 275
197 3300046536 Ga0495587_0116283 Ga0495587_0116283_248_1138 275
198 3300046559 Ga0495667_0033428 Ga0495667_0033428_1327_2217 275
199 3300046679 Ga0495623_0082329 Ga0495623_0082329_866_1756 275
200 3300048088 Ga0495602_0062805 Ga0495602_0062805_243_1133 275
201 3300005435 Ga0070714_100014958 Ga0070714_1000149583 276
202 3300005436 Ga0070713_100043209 Ga0070713_1000432093 276
203 3300005467 Ga0070706_100179072 Ga0070706_1001790721 276
204 3300005616 Ga0068852_100462689 Ga0068852_1004626891 276
205 3300006028 Ga0070717_10001757 Ga0070717_1000175714 276
206 3300009094 Ga0111539_10123999 Ga0111539_101239992 276
207 3300013100 Ga0157373_10179650 Ga0157373_101796502 276
208 3300025922 Ga0207646_10112691 Ga0207646_101126911 276
209 3300025928 Ga0207700_10074122 Ga0207700_100741222 276
210 3300025929 Ga0207664_10003758 Ga0207664_100037588 276
211 3300026142 Ga0207698_10735967 Ga0207698_107359671 276
212 3300037312 Ga0395899_0061735 Ga0395899_0061735_1377_2270 276
213 3300037471 Ga0395905_0221312 Ga0395905_0221312_744_1637 276
214 3300038443 Ga0395901_0145677 Ga0395901_0145677_216_1109 276
215 3300050511 nmdc:mga08y16_112699_c1 nmdc:mga08y16_112699_c1_163_1050 276
216 3300053085 Ga0495619_0186611 Ga0495619_0186611_192_1064 276
217 3300005471 Ga0070698_100042244 Ga0070698_1000422442 277
218 3300005983 Ga0081540_1017483 Ga0081540_10174833 277
219 3300006058 Ga0075432_10011481 Ga0075432_100114812 277
220 3300006844 Ga0075428_100030779 Ga0075428_1000307793 277
221 3300006847 Ga0075431_100102635 Ga0075431_1001026353 277
222 3300006852 Ga0075433_10021680 Ga0075433_100216803 277
223 3300006871 Ga0075434_100099755 Ga0075434_1000997553 277
224 3300006914 Ga0075436_100006811 Ga0075436_1000068115 277
225 3300009094 Ga0111539_10029561 Ga0111539_100295612 277
226 3300009147 Ga0114129_10017054 Ga0114129_100170546 277
227 3300027907 Ga0207428_10012037 Ga0207428_100120377 277
228 3300031995 Ga0307409_100044618 Ga0307409_1000446183 277
229 3300037312 Ga0395899_0004010 Ga0395899_0004010_9318_10208 277
230 3300037418 Ga0395900_0003593 Ga0395900_0003593_9111_10001 277
231 3300037466 Ga0395898_0001134 Ga0395898_0001134_33486_34376 277
232 3300037471 Ga0395905_0002236 Ga0395905_0002236_8167_9057 277
233 3300038443 Ga0395901_0040926 Ga0395901_0040926_781_1671 277
234 3300050507 nmdc:mga05p37_24422_c1 nmdc:mga05p37_24422_c1_6312_7199 277
235 3300050510 nmdc:mga06r32_110320_c1 nmdc:mga06r32_110320_c1_1287_2174 277
236 3300050511 nmdc:mga08y16_159191_c1 nmdc:mga08y16_159191_c1_368_1255 277
237 3300050513 nmdc:mga0rr50_215803_c1 nmdc:mga0rr50_215803_c1_430_1317 277
238 3300050514 nmdc:mga08x19_123982_c1 nmdc:mga08x19_123982_c1_607_1494 277
239 3300053078 Ga0495612_0074261 Ga0495612_0074261_533_1384 277
240 3300005471 Ga0070698_100185561 Ga0070698_1001855612 278
241 3300025929 Ga0207664_10102183 Ga0207664_101021834 278
242 3300031241 Ga0265325_10033619 Ga0265325_100336192 278
243 3300031250 Ga0265331_10123830 Ga0265331_101238302 278
244 3300031595 Ga0265313_10014891 Ga0265313_100148913 278
245 3300039450 Ga0436363_0255584 Ga0436363_0255584_20_910 278
246 3300044706 Ga0466964_0025736 Ga0466964_0025736_547_1440 278
247 3300045976 Ga0466967_0008229 Ga0466967_0008229_6632_7525 278
248 3300028573 Ga0265334_10062399 Ga0265334_100623992 279
249 3300005445 Ga0070708_100078706 Ga0070708_1000787063 280
250 3300005467 Ga0070706_100019076 Ga0070706_1000190762 280
251 3300005468 Ga0070707_100024924 Ga0070707_1000249242 280
252 3300005468 Ga0070707_100072210 Ga0070707_1000722104 280
253 3300005468 Ga0070707_100271698 Ga0070707_1002716982 280
254 3300005471 Ga0070698_100468510 Ga0070698_1004685101 280
255 3300005518 Ga0070699_100034351 Ga0070699_1000343513 280
256 3300014745 Ga0157377_10029358 Ga0157377_100293582 280
257 3300025910 Ga0207684_10008644 Ga0207684_100086445 280
258 3300025916 Ga0207663_10260222 Ga0207663_102602222 280
259 3300025922 Ga0207646_10013769 Ga0207646_100137695 280
260 3300025922 Ga0207646_10237744 Ga0207646_102377442 280
261 3300045049 Ga0466959_0082665 Ga0466959_0082665_80_973 280
262 3300005327 Ga0070658_10086715 Ga0070658_100867152 281
263 3300005329 Ga0070683_100111524 Ga0070683_1001115242 281
264 3300005336 Ga0070680_100026140 Ga0070680_1000261405 281
265 3300005337 Ga0070682_100199876 Ga0070682_1001998761 281
266 3300005339 Ga0070660_100049573 Ga0070660_1000495731 281
267 3300005339 Ga0070660_100069829 Ga0070660_1000698292 281
268 3300005344 Ga0070661_100164052 Ga0070661_1001640522 281
269 3300005366 Ga0070659_100013732 Ga0070659_1000137325 281
270 3300005366 Ga0070659_100067593 Ga0070659_1000675932 281
271 3300005458 Ga0070681_10018844 Ga0070681_100188442 281
272 3300005458 Ga0070681_10121004 Ga0070681_101210042 281
273 3300005458 Ga0070681_10299753 Ga0070681_102997532 281
274 3300005530 Ga0070679_100084278 Ga0070679_1000842782 281
275 3300013100 Ga0157373_10082421 Ga0157373_100824212 281
276 3300014497 Ga0182008_10003241 Ga0182008_100032419 281
277 3300014497 Ga0182008_10053879 Ga0182008_100538792 281
278 3300015261 Ga0182006_1020518 Ga0182006_10205182 281
279 3300020070 Ga0206356_10423288 Ga0206356_104232882 281
280 3300020082 Ga0206353_11481888 Ga0206353_114818885 281
281 3300025912 Ga0207707_10204089 Ga0207707_102040891 281
282 3300025912 Ga0207707_10457140 Ga0207707_104571401 281
283 3300025917 Ga0207660_10066539 Ga0207660_100665392 281
284 3300025919 Ga0207657_10003276 Ga0207657_1000327613 281
285 3300025919 Ga0207657_10013935 Ga0207657_100139353 281
286 3300025921 Ga0207652_10085686 Ga0207652_100856863 281
287 3300025921 Ga0207652_10339305 Ga0207652_103393052 281
288 3300025932 Ga0207690_10053416 Ga0207690_100534162 281
289 3300025944 Ga0207661_10080393 Ga0207661_100803932 281
290 3300025949 Ga0207667_10618635 Ga0207667_106186351 281
291 3300026041 Ga0207639_10415883 Ga0207639_104158832 281
292 3300035692 Ga0373935_0201190 Ga0373935_0201190_250_1146 281
293 3300037418 Ga0395900_0589635 Ga0395900_0589635_146_1042 281
294 3300044901 Ga0466960_0040342 Ga0466960_0040342_575_1465 281
295 3300044901 Ga0466960_0143022 Ga0466960_0143022_308_1204 281
296 3300046463 Ga0495653_0017311 Ga0495653_0017311_4657_5550 281
297 3300046559 Ga0495667_0081995 Ga0495667_0081995_932_1825 281
298 3300048909 Ga0496106_0016966 Ga0496106_0016966_4230_5123 281
299 3300048910 Ga0496107_0003668 Ga0496107_0003668_4350_5243 281
300 3300048915 Ga0496112_0003989 Ga0496112_0003989_3572_4465 281
301 3300005329 Ga0070683_100098610 Ga0070683_1000986102 282
302 3300005336 Ga0070680_100038676 Ga0070680_1000386762 282
303 3300005456 Ga0070678_100507236 Ga0070678_1005072361 282
304 3300005458 Ga0070681_10053300 Ga0070681_100533002 282
305 3300005530 Ga0070679_100395319 Ga0070679_1003953191 282
306 3300005535 Ga0070684_100038193 Ga0070684_1000381934 282
307 3300005535 Ga0070684_100108789 Ga0070684_1001087892 282
308 3300020082 Ga0206353_11330602 Ga0206353_113306022 282
309 3300025912 Ga0207707_10029476 Ga0207707_100294763 282
310 3300025917 Ga0207660_10274374 Ga0207660_102743742 282
311 3300025929 Ga0207664_10130266 Ga0207664_101302662 282
312 3300025944 Ga0207661_10019465 Ga0207661_100194655 282
313 3300035083 Ga0373926_0004191 Ga0373926_0004191_3104_4000 282
314 3300035116 Ga0373945_0012531 Ga0373945_0012531_1603_2499 282
315 3300035170 Ga0373943_0000485 Ga0373943_0000485_11832_12728 282
316 3300035171 Ga0373946_0014141 Ga0373946_0014141_949_1845 282
317 3300035692 Ga0373935_0176799 Ga0373935_0176799_99_995 282
318 3300035725 Ga0373947_0002997 Ga0373947_0002997_3751_4647 282
319 3300037068 Ga0373925_0009978 Ga0373925_0009978_4283_5179 282
320 3300044694 Ga0466963_0001715 Ga0466963_0001715_9118_10011 282
321 3300044694 Ga0466963_0007445 Ga0466963_0007445_5434_6327 282
322 3300044694 Ga0466963_0012911 Ga0466963_0012911_686_1579 282
323 3300044706 Ga0466964_0027129 Ga0466964_0027129_1315_2208 282
324 3300044842 Ga0466957_0227357 Ga0466957_0227357_86_979 282
325 3300045836 Ga0466958_0021267 Ga0466958_0021267_1917_2810 282
326 3300045836 Ga0466958_0077428 Ga0466958_0077428_1046_1939 282
327 3300045976 Ga0466967_0012380 Ga0466967_0012380_2612_3505 282
328 3300045976 Ga0466967_0026636 Ga0466967_0026636_1209_2102 282
329 3300045976 Ga0466967_0027483 Ga0466967_0027483_1062_1955 282
330 3300045976 Ga0466967_0035678 Ga0466967_0035678_2127_3020 282
331 3300045976 Ga0466967_0101661 Ga0466967_0101661_986_1879 282
332 3300045976 Ga0466967_0126011 Ga0466967_0126011_1341_2234 282
333 3300046459 Ga0495629_0017474 Ga0495629_0017474_3410_4306 282
334 3300046461 Ga0495641_0008094 Ga0495641_0008094_1212_2108 282
335 3300046463 Ga0495653_0069725 Ga0495653_0069725_1090_1986 282
336 3300046472 Ga0495580_0037730 Ga0495580_0037730_1288_2184 282
337 3300046473 Ga0495582_0000560 Ga0495582_0000560_8858_9754 282
338 3300046475 Ga0495639_0000517 Ga0495639_0000517_11807_12703 282
339 3300046476 Ga0495662_0028122 Ga0495662_0028122_897_1793 282
340 3300046517 Ga0495630_0001418 Ga0495630_0001418_11615_12511 282
341 3300046526 Ga0495666_0000186 Ga0495666_0000186_13936_14832 282
342 3300046529 Ga0495652_0043635 Ga0495652_0043635_229_1125 282
343 3300046531 Ga0495665_0035777 Ga0495665_0035777_834_1730 282
344 3300046533 Ga0495640_0028051 Ga0495640_0028051_2326_3222 282
345 3300046559 Ga0495667_0129403 Ga0495667_0129403_674_1570 282
346 3300046642 Ga0495634_0033819 Ga0495634_0033819_339_1235 282
347 3300046681 Ga0495647_0000811 Ga0495647_0000811_2439_3335 282
348 3300046683 Ga0495658_0001241 Ga0495658_0001241_8095_8991 282
349 3300046689 Ga0495613_0017903 Ga0495613_0017903_649_1545 282
350 3300046690 Ga0495624_0008189 Ga0495624_0008189_639_1535 282
351 3300047315 Ga0495581_0003648 Ga0495581_0003648_1212_2108 282
352 3300047321 Ga0495676_0134668 Ga0495676_0134668_639_1535 282
353 3300047322 Ga0495680_0018302 Ga0495680_0018302_29_925 282
354 3300047673 Ga0495593_0000358 Ga0495593_0000358_6633_7529 282
355 3300048913 Ga0496110_0372610 Ga0496110_0372610_173_1060 282
356 3300048915 Ga0496112_0090149 Ga0496112_0090149_1541_2434 282
357 3300061719 Ga0466962_0035560 Ga0466962_0035560_1005_1898 282
358 3300020081 Ga0206354_10463591 Ga0206354_104635912 283
359 3300020082 Ga0206353_10028453 Ga0206353_100284539 283
360 3300025912 Ga0207707_10035228 Ga0207707_100352283 283
361 3300025944 Ga0207661_10038781 Ga0207661_100387811 283
362 3300044694 Ga0466963_0063714 Ga0466963_0063714_1260_2153 283
363 3300045976 Ga0466967_0017082 Ga0466967_0017082_4557_5450 283
364 3300005435 Ga0070714_100024655 Ga0070714_1000246552 284
365 3300005436 Ga0070713_100067966 Ga0070713_1000679662 284
366 3300005437 Ga0070710_10071628 Ga0070710_100716282 284
367 3300005439 Ga0070711_100243066 Ga0070711_1002430662 284
368 3300005455 Ga0070663_100095759 Ga0070663_1000957592 284
369 3300005456 Ga0070678_100189116 Ga0070678_1001891162 284
370 3300005546 Ga0070696_100023241 Ga0070696_1000232413 284
371 3300005547 Ga0070693_100002395 Ga0070693_1000023954 284
372 3300005614 Ga0068856_100312703 Ga0068856_1003127032 284
373 3300006028 Ga0070717_10138621 Ga0070717_101386212 284
374 3300006173 Ga0070716_100001535 Ga0070716_1000015353 284
375 3300006175 Ga0070712_100234681 Ga0070712_1002346812 284
376 3300006237 Ga0097621_100018984 Ga0097621_1000189843 284
377 3300006358 Ga0068871_100157329 Ga0068871_1001573292 284
378 3300007076 Ga0075435_100530932 Ga0075435_1005309321 284
379 3300009174 Ga0105241_10074742 Ga0105241_100747422 284
380 3300014969 Ga0157376_10055099 Ga0157376_100550992 284
381 3300025898 Ga0207692_10044508 Ga0207692_100445082 284
382 3300025905 Ga0207685_10045598 Ga0207685_100455982 284
383 3300025906 Ga0207699_10047467 Ga0207699_100474672 284
384 3300025906 Ga0207699_10135583 Ga0207699_101355831 284
385 3300025915 Ga0207693_10066768 Ga0207693_100667682 284
386 3300025915 Ga0207693_10168483 Ga0207693_101684832 284
387 3300025916 Ga0207663_10015092 Ga0207663_100150922 284
388 3300025928 Ga0207700_10170157 Ga0207700_101701572 284
389 3300025929 Ga0207664_10038872 Ga0207664_100388723 284
390 3300025939 Ga0207665_10000494 Ga0207665_100004943 284
391 3300026067 Ga0207678_10080789 Ga0207678_100807893 284
392 3300026121 Ga0207683_10000425 Ga0207683_100004252 284
393 3300034819 Ga0373958_0003682 Ga0373958_0003682_875_1765 284
394 3300035090 Ga0373949_0025914 Ga0373949_0025914_262_1152 284
395 3300035121 Ga0373960_0021080 Ga0373960_0021080_175_1065 284
396 3300035242 Ga0373962_0026692 Ga0373962_0026692_259_1149 284
397 3300035691 Ga0373931_0024091 Ga0373931_0024091_1171_2061 284
398 3300037312 Ga0395899_0011275 Ga0395899_0011275_4964_5857 284
399 3300037418 Ga0395900_0002828 Ga0395900_0002828_4836_5732 284
400 3300037418 Ga0395900_0172585 Ga0395900_0172585_509_1402 284
401 3300037466 Ga0395898_0049785 Ga0395898_0049785_1521_2414 284
402 3300037466 Ga0395898_0072008 Ga0395898_0072008_2390_3286 284
403 3300037471 Ga0395905_0012265 Ga0395905_0012265_3880_4776 284
404 3300037471 Ga0395905_0025136 Ga0395905_0025136_309_1202 284
405 3300038443 Ga0395901_0060585 Ga0395901_0060585_2748_3644 284
406 3300038443 Ga0395901_0133811 Ga0395901_0133811_799_1692 284
407 3300045976 Ga0466967_0098881 Ga0466967_0098881_1575_2471 284
408 3300048906 Ga0496103_0012699 Ga0496103_0012699_2481_3371 284
409 3300048909 Ga0496106_0160704 Ga0496106_0160704_679_1569 284
410 3300048911 Ga0496108_0128285 Ga0496108_0128285_480_1370 284
411 3300048912 Ga0496109_0279857 Ga0496109_0279857_216_1106 284
412 3300048915 Ga0496112_0342378 Ga0496112_0342378_373_1263 284
413 3300048916 Ga0496113_0041307 Ga0496113_0041307_425_1315 284
414 3300048918 Ga0496115_0024979 Ga0496115_0024979_2120_3010 284
415 3300050512 nmdc:mga0n895_168363_c1 nmdc:mga0n895_168363_c1_19_912 284
416 3300050513 nmdc:mga0rr50_133887_c1 nmdc:mga0rr50_133887_c1_172_1065 284
417 3300005539 Ga0068853_100040622 Ga0068853_1000406222 285
418 3300005578 Ga0068854_100015581 Ga0068854_1000155812 285
419 3300005614 Ga0068856_100076345 Ga0068856_1000763452 285
420 3300005981 Ga0081538_10101850 Ga0081538_101018501 285
421 3300009093 Ga0105240_10065989 Ga0105240_100659893 285
422 3300009174 Ga0105241_10019064 Ga0105241_100190643 285
423 3300010375 Ga0105239_10036040 Ga0105239_100360402 285
424 3300020069 Ga0197907_11177942 Ga0197907_111779421 285
425 3300020078 Ga0206352_10445858 Ga0206352_104458581 285
426 3300022467 Ga0224712_10146589 Ga0224712_101465891 285
427 3300025904 Ga0207647_10002020 Ga0207647_1000202011 285
428 3300025910 Ga0207684_10274939 Ga0207684_102749392 285
429 3300025911 Ga0207654_10020346 Ga0207654_100203462 285
430 3300025913 Ga0207695_10004382 Ga0207695_1000438214 285
431 3300025914 Ga0207671_10004661 Ga0207671_100046613 285
432 3300025924 Ga0207694_10007484 Ga0207694_100074843 285
433 3300025972 Ga0207668_10043093 Ga0207668_100430931 285
434 3300025981 Ga0207640_10076784 Ga0207640_100767842 285
435 3300026067 Ga0207678_10023982 Ga0207678_100239823 285
436 3300033179 Ga0307507_10102391 Ga0307507_101023912 285
437 3300044693 Ga0466961_0029685 Ga0466961_0029685_2527_3432 285
438 3300044765 Ga0466970_0010391 Ga0466970_0010391_1280_2185 285
439 3300046462 Ga0495651_0075725 Ga0495651_0075725_1596_2504 285
440 3300046462 Ga0495651_0106769 Ga0495651_0106769_1121_2032 285
441 3300046516 Ga0495628_0037003 Ga0495628_0037003_2822_3730 285
442 3300046529 Ga0495652_0019058 Ga0495652_0019058_5156_6064 285
443 3300046543 Ga0495645_0055960 Ga0495645_0055960_649_1557 285
444 3300046809 Ga0495600_0182927 Ga0495600_0182927_88_996 285
445 3300047315 Ga0495581_0099162 Ga0495581_0099162_774_1682 285
446 3300049568 Ga0501031_0008119 Ga0501031_0008119_1013_1888 285
447 3300049570 Ga0501033_0073085 Ga0501033_0073085_1101_1976 285
448 3300049572 Ga0501036_0026468 Ga0501036_0026468_1686_2561 285
449 3300049575 Ga0501039_0025405 Ga0501039_0025405_1387_2262 285
450 3300049576 Ga0501040_0035637 Ga0501040_0035637_289_1164 285
451 3300049577 Ga0501041_0002691 Ga0501041_0002691_161_1036 285
452 3300049578 Ga0501042_0006512 Ga0501042_0006512_1611_2486 285
453 3300049582 Ga0501048_0012008 Ga0501048_0012008_208_1083 285
454 3300049586 Ga0501070_0076082 Ga0501070_0076082_1351_2226 285
455 3300049588 Ga0501072_0008797 Ga0501072_0008797_354_1229 285
456 3300049591 Ga0501075_0011065 Ga0501075_0011065_3776_4651 285
457 3300049592 Ga0501076_0002641 Ga0501076_0002641_5436_6311 285
458 3300049593 Ga0501077_0014568 Ga0501077_0014568_3446_4321 285
459 3300049741 Ga0501079_0107983 Ga0501079_0107983_416_1291 285
460 3300049743 Ga0501081_0024489 Ga0501081_0024489_1571_2446 285
461 3300053077 Ga0495601_0064330 Ga0495601_0064330_1163_2074 285
462 3300053077 Ga0495601_0180865 Ga0495601_0180865_262_1167 285
463 3300053078 Ga0495612_0037473 Ga0495612_0037473_912_1823 285
464 3300053085 Ga0495619_0138371 Ga0495619_0138371_688_1599 285
465 3300054114 Ga0501084_0036663 Ga0501084_0036663_1541_2416 285
466 3300060353 Ga0501082_0037979 Ga0501082_0037979_2263_3138 285
467 3300061734 Ga0530510_0005837 Ga0530510_0005837_2850_3725 285
468 3300005434 Ga0070709_10026418 Ga0070709_100264182 286
469 3300005435 Ga0070714_100050308 Ga0070714_1000503082 286
470 3300005436 Ga0070713_100011866 Ga0070713_1000118666 286
471 3300005437 Ga0070710_10003409 Ga0070710_100034092 286
472 3300005439 Ga0070711_100045049 Ga0070711_1000450493 286
473 3300006028 Ga0070717_10034875 Ga0070717_100348752 286
474 3300006163 Ga0070715_10001705 Ga0070715_100017057 286
475 3300006173 Ga0070716_100000830 Ga0070716_1000008302 286
476 3300006175 Ga0070712_100024636 Ga0070712_1000246362 286
477 3300009101 Ga0105247_10049845 Ga0105247_100498452 286
478 3300044683 Ga0466965_0065176 Ga0466965_0065176_175_1053 286
479 3300046455 Ga0495603_0007259 Ga0495603_0007259_1621_2520 286
480 3300005544 Ga0070686_100164479 Ga0070686_1001644791 287
481 3300005614 Ga0068856_100046531 Ga0068856_1000465316 287
482 3300006028 Ga0070717_10128226 Ga0070717_101282262 287
483 3300025900 Ga0207710_10074222 Ga0207710_100742222 287
484 3300025906 Ga0207699_10037107 Ga0207699_100371072 287
485 3300025915 Ga0207693_10001266 Ga0207693_100012662 287
486 3300025927 Ga0207687_10023728 Ga0207687_100237282 287
487 3300025928 Ga0207700_10030891 Ga0207700_100308912 287
488 3300025929 Ga0207664_10053180 Ga0207664_100531802 287
489 3300025929 Ga0207664_10575544 Ga0207664_105755441 287
490 3300025929 Ga0207664_10591130 Ga0207664_105911301 287
491 3300025939 Ga0207665_10000793 Ga0207665_1000079321 287
492 3300034820 Ga0373959_0010585 Ga0373959_0010585_405_1295 287
493 3300035691 Ga0373931_0063205 Ga0373931_0063205_104_997 287
494 3300037312 Ga0395899_0006507 Ga0395899_0006507_1602_2489 287
495 3300037418 Ga0395900_0006278 Ga0395900_0006278_4269_5156 287
496 3300037466 Ga0395898_0109197 Ga0395898_0109197_889_1776 287
497 3300038443 Ga0395901_0020672 Ga0395901_0020672_877_1764 287
498 3300044656 Ga0466969_0073565 Ga0466969_0073565_336_1229 287
499 3300044842 Ga0466957_0105532 Ga0466957_0105532_283_1176 287
500 3300045976 Ga0466967_0068385 Ga0466967_0068385_1831_2727 287
501 3300048903 Ga0496100_0076117 Ga0496100_0076117_601_1494 287
502 3300048904 Ga0496101_0076125 Ga0496101_0076125_1258_2151 287
503 3300048905 Ga0496102_0148864 Ga0496102_0148864_1067_1960 287
504 3300048907 Ga0496104_0047719 Ga0496104_0047719_2405_3298 287
505 3300048908 Ga0496105_0153980 Ga0496105_0153980_915_1808 287
506 3300048908 Ga0496105_0429524 Ga0496105_0429524_76_969 287
507 3300048909 Ga0496106_0014103 Ga0496106_0014103_3708_4601 287
508 3300048910 Ga0496107_0022333 Ga0496107_0022333_3071_3964 287
509 3300048911 Ga0496108_0024398 Ga0496108_0024398_1180_2073 287
510 3300048911 Ga0496108_0305360 Ga0496108_0305360_289_1182 287
511 3300048912 Ga0496109_0113334 Ga0496109_0113334_385_1278 287
512 3300048912 Ga0496109_0138252 Ga0496109_0138252_685_1578 287
513 3300048913 Ga0496110_0204690 Ga0496110_0204690_411_1304 287
514 3300048914 Ga0496111_0007486 Ga0496111_0007486_3861_4754 287
515 3300048914 Ga0496111_0073513 Ga0496111_0073513_298_1191 287
516 3300048915 Ga0496112_0206812 Ga0496112_0206812_977_1870 287
517 3300048917 Ga0496114_0021288 Ga0496114_0021288_1343_2236 287
518 3300048917 Ga0496114_0067293 Ga0496114_0067293_1239_2132 287
519 3300048918 Ga0496115_0159740 Ga0496115_0159740_700_1593 287
520 3300049583 Ga0501067_0113394 Ga0501067_0113394_389_1282 287
521 3300061734 Ga0530510_0167468 Ga0530510_0167468_663_1556 287
522 3300005336 Ga0070680_100022930 Ga0070680_1000229303 288
523 3300005341 Ga0070691_10068193 Ga0070691_100681931 288
524 3300005458 Ga0070681_10060073 Ga0070681_100600732 288
525 3300005547 Ga0070693_100051817 Ga0070693_1000518172 288
526 3300005578 Ga0068854_100095963 Ga0068854_1000959632 288
527 3300013307 Ga0157372_10417496 Ga0157372_104174962 288
528 3300026121 Ga0207683_10114597 Ga0207683_101145972 288
529 3300037418 Ga0395900_0276367 Ga0395900_0276367_676_1560 288
530 3300038443 Ga0395901_0122764 Ga0395901_0122764_957_1841 288
531 3300005981 Ga0081538_10084936 Ga0081538_100849362 289
532 3300042156 Ga0439446_0049625 Ga0439446_0049625_319_1215 289
533 3300005467 Ga0070706_100482644 Ga0070706_1004826442 290
534 3300005471 Ga0070698_100257731 Ga0070698_1002577311 290
535 3300005518 Ga0070699_100042226 Ga0070699_1000422262 290
536 3300005536 Ga0070697_100163675 Ga0070697_1001636752 290
537 3300005563 Ga0068855_100005058 Ga0068855_1000050584 290
538 3300007076 Ga0075435_100425225 Ga0075435_1004252251 290
539 3300013104 Ga0157370_10014977 Ga0157370_100149777 290
540 3300025944 Ga0207661_10127929 Ga0207661_101279292 290
541 3300035692 Ga0373935_0049449 Ga0373935_0049449_867_1763 290
542 3300035725 Ga0373947_0038498 Ga0373947_0038498_972_1868 290
543 3300042001 Ga0439441_017247 Ga0439441_017247_165_1052 290
544 3300042435 Ga0439434_0075977 Ga0439434_0075977_127_1014 290
545 3300044694 Ga0466963_0033509 Ga0466963_0033509_565_1458 290
546 3300044706 Ga0466964_0024881 Ga0466964_0024881_510_1403 290
547 3300044842 Ga0466957_0321994 Ga0466957_0321994_104_997 290
548 3300045836 Ga0466958_0058286 Ga0466958_0058286_181_1074 290
549 3300046689 Ga0495613_0326211 Ga0495613_0326211_92_985 290
550 3300005468 Ga0070707_100012755 Ga0070707_1000127553 291
551 3300005937 Ga0081455_10010754 Ga0081455_100107545 291
552 3300009177 Ga0105248_10352222 Ga0105248_103522222 291
553 3300025941 Ga0207711_10577988 Ga0207711_105779881 291
554 3300044693 Ga0466961_0203402 Ga0466961_0203402_205_1098 291
555 3300044694 Ga0466963_0056151 Ga0466963_0056151_650_1540 291
556 3300044719 Ga0466971_0003347 Ga0466971_0003347_5581_6471 291
557 3300044719 Ga0466971_0077790 Ga0466971_0077790_409_1302 291
558 3300044735 Ga0466968_0032397 Ga0466968_0032397_948_1841 291
559 3300044765 Ga0466970_0135172 Ga0466970_0135172_290_1183 291
560 3300045049 Ga0466959_0104340 Ga0466959_0104340_1075_1968 291
561 3300045836 Ga0466958_0000655 Ga0466958_0000655_4158_5048 291
562 3300048918 Ga0496115_0415806 Ga0496115_0415806_30_917 291
563 3300049577 Ga0501041_0172052 Ga0501041_0172052_149_1033 291
564 3300049580 Ga0501046_0111991 Ga0501046_0111991_374_1282 291
565 3300049588 Ga0501072_0083649 Ga0501072_0083649_1446_2330 291
566 3300049591 Ga0501075_0258859 Ga0501075_0258859_202_1110 291
567 3300049593 Ga0501077_0001491 Ga0501077_0001491_11723_12631 291
568 3300049743 Ga0501081_0047735 Ga0501081_0047735_1634_2542 291
569 3300060353 Ga0501082_0218065 Ga0501082_0218065_603_1511 291
570 3300061734 Ga0530510_0123401 Ga0530510_0123401_296_1180 291
571 3300005336 Ga0070680_100189518 Ga0070680_1001895182 292
572 3300005366 Ga0070659_100082730 Ga0070659_1000827302 292
573 3300005367 Ga0070667_100513408 Ga0070667_1005134082 292
574 3300005434 Ga0070709_10112469 Ga0070709_101124692 292
575 3300005434 Ga0070709_10138958 Ga0070709_101389582 292
576 3300005434 Ga0070709_10177128 Ga0070709_101771282 292
577 3300005435 Ga0070714_100024816 Ga0070714_1000248165 292
578 3300005435 Ga0070714_100055758 Ga0070714_1000557583 292
579 3300005435 Ga0070714_100088439 Ga0070714_1000884392 292
580 3300005435 Ga0070714_100098020 Ga0070714_1000980202 292
581 3300005436 Ga0070713_100080971 Ga0070713_1000809713 292
582 3300005437 Ga0070710_10020879 Ga0070710_100208792 292
583 3300005437 Ga0070710_10024050 Ga0070710_100240503 292
584 3300005439 Ga0070711_100011594 Ga0070711_1000115942 292
585 3300005439 Ga0070711_100021763 Ga0070711_1000217632 292
586 3300005439 Ga0070711_100282579 Ga0070711_1002825792 292
587 3300005440 Ga0070705_100002740 Ga0070705_1000027405 292
588 3300005441 Ga0070700_100317621 Ga0070700_1003176211 292
589 3300005444 Ga0070694_100047568 Ga0070694_1000475683 292
590 3300005444 Ga0070694_100104451 Ga0070694_1001044512 292
591 3300005445 Ga0070708_100010130 Ga0070708_1000101302 292
592 3300005445 Ga0070708_100317867 Ga0070708_1003178672 292
593 3300005455 Ga0070663_100403726 Ga0070663_1004037261 292
594 3300005458 Ga0070681_10058249 Ga0070681_100582494 292
595 3300005458 Ga0070681_10435258 Ga0070681_104352582 292
596 3300005467 Ga0070706_100240140 Ga0070706_1002401402 292
597 3300005468 Ga0070707_100001067 Ga0070707_1000010672 292
598 3300005468 Ga0070707_100179368 Ga0070707_1001793682 292
599 3300005471 Ga0070698_100127089 Ga0070698_1001270892 292
600 3300005518 Ga0070699_100134460 Ga0070699_1001344602 292
601 3300005530 Ga0070679_100211271 Ga0070679_1002112712 292
602 3300005535 Ga0070684_100051304 Ga0070684_1000513043 292
603 3300005544 Ga0070686_100344612 Ga0070686_1003446121 292
604 3300005545 Ga0070695_100000028 Ga0070695_10000002850 292
605 3300005545 Ga0070695_100059393 Ga0070695_1000593932 292
606 3300005546 Ga0070696_100024291 Ga0070696_1000242912 292
607 3300005547 Ga0070693_100052885 Ga0070693_1000528852 292
608 3300005549 Ga0070704_100030744 Ga0070704_1000307443 292
609 3300005549 Ga0070704_100296520 Ga0070704_1002965202 292
610 3300006028 Ga0070717_10017134 Ga0070717_100171344 292
611 3300006028 Ga0070717_10491595 Ga0070717_104915952 292
612 3300006163 Ga0070715_10003612 Ga0070715_100036122 292
613 3300006173 Ga0070716_100306096 Ga0070716_1003060961 292
614 3300006175 Ga0070712_100004474 Ga0070712_1000044746 292
615 3300006175 Ga0070712_100013288 Ga0070712_1000132883 292
616 3300006175 Ga0070712_100019657 Ga0070712_1000196573 292
617 3300006358 Ga0068871_100227165 Ga0068871_1002271652 292
618 3300006914 Ga0075436_100206907 Ga0075436_1002069071 292
619 3300009093 Ga0105240_10565926 Ga0105240_105659262 292
620 3300009147 Ga0114129_10048955 Ga0114129_100489553 292
621 3300009148 Ga0105243_10113711 Ga0105243_101137112 292
622 3300009174 Ga0105241_10152458 Ga0105241_101524582 292
623 3300009174 Ga0105241_10556005 Ga0105241_105560051 292
624 3300009176 Ga0105242_10058539 Ga0105242_100585393 292
625 3300009551 Ga0105238_10257767 Ga0105238_102577672 292
626 3300010159 Ga0099796_10025949 Ga0099796_100259491 292
627 3300010375 Ga0105239_10240441 Ga0105239_102404412 292
628 3300013105 Ga0157369_10079582 Ga0157369_100795822 292
629 3300013296 Ga0157374_10060145 Ga0157374_100601454 292
630 3300013306 Ga0163162_10440117 Ga0163162_104401171 292
631 3300013307 Ga0157372_10066175 Ga0157372_100661752 292
632 3300013307 Ga0157372_10306046 Ga0157372_103060462 292
633 3300014969 Ga0157376_10078082 Ga0157376_100780822 292
634 3300021441 Ga0213871_10026056 Ga0213871_100260562 292
635 3300025885 Ga0207653_10011312 Ga0207653_100113122 292
636 3300025898 Ga0207692_10023153 Ga0207692_100231532 292
637 3300025906 Ga0207699_10091303 Ga0207699_100913032 292
638 3300025906 Ga0207699_10114712 Ga0207699_101147122 292
639 3300025910 Ga0207684_10133559 Ga0207684_101335592 292
640 3300025911 Ga0207654_10179479 Ga0207654_101794792 292
641 3300025912 Ga0207707_10108051 Ga0207707_101080512 292
642 3300025914 Ga0207671_10224856 Ga0207671_102248562 292
643 3300025915 Ga0207693_10000126 Ga0207693_1000012617 292
644 3300025915 Ga0207693_10000586 Ga0207693_1000058618 292
645 3300025915 Ga0207693_10004553 Ga0207693_100045538 292
646 3300025916 Ga0207663_10047454 Ga0207663_100474542 292
647 3300025916 Ga0207663_10094468 Ga0207663_100944682 292
648 3300025916 Ga0207663_10333105 Ga0207663_103331052 292
649 3300025921 Ga0207652_10056227 Ga0207652_100562272 292
650 3300025922 Ga0207646_10007593 Ga0207646_100075934 292
651 3300025924 Ga0207694_10578222 Ga0207694_105782221 292
652 3300025928 Ga0207700_10307581 Ga0207700_103075812 292
653 3300025929 Ga0207664_10007986 Ga0207664_100079868 292
654 3300025929 Ga0207664_10024595 Ga0207664_100245954 292
655 3300025929 Ga0207664_10039781 Ga0207664_100397813 292
656 3300025929 Ga0207664_10144588 Ga0207664_101445882 292
657 3300025929 Ga0207664_10152646 Ga0207664_101526461 292
658 3300025935 Ga0207709_10067404 Ga0207709_100674042 292
659 3300025939 Ga0207665_10022156 Ga0207665_100221561 292
660 3300025939 Ga0207665_10112145 Ga0207665_101121452 292
661 3300026121 Ga0207683_10003390 Ga0207683_100033909 292
662 3300028556 Ga0265337_1025049 Ga0265337_10250491 292
663 3300028666 Ga0265336_10003988 Ga0265336_100039883 292
664 3300028666 Ga0265336_10028972 Ga0265336_100289721 292
665 3300028800 Ga0265338_10003714 Ga0265338_1000371414 292
666 3300028800 Ga0265338_10025017 Ga0265338_100250173 292
667 3300031249 Ga0265339_10001965 Ga0265339_1000196512 292
668 3300031251 Ga0265327_10112388 Ga0265327_101123881 292
669 3300031344 Ga0265316_10006316 Ga0265316_100063162 292
670 3300031595 Ga0265313_10004551 Ga0265313_100045515 292
671 3300031595 Ga0265313_10030777 Ga0265313_100307772 292
672 3300031711 Ga0265314_10002877 Ga0265314_1000287712 292
673 3300031712 Ga0265342_10043074 Ga0265342_100430742 292
674 3300034817 Ga0373948_0009199 Ga0373948_0009199_234_1136 292
675 3300034818 Ga0373950_0004352 Ga0373950_0004352_916_1818 292
676 3300034819 Ga0373958_0008772 Ga0373958_0008772_242_1144 292
677 3300035085 Ga0373929_0004041 Ga0373929_0004041_1421_2323 292
678 3300035088 Ga0373940_0010255 Ga0373940_0010255_212_1114 292
679 3300035090 Ga0373949_0004829 Ga0373949_0004829_1739_2641 292
680 3300035091 Ga0373951_0006426 Ga0373951_0006426_1509_2411 292
681 3300035115 Ga0373941_0014138 Ga0373941_0014138_525_1427 292
682 3300035119 Ga0373956_0098723 Ga0373956_0098723_203_1099 292
683 3300035121 Ga0373960_0022792 Ga0373960_0022792_635_1537 292
684 3300035207 Ga0373942_0009194 Ga0373942_0009194_421_1323 292
685 3300035242 Ga0373962_0015267 Ga0373962_0015267_306_1208 292
686 3300035691 Ga0373931_0055222 Ga0373931_0055222_85_987 292
687 3300035724 Ga0373933_0075786 Ga0373933_0075786_1016_1912 292
688 3300036401 Ga0373937_0003925 Ga0373937_0003925_3682_4578 292
689 3300037312 Ga0395899_0006761 Ga0395899_0006761_7538_8431 292
690 3300037312 Ga0395899_0036950 Ga0395899_0036950_1130_2023 292
691 3300037418 Ga0395900_0061528 Ga0395900_0061528_1880_2773 292
692 3300037418 Ga0395900_0192711 Ga0395900_0192711_451_1344 292
693 3300037466 Ga0395898_0005553 Ga0395898_0005553_4327_5220 292
694 3300037466 Ga0395898_0027207 Ga0395898_0027207_3178_4065 292
695 3300037466 Ga0395898_0158144 Ga0395898_0158144_995_1888 292
696 3300037471 Ga0395905_0010133 Ga0395905_0010133_7631_8524 292
697 3300037471 Ga0395905_0056536 Ga0395905_0056536_1872_2759 292
698 3300037471 Ga0395905_0364826 Ga0395905_0364826_29_922 292
699 3300038443 Ga0395901_0136438 Ga0395901_0136438_876_1769 292
700 3300039438 Ga0436360_0881869 Ga0436360_0881869_4667_5566 292
701 3300044656 Ga0466969_0000749 Ga0466969_0000749_6986_7882 292
702 3300044656 Ga0466969_0007379 Ga0466969_0007379_1560_2453 292
703 3300044683 Ga0466965_0013039 Ga0466965_0013039_2932_3828 292
704 3300044683 Ga0466965_0138536 Ga0466965_0138536_163_1059 292
705 3300044684 Ga0466966_0039970 Ga0466966_0039970_1033_1929 292
706 3300044684 Ga0466966_0103162 Ga0466966_0103162_698_1591 292
707 3300044693 Ga0466961_0000560 Ga0466961_0000560_22635_23531 292
708 3300044693 Ga0466961_0014772 Ga0466961_0014772_2384_3280 292
709 3300044693 Ga0466961_0076948 Ga0466961_0076948_1075_1971 292
710 3300044693 Ga0466961_0097789 Ga0466961_0097789_745_1638 292
711 3300044694 Ga0466963_0000355 Ga0466963_0000355_11403_12299 292
712 3300044694 Ga0466963_0001329 Ga0466963_0001329_2490_3386 292
713 3300044694 Ga0466963_0005352 Ga0466963_0005352_6197_7093 292
714 3300044694 Ga0466963_0012463 Ga0466963_0012463_1141_2037 292
715 3300044694 Ga0466963_0012733 Ga0466963_0012733_1275_2171 292
716 3300044694 Ga0466963_0013492 Ga0466963_0013492_2856_3752 292
717 3300044694 Ga0466963_0038888 Ga0466963_0038888_600_1496 292
718 3300044694 Ga0466963_0049915 Ga0466963_0049915_75_974 292
719 3300044694 Ga0466963_0055778 Ga0466963_0055778_231_1124 292
720 3300044694 Ga0466963_0059013 Ga0466963_0059013_1204_2100 292
721 3300044694 Ga0466963_0078684 Ga0466963_0078684_1057_1953 292
722 3300044694 Ga0466963_0095686 Ga0466963_0095686_604_1500 292
723 3300044694 Ga0466963_0292901 Ga0466963_0292901_69_965 292
724 3300044706 Ga0466964_0000982 Ga0466964_0000982_7956_8852 292
725 3300044706 Ga0466964_0024366 Ga0466964_0024366_1021_1917 292
726 3300044706 Ga0466964_0037728 Ga0466964_0037728_451_1347 292
727 3300044706 Ga0466964_0042827 Ga0466964_0042827_838_1734 292
728 3300044719 Ga0466971_0005127 Ga0466971_0005127_1751_2647 292
729 3300044719 Ga0466971_0007091 Ga0466971_0007091_2937_3833 292
730 3300044719 Ga0466971_0007850 Ga0466971_0007850_1987_2880 292
731 3300044719 Ga0466971_0017867 Ga0466971_0017867_1540_2433 292
732 3300044735 Ga0466968_0000662 Ga0466968_0000662_3583_4479 292
733 3300044735 Ga0466968_0005087 Ga0466968_0005087_1507_2403 292
734 3300044765 Ga0466970_0006693 Ga0466970_0006693_4428_5324 292
735 3300044842 Ga0466957_0004105 Ga0466957_0004105_1105_2001 292
736 3300044842 Ga0466957_0021190 Ga0466957_0021190_1268_2164 292
737 3300044842 Ga0466957_0027919 Ga0466957_0027919_1947_2843 292
738 3300044842 Ga0466957_0032093 Ga0466957_0032093_2133_3029 292
739 3300044842 Ga0466957_0112142 Ga0466957_0112142_748_1641 292
740 3300044901 Ga0466960_0012397 Ga0466960_0012397_1151_2047 292
741 3300045049 Ga0466959_0001794 Ga0466959_0001794_4927_5823 292
742 3300045049 Ga0466959_0005411 Ga0466959_0005411_4889_5785 292
743 3300045049 Ga0466959_0019863 Ga0466959_0019863_3838_4731 292
744 3300045049 Ga0466959_0033367 Ga0466959_0033367_2806_3702 292
745 3300045836 Ga0466958_0001851 Ga0466958_0001851_6485_7381 292
746 3300045836 Ga0466958_0007203 Ga0466958_0007203_3096_3992 292
747 3300045836 Ga0466958_0007899 Ga0466958_0007899_3459_4352 292
748 3300045836 Ga0466958_0014393 Ga0466958_0014393_787_1683 292
749 3300045836 Ga0466958_0014823 Ga0466958_0014823_290_1186 292
750 3300045836 Ga0466958_0019682 Ga0466958_0019682_1302_2198 292
751 3300045836 Ga0466958_0031370 Ga0466958_0031370_425_1321 292
752 3300045836 Ga0466958_0032176 Ga0466958_0032176_115_1011 292
753 3300045836 Ga0466958_0067638 Ga0466958_0067638_470_1366 292
754 3300045976 Ga0466967_0000219 Ga0466967_0000219_4541_5437 292
755 3300045976 Ga0466967_0002872 Ga0466967_0002872_2591_3487 292
756 3300045976 Ga0466967_0003820 Ga0466967_0003820_1961_2857 292
757 3300045976 Ga0466967_0022408 Ga0466967_0022408_338_1234 292
758 3300045976 Ga0466967_0027813 Ga0466967_0027813_2476_3372 292
759 3300045976 Ga0466967_0044675 Ga0466967_0044675_1418_2314 292
760 3300045976 Ga0466967_0081285 Ga0466967_0081285_1756_2652 292
761 3300045976 Ga0466967_0102031 Ga0466967_0102031_836_1729 292
762 3300045976 Ga0466967_0137409 Ga0466967_0137409_564_1463 292
763 3300045976 Ga0466967_0170459 Ga0466967_0170459_367_1266 292
764 3300045976 Ga0466967_0203006 Ga0466967_0203006_145_1041 292
765 3300045976 Ga0466967_0258890 Ga0466967_0258890_134_1030 292
766 3300045976 Ga0466967_0274350 Ga0466967_0274350_40_936 292
767 3300045976 Ga0466967_0383746 Ga0466967_0383746_330_1226 292
768 3300046454 Ga0495592_0001003 Ga0495592_0001003_17516_18412 292
769 3300046454 Ga0495592_0002313 Ga0495592_0002313_6744_7640 292
770 3300046454 Ga0495592_0054383 Ga0495592_0054383_564_1460 292
771 3300046454 Ga0495592_0112200 Ga0495592_0112200_56_949 292
772 3300046459 Ga0495629_0050680 Ga0495629_0050680_187_1083 292
773 3300046459 Ga0495629_0090116 Ga0495629_0090116_1214_2110 292
774 3300046459 Ga0495629_0222685 Ga0495629_0222685_248_1144 292
775 3300046461 Ga0495641_0028643 Ga0495641_0028643_925_1821 292
776 3300046462 Ga0495651_0000038 Ga0495651_0000038_53509_54405 292
777 3300046462 Ga0495651_0054468 Ga0495651_0054468_1547_2443 292
778 3300046463 Ga0495653_0014400 Ga0495653_0014400_1897_2793 292
779 3300046476 Ga0495662_0102568 Ga0495662_0102568_71_967 292
780 3300046477 Ga0495664_0136747 Ga0495664_0136747_285_1181 292
781 3300046501 Ga0495607_0096921 Ga0495607_0096921_379_1272 292
782 3300046511 Ga0495608_0019558 Ga0495608_0019558_2156_3052 292
783 3300046514 Ga0495618_0001861 Ga0495618_0001861_12259_13155 292
784 3300046516 Ga0495628_0000025 Ga0495628_0000025_101191_102087 292
785 3300046516 Ga0495628_0034135 Ga0495628_0034135_2436_3332 292
786 3300046517 Ga0495630_0231149 Ga0495630_0231149_230_1123 292
787 3300046523 Ga0495644_0002988 Ga0495644_0002988_5225_6118 292
788 3300046529 Ga0495652_0000088 Ga0495652_0000088_53529_54425 292
789 3300046529 Ga0495652_0041133 Ga0495652_0041133_1775_2671 292
790 3300046529 Ga0495652_0227150 Ga0495652_0227150_83_976 292
791 3300046533 Ga0495640_0160401 Ga0495640_0160401_257_1153 292
792 3300046536 Ga0495587_0002637 Ga0495587_0002637_4249_5145 292
793 3300046536 Ga0495587_0108668 Ga0495587_0108668_67_963 292
794 3300046543 Ga0495645_0000024 Ga0495645_0000024_53504_54400 292
795 3300046543 Ga0495645_0009655 Ga0495645_0009655_4523_5419 292
796 3300046559 Ga0495667_0002973 Ga0495667_0002973_10226_11122 292
797 3300046559 Ga0495667_0041717 Ga0495667_0041717_754_1650 292
798 3300046615 Ga0495656_0001592 Ga0495656_0001592_597_1490 292
799 3300046642 Ga0495634_0052255 Ga0495634_0052255_1804_2700 292
800 3300046642 Ga0495634_0246242 Ga0495634_0246242_154_1050 292
801 3300046663 Ga0495635_0015180 Ga0495635_0015180_2927_3823 292
802 3300046675 Ga0495657_0022864 Ga0495657_0022864_545_1441 292
803 3300046675 Ga0495657_0038995 Ga0495657_0038995_1195_2091 292
804 3300046675 Ga0495657_0159811 Ga0495657_0159811_330_1223 292
805 3300046678 Ga0495599_0000019 Ga0495599_0000019_39389_40285 292
806 3300046678 Ga0495599_0117614 Ga0495599_0117614_651_1547 292
807 3300046679 Ga0495623_0000032 Ga0495623_0000032_66854_67750 292
808 3300046680 Ga0495646_0087168 Ga0495646_0087168_434_1330 292
809 3300046681 Ga0495647_0021859 Ga0495647_0021859_826_1722 292
810 3300046681 Ga0495647_0022573 Ga0495647_0022573_1268_2164 292
811 3300046683 Ga0495658_0029375 Ga0495658_0029375_204_1100 292
812 3300046794 Ga0495589_0045883 Ga0495589_0045883_803_1696 292
813 3300046809 Ga0495600_0034542 Ga0495600_0034542_2097_2993 292
814 3300046809 Ga0495600_0123192 Ga0495600_0123192_376_1272 292
815 3300046809 Ga0495600_0143721 Ga0495600_0143721_587_1480 292
816 3300047317 Ga0495604_0000128 Ga0495604_0000128_9321_10217 292
817 3300047317 Ga0495604_0086098 Ga0495604_0086098_647_1543 292
818 3300047317 Ga0495604_0183546 Ga0495604_0183546_517_1413 292
819 3300047319 Ga0495674_0065311 Ga0495674_0065311_1817_2713 292
820 3300047319 Ga0495674_0080843 Ga0495674_0080843_16_912 292
821 3300047322 Ga0495680_0018043 Ga0495680_0018043_3612_4508 292
822 3300047322 Ga0495680_0044914 Ga0495680_0044914_435_1331 292
823 3300047322 Ga0495680_0256521 Ga0495680_0256521_255_1148 292
824 3300047444 Ga0495675_0000007 Ga0495675_0000007_108236_109132 292
825 3300047471 Ga0495684_0019114 Ga0495684_0019114_2501_3397 292
826 3300047471 Ga0495684_0029481 Ga0495684_0029481_541_1437 292
827 3300048088 Ga0495602_0000246 Ga0495602_0000246_7121_8017 292
828 3300048088 Ga0495602_0121928 Ga0495602_0121928_1184_2077 292
829 3300048903 Ga0496100_0143962 Ga0496100_0143962_455_1348 292
830 3300048903 Ga0496100_0194042 Ga0496100_0194042_312_1208 292
831 3300048903 Ga0496100_0287729 Ga0496100_0287729_181_1077 292
832 3300048905 Ga0496102_0015928 Ga0496102_0015928_5563_6462 292
833 3300048905 Ga0496102_0300361 Ga0496102_0300361_392_1285 292
834 3300048906 Ga0496103_0031665 Ga0496103_0031665_562_1461 292
835 3300048906 Ga0496103_0043277 Ga0496103_0043277_958_1860 292
836 3300048907 Ga0496104_0002359 Ga0496104_0002359_4106_5002 292
837 3300048907 Ga0496104_0003973 Ga0496104_0003973_9029_9931 292
838 3300048907 Ga0496104_0136424 Ga0496104_0136424_617_1513 292
839 3300048908 Ga0496105_0003530 Ga0496105_0003530_6515_7411 292
840 3300048908 Ga0496105_0018165 Ga0496105_0018165_1059_1961 292
841 3300048908 Ga0496105_0103642 Ga0496105_0103642_396_1292 292
842 3300048908 Ga0496105_0172311 Ga0496105_0172311_562_1455 292
843 3300048909 Ga0496106_0100183 Ga0496106_0100183_1086_1988 292
844 3300048910 Ga0496107_0206775 Ga0496107_0206775_521_1417 292
845 3300048911 Ga0496108_0016705 Ga0496108_0016705_2979_3875 292
846 3300048911 Ga0496108_0018902 Ga0496108_0018902_4197_5090 292
847 3300048912 Ga0496109_0001544 Ga0496109_0001544_5060_5956 292
848 3300048912 Ga0496109_0044409 Ga0496109_0044409_1668_2561 292
849 3300048913 Ga0496110_0090840 Ga0496110_0090840_449_1342 292
850 3300048913 Ga0496110_0156666 Ga0496110_0156666_1085_1987 292
851 3300048914 Ga0496111_0057934 Ga0496111_0057934_1676_2572 292
852 3300048914 Ga0496111_0120089 Ga0496111_0120089_835_1737 292
853 3300048914 Ga0496111_0241902 Ga0496111_0241902_281_1180 292
854 3300048915 Ga0496112_0032775 Ga0496112_0032775_3680_4573 292
855 3300048916 Ga0496113_0029569 Ga0496113_0029569_1122_2015 292
856 3300048917 Ga0496114_0011285 Ga0496114_0011285_5401_6297 292
857 3300048917 Ga0496114_0131769 Ga0496114_0131769_754_1656 292
858 3300048917 Ga0496114_0228206 Ga0496114_0228206_386_1282 292
859 3300048918 Ga0496115_0105449 Ga0496115_0105449_901_1803 292
860 3300048918 Ga0496115_0377945 Ga0496115_0377945_166_1062 292
861 3300049581 Ga0501047_0053297 Ga0501047_0053297_2878_3765 292
862 3300049585 Ga0501069_0050934 Ga0501069_0050934_1235_2131 292
863 3300049589 Ga0501073_0121549 Ga0501073_0121549_568_1455 292
864 3300050507 nmdc:mga05p37_315261_c1 nmdc:mga05p37_315261_c1_643_1545 292
865 3300050513 nmdc:mga0rr50_11827_c1 nmdc:mga0rr50_11827_c1_719_1612 292
866 3300050514 nmdc:mga08x19_22289_c1 nmdc:mga08x19_22289_c1_1224_2126 292
867 3300053077 Ga0495601_0000313 Ga0495601_0000313_17516_18412 292
868 3300053077 Ga0495601_0016312 Ga0495601_0016312_68_964 292
869 3300053077 Ga0495601_0022926 Ga0495601_0022926_1251_2147 292
870 3300053077 Ga0495601_0050349 Ga0495601_0050349_742_1638 292
871 3300053077 Ga0495601_0106150 Ga0495601_0106150_498_1394 292
872 3300053078 Ga0495612_0040271 Ga0495612_0040271_548_1444 292
873 3300053078 Ga0495612_0088157 Ga0495612_0088157_173_1069 292
874 3300053085 Ga0495619_0005391 Ga0495619_0005391_6091_6987 292
875 3300053085 Ga0495619_0006346 Ga0495619_0006346_3365_4261 292
876 3300053085 Ga0495619_0031125 Ga0495619_0031125_1393_2289 292
877 3300059426 Ga0590077_022636 Ga0590077_022636_32_928 292
878 3300061719 Ga0466962_0004666 Ga0466962_0004666_2762_3658 292
879 3300061719 Ga0466962_0006290 Ga0466962_0006290_2396_3289 292
880 3300061719 Ga0466962_0012287 Ga0466962_0012287_3145_4041 292
881 3300028800 Ga0265338_10177402 Ga0265338_101774021 293
882 3300029957 Ga0265324_10016427 Ga0265324_100164272 293
883 3300031548 Ga0307408_100054954 Ga0307408_1000549542 293
884 3300049742 Ga0501080_0050844 Ga0501080_0050844_1677_2567 293
885 3300049823 Ga0501044_0226877 Ga0501044_0226877_670_1560 293
886 3300005329 Ga0070683_100252667 Ga0070683_1002526671 294
887 3300005355 Ga0070671_100019046 Ga0070671_1000190466 294
888 3300005535 Ga0070684_100354122 Ga0070684_1003541221 294
889 3300005564 Ga0070664_100534444 Ga0070664_1005344442 294
890 3300005618 Ga0068864_100284927 Ga0068864_1002849272 294
891 3300005937 Ga0081455_10005241 Ga0081455_100052414 294
892 3300005983 Ga0081540_1003731 Ga0081540_10037314 294
893 3300005983 Ga0081540_1009956 Ga0081540_10099563 294
894 3300006852 Ga0075433_10053501 Ga0075433_100535011 294
895 3300006871 Ga0075434_100113694 Ga0075434_1001136943 294
896 3300006914 Ga0075436_100024507 Ga0075436_1000245073 294
897 3300007076 Ga0075435_100228597 Ga0075435_1002285971 294
898 3300009094 Ga0111539_11053667 Ga0111539_110536671 294
899 3300009098 Ga0105245_10066994 Ga0105245_100669942 294
900 3300009176 Ga0105242_10185869 Ga0105242_101858692 294
901 3300009553 Ga0105249_10056772 Ga0105249_100567723 294
902 3300013308 Ga0157375_10056902 Ga0157375_100569024 294
903 3300014325 Ga0163163_10050648 Ga0163163_100506485 294
904 3300014968 Ga0157379_10297547 Ga0157379_102975472 294
905 3300025919 Ga0207657_10186486 Ga0207657_101864862 294
906 3300025927 Ga0207687_10065695 Ga0207687_100656953 294
907 3300025928 Ga0207700_10197544 Ga0207700_101975442 294
908 3300025936 Ga0207670_10096891 Ga0207670_100968912 294
909 3300025941 Ga0207711_10242658 Ga0207711_102426582 294
910 3300025944 Ga0207661_10279814 Ga0207661_102798142 294
911 3300025960 Ga0207651_10114056 Ga0207651_101140562 294
912 3300025981 Ga0207640_10233176 Ga0207640_102331762 294
913 3300026078 Ga0207702_10022381 Ga0207702_100223812 294
914 3300031903 Ga0307407_10023778 Ga0307407_100237783 294
915 3300031995 Ga0307409_100125795 Ga0307409_1001257952 294
916 3300032002 Ga0307416_100172879 Ga0307416_1001728792 294
917 3300035170 Ga0373943_0007678 Ga0373943_0007678_558_1445 294
918 3300035692 Ga0373935_0020284 Ga0373935_0020284_2500_3387 294
919 3300035725 Ga0373947_0019181 Ga0373947_0019181_117_1004 294
920 3300037068 Ga0373925_0026517 Ga0373925_0026517_1150_2037 294
921 3300042008 Ga0439450_014406 Ga0439450_014406_222_1112 294
922 3300045051 Ga0451576_0262200 Ga0451576_0262200_820_1710 294
923 3300045051 Ga0451576_0283072 Ga0451576_0283072_513_1403 294
924 3300046455 Ga0495603_0000062 Ga0495603_0000062_28457_29344 294
925 3300046461 Ga0495641_0011742 Ga0495641_0011742_67_954 294
926 3300046472 Ga0495580_0063357 Ga0495580_0063357_306_1193 294
927 3300046473 Ga0495582_0020372 Ga0495582_0020372_2172_3059 294
928 3300046475 Ga0495639_0090749 Ga0495639_0090749_476_1363 294
929 3300046475 Ga0495639_0162252 Ga0495639_0162252_142_1029 294
930 3300046499 Ga0495594_0000447 Ga0495594_0000447_3718_4605 294
931 3300046517 Ga0495630_0066996 Ga0495630_0066996_530_1417 294
932 3300046557 Ga0495622_0098689 Ga0495622_0098689_287_1174 294
933 3300046674 Ga0495588_0000632 Ga0495588_0000632_14095_14982 294
934 3300046681 Ga0495647_0070639 Ga0495647_0070639_465_1352 294
935 3300046683 Ga0495658_0075027 Ga0495658_0075027_1029_1916 294
936 3300047321 Ga0495676_0000253 Ga0495676_0000253_19007_19894 294
937 3300047321 Ga0495676_0075731 Ga0495676_0075731_424_1311 294
938 3300048903 Ga0496100_0199318 Ga0496100_0199318_27_914 294
939 3300048904 Ga0496101_0156241 Ga0496101_0156241_583_1470 294
940 3300048905 Ga0496102_0044862 Ga0496102_0044862_2304_3191 294
941 3300048905 Ga0496102_0272646 Ga0496102_0272646_565_1452 294
942 3300048907 Ga0496104_0007410 Ga0496104_0007410_6786_7673 294
943 3300048907 Ga0496104_0205254 Ga0496104_0205254_557_1444 294
944 3300048908 Ga0496105_0000042 Ga0496105_0000042_93063_93950 294
945 3300048909 Ga0496106_0003639 Ga0496106_0003639_1292_2179 294
946 3300048909 Ga0496106_0039400 Ga0496106_0039400_331_1218 294
947 3300048910 Ga0496107_0016603 Ga0496107_0016603_990_1877 294
948 3300048910 Ga0496107_0088641 Ga0496107_0088641_1320_2207 294
949 3300048911 Ga0496108_0001658 Ga0496108_0001658_11837_12724 294
950 3300048911 Ga0496108_0102798 Ga0496108_0102798_1026_1913 294
951 3300048912 Ga0496109_0033522 Ga0496109_0033522_1723_2610 294
952 3300048912 Ga0496109_0205551 Ga0496109_0205551_390_1277 294
953 3300048913 Ga0496110_0000050 Ga0496110_0000050_34000_34887 294
954 3300048913 Ga0496110_0171147 Ga0496110_0171147_36_923 294
955 3300048913 Ga0496110_0608915 Ga0496110_0608915_80_967 294
956 3300048914 Ga0496111_0000439 Ga0496111_0000439_1465_2352 294
957 3300048914 Ga0496111_0000734 Ga0496111_0000734_3247_4134 294
958 3300048914 Ga0496111_0071315 Ga0496111_0071315_723_1610 294
959 3300048915 Ga0496112_0028410 Ga0496112_0028410_4359_5246 294
960 3300048916 Ga0496113_0000348 Ga0496113_0000348_8065_8952 294
961 3300048917 Ga0496114_0119631 Ga0496114_0119631_1223_2110 294
962 3300048917 Ga0496114_0209371 Ga0496114_0209371_236_1123 294
963 3300049587 Ga0501071_0090727 Ga0501071_0090727_579_1466 294
964 3300049592 Ga0501076_0119311 Ga0501076_0119311_1011_1898 294
965 3300050507 nmdc:mga05p37_270310_c1 nmdc:mga05p37_270310_c1_547_1437 294
966 3300050513 nmdc:mga0rr50_98139_c1 nmdc:mga0rr50_98139_c1_505_1395 294
967 3300050515 nmdc:mga0a205_123064_c1 nmdc:mga0a205_123064_c1_1523_2413 294
968 3300003373 JGI25407J50210_10007465 JGI25407J50210_100074652 295
969 3300005330 Ga0070690_100026749 Ga0070690_1000267492 295
970 3300005338 Ga0068868_100042943 Ga0068868_1000429432 295
971 3300005341 Ga0070691_10040050 Ga0070691_100400502 295
972 3300005343 Ga0070687_100042135 Ga0070687_1000421352 295
973 3300005345 Ga0070692_10061013 Ga0070692_100610132 295
974 3300005347 Ga0070668_100107211 Ga0070668_1001072112 295
975 3300005353 Ga0070669_100061721 Ga0070669_1000617212 295
976 3300005364 Ga0070673_100407496 Ga0070673_1004074962 295
977 3300005366 Ga0070659_100041418 Ga0070659_1000414183 295
978 3300005440 Ga0070705_100023412 Ga0070705_1000234123 295
979 3300005441 Ga0070700_100038446 Ga0070700_1000384462 295
980 3300005444 Ga0070694_100010676 Ga0070694_1000106762 295
981 3300005456 Ga0070678_100039031 Ga0070678_1000390313 295
982 3300005459 Ga0068867_100009137 Ga0068867_1000091376 295
983 3300005471 Ga0070698_100323680 Ga0070698_1003236802 295
984 3300005530 Ga0070679_100156125 Ga0070679_1001561252 295
985 3300005539 Ga0068853_100182407 Ga0068853_1001824072 295
986 3300005544 Ga0070686_100049581 Ga0070686_1000495813 295
987 3300005545 Ga0070695_100106805 Ga0070695_1001068052 295
988 3300005546 Ga0070696_100007393 Ga0070696_1000073936 295
989 3300005547 Ga0070693_100025670 Ga0070693_1000256702 295
990 3300005549 Ga0070704_100070682 Ga0070704_1000706822 295
991 3300005578 Ga0068854_100037319 Ga0068854_1000373192 295
992 3300005615 Ga0070702_100007186 Ga0070702_1000071862 295
993 3300005844 Ga0068862_100193412 Ga0068862_1001934122 295
994 3300005937 Ga0081455_10028050 Ga0081455_100280502 295
995 3300005937 Ga0081455_10067713 Ga0081455_100677132 295
996 3300005937 Ga0081455_10079678 Ga0081455_100796782 295
997 3300005981 Ga0081538_10005878 Ga0081538_100058784 295
998 3300005981 Ga0081538_10016944 Ga0081538_100169444 295
999 3300005983 Ga0081540_1001832 Ga0081540_10018327 295
1000 3300006881 Ga0068865_100016700 Ga0068865_1000167003 295
1001 3300009176 Ga0105242_10028569 Ga0105242_100285693 295
1002 3300009553 Ga0105249_10052496 Ga0105249_100524962 295
1003 3300013102 Ga0157371_10152118 Ga0157371_101521182 295
1004 3300013306 Ga0163162_10315006 Ga0163162_103150062 295
1005 3300014969 Ga0157376_10270227 Ga0157376_102702272 295
1006 3300025918 Ga0207662_10026623 Ga0207662_100266232 295
1007 3300025927 Ga0207687_10252775 Ga0207687_102527752 295
1008 3300025933 Ga0207706_10037819 Ga0207706_100378193 295
1009 3300025937 Ga0207669_10037693 Ga0207669_100376931 295
1010 3300025938 Ga0207704_10031842 Ga0207704_100318423 295
1011 3300025960 Ga0207651_10353079 Ga0207651_103530792 295
1012 3300026023 Ga0207677_10121005 Ga0207677_101210052 295
1013 3300026041 Ga0207639_10299849 Ga0207639_102998491 295
1014 3300026075 Ga0207708_10036774 Ga0207708_100367742 295
1015 3300026089 Ga0207648_10003750 Ga0207648_1000375012 295
1016 3300026118 Ga0207675_100010036 Ga0207675_1000100366 295
1017 3300037312 Ga0395899_0025260 Ga0395899_0025260_222_1109 295
1018 3300037312 Ga0395899_0115104 Ga0395899_0115104_770_1657 295
1019 3300037418 Ga0395900_0004234 Ga0395900_0004234_12965_13852 295
1020 3300037418 Ga0395900_0165520 Ga0395900_0165520_1254_2147 295
1021 3300037418 Ga0395900_0331965 Ga0395900_0331965_208_1095 295
1022 3300037466 Ga0395898_0019229 Ga0395898_0019229_415_1302 295
1023 3300037466 Ga0395898_0152234 Ga0395898_0152234_785_1672 295
1024 3300037471 Ga0395905_0057121 Ga0395905_0057121_2542_3429 295
1025 3300037471 Ga0395905_0068620 Ga0395905_0068620_46_933 295
1026 3300037471 Ga0395905_0192110 Ga0395905_0192110_443_1336 295
1027 3300038443 Ga0395901_0030818 Ga0395901_0030818_3353_4246 295
1028 3300038443 Ga0395901_0049417 Ga0395901_0049417_2132_3019 295
1029 3300038443 Ga0395901_0180719 Ga0395901_0180719_541_1428 295
1030 3300046491 Ga0495584_0163131 Ga0495584_0163131_137_1027 295
1031 3300046538 Ga0495609_0062728 Ga0495609_0062728_574_1464 295
1032 3300048917 Ga0496114_0158162 Ga0496114_0158162_55_945 295
1033 3300049743 Ga0501081_0055592 Ga0501081_0055592_402_1289 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09754

PAC2

PAC2 family

41

260

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mnf-assembly1.cif.gz_A crystal structure of pac2 family protein from streptomyces avermitilis ma 0.9259 16 247
5un0-assembly1.cif.gz_3 crystal structure of mycobacterium tuberculosis proteasome-assembly chaperone homologue rv2125 0.9149 17 247
3mnf-assembly1.cif.gz_A crystal structure of pac2 family protein from streptomyces avermitilis ma 0.9108 16 247
2p90-assembly1.cif.gz_C the crystal structure of a protein of unknown function from corynebacterium glutamicum atcc 13032 0.9062 3 259
2wam-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis unknown function protein rv2714 0.9047 1 260
ID Description Score Start End Superfamily
3mnfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;PAC-like subunit 0.9152 17 247 3.40.50.10900
3mnfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;PAC-like subunit 0.9039 17 247 3.40.50.10900
2p90C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;PAC-like subunit 0.8924 3 217 3.40.50.10900
2wamC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;PAC-like subunit 0.8807 1 217 3.40.50.10900
3e35A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;PAC-like subunit 0.8769 17 217 3.40.50.10900
ID Description Score Start End GO Terms
AF-A0A538FH41-F1-model_v4 PAC2 family protein 0.9912 1 257
AF-A0A538FH13-F1-model_v4 PAC2 family protein 0.9904 1 142
AF-A0A7V8XNW6-F1-model_v4 PAC2 family protein 0.9865 4 206
AF-A0A382U0J3-F1-model_v4 PAC2 family protein 0.9798 4 192
AF-A0A2W1AQ56-F1-model_v4 Proteasome assembly chaperone (PAC2) family protein 0.9783 4 254 GO:0000502

Feature Viewer

pLDDT pTM Quality
88.07 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map