F488663
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1033 | 350 | 1033 | 288 |
Family's Representative Sequence
| Representative Sequence | 3300028573|Ga0265334_10062399|Ga0265334_100623992 |
| Length | 304 |
| Sequence | MVDLAGVEPPWAPHVPRYYREMPELNVSFRPTLRRPVLVAAFRGWNDGGQGASLGGGYLAKQWQATRFAEIEPEGFYDFQATRPHVSLVDGITRQLDWPENAFFHATIPGTDRDAIVLLGVEPNLRWKTFSGLVLDLAQDLGVEMLVTFGSLLADVPHTRAAPVTGAATDPALVEELGLEPSRYEGPTGIVGVVHDACRAADIRSVSLWAAVPHYVSLAPSPRAALSLVRRFGELMHVDIDLAELEQASDEYAAYVEELERRVDMLEAADDLPSGDTLAAELTRFLRERDEADESDLGPDGPAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 106 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 170 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 186 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 187 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 188 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 189 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 191 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 219 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 220 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 221 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 222 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 223 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 229 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 230 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 231 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 232 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 239 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 350 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.94 |
| Metatranscriptomes | 1.06 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.19 |
| Nodule | 0 |
| Rhizoplane | 9.1 |
| Rhizosphere | 90.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10007465 | 3300003373 | Bacteria | 2739 |
| 2 | Ga0070658_10003082 | 3300005327 | Bacteria | 13757 |
| 3 | Ga0070658_10007291 | 3300005327 | Bacteria | 8927 |
| 4 | Ga0070658_10086715 | 3300005327 | Bacteria | 2575 |
| 5 | Ga0070658_10112980 | 3300005327 | Bacteria | 2252 |
| 6 | Ga0070683_100026294 | 3300005329 | Bacteria | 5238 |
| 7 | Ga0070683_100026519 | 3300005329 | Bacteria | 5219 |
| 8 | Ga0070683_100059085 | 3300005329 | Bacteria | 3562 |
| 9 | Ga0070683_100098610 | 3300005329 | Bacteria | 2750 |
| 10 | Ga0070683_100111524 | 3300005329 | Bacteria | 2580 |
| 11 | Ga0070683_100252667 | 3300005329 | Bacteria | 1677 |
| 12 | Ga0070690_100026749 | 3300005330 | Bacteria | 3562 |
| 13 | Ga0070680_100022930 | 3300005336 | Bacteria | 4974 |
| 14 | Ga0070680_100026140 | 3300005336 | Bacteria | 4668 |
| 15 | Ga0070680_100038676 | 3300005336 | Bacteria | 3859 |
| 16 | Ga0070680_100189518 | 3300005336 | Bacteria | 1733 |
| 17 | Ga0070682_100134503 | 3300005337 | Bacteria | 1677 |
| 18 | Ga0070682_100199876 | 3300005337 | Bacteria | 1409 |
| 19 | Ga0068868_100042943 | 3300005338 | Bacteria | 3531 |
| 20 | Ga0070660_100049573 | 3300005339 | Bacteria | 3228 |
| 21 | Ga0070660_100069829 | 3300005339 | Bacteria | 2740 |
| 22 | Ga0070691_10040050 | 3300005341 | Bacteria | 2214 |
| 23 | Ga0070691_10068193 | 3300005341 | Bacteria | 1722 |
| 24 | Ga0070687_100042135 | 3300005343 | Bacteria | 2312 |
| 25 | Ga0070661_100164052 | 3300005344 | Bacteria | 1684 |
| 26 | Ga0070692_10061013 | 3300005345 | Bacteria | 1987 |
| 27 | Ga0070668_100099447 | 3300005347 | Bacteria | 2303 |
| 28 | Ga0070668_100107211 | 3300005347 | Bacteria | 2221 |
| 29 | Ga0070669_100061721 | 3300005353 | Bacteria | 2755 |
| 30 | Ga0070671_100019046 | 3300005355 | Bacteria | 5583 |
| 31 | Ga0070673_100407496 | 3300005364 | Bacteria | 1217 |
| 32 | Ga0070659_100013732 | 3300005366 | Bacteria | 6038 |
| 33 | Ga0070659_100041418 | 3300005366 | Bacteria | 3600 |
| 34 | Ga0070659_100067593 | 3300005366 | Bacteria | 2834 |
| 35 | Ga0070659_100082730 | 3300005366 | Bacteria | 2565 |
| 36 | Ga0070667_100513408 | 3300005367 | Bacteria | 1099 |
| 37 | Ga0070709_10026418 | 3300005434 | Bacteria | 3441 |
| 38 | Ga0070709_10069679 | 3300005434 | Bacteria | 2266 |
| 39 | Ga0070709_10112469 | 3300005434 | Bacteria | 1832 |
| 40 | Ga0070709_10138958 | 3300005434 | Bacteria | 1667 |
| 41 | Ga0070709_10177128 | 3300005434 | Bacteria | 1495 |
| 42 | Ga0070714_100013212 | 3300005435 | Bacteria | 6609 |
| 43 | Ga0070714_100014958 | 3300005435 | Bacteria | 6237 |
| 44 | Ga0070714_100024655 | 3300005435 | Bacteria | 4956 |
| 45 | Ga0070714_100024816 | 3300005435 | Bacteria | 4941 |
| 46 | Ga0070714_100050308 | 3300005435 | Bacteria | 3549 |
| 47 | Ga0070714_100055758 | 3300005435 | Bacteria | 3379 |
| 48 | Ga0070714_100088439 | 3300005435 | Bacteria | 2710 |
| 49 | Ga0070714_100098020 | 3300005435 | Bacteria | 2578 |
| 50 | Ga0070714_100435120 | 3300005435 | Bacteria | 1244 |
| 51 | Ga0070713_100011866 | 3300005436 | Bacteria | 6368 |
| 52 | Ga0070713_100043209 | 3300005436 | Bacteria | 3683 |
| 53 | Ga0070713_100067966 | 3300005436 | Bacteria | 3002 |
| 54 | Ga0070713_100080971 | 3300005436 | Bacteria | 2770 |
| 55 | Ga0070713_100153066 | 3300005436 | Bacteria | 2053 |
| 56 | Ga0070710_10003409 | 3300005437 | Bacteria | 7531 |
| 57 | Ga0070710_10020879 | 3300005437 | Bacteria | 3404 |
| 58 | Ga0070710_10024050 | 3300005437 | Bacteria | 3209 |
| 59 | Ga0070710_10071628 | 3300005437 | Bacteria | 1999 |
| 60 | Ga0070711_100011594 | 3300005439 | Bacteria | 5478 |
| 61 | Ga0070711_100021763 | 3300005439 | Bacteria | 4149 |
| 62 | Ga0070711_100045049 | 3300005439 | Bacteria | 2997 |
| 63 | Ga0070711_100203315 | 3300005439 | Unclassified | 1530 |
| 64 | Ga0070711_100243066 | 3300005439 | Bacteria | 1408 |
| 65 | Ga0070711_100267971 | 3300005439 | Bacteria | 1346 |
| 66 | Ga0070711_100282579 | 3300005439 | Bacteria | 1313 |
| 67 | Ga0070705_100002740 | 3300005440 | Bacteria | 8790 |
| 68 | Ga0070705_100023412 | 3300005440 | Bacteria | 3316 |
| 69 | Ga0070700_100038446 | 3300005441 | Bacteria | 2916 |
| 70 | Ga0070700_100317621 | 3300005441 | Bacteria | 1143 |
| 71 | Ga0070694_100010676 | 3300005444 | Bacteria | 5675 |
| 72 | Ga0070694_100047568 | 3300005444 | Bacteria | 2883 |
| 73 | Ga0070694_100104451 | 3300005444 | Bacteria | 2009 |
| 74 | Ga0070708_100010130 | 3300005445 | Bacteria | 7628 |
| 75 | Ga0070708_100078706 | 3300005445 | Bacteria | 2980 |
| 76 | Ga0070708_100317867 | 3300005445 | Bacteria | 1466 |
| 77 | Ga0070663_100095759 | 3300005455 | Bacteria | 2207 |
| 78 | Ga0070663_100403726 | 3300005455 | Bacteria | 1118 |
| 79 | Ga0070678_100039031 | 3300005456 | Bacteria | 3347 |
| 80 | Ga0070678_100189116 | 3300005456 | Bacteria | 1691 |
| 81 | Ga0070678_100507236 | 3300005456 | Bacteria | 1065 |
| 82 | Ga0070681_10018844 | 3300005458 | Bacteria | 6906 |
| 83 | Ga0070681_10053300 | 3300005458 | Bacteria | 4031 |
| 84 | Ga0070681_10058249 | 3300005458 | Bacteria | 3843 |
| 85 | Ga0070681_10060073 | 3300005458 | Bacteria | 3780 |
| 86 | Ga0070681_10121004 | 3300005458 | Bacteria | 2553 |
| 87 | Ga0070681_10299753 | 3300005458 | Bacteria | 1517 |
| 88 | Ga0070681_10435258 | 3300005458 | Bacteria | 1223 |
| 89 | Ga0068867_100009137 | 3300005459 | Bacteria | 6993 |
| 90 | Ga0070706_100019076 | 3300005467 | Bacteria | 6327 |
| 91 | Ga0070706_100179072 | 3300005467 | Bacteria | 1979 |
| 92 | Ga0070706_100240140 | 3300005467 | Bacteria | 1692 |
| 93 | Ga0070706_100482644 | 3300005467 | Bacteria | 1153 |
| 94 | Ga0070707_100001067 | 3300005468 | Bacteria | 27041 |
| 95 | Ga0070707_100012755 | 3300005468 | Bacteria | 7848 |
| 96 | Ga0070707_100024924 | 3300005468 | Bacteria | 5671 |
| 97 | Ga0070707_100072210 | 3300005468 | Bacteria | 3326 |
| 98 | Ga0070707_100179368 | 3300005468 | Bacteria | 2065 |
| 99 | Ga0070707_100271698 | 3300005468 | Bacteria | 1648 |
| 100 | Ga0070698_100042244 | 3300005471 | Bacteria | 4676 |
| 101 | Ga0070698_100127089 | 3300005471 | Bacteria | 2506 |
| 102 | Ga0070698_100185561 | 3300005471 | Bacteria | 2018 |
| 103 | Ga0070698_100257731 | 3300005471 | Bacteria | 1676 |
| 104 | Ga0070698_100323680 | 3300005471 | Bacteria | 1472 |
| 105 | Ga0070698_100468510 | 3300005471 | Bacteria | 1196 |
| 106 | Ga0070699_100034351 | 3300005518 | Bacteria | 4383 |
| 107 | Ga0070699_100042226 | 3300005518 | Bacteria | 3945 |
| 108 | Ga0070699_100134460 | 3300005518 | Bacteria | 2181 |
| 109 | Ga0070699_100403485 | 3300005518 | Bacteria | 1236 |
| 110 | Ga0070679_100084278 | 3300005530 | Bacteria | 3167 |
| 111 | Ga0070679_100156125 | 3300005530 | Bacteria | 2257 |
| 112 | Ga0070679_100211271 | 3300005530 | Bacteria | 1904 |
| 113 | Ga0070679_100395319 | 3300005530 | Bacteria | 1328 |
| 114 | Ga0070684_100015547 | 3300005535 | Bacteria | 6201 |
| 115 | Ga0070684_100031140 | 3300005535 | Bacteria | 4539 |
| 116 | Ga0070684_100038193 | 3300005535 | Bacteria | 4123 |
| 117 | Ga0070684_100051304 | 3300005535 | Bacteria | 3583 |
| 118 | Ga0070684_100108789 | 3300005535 | Bacteria | 2484 |
| 119 | Ga0070684_100177024 | 3300005535 | Bacteria | 1939 |
| 120 | Ga0070684_100354122 | 3300005535 | Bacteria | 1350 |
| 121 | Ga0070697_100163675 | 3300005536 | Bacteria | 1880 |
| 122 | Ga0068853_100040622 | 3300005539 | Bacteria | 3970 |
| 123 | Ga0068853_100182407 | 3300005539 | Bacteria | 1904 |
| 124 | Ga0070686_100049581 | 3300005544 | Bacteria | 2665 |
| 125 | Ga0070686_100164479 | 3300005544 | Bacteria | 1565 |
| 126 | Ga0070686_100344612 | 3300005544 | Bacteria | 1117 |
| 127 | Ga0070695_100000028 | 3300005545 | Bacteria | 53880 |
| 128 | Ga0070695_100059393 | 3300005545 | Bacteria | 2475 |
| 129 | Ga0070695_100106805 | 3300005545 | Bacteria | 1893 |
| 130 | Ga0070696_100007393 | 3300005546 | Bacteria | 7340 |
| 131 | Ga0070696_100023241 | 3300005546 | Bacteria | 4213 |
| 132 | Ga0070696_100024291 | 3300005546 | Bacteria | 4119 |
| 133 | Ga0070693_100002395 | 3300005547 | Bacteria | 8627 |
| 134 | Ga0070693_100025670 | 3300005547 | Bacteria | 3173 |
| 135 | Ga0070693_100051817 | 3300005547 | Bacteria | 2351 |
| 136 | Ga0070693_100052885 | 3300005547 | Bacteria | 2330 |
| 137 | Ga0070704_100030744 | 3300005549 | Bacteria | 3602 |
| 138 | Ga0070704_100070682 | 3300005549 | Bacteria | 2533 |
| 139 | Ga0070704_100296520 | 3300005549 | Bacteria | 1345 |
| 140 | Ga0068855_100005058 | 3300005563 | Bacteria | 16092 |
| 141 | Ga0068855_100085831 | 3300005563 | Bacteria | 3641 |
| 142 | Ga0070664_100038075 | 3300005564 | Bacteria | 4047 |
| 143 | Ga0070664_100534444 | 3300005564 | Bacteria | 1083 |
| 144 | Ga0068857_100002049 | 3300005577 | Bacteria | 16363 |
| 145 | Ga0068854_100015581 | 3300005578 | Bacteria | 5040 |
| 146 | Ga0068854_100037319 | 3300005578 | Bacteria | 3410 |
| 147 | Ga0068854_100095963 | 3300005578 | Bacteria | 2214 |
| 148 | Ga0068856_100046531 | 3300005614 | Bacteria | 4273 |
| 149 | Ga0068856_100076345 | 3300005614 | Bacteria | 3320 |
| 150 | Ga0068856_100152871 | 3300005614 | Bacteria | 2317 |
| 151 | Ga0068856_100210424 | 3300005614 | Bacteria | 1960 |
| 152 | Ga0068856_100312703 | 3300005614 | Bacteria | 1588 |
| 153 | Ga0070702_100007186 | 3300005615 | Bacteria | 5319 |
| 154 | Ga0068852_100462689 | 3300005616 | Bacteria | 1258 |
| 155 | Ga0068864_100284927 | 3300005618 | Bacteria | 1543 |
| 156 | Ga0068862_100193412 | 3300005844 | Bacteria | 1832 |
| 157 | Ga0081455_10005241 | 3300005937 | Bacteria | 14252 |
| 158 | Ga0081455_10010754 | 3300005937 | Bacteria | 9253 |
| 159 | Ga0081455_10028050 | 3300005937 | Bacteria | 5148 |
| 160 | Ga0081455_10067713 | 3300005937 | Bacteria | 2974 |
| 161 | Ga0081455_10079678 | 3300005937 | Bacteria | 2688 |
| 162 | Ga0081538_10005878 | 3300005981 | Bacteria | 10932 |
| 163 | Ga0081538_10016944 | 3300005981 | Bacteria | 5558 |
| 164 | Ga0081538_10084936 | 3300005981 | Bacteria | 1665 |
| 165 | Ga0081538_10101850 | 3300005981 | Bacteria | 1443 |
| 166 | Ga0081540_1001832 | 3300005983 | Bacteria | 17820 |
| 167 | Ga0081540_1003731 | 3300005983 | Bacteria | 11937 |
| 168 | Ga0081540_1009956 | 3300005983 | Bacteria | 6483 |
| 169 | Ga0081540_1017483 | 3300005983 | Bacteria | 4438 |
| 170 | Ga0070717_10001757 | 3300006028 | Bacteria | 15091 |
| 171 | Ga0070717_10017134 | 3300006028 | Bacteria | 5629 |
| 172 | Ga0070717_10034875 | 3300006028 | Bacteria | 4069 |
| 173 | Ga0070717_10060586 | 3300006028 | Bacteria | 3134 |
| 174 | Ga0070717_10128226 | 3300006028 | Bacteria | 2180 |
| 175 | Ga0070717_10138621 | 3300006028 | Bacteria | 2097 |
| 176 | Ga0070717_10491595 | 3300006028 | Bacteria | 1108 |
| 177 | Ga0075364_10272592 | 3300006051 | Bacteria | 1151 |
| 178 | Ga0075432_10011481 | 3300006058 | Bacteria | 3010 |
| 179 | Ga0070715_10001705 | 3300006163 | Bacteria | 6533 |
| 180 | Ga0070715_10003612 | 3300006163 | Bacteria | 4958 |
| 181 | Ga0070716_100000830 | 3300006173 | Bacteria | 13319 |
| 182 | Ga0070716_100001535 | 3300006173 | Bacteria | 10347 |
| 183 | Ga0070716_100123972 | 3300006173 | Unclassified | 1622 |
| 184 | Ga0070716_100306096 | 3300006173 | Bacteria | 1107 |
| 185 | Ga0070712_100004474 | 3300006175 | Bacteria | 8629 |
| 186 | Ga0070712_100013288 | 3300006175 | Bacteria | 5259 |
| 187 | Ga0070712_100019657 | 3300006175 | Bacteria | 4410 |
| 188 | Ga0070712_100024636 | 3300006175 | Bacteria | 3990 |
| 189 | Ga0070712_100079294 | 3300006175 | Bacteria | 2373 |
| 190 | Ga0070712_100234681 | 3300006175 | Bacteria | 1458 |
| 191 | Ga0097621_100018984 | 3300006237 | Bacteria | 5269 |
| 192 | Ga0068871_100157329 | 3300006358 | Bacteria | 1941 |
| 193 | Ga0068871_100227165 | 3300006358 | Bacteria | 1619 |
| 194 | Ga0075428_100030779 | 3300006844 | Bacteria | 5934 |
| 195 | Ga0075430_100071532 | 3300006846 | Bacteria | 2910 |
| 196 | Ga0075431_100030600 | 3300006847 | Bacteria | 5545 |
| 197 | Ga0075431_100102635 | 3300006847 | Bacteria | 2952 |
| 198 | Ga0075433_10021680 | 3300006852 | Bacteria | 5388 |
| 199 | Ga0075433_10053501 | 3300006852 | Bacteria | 3520 |
| 200 | Ga0075433_10507689 | 3300006852 | Bacteria | 1061 |
| 201 | Ga0075434_100099755 | 3300006871 | Bacteria | 2909 |
| 202 | Ga0075434_100113694 | 3300006871 | Bacteria | 2719 |
| 203 | Ga0068865_100016700 | 3300006881 | Bacteria | 4703 |
| 204 | Ga0075436_100006811 | 3300006914 | Bacteria | 7822 |
| 205 | Ga0075436_100024507 | 3300006914 | Bacteria | 4147 |
| 206 | Ga0075436_100206907 | 3300006914 | Bacteria | 1390 |
| 207 | Ga0075435_100228597 | 3300007076 | Bacteria | 1580 |
| 208 | Ga0075435_100425225 | 3300007076 | Bacteria | 1144 |
| 209 | Ga0075435_100530932 | 3300007076 | Bacteria | 1018 |
| 210 | Ga0105240_10065989 | 3300009093 | Bacteria | 4491 |
| 211 | Ga0105240_10094971 | 3300009093 | Bacteria | 3636 |
| 212 | Ga0105240_10186695 | 3300009093 | Bacteria | 2441 |
| 213 | Ga0105240_10359770 | 3300009093 | Bacteria | 1649 |
| 214 | Ga0105240_10565926 | 3300009093 | Bacteria | 1256 |
| 215 | Ga0111539_10029561 | 3300009094 | Bacteria | 6671 |
| 216 | Ga0111539_10123999 | 3300009094 | Bacteria | 3028 |
| 217 | Ga0111539_11053667 | 3300009094 | Bacteria | 945 |
| 218 | Ga0105245_10066994 | 3300009098 | Bacteria | 3251 |
| 219 | Ga0105247_10049845 | 3300009101 | Bacteria | 2576 |
| 220 | Ga0114129_10017054 | 3300009147 | Bacteria | 10340 |
| 221 | Ga0114129_10048955 | 3300009147 | Bacteria | 5940 |
| 222 | Ga0114129_10374721 | 3300009147 | Bacteria | 1881 |
| 223 | Ga0114129_10481359 | 3300009147 | Bacteria | 1624 |
| 224 | Ga0105243_10113711 | 3300009148 | Bacteria | 2270 |
| 225 | Ga0105243_10320362 | 3300009148 | Bacteria | 1412 |
| 226 | Ga0105241_10019064 | 3300009174 | Bacteria | 5059 |
| 227 | Ga0105241_10074742 | 3300009174 | Bacteria | 2639 |
| 228 | Ga0105241_10152458 | 3300009174 | Bacteria | 1892 |
| 229 | Ga0105241_10556005 | 3300009174 | Bacteria | 1031 |
| 230 | Ga0105242_10028569 | 3300009176 | Bacteria | 4442 |
| 231 | Ga0105242_10058539 | 3300009176 | Bacteria | 3159 |
| 232 | Ga0105242_10185869 | 3300009176 | Bacteria | 1836 |
| 233 | Ga0105248_10352222 | 3300009177 | Bacteria | 1658 |
| 234 | Ga0105238_10257767 | 3300009551 | Bacteria | 1723 |
| 235 | Ga0105249_10052496 | 3300009553 | Bacteria | 3723 |
| 236 | Ga0105249_10056772 | 3300009553 | Bacteria | 3585 |
| 237 | Ga0099796_10025949 | 3300010159 | Bacteria | 1856 |
| 238 | Ga0105239_10036040 | 3300010375 | Bacteria | 5431 |
| 239 | Ga0105239_10037540 | 3300010375 | Bacteria | 5309 |
| 240 | Ga0105239_10240441 | 3300010375 | Bacteria | 2032 |
| 241 | Ga0157373_10082421 | 3300013100 | Bacteria | 2267 |
| 242 | Ga0157373_10121168 | 3300013100 | Bacteria | 1838 |
| 243 | Ga0157373_10179650 | 3300013100 | Bacteria | 1490 |
| 244 | Ga0157371_10152118 | 3300013102 | Bacteria | 1650 |
| 245 | Ga0157370_10014977 | 3300013104 | Bacteria | 7906 |
| 246 | Ga0157370_10064257 | 3300013104 | Bacteria | 3475 |
| 247 | Ga0157370_10118798 | 3300013104 | Bacteria | 2469 |
| 248 | Ga0157369_10079582 | 3300013105 | Bacteria | 3510 |
| 249 | Ga0157369_10088380 | 3300013105 | Bacteria | 3307 |
| 250 | Ga0157374_10060145 | 3300013296 | Bacteria | 3555 |
| 251 | Ga0163162_10315006 | 3300013306 | Bacteria | 1697 |
| 252 | Ga0163162_10440117 | 3300013306 | Bacteria | 1436 |
| 253 | Ga0157372_10066175 | 3300013307 | Bacteria | 4060 |
| 254 | Ga0157372_10306046 | 3300013307 | Bacteria | 1849 |
| 255 | Ga0157372_10417496 | 3300013307 | Bacteria | 1563 |
| 256 | Ga0157375_10056902 | 3300013308 | Bacteria | 3863 |
| 257 | Ga0163163_10050648 | 3300014325 | Bacteria | 4090 |
| 258 | Ga0182008_10003241 | 3300014497 | Bacteria | 9946 |
| 259 | Ga0182008_10053879 | 3300014497 | Unclassified | 1991 |
| 260 | Ga0157377_10029358 | 3300014745 | Bacteria | 2968 |
| 261 | Ga0157379_10297547 | 3300014968 | Bacteria | 1470 |
| 262 | Ga0157376_10055099 | 3300014969 | Bacteria | 3317 |
| 263 | Ga0157376_10078082 | 3300014969 | Bacteria | 2834 |
| 264 | Ga0157376_10270227 | 3300014969 | Bacteria | 1597 |
| 265 | Ga0182006_1020518 | 3300015261 | Bacteria | 2768 |
| 266 | Ga0197907_11090182 | 3300020069 | Bacteria | 2587 |
| 267 | Ga0197907_11177942 | 3300020069 | Bacteria | 1095 |
| 268 | Ga0206356_10423288 | 3300020070 | Bacteria | 3027 |
| 269 | Ga0206356_10497752 | 3300020070 | Bacteria | 1728 |
| 270 | Ga0206352_10445858 | 3300020078 | Bacteria | 1080 |
| 271 | Ga0206354_10463591 | 3300020081 | Bacteria | 2015 |
| 272 | Ga0206353_10028453 | 3300020082 | Bacteria | 12119 |
| 273 | Ga0206353_10670244 | 3300020082 | Bacteria | 1233 |
| 274 | Ga0206353_11330602 | 3300020082 | Bacteria | 1031 |
| 275 | Ga0206353_11481888 | 3300020082 | Bacteria | 4198 |
| 276 | Ga0213871_10026056 | 3300021441 | Bacteria | 1493 |
| 277 | Ga0224712_10146589 | 3300022467 | Bacteria | 1043 |
| 278 | Ga0207653_10011312 | 3300025885 | Bacteria | 2786 |
| 279 | Ga0207692_10023153 | 3300025898 | Bacteria | 2869 |
| 280 | Ga0207692_10044508 | 3300025898 | Bacteria | 2215 |
| 281 | Ga0207710_10074222 | 3300025900 | Bacteria | 1565 |
| 282 | Ga0207688_10018666 | 3300025901 | Bacteria | 3771 |
| 283 | Ga0207647_10002020 | 3300025904 | Bacteria | 15521 |
| 284 | Ga0207685_10045598 | 3300025905 | Bacteria | 1663 |
| 285 | Ga0207699_10037107 | 3300025906 | Bacteria | 2783 |
| 286 | Ga0207699_10047467 | 3300025906 | Bacteria | 2518 |
| 287 | Ga0207699_10091303 | 3300025906 | Bacteria | 1912 |
| 288 | Ga0207699_10114712 | 3300025906 | Bacteria | 1733 |
| 289 | Ga0207699_10135583 | 3300025906 | Bacteria | 1612 |
| 290 | Ga0207705_10034013 | 3300025909 | Bacteria | 3643 |
| 291 | Ga0207705_10105746 | 3300025909 | Bacteria | 2075 |
| 292 | Ga0207705_10157899 | 3300025909 | Bacteria | 1702 |
| 293 | Ga0207684_10008644 | 3300025910 | Bacteria | 9045 |
| 294 | Ga0207684_10133559 | 3300025910 | Bacteria | 2130 |
| 295 | Ga0207684_10274939 | 3300025910 | Bacteria | 1453 |
| 296 | Ga0207654_10020346 | 3300025911 | Bacteria | 3517 |
| 297 | Ga0207654_10179479 | 3300025911 | Bacteria | 1380 |
| 298 | Ga0207707_10029476 | 3300025912 | Bacteria | 4798 |
| 299 | Ga0207707_10035228 | 3300025912 | Bacteria | 4377 |
| 300 | Ga0207707_10108051 | 3300025912 | Bacteria | 2432 |
| 301 | Ga0207707_10204089 | 3300025912 | Bacteria | 1723 |
| 302 | Ga0207707_10457140 | 3300025912 | Bacteria | 1092 |
| 303 | Ga0207695_10004382 | 3300025913 | Bacteria | 19305 |
| 304 | Ga0207695_10185683 | 3300025913 | Bacteria | 1998 |
| 305 | Ga0207671_10004661 | 3300025914 | Bacteria | 12974 |
| 306 | Ga0207671_10224856 | 3300025914 | Bacteria | 1471 |
| 307 | Ga0207693_10000126 | 3300025915 | Bacteria | 68560 |
| 308 | Ga0207693_10000586 | 3300025915 | Bacteria | 32620 |
| 309 | Ga0207693_10001266 | 3300025915 | Bacteria | 22523 |
| 310 | Ga0207693_10004553 | 3300025915 | Bacteria | 11703 |
| 311 | Ga0207693_10066768 | 3300025915 | Bacteria | 2816 |
| 312 | Ga0207693_10168483 | 3300025915 | Bacteria | 1725 |
| 313 | Ga0207693_10276878 | 3300025915 | Bacteria | 1315 |
| 314 | Ga0207663_10015092 | 3300025916 | Bacteria | 4252 |
| 315 | Ga0207663_10035912 | 3300025916 | Bacteria | 2977 |
| 316 | Ga0207663_10047454 | 3300025916 | Bacteria | 2651 |
| 317 | Ga0207663_10092737 | 3300025916 | Bacteria | 2008 |
| 318 | Ga0207663_10094468 | 3300025916 | Bacteria | 1992 |
| 319 | Ga0207663_10260222 | 3300025916 | Bacteria | 1281 |
| 320 | Ga0207663_10333105 | 3300025916 | Bacteria | 1144 |
| 321 | Ga0207660_10066539 | 3300025917 | Bacteria | 2607 |
| 322 | Ga0207660_10274374 | 3300025917 | Bacteria | 1336 |
| 323 | Ga0207662_10026623 | 3300025918 | Bacteria | 3336 |
| 324 | Ga0207657_10003276 | 3300025919 | Bacteria | 17325 |
| 325 | Ga0207657_10013935 | 3300025919 | Bacteria | 7866 |
| 326 | Ga0207657_10013989 | 3300025919 | Bacteria | 7851 |
| 327 | Ga0207657_10186486 | 3300025919 | Bacteria | 1675 |
| 328 | Ga0207652_10056227 | 3300025921 | Bacteria | 3387 |
| 329 | Ga0207652_10085686 | 3300025921 | Bacteria | 2761 |
| 330 | Ga0207652_10339305 | 3300025921 | Bacteria | 1356 |
| 331 | Ga0207646_10007593 | 3300025922 | Bacteria | 10986 |
| 332 | Ga0207646_10013769 | 3300025922 | Bacteria | 7719 |
| 333 | Ga0207646_10112691 | 3300025922 | Bacteria | 2441 |
| 334 | Ga0207646_10237744 | 3300025922 | Bacteria | 1646 |
| 335 | Ga0207694_10007484 | 3300025924 | Bacteria | 8279 |
| 336 | Ga0207694_10368117 | 3300025924 | Bacteria | 1192 |
| 337 | Ga0207694_10578222 | 3300025924 | Bacteria | 944 |
| 338 | Ga0207687_10023728 | 3300025927 | Bacteria | 4091 |
| 339 | Ga0207687_10065695 | 3300025927 | Bacteria | 2576 |
| 340 | Ga0207687_10067416 | 3300025927 | Bacteria | 2546 |
| 341 | Ga0207687_10252775 | 3300025927 | Bacteria | 1402 |
| 342 | Ga0207700_10010214 | 3300025928 | Bacteria | 5908 |
| 343 | Ga0207700_10030891 | 3300025928 | Bacteria | 3799 |
| 344 | Ga0207700_10074122 | 3300025928 | Bacteria | 2631 |
| 345 | Ga0207700_10170157 | 3300025928 | Bacteria | 1817 |
| 346 | Ga0207700_10197544 | 3300025928 | Bacteria | 1693 |
| 347 | Ga0207700_10307581 | 3300025928 | Bacteria | 1370 |
| 348 | Ga0207664_10002009 | 3300025929 | Bacteria | 13400 |
| 349 | Ga0207664_10003758 | 3300025929 | Bacteria | 10197 |
| 350 | Ga0207664_10007986 | 3300025929 | Bacteria | 7357 |
| 351 | Ga0207664_10024595 | 3300025929 | Bacteria | 4527 |
| 352 | Ga0207664_10038872 | 3300025929 | Bacteria | 3691 |
| 353 | Ga0207664_10039781 | 3300025929 | Bacteria | 3651 |
| 354 | Ga0207664_10053180 | 3300025929 | Bacteria | 3204 |
| 355 | Ga0207664_10102183 | 3300025929 | Bacteria | 2370 |
| 356 | Ga0207664_10130266 | 3300025929 | Bacteria | 2117 |
| 357 | Ga0207664_10144588 | 3300025929 | Bacteria | 2015 |
| 358 | Ga0207664_10152646 | 3300025929 | Bacteria | 1963 |
| 359 | Ga0207664_10575544 | 3300025929 | Bacteria | 1011 |
| 360 | Ga0207664_10591130 | 3300025929 | Bacteria | 997 |
| 361 | Ga0207690_10053416 | 3300025932 | Bacteria | 2711 |
| 362 | Ga0207706_10037819 | 3300025933 | Bacteria | 4283 |
| 363 | Ga0207706_10328655 | 3300025933 | Bacteria | 1330 |
| 364 | Ga0207686_10365457 | 3300025934 | Bacteria | 1090 |
| 365 | Ga0207709_10067404 | 3300025935 | Bacteria | 2258 |
| 366 | Ga0207670_10096891 | 3300025936 | Bacteria | 2099 |
| 367 | Ga0207669_10037693 | 3300025937 | Bacteria | 2777 |
| 368 | Ga0207704_10031842 | 3300025938 | Bacteria | 2976 |
| 369 | Ga0207665_10000494 | 3300025939 | Bacteria | 26650 |
| 370 | Ga0207665_10000793 | 3300025939 | Bacteria | 21330 |
| 371 | Ga0207665_10022156 | 3300025939 | Bacteria | 4177 |
| 372 | Ga0207665_10112145 | 3300025939 | Bacteria | 1917 |
| 373 | Ga0207711_10242658 | 3300025941 | Bacteria | 1652 |
| 374 | Ga0207711_10577988 | 3300025941 | Bacteria | 1048 |
| 375 | Ga0207661_10019465 | 3300025944 | Bacteria | 5062 |
| 376 | Ga0207661_10038781 | 3300025944 | Bacteria | 3736 |
| 377 | Ga0207661_10059310 | 3300025944 | Bacteria | 3083 |
| 378 | Ga0207661_10073908 | 3300025944 | Bacteria | 2793 |
| 379 | Ga0207661_10080393 | 3300025944 | Bacteria | 2690 |
| 380 | Ga0207661_10127929 | 3300025944 | Bacteria | 2172 |
| 381 | Ga0207661_10279814 | 3300025944 | Bacteria | 1491 |
| 382 | Ga0207667_10157764 | 3300025949 | Bacteria | 2334 |
| 383 | Ga0207667_10618635 | 3300025949 | Bacteria | 1091 |
| 384 | Ga0207651_10114056 | 3300025960 | Bacteria | 2035 |
| 385 | Ga0207651_10353079 | 3300025960 | Bacteria | 1239 |
| 386 | Ga0207668_10043093 | 3300025972 | Bacteria | 3060 |
| 387 | Ga0207668_10229799 | 3300025972 | Bacteria | 1495 |
| 388 | Ga0207640_10076784 | 3300025981 | Bacteria | 2269 |
| 389 | Ga0207640_10233176 | 3300025981 | Bacteria | 1417 |
| 390 | Ga0207677_10121005 | 3300026023 | Bacteria | 1969 |
| 391 | Ga0207639_10299849 | 3300026041 | Bacteria | 1420 |
| 392 | Ga0207639_10415883 | 3300026041 | Bacteria | 1214 |
| 393 | Ga0207678_10023982 | 3300026067 | Bacteria | 5333 |
| 394 | Ga0207678_10080789 | 3300026067 | Bacteria | 2783 |
| 395 | Ga0207708_10036774 | 3300026075 | Bacteria | 3729 |
| 396 | Ga0207702_10022381 | 3300026078 | Bacteria | 5240 |
| 397 | Ga0207702_10315948 | 3300026078 | Bacteria | 1486 |
| 398 | Ga0207648_10003750 | 3300026089 | Bacteria | 15885 |
| 399 | Ga0207648_10098634 | 3300026089 | Unclassified | 2558 |
| 400 | Ga0207674_10003294 | 3300026116 | Bacteria | 19867 |
| 401 | Ga0207675_100010036 | 3300026118 | Bacteria | 8877 |
| 402 | Ga0207683_10000425 | 3300026121 | Bacteria | 38973 |
| 403 | Ga0207683_10003390 | 3300026121 | Bacteria | 13894 |
| 404 | Ga0207683_10114597 | 3300026121 | Bacteria | 2415 |
| 405 | Ga0207683_10367784 | 3300026121 | Bacteria | 1321 |
| 406 | Ga0207698_10735967 | 3300026142 | Bacteria | 984 |
| 407 | Ga0207428_10012037 | 3300027907 | Bacteria | 7613 |
| 408 | Ga0265337_1025049 | 3300028556 | Bacteria | 1819 |
| 409 | Ga0265326_10051843 | 3300028558 | Bacteria | 1162 |
| 410 | Ga0265319_1003192 | 3300028563 | Bacteria | 8622 |
| 411 | Ga0265319_1051171 | 3300028563 | Bacteria | 1362 |
| 412 | Ga0265334_10006423 | 3300028573 | Bacteria | 5065 |
| 413 | Ga0265334_10062399 | 3300028573 | Bacteria | 1403 |
| 414 | Ga0265334_10079001 | 3300028573 | Bacteria | 1214 |
| 415 | Ga0265318_10000315 | 3300028577 | Bacteria | 38724 |
| 416 | Ga0265318_10003754 | 3300028577 | Bacteria | 7557 |
| 417 | Ga0265322_10025979 | 3300028654 | Bacteria | 1674 |
| 418 | Ga0265322_10027343 | 3300028654 | Bacteria | 1630 |
| 419 | Ga0265336_10003988 | 3300028666 | Bacteria | 5649 |
| 420 | Ga0265336_10028972 | 3300028666 | Bacteria | 1728 |
| 421 | Ga0265338_10003714 | 3300028800 | Bacteria | 21233 |
| 422 | Ga0265338_10011694 | 3300028800 | Bacteria | 10105 |
| 423 | Ga0265338_10014556 | 3300028800 | Bacteria | 8738 |
| 424 | Ga0265338_10025017 | 3300028800 | Bacteria | 6078 |
| 425 | Ga0265338_10065694 | 3300028800 | Bacteria | 3144 |
| 426 | Ga0265338_10177402 | 3300028800 | Bacteria | 1627 |
| 427 | Ga0265324_10016427 | 3300029957 | Bacteria | 2702 |
| 428 | Ga0265330_10151185 | 3300031235 | Bacteria | 986 |
| 429 | Ga0265332_10006779 | 3300031238 | Bacteria | 5190 |
| 430 | Ga0265328_10003597 | 3300031239 | Bacteria | 6837 |
| 431 | Ga0265320_10007161 | 3300031240 | Bacteria | 6950 |
| 432 | Ga0265320_10016743 | 3300031240 | Bacteria | 4097 |
| 433 | Ga0265320_10057555 | 3300031240 | Bacteria | 1864 |
| 434 | Ga0265325_10000170 | 3300031241 | Bacteria | 46230 |
| 435 | Ga0265325_10005433 | 3300031241 | Bacteria | 7865 |
| 436 | Ga0265325_10033619 | 3300031241 | Bacteria | 2733 |
| 437 | Ga0265329_10020907 | 3300031242 | Bacteria | 2204 |
| 438 | Ga0265329_10089138 | 3300031242 | Bacteria | 978 |
| 439 | Ga0265340_10061620 | 3300031247 | Bacteria | 1794 |
| 440 | Ga0265340_10075987 | 3300031247 | Bacteria | 1586 |
| 441 | Ga0265339_10001965 | 3300031249 | Bacteria | 15100 |
| 442 | Ga0265339_10026079 | 3300031249 | Bacteria | 3350 |
| 443 | Ga0265339_10030019 | 3300031249 | Bacteria | 3080 |
| 444 | Ga0265339_10031373 | 3300031249 | Bacteria | 3003 |
| 445 | Ga0265331_10001277 | 3300031250 | Bacteria | 18778 |
| 446 | Ga0265331_10123830 | 3300031250 | Bacteria | 1181 |
| 447 | Ga0265327_10007023 | 3300031251 | Bacteria | 8826 |
| 448 | Ga0265327_10039105 | 3300031251 | Bacteria | 2579 |
| 449 | Ga0265327_10074592 | 3300031251 | Bacteria | 1689 |
| 450 | Ga0265327_10112388 | 3300031251 | Bacteria | 1300 |
| 451 | Ga0265316_10006316 | 3300031344 | Bacteria | 11343 |
| 452 | Ga0265316_10009416 | 3300031344 | Bacteria | 8999 |
| 453 | Ga0265316_10011381 | 3300031344 | Bacteria | 8028 |
| 454 | Ga0307408_100054954 | 3300031548 | Bacteria | 2881 |
| 455 | Ga0265313_10004551 | 3300031595 | Bacteria | 10575 |
| 456 | Ga0265313_10014891 | 3300031595 | Bacteria | 4565 |
| 457 | Ga0265313_10030777 | 3300031595 | Bacteria | 2758 |
| 458 | Ga0265314_10002877 | 3300031711 | Bacteria | 17091 |
| 459 | Ga0265314_10018847 | 3300031711 | Bacteria | 5361 |
| 460 | Ga0265314_10020861 | 3300031711 | Bacteria | 5051 |
| 461 | Ga0265342_10005444 | 3300031712 | Bacteria | 9701 |
| 462 | Ga0265342_10006088 | 3300031712 | Bacteria | 9053 |
| 463 | Ga0265342_10043074 | 3300031712 | Bacteria | 2725 |
| 464 | Ga0265342_10055751 | 3300031712 | Bacteria | 2345 |
| 465 | Ga0307407_10023778 | 3300031903 | Bacteria | 3202 |
| 466 | Ga0307409_100044618 | 3300031995 | Bacteria | 3341 |
| 467 | Ga0307409_100125795 | 3300031995 | Bacteria | 2180 |
| 468 | Ga0307409_100138894 | 3300031995 | Bacteria | 2090 |
| 469 | Ga0307416_100045473 | 3300032002 | Bacteria | 3457 |
| 470 | Ga0307416_100122315 | 3300032002 | Bacteria | 2323 |
| 471 | Ga0307416_100172879 | 3300032002 | Bacteria | 2014 |
| 472 | Ga0307411_10432514 | 3300032005 | Bacteria | 1096 |
| 473 | Ga0307415_100001487 | 3300032126 | Bacteria | 11236 |
| 474 | Ga0307415_100138683 | 3300032126 | Bacteria | 1854 |
| 475 | Ga0307507_10102391 | 3300033179 | Bacteria | 2389 |
| 476 | Ga0373948_0009199 | 3300034817 | Bacteria | 1700 |
| 477 | Ga0373950_0004352 | 3300034818 | Bacteria | 2072 |
| 478 | Ga0373958_0003682 | 3300034819 | Bacteria | 2228 |
| 479 | Ga0373958_0008772 | 3300034819 | Bacteria | 1647 |
| 480 | Ga0373959_0010585 | 3300034820 | Bacteria | 1614 |
| 481 | Ga0373926_0004191 | 3300035083 | Bacteria | 4705 |
| 482 | Ga0373929_0004041 | 3300035085 | Bacteria | 2629 |
| 483 | Ga0373940_0010255 | 3300035088 | Bacteria | 2198 |
| 484 | Ga0373949_0004829 | 3300035090 | Bacteria | 3054 |
| 485 | Ga0373949_0025914 | 3300035090 | Bacteria | 1371 |
| 486 | Ga0373951_0006426 | 3300035091 | Bacteria | 2688 |
| 487 | Ga0373941_0014138 | 3300035115 | Bacteria | 2126 |
| 488 | Ga0373945_0012531 | 3300035116 | Bacteria | 2818 |
| 489 | Ga0373956_0098723 | 3300035119 | Bacteria | 1353 |
| 490 | Ga0373960_0021080 | 3300035121 | Bacteria | 1729 |
| 491 | Ga0373960_0022792 | 3300035121 | Bacteria | 1681 |
| 492 | Ga0373943_0000485 | 3300035170 | Bacteria | 16976 |
| 493 | Ga0373943_0007678 | 3300035170 | Bacteria | 4845 |
| 494 | Ga0373946_0014141 | 3300035171 | Bacteria | 3007 |
| 495 | Ga0373955_0056223 | 3300035172 | Bacteria | 2158 |
| 496 | Ga0373942_0009194 | 3300035207 | Bacteria | 2310 |
| 497 | Ga0373962_0015267 | 3300035242 | Bacteria | 1967 |
| 498 | Ga0373962_0026692 | 3300035242 | Bacteria | 1558 |
| 499 | Ga0373924_0111493 | 3300035410 | Bacteria | 1183 |
| 500 | Ga0373931_0024091 | 3300035691 | Bacteria | 3079 |
| 501 | Ga0373931_0055222 | 3300035691 | Bacteria | 2124 |
| 502 | Ga0373931_0063205 | 3300035691 | Bacteria | 2000 |
| 503 | Ga0373935_0017406 | 3300035692 | Bacteria | 4361 |
| 504 | Ga0373935_0020284 | 3300035692 | Bacteria | 4060 |
| 505 | Ga0373935_0049449 | 3300035692 | Bacteria | 2665 |
| 506 | Ga0373935_0176799 | 3300035692 | Bacteria | 1463 |
| 507 | Ga0373935_0201190 | 3300035692 | Bacteria | 1376 |
| 508 | Ga0373933_0028542 | 3300035724 | Bacteria | 3220 |
| 509 | Ga0373933_0075786 | 3300035724 | Bacteria | 2054 |
| 510 | Ga0373933_0136809 | 3300035724 | Bacteria | 1544 |
| 511 | Ga0373947_0002997 | 3300035725 | Bacteria | 10071 |
| 512 | Ga0373947_0019181 | 3300035725 | Bacteria | 3942 |
| 513 | Ga0373947_0038498 | 3300035725 | Bacteria | 2841 |
| 514 | Ga0373937_0003925 | 3300036401 | Bacteria | 12581 |
| 515 | Ga0373925_0009978 | 3300037068 | Bacteria | 6897 |
| 516 | Ga0373925_0026517 | 3300037068 | Bacteria | 4240 |
| 517 | Ga0395899_0004010 | 3300037312 | Bacteria | 11605 |
| 518 | Ga0395899_0006507 | 3300037312 | Bacteria | 9051 |
| 519 | Ga0395899_0006761 | 3300037312 | Bacteria | 8881 |
| 520 | Ga0395899_0011275 | 3300037312 | Bacteria | 6846 |
| 521 | Ga0395899_0014532 | 3300037312 | Bacteria | 6011 |
| 522 | Ga0395899_0025260 | 3300037312 | Bacteria | 4485 |
| 523 | Ga0395899_0025933 | 3300037312 | Bacteria | 4424 |
| 524 | Ga0395899_0036950 | 3300037312 | Bacteria | 3662 |
| 525 | Ga0395899_0061735 | 3300037312 | Bacteria | 2760 |
| 526 | Ga0395899_0115104 | 3300037312 | Bacteria | 1930 |
| 527 | Ga0395899_0129833 | 3300037312 | Bacteria | 1800 |
| 528 | Ga0395900_0002828 | 3300037418 | Bacteria | 18940 |
| 529 | Ga0395900_0003593 | 3300037418 | Bacteria | 16669 |
| 530 | Ga0395900_0004234 | 3300037418 | Bacteria | 15230 |
| 531 | Ga0395900_0006278 | 3300037418 | Bacteria | 12400 |
| 532 | Ga0395900_0033157 | 3300037418 | Bacteria | 5315 |
| 533 | Ga0395900_0061528 | 3300037418 | Bacteria | 3860 |
| 534 | Ga0395900_0080687 | 3300037418 | Bacteria | 3343 |
| 535 | Ga0395900_0093962 | 3300037418 | Bacteria | 3080 |
| 536 | Ga0395900_0122367 | 3300037418 | Bacteria | 2669 |
| 537 | Ga0395900_0165520 | 3300037418 | Bacteria | 2254 |
| 538 | Ga0395900_0172585 | 3300037418 | Bacteria | 2200 |
| 539 | Ga0395900_0192711 | 3300037418 | Bacteria | 2066 |
| 540 | Ga0395900_0276367 | 3300037418 | Bacteria | 1673 |
| 541 | Ga0395900_0331965 | 3300037418 | Bacteria | 1498 |
| 542 | Ga0395900_0589635 | 3300037418 | Bacteria | 1053 |
| 543 | Ga0395898_0001134 | 3300037466 | Bacteria | 40919 |
| 544 | Ga0395898_0005553 | 3300037466 | Bacteria | 13601 |
| 545 | Ga0395898_0007704 | 3300037466 | Bacteria | 11433 |
| 546 | Ga0395898_0013807 | 3300037466 | Bacteria | 8303 |
| 547 | Ga0395898_0019229 | 3300037466 | Bacteria | 6953 |
| 548 | Ga0395898_0027207 | 3300037466 | Bacteria | 5744 |
| 549 | Ga0395898_0049785 | 3300037466 | Bacteria | 4104 |
| 550 | Ga0395898_0053081 | 3300037466 | Bacteria | 3959 |
| 551 | Ga0395898_0061284 | 3300037466 | Bacteria | 3654 |
| 552 | Ga0395898_0072008 | 3300037466 | Bacteria | 3339 |
| 553 | Ga0395898_0109197 | 3300037466 | Bacteria | 2652 |
| 554 | Ga0395898_0152234 | 3300037466 | Bacteria | 2212 |
| 555 | Ga0395898_0158144 | 3300037466 | Bacteria | 2167 |
| 556 | Ga0395898_0316661 | 3300037466 | Bacteria | 1488 |
| 557 | Ga0395898_0710203 | 3300037466 | Bacteria | 947 |
| 558 | Ga0395905_0002236 | 3300037471 | Bacteria | 21813 |
| 559 | Ga0395905_0006381 | 3300037471 | Bacteria | 11885 |
| 560 | Ga0395905_0010133 | 3300037471 | Bacteria | 9187 |
| 561 | Ga0395905_0012265 | 3300037471 | Bacteria | 8255 |
| 562 | Ga0395905_0018237 | 3300037471 | Bacteria | 6662 |
| 563 | Ga0395905_0023180 | 3300037471 | Bacteria | 5869 |
| 564 | Ga0395905_0025136 | 3300037471 | Bacteria | 5617 |
| 565 | Ga0395905_0052866 | 3300037471 | Bacteria | 3802 |
| 566 | Ga0395905_0056536 | 3300037471 | Bacteria | 3670 |
| 567 | Ga0395905_0057121 | 3300037471 | Bacteria | 3650 |
| 568 | Ga0395905_0068620 | 3300037471 | Bacteria | 3320 |
| 569 | Ga0395905_0192110 | 3300037471 | Bacteria | 1915 |
| 570 | Ga0395905_0221312 | 3300037471 | Bacteria | 1771 |
| 571 | Ga0395905_0364826 | 3300037471 | Bacteria | 1337 |
| 572 | Ga0395901_0006426 | 3300038443 | Bacteria | 11911 |
| 573 | Ga0395901_0018217 | 3300038443 | Bacteria | 7169 |
| 574 | Ga0395901_0020672 | 3300038443 | Bacteria | 6737 |
| 575 | Ga0395901_0030818 | 3300038443 | Bacteria | 5527 |
| 576 | Ga0395901_0040926 | 3300038443 | Bacteria | 4800 |
| 577 | Ga0395901_0049417 | 3300038443 | Bacteria | 4369 |
| 578 | Ga0395901_0058774 | 3300038443 | Bacteria | 3999 |
| 579 | Ga0395901_0060585 | 3300038443 | Bacteria | 3938 |
| 580 | Ga0395901_0122764 | 3300038443 | Bacteria | 2730 |
| 581 | Ga0395901_0126537 | 3300038443 | Bacteria | 2685 |
| 582 | Ga0395901_0133811 | 3300038443 | Bacteria | 2605 |
| 583 | Ga0395901_0136438 | 3300038443 | Bacteria | 2578 |
| 584 | Ga0395901_0145677 | 3300038443 | Bacteria | 2489 |
| 585 | Ga0395901_0180719 | 3300038443 | Bacteria | 2212 |
| 586 | Ga0395901_0359095 | 3300038443 | Bacteria | 1502 |
| 587 | Ga0436360_0394144 | 3300039438 | Bacteria | 1935 |
| 588 | Ga0436360_0881869 | 3300039438 | Bacteria | 5939 |
| 589 | Ga0436363_0255584 | 3300039450 | Bacteria | 3141 |
| 590 | Ga0439441_017247 | 3300042001 | Bacteria | 1294 |
| 591 | Ga0439450_014406 | 3300042008 | Bacteria | 1604 |
| 592 | Ga0439456_024456 | 3300042013 | Bacteria | 1281 |
| 593 | Ga0450907_015470 | 3300042146 | Bacteria | 1273 |
| 594 | Ga0439446_0049625 | 3300042156 | Bacteria | 1251 |
| 595 | Ga0439434_0075977 | 3300042435 | Bacteria | 1062 |
| 596 | Ga0466969_0000749 | 3300044656 | Bacteria | 17589 |
| 597 | Ga0466969_0007379 | 3300044656 | Bacteria | 5845 |
| 598 | Ga0466969_0073565 | 3300044656 | Bacteria | 1640 |
| 599 | Ga0466965_0013039 | 3300044683 | Bacteria | 3916 |
| 600 | Ga0466965_0065176 | 3300044683 | Bacteria | 1825 |
| 601 | Ga0466965_0138536 | 3300044683 | Bacteria | 1265 |
| 602 | Ga0466966_0039970 | 3300044684 | Bacteria | 3019 |
| 603 | Ga0466966_0103162 | 3300044684 | Bacteria | 1762 |
| 604 | Ga0466961_0000560 | 3300044693 | Bacteria | 23625 |
| 605 | Ga0466961_0014772 | 3300044693 | Bacteria | 5017 |
| 606 | Ga0466961_0029685 | 3300044693 | Bacteria | 3513 |
| 607 | Ga0466961_0076948 | 3300044693 | Bacteria | 2114 |
| 608 | Ga0466961_0097789 | 3300044693 | Bacteria | 1850 |
| 609 | Ga0466961_0196251 | 3300044693 | Bacteria | 1249 |
| 610 | Ga0466961_0203402 | 3300044693 | Bacteria | 1224 |
| 611 | Ga0466963_0000355 | 3300044694 | Bacteria | 20745 |
| 612 | Ga0466963_0001329 | 3300044694 | Bacteria | 13167 |
| 613 | Ga0466963_0001715 | 3300044694 | Bacteria | 11927 |
| 614 | Ga0466963_0005352 | 3300044694 | Bacteria | 7508 |
| 615 | Ga0466963_0007445 | 3300044694 | Bacteria | 6527 |
| 616 | Ga0466963_0012463 | 3300044694 | Bacteria | 5204 |
| 617 | Ga0466963_0012733 | 3300044694 | Bacteria | 5151 |
| 618 | Ga0466963_0012911 | 3300044694 | Bacteria | 5119 |
| 619 | Ga0466963_0013492 | 3300044694 | Bacteria | 5017 |
| 620 | Ga0466963_0020303 | 3300044694 | Bacteria | 4177 |
| 621 | Ga0466963_0033509 | 3300044694 | Bacteria | 3336 |
| 622 | Ga0466963_0038888 | 3300044694 | Bacteria | 3113 |
| 623 | Ga0466963_0049915 | 3300044694 | Bacteria | 2768 |
| 624 | Ga0466963_0055778 | 3300044694 | Bacteria | 2628 |
| 625 | Ga0466963_0056151 | 3300044694 | Bacteria | 2619 |
| 626 | Ga0466963_0059013 | 3300044694 | Bacteria | 2560 |
| 627 | Ga0466963_0063714 | 3300044694 | Unclassified | 2468 |
| 628 | Ga0466963_0078684 | 3300044694 | Bacteria | 2229 |
| 629 | Ga0466963_0095686 | 3300044694 | Bacteria | 2027 |
| 630 | Ga0466963_0292901 | 3300044694 | Bacteria | 1144 |
| 631 | Ga0466964_0000982 | 3300044706 | Bacteria | 9450 |
| 632 | Ga0466964_0024366 | 3300044706 | Bacteria | 2358 |
| 633 | Ga0466964_0024881 | 3300044706 | Bacteria | 2335 |
| 634 | Ga0466964_0025736 | 3300044706 | Bacteria | 2300 |
| 635 | Ga0466964_0027129 | 3300044706 | Bacteria | 2247 |
| 636 | Ga0466964_0037728 | 3300044706 | Bacteria | 1941 |
| 637 | Ga0466964_0042827 | 3300044706 | Bacteria | 1835 |
| 638 | Ga0466971_0003347 | 3300044719 | Bacteria | 6845 |
| 639 | Ga0466971_0005127 | 3300044719 | Bacteria | 5674 |
| 640 | Ga0466971_0007091 | 3300044719 | Bacteria | 4878 |
| 641 | Ga0466971_0007850 | 3300044719 | Bacteria | 4648 |
| 642 | Ga0466971_0017867 | 3300044719 | Bacteria | 3141 |
| 643 | Ga0466971_0077790 | 3300044719 | Bacteria | 1511 |
| 644 | Ga0466968_0000662 | 3300044735 | Bacteria | 11788 |
| 645 | Ga0466968_0005087 | 3300044735 | Bacteria | 4921 |
| 646 | Ga0466968_0032397 | 3300044735 | Bacteria | 2174 |
| 647 | Ga0466970_0006693 | 3300044765 | Bacteria | 5766 |
| 648 | Ga0466970_0010391 | 3300044765 | Bacteria | 4726 |
| 649 | Ga0466970_0135172 | 3300044765 | Bacteria | 1356 |
| 650 | Ga0466957_0004105 | 3300044842 | Bacteria | 8067 |
| 651 | Ga0466957_0021190 | 3300044842 | Bacteria | 3829 |
| 652 | Ga0466957_0027919 | 3300044842 | Bacteria | 3356 |
| 653 | Ga0466957_0032093 | 3300044842 | Bacteria | 3143 |
| 654 | Ga0466957_0105532 | 3300044842 | Bacteria | 1781 |
| 655 | Ga0466957_0112142 | 3300044842 | Bacteria | 1730 |
| 656 | Ga0466957_0227357 | 3300044842 | Bacteria | 1234 |
| 657 | Ga0466957_0321994 | 3300044842 | Bacteria | 1043 |
| 658 | Ga0466960_0012397 | 3300044901 | Bacteria | 3596 |
| 659 | Ga0466960_0040342 | 3300044901 | Bacteria | 2207 |
| 660 | Ga0466960_0143022 | 3300044901 | Bacteria | 1272 |
| 661 | Ga0466959_0001794 | 3300045049 | Bacteria | 13421 |
| 662 | Ga0466959_0005411 | 3300045049 | Bacteria | 8739 |
| 663 | Ga0466959_0019863 | 3300045049 | Bacteria | 4943 |
| 664 | Ga0466959_0033367 | 3300045049 | Bacteria | 3806 |
| 665 | Ga0466959_0082665 | 3300045049 | Bacteria | 2313 |
| 666 | Ga0466959_0104340 | 3300045049 | Bacteria | 2028 |
| 667 | Ga0451576_0262200 | 3300045051 | Bacteria | 1806 |
| 668 | Ga0451576_0283072 | 3300045051 | Bacteria | 1734 |
| 669 | Ga0466958_0000655 | 3300045836 | Bacteria | 14950 |
| 670 | Ga0466958_0001851 | 3300045836 | Bacteria | 10308 |
| 671 | Ga0466958_0007203 | 3300045836 | Bacteria | 6097 |
| 672 | Ga0466958_0007899 | 3300045836 | Bacteria | 5880 |
| 673 | Ga0466958_0014393 | 3300045836 | Bacteria | 4518 |
| 674 | Ga0466958_0014823 | 3300045836 | Bacteria | 4456 |
| 675 | Ga0466958_0019682 | 3300045836 | Bacteria | 3929 |
| 676 | Ga0466958_0021267 | 3300045836 | Bacteria | 3789 |
| 677 | Ga0466958_0031370 | 3300045836 | Bacteria | 3158 |
| 678 | Ga0466958_0032176 | 3300045836 | Bacteria | 3119 |
| 679 | Ga0466958_0058286 | 3300045836 | Bacteria | 2348 |
| 680 | Ga0466958_0067638 | 3300045836 | Bacteria | 2182 |
| 681 | Ga0466958_0077428 | 3300045836 | Bacteria | 2042 |
| 682 | Ga0466967_0000219 | 3300045976 | Bacteria | 24460 |
| 683 | Ga0466967_0002872 | 3300045976 | Bacteria | 10954 |
| 684 | Ga0466967_0003820 | 3300045976 | Bacteria | 9965 |
| 685 | Ga0466967_0008229 | 3300045976 | Bacteria | 7619 |
| 686 | Ga0466967_0012380 | 3300045976 | Bacteria | 6521 |
| 687 | Ga0466967_0017082 | 3300045976 | Bacteria | 5746 |
| 688 | Ga0466967_0022408 | 3300045976 | Bacteria | 5153 |
| 689 | Ga0466967_0026636 | 3300045976 | Bacteria | 4792 |
| 690 | Ga0466967_0027483 | 3300045976 | Bacteria | 4734 |
| 691 | Ga0466967_0027813 | 3300045976 | Bacteria | 4709 |
| 692 | Ga0466967_0035678 | 3300045976 | Bacteria | 4236 |
| 693 | Ga0466967_0044675 | 3300045976 | Bacteria | 3844 |
| 694 | Ga0466967_0068385 | 3300045976 | Bacteria | 3171 |
| 695 | Ga0466967_0081285 | 3300045976 | Bacteria | 2926 |
| 696 | Ga0466967_0086585 | 3300045976 | Bacteria | 2839 |
| 697 | Ga0466967_0098881 | 3300045976 | Bacteria | 2664 |
| 698 | Ga0466967_0101661 | 3300045976 | Bacteria | 2628 |
| 699 | Ga0466967_0102031 | 3300045976 | Bacteria | 2624 |
| 700 | Ga0466967_0126011 | 3300045976 | Bacteria | 2372 |
| 701 | Ga0466967_0137409 | 3300045976 | Bacteria | 2273 |
| 702 | Ga0466967_0170459 | 3300045976 | Bacteria | 2047 |
| 703 | Ga0466967_0203006 | 3300045976 | Bacteria | 1878 |
| 704 | Ga0466967_0258890 | 3300045976 | Bacteria | 1664 |
| 705 | Ga0466967_0274350 | 3300045976 | Bacteria | 1616 |
| 706 | Ga0466967_0383746 | 3300045976 | Unclassified | 1364 |
| 707 | Ga0495592_0001003 | 3300046454 | Bacteria | 19611 |
| 708 | Ga0495592_0002313 | 3300046454 | Bacteria | 13442 |
| 709 | Ga0495592_0054383 | 3300046454 | Bacteria | 2966 |
| 710 | Ga0495592_0112200 | 3300046454 | Bacteria | 1928 |
| 711 | Ga0495603_0000062 | 3300046455 | Bacteria | 46880 |
| 712 | Ga0495603_0007259 | 3300046455 | Bacteria | 6656 |
| 713 | Ga0495603_0076911 | 3300046455 | Bacteria | 1958 |
| 714 | Ga0495629_0017474 | 3300046459 | Bacteria | 5139 |
| 715 | Ga0495629_0050680 | 3300046459 | Bacteria | 2907 |
| 716 | Ga0495629_0090116 | 3300046459 | Bacteria | 2139 |
| 717 | Ga0495629_0120735 | 3300046459 | Bacteria | 1826 |
| 718 | Ga0495629_0222685 | 3300046459 | Bacteria | 1301 |
| 719 | Ga0495641_0008094 | 3300046461 | Bacteria | 6458 |
| 720 | Ga0495641_0011742 | 3300046461 | Bacteria | 4958 |
| 721 | Ga0495641_0028643 | 3300046461 | Bacteria | 2693 |
| 722 | Ga0495651_0000038 | 3300046462 | Bacteria | 97248 |
| 723 | Ga0495651_0054468 | 3300046462 | Bacteria | 3076 |
| 724 | Ga0495651_0075725 | 3300046462 | Bacteria | 2550 |
| 725 | Ga0495651_0106769 | 3300046462 | Bacteria | 2075 |
| 726 | Ga0495653_0014400 | 3300046463 | Bacteria | 6453 |
| 727 | Ga0495653_0017311 | 3300046463 | Bacteria | 5862 |
| 728 | Ga0495653_0069725 | 3300046463 | Bacteria | 2632 |
| 729 | Ga0495580_0037730 | 3300046472 | Bacteria | 3465 |
| 730 | Ga0495580_0063357 | 3300046472 | Bacteria | 2593 |
| 731 | Ga0495582_0000560 | 3300046473 | Bacteria | 20576 |
| 732 | Ga0495582_0008803 | 3300046473 | Bacteria | 5565 |
| 733 | Ga0495582_0020372 | 3300046473 | Bacteria | 3630 |
| 734 | Ga0495639_0000517 | 3300046475 | Bacteria | 18127 |
| 735 | Ga0495639_0090749 | 3300046475 | Bacteria | 1433 |
| 736 | Ga0495639_0162252 | 3300046475 | Bacteria | 1082 |
| 737 | Ga0495662_0028122 | 3300046476 | Bacteria | 2714 |
| 738 | Ga0495662_0102568 | 3300046476 | Bacteria | 1400 |
| 739 | Ga0495664_0136747 | 3300046477 | Bacteria | 1485 |
| 740 | Ga0495584_0163131 | 3300046491 | Bacteria | 1133 |
| 741 | Ga0495594_0000447 | 3300046499 | Bacteria | 20925 |
| 742 | Ga0495596_0069062 | 3300046500 | Unclassified | 1373 |
| 743 | Ga0495607_0060191 | 3300046501 | Bacteria | 2163 |
| 744 | Ga0495607_0096921 | 3300046501 | Bacteria | 1587 |
| 745 | Ga0495607_0166365 | 3300046501 | Bacteria | 1117 |
| 746 | Ga0495608_0002720 | 3300046511 | Bacteria | 12708 |
| 747 | Ga0495608_0019558 | 3300046511 | Bacteria | 4660 |
| 748 | Ga0495618_0001861 | 3300046514 | Bacteria | 13905 |
| 749 | Ga0495618_0038908 | 3300046514 | Bacteria | 2990 |
| 750 | Ga0495628_0000025 | 3300046516 | Bacteria | 127935 |
| 751 | Ga0495628_0034135 | 3300046516 | Bacteria | 4095 |
| 752 | Ga0495628_0037003 | 3300046516 | Bacteria | 3914 |
| 753 | Ga0495630_0001418 | 3300046517 | Bacteria | 16580 |
| 754 | Ga0495630_0009799 | 3300046517 | Bacteria | 6898 |
| 755 | Ga0495630_0066996 | 3300046517 | Bacteria | 2699 |
| 756 | Ga0495630_0231149 | 3300046517 | Bacteria | 1413 |
| 757 | Ga0495644_0002988 | 3300046523 | Bacteria | 6696 |
| 758 | Ga0495666_0000186 | 3300046526 | Bacteria | 26616 |
| 759 | Ga0495652_0000088 | 3300046529 | Bacteria | 98865 |
| 760 | Ga0495652_0019058 | 3300046529 | Bacteria | 6112 |
| 761 | Ga0495652_0041133 | 3300046529 | Bacteria | 3991 |
| 762 | Ga0495652_0043635 | 3300046529 | Bacteria | 3861 |
| 763 | Ga0495652_0214915 | 3300046529 | Bacteria | 1449 |
| 764 | Ga0495652_0227150 | 3300046529 | Bacteria | 1399 |
| 765 | Ga0495652_0229632 | 3300046529 | Bacteria | 1389 |
| 766 | Ga0495665_0035777 | 3300046531 | Bacteria | 2651 |
| 767 | Ga0495665_0129482 | 3300046531 | Bacteria | 1321 |
| 768 | Ga0495640_0028051 | 3300046533 | Bacteria | 4055 |
| 769 | Ga0495640_0160401 | 3300046533 | Bacteria | 1441 |
| 770 | Ga0495586_0020074 | 3300046535 | Bacteria | 3559 |
| 771 | Ga0495586_0085483 | 3300046535 | Bacteria | 1738 |
| 772 | Ga0495587_0002637 | 3300046536 | Bacteria | 11988 |
| 773 | Ga0495587_0108668 | 3300046536 | Bacteria | 1594 |
| 774 | Ga0495587_0116283 | 3300046536 | Bacteria | 1534 |
| 775 | Ga0495609_0062728 | 3300046538 | Bacteria | 1641 |
| 776 | Ga0495645_0000024 | 3300046543 | Bacteria | 125065 |
| 777 | Ga0495645_0009655 | 3300046543 | Bacteria | 6748 |
| 778 | Ga0495645_0055960 | 3300046543 | Bacteria | 2864 |
| 779 | Ga0495622_0098689 | 3300046557 | Bacteria | 1339 |
| 780 | Ga0495667_0002973 | 3300046559 | Bacteria | 11364 |
| 781 | Ga0495667_0033428 | 3300046559 | Bacteria | 3442 |
| 782 | Ga0495667_0041717 | 3300046559 | Bacteria | 3043 |
| 783 | Ga0495667_0081995 | 3300046559 | Bacteria | 2096 |
| 784 | Ga0495667_0129403 | 3300046559 | Bacteria | 1629 |
| 785 | Ga0495656_0001592 | 3300046615 | Bacteria | 7433 |
| 786 | Ga0495656_0092264 | 3300046615 | Bacteria | 1387 |
| 787 | Ga0495656_0140061 | 3300046615 | Bacteria | 1159 |
| 788 | Ga0495634_0031612 | 3300046642 | Bacteria | 3644 |
| 789 | Ga0495634_0033819 | 3300046642 | Bacteria | 3510 |
| 790 | Ga0495634_0052255 | 3300046642 | Bacteria | 2739 |
| 791 | Ga0495634_0246242 | 3300046642 | Unclassified | 1095 |
| 792 | Ga0495635_0015180 | 3300046663 | Bacteria | 5388 |
| 793 | Ga0495588_0000632 | 3300046674 | Bacteria | 16378 |
| 794 | Ga0495588_0114027 | 3300046674 | Bacteria | 1424 |
| 795 | Ga0495657_0022864 | 3300046675 | Bacteria | 4473 |
| 796 | Ga0495657_0038995 | 3300046675 | Bacteria | 3266 |
| 797 | Ga0495657_0159811 | 3300046675 | Bacteria | 1395 |
| 798 | Ga0495599_0000019 | 3300046678 | Bacteria | 141108 |
| 799 | Ga0495599_0117614 | 3300046678 | Bacteria | 1653 |
| 800 | Ga0495623_0000032 | 3300046679 | Bacteria | 84435 |
| 801 | Ga0495623_0082329 | 3300046679 | Bacteria | 1989 |
| 802 | Ga0495646_0087168 | 3300046680 | Bacteria | 1809 |
| 803 | Ga0495647_0000811 | 3300046681 | Bacteria | 9345 |
| 804 | Ga0495647_0021859 | 3300046681 | Bacteria | 2307 |
| 805 | Ga0495647_0022573 | 3300046681 | Bacteria | 2274 |
| 806 | Ga0495647_0031045 | 3300046681 | Bacteria | 1986 |
| 807 | Ga0495647_0070639 | 3300046681 | Bacteria | 1397 |
| 808 | Ga0495658_0001241 | 3300046683 | Bacteria | 13401 |
| 809 | Ga0495658_0015566 | 3300046683 | Bacteria | 3903 |
| 810 | Ga0495658_0029375 | 3300046683 | Bacteria | 2976 |
| 811 | Ga0495658_0075027 | 3300046683 | Bacteria | 1972 |
| 812 | Ga0495613_0017903 | 3300046689 | Bacteria | 5282 |
| 813 | Ga0495613_0026998 | 3300046689 | Bacteria | 4274 |
| 814 | Ga0495613_0110740 | 3300046689 | Bacteria | 1978 |
| 815 | Ga0495613_0326211 | 3300046689 | Bacteria | 1059 |
| 816 | Ga0495624_0008189 | 3300046690 | Bacteria | 7311 |
| 817 | Ga0495624_0070883 | 3300046690 | Bacteria | 2169 |
| 818 | Ga0495671_0046187 | 3300046692 | Bacteria | 2178 |
| 819 | Ga0495589_0045883 | 3300046794 | Bacteria | 2170 |
| 820 | Ga0495600_0034542 | 3300046809 | Bacteria | 3283 |
| 821 | Ga0495600_0123192 | 3300046809 | Bacteria | 1686 |
| 822 | Ga0495600_0143721 | 3300046809 | Bacteria | 1547 |
| 823 | Ga0495600_0182927 | 3300046809 | Bacteria | 1350 |
| 824 | Ga0495581_0002069 | 3300047315 | Bacteria | 11286 |
| 825 | Ga0495581_0003648 | 3300047315 | Bacteria | 8866 |
| 826 | Ga0495581_0099162 | 3300047315 | Bacteria | 1692 |
| 827 | Ga0495604_0000128 | 3300047317 | Bacteria | 63743 |
| 828 | Ga0495604_0086098 | 3300047317 | Bacteria | 2344 |
| 829 | Ga0495604_0183546 | 3300047317 | Bacteria | 1462 |
| 830 | Ga0495674_0032285 | 3300047319 | Bacteria | 4750 |
| 831 | Ga0495674_0065311 | 3300047319 | Bacteria | 3161 |
| 832 | Ga0495674_0080843 | 3300047319 | Bacteria | 2788 |
| 833 | Ga0495676_0000253 | 3300047321 | Bacteria | 43107 |
| 834 | Ga0495676_0018217 | 3300047321 | Bacteria | 6193 |
| 835 | Ga0495676_0075731 | 3300047321 | Bacteria | 2572 |
| 836 | Ga0495676_0134668 | 3300047321 | Bacteria | 1778 |
| 837 | Ga0495676_0140450 | 3300047321 | Bacteria | 1732 |
| 838 | Ga0495680_0002766 | 3300047322 | Bacteria | 17688 |
| 839 | Ga0495680_0018043 | 3300047322 | Bacteria | 6005 |
| 840 | Ga0495680_0018302 | 3300047322 | Bacteria | 5952 |
| 841 | Ga0495680_0044914 | 3300047322 | Bacteria | 3491 |
| 842 | Ga0495680_0188464 | 3300047322 | Bacteria | 1485 |
| 843 | Ga0495680_0256521 | 3300047322 | Bacteria | 1238 |
| 844 | Ga0495675_0000007 | 3300047444 | Bacteria | 162640 |
| 845 | Ga0495684_0019114 | 3300047471 | Bacteria | 5275 |
| 846 | Ga0495684_0027520 | 3300047471 | Bacteria | 4365 |
| 847 | Ga0495684_0029481 | 3300047471 | Bacteria | 4211 |
| 848 | Ga0495593_0000358 | 3300047673 | Bacteria | 25227 |
| 849 | Ga0495602_0000246 | 3300048088 | Bacteria | 50728 |
| 850 | Ga0495602_0062805 | 3300048088 | Bacteria | 3221 |
| 851 | Ga0495602_0121928 | 3300048088 | Bacteria | 2096 |
| 852 | Ga0496100_0076117 | 3300048903 | Bacteria | 2252 |
| 853 | Ga0496100_0143962 | 3300048903 | Bacteria | 1693 |
| 854 | Ga0496100_0194042 | 3300048903 | Bacteria | 1476 |
| 855 | Ga0496100_0199318 | 3300048903 | Bacteria | 1458 |
| 856 | Ga0496100_0287729 | 3300048903 | Bacteria | 1227 |
| 857 | Ga0496101_0076125 | 3300048904 | Bacteria | 2471 |
| 858 | Ga0496101_0156241 | 3300048904 | Bacteria | 1747 |
| 859 | Ga0496102_0015928 | 3300048905 | Bacteria | 6560 |
| 860 | Ga0496102_0044862 | 3300048905 | Bacteria | 4012 |
| 861 | Ga0496102_0148864 | 3300048905 | Bacteria | 2198 |
| 862 | Ga0496102_0272646 | 3300048905 | Bacteria | 1595 |
| 863 | Ga0496102_0300361 | 3300048905 | Bacteria | 1513 |
| 864 | Ga0496103_0005447 | 3300048906 | Bacteria | 7613 |
| 865 | Ga0496103_0012699 | 3300048906 | Bacteria | 4996 |
| 866 | Ga0496103_0031665 | 3300048906 | Bacteria | 3224 |
| 867 | Ga0496103_0043277 | 3300048906 | Bacteria | 2772 |
| 868 | Ga0496104_0002359 | 3300048907 | Bacteria | 16318 |
| 869 | Ga0496104_0003973 | 3300048907 | Bacteria | 12803 |
| 870 | Ga0496104_0007410 | 3300048907 | Bacteria | 9695 |
| 871 | Ga0496104_0047719 | 3300048907 | Bacteria | 4037 |
| 872 | Ga0496104_0136424 | 3300048907 | Bacteria | 2357 |
| 873 | Ga0496104_0205254 | 3300048907 | Bacteria | 1882 |
| 874 | Ga0496105_0000042 | 3300048908 | Bacteria | 114886 |
| 875 | Ga0496105_0003530 | 3300048908 | Bacteria | 11596 |
| 876 | Ga0496105_0018165 | 3300048908 | Bacteria | 5646 |
| 877 | Ga0496105_0103642 | 3300048908 | Bacteria | 2349 |
| 878 | Ga0496105_0153980 | 3300048908 | Bacteria | 1888 |
| 879 | Ga0496105_0172311 | 3300048908 | Bacteria | 1774 |
| 880 | Ga0496105_0429524 | 3300048908 | Bacteria | 1045 |
| 881 | Ga0496106_0003639 | 3300048909 | Bacteria | 11495 |
| 882 | Ga0496106_0014103 | 3300048909 | Bacteria | 5905 |
| 883 | Ga0496106_0016966 | 3300048909 | Bacteria | 5389 |
| 884 | Ga0496106_0039400 | 3300048909 | Bacteria | 3539 |
| 885 | Ga0496106_0100183 | 3300048909 | Bacteria | 2246 |
| 886 | Ga0496106_0160704 | 3300048909 | Bacteria | 1776 |
| 887 | Ga0496107_0003668 | 3300048910 | Bacteria | 10322 |
| 888 | Ga0496107_0016603 | 3300048910 | Bacteria | 5173 |
| 889 | Ga0496107_0022333 | 3300048910 | Bacteria | 4471 |
| 890 | Ga0496107_0088641 | 3300048910 | Bacteria | 2258 |
| 891 | Ga0496107_0206775 | 3300048910 | Bacteria | 1459 |
| 892 | Ga0496108_0001658 | 3300048911 | Bacteria | 17647 |
| 893 | Ga0496108_0016705 | 3300048911 | Bacteria | 5995 |
| 894 | Ga0496108_0018902 | 3300048911 | Bacteria | 5651 |
| 895 | Ga0496108_0024398 | 3300048911 | Bacteria | 4978 |
| 896 | Ga0496108_0102798 | 3300048911 | Bacteria | 2438 |
| 897 | Ga0496108_0128285 | 3300048911 | Bacteria | 2179 |
| 898 | Ga0496108_0305360 | 3300048911 | Bacteria | 1386 |
| 899 | Ga0496109_0001544 | 3300048912 | Bacteria | 19145 |
| 900 | Ga0496109_0033522 | 3300048912 | Bacteria | 4620 |
| 901 | Ga0496109_0044409 | 3300048912 | Bacteria | 4031 |
| 902 | Ga0496109_0055983 | 3300048912 | Bacteria | 3598 |
| 903 | Ga0496109_0113334 | 3300048912 | Bacteria | 2522 |
| 904 | Ga0496109_0138252 | 3300048912 | Bacteria | 2277 |
| 905 | Ga0496109_0205551 | 3300048912 | Bacteria | 1851 |
| 906 | Ga0496109_0279857 | 3300048912 | Bacteria | 1572 |
| 907 | Ga0496110_0000050 | 3300048913 | Bacteria | 59023 |
| 908 | Ga0496110_0011943 | 3300048913 | Bacteria | 7135 |
| 909 | Ga0496110_0090840 | 3300048913 | Bacteria | 2731 |
| 910 | Ga0496110_0156666 | 3300048913 | Bacteria | 2063 |
| 911 | Ga0496110_0171147 | 3300048913 | Bacteria | 1970 |
| 912 | Ga0496110_0204690 | 3300048913 | Bacteria | 1793 |
| 913 | Ga0496110_0372610 | 3300048913 | Bacteria | 1301 |
| 914 | Ga0496110_0608915 | 3300048913 | Bacteria | 990 |
| 915 | Ga0496111_0000439 | 3300048914 | Bacteria | 21067 |
| 916 | Ga0496111_0000734 | 3300048914 | Bacteria | 17468 |
| 917 | Ga0496111_0007486 | 3300048914 | Bacteria | 7162 |
| 918 | Ga0496111_0057934 | 3300048914 | Bacteria | 2804 |
| 919 | Ga0496111_0071315 | 3300048914 | Bacteria | 2528 |
| 920 | Ga0496111_0073513 | 3300048914 | Bacteria | 2489 |
| 921 | Ga0496111_0120089 | 3300048914 | Bacteria | 1941 |
| 922 | Ga0496111_0241902 | 3300048914 | Bacteria | 1340 |
| 923 | Ga0496112_0003989 | 3300048915 | Bacteria | 12369 |
| 924 | Ga0496112_0028410 | 3300048915 | Bacteria | 5398 |
| 925 | Ga0496112_0032775 | 3300048915 | Bacteria | 5045 |
| 926 | Ga0496112_0090149 | 3300048915 | Bacteria | 3035 |
| 927 | Ga0496112_0206812 | 3300048915 | Bacteria | 1920 |
| 928 | Ga0496112_0239766 | 3300048915 | Bacteria | 1766 |
| 929 | Ga0496112_0342378 | 3300048915 | Bacteria | 1438 |
| 930 | Ga0496113_0000348 | 3300048916 | Bacteria | 22048 |
| 931 | Ga0496113_0029569 | 3300048916 | Bacteria | 3959 |
| 932 | Ga0496113_0041307 | 3300048916 | Bacteria | 3403 |
| 933 | Ga0496114_0011285 | 3300048917 | Bacteria | 7135 |
| 934 | Ga0496114_0021288 | 3300048917 | Bacteria | 5273 |
| 935 | Ga0496114_0067293 | 3300048917 | Bacteria | 3005 |
| 936 | Ga0496114_0119631 | 3300048917 | Bacteria | 2264 |
| 937 | Ga0496114_0131769 | 3300048917 | Bacteria | 2159 |
| 938 | Ga0496114_0158162 | 3300048917 | Bacteria | 1969 |
| 939 | Ga0496114_0209371 | 3300048917 | Bacteria | 1710 |
| 940 | Ga0496114_0228206 | 3300048917 | Bacteria | 1635 |
| 941 | Ga0496115_0024979 | 3300048918 | Bacteria | 4648 |
| 942 | Ga0496115_0105449 | 3300048918 | Bacteria | 2313 |
| 943 | Ga0496115_0159740 | 3300048918 | Bacteria | 1862 |
| 944 | Ga0496115_0377945 | 3300048918 | Bacteria | 1152 |
| 945 | Ga0496115_0415806 | 3300048918 | Bacteria | 1090 |
| 946 | Ga0501031_0008119 | 3300049568 | Bacteria | 6837 |
| 947 | Ga0501033_0073085 | 3300049570 | Bacteria | 2518 |
| 948 | Ga0501036_0026468 | 3300049572 | Bacteria | 4896 |
| 949 | Ga0501039_0025405 | 3300049575 | Bacteria | 4551 |
| 950 | Ga0501039_0421906 | 3300049575 | Bacteria | 1048 |
| 951 | Ga0501040_0035637 | 3300049576 | Bacteria | 3375 |
| 952 | Ga0501041_0002691 | 3300049577 | Bacteria | 10137 |
| 953 | Ga0501041_0172052 | 3300049577 | Bacteria | 1355 |
| 954 | Ga0501042_0006512 | 3300049578 | Bacteria | 7586 |
| 955 | Ga0501046_0111991 | 3300049580 | Bacteria | 2084 |
| 956 | Ga0501047_0053297 | 3300049581 | Bacteria | 3911 |
| 957 | Ga0501047_0247748 | 3300049581 | Bacteria | 1631 |
| 958 | Ga0501048_0012008 | 3300049582 | Bacteria | 6455 |
| 959 | Ga0501067_0014659 | 3300049583 | Bacteria | 4339 |
| 960 | Ga0501067_0113394 | 3300049583 | Bacteria | 1507 |
| 961 | Ga0501069_0050934 | 3300049585 | Bacteria | 2303 |
| 962 | Ga0501069_0099886 | 3300049585 | Bacteria | 1647 |
| 963 | Ga0501070_0076082 | 3300049586 | Bacteria | 2779 |
| 964 | Ga0501070_0206354 | 3300049586 | Bacteria | 1613 |
| 965 | Ga0501071_0090727 | 3300049587 | Bacteria | 2244 |
| 966 | Ga0501072_0002912 | 3300049588 | Bacteria | 12879 |
| 967 | Ga0501072_0008797 | 3300049588 | Bacteria | 7667 |
| 968 | Ga0501072_0083649 | 3300049588 | Bacteria | 2530 |
| 969 | Ga0501073_0121549 | 3300049589 | Bacteria | 1810 |
| 970 | Ga0501074_0146850 | 3300049590 | Bacteria | 1686 |
| 971 | Ga0501075_0011065 | 3300049591 | Bacteria | 6368 |
| 972 | Ga0501075_0258859 | 3300049591 | Bacteria | 1326 |
| 973 | Ga0501076_0002641 | 3300049592 | Bacteria | 12370 |
| 974 | Ga0501076_0119311 | 3300049592 | Bacteria | 2136 |
| 975 | Ga0501077_0001491 | 3300049593 | Bacteria | 14106 |
| 976 | Ga0501077_0014568 | 3300049593 | Bacteria | 4943 |
| 977 | Ga0501077_0146994 | 3300049593 | Bacteria | 1495 |
| 978 | Ga0501079_0078856 | 3300049741 | Bacteria | 2547 |
| 979 | Ga0501079_0107983 | 3300049741 | Bacteria | 2160 |
| 980 | Ga0501080_0017611 | 3300049742 | Bacteria | 6606 |
| 981 | Ga0501080_0050844 | 3300049742 | Bacteria | 3856 |
| 982 | Ga0501081_0024489 | 3300049743 | Bacteria | 4052 |
| 983 | Ga0501081_0047735 | 3300049743 | Bacteria | 2946 |
| 984 | Ga0501081_0055592 | 3300049743 | Bacteria | 2735 |
| 985 | Ga0501083_0001129 | 3300049744 | Bacteria | 17880 |
| 986 | Ga0501044_0226877 | 3300049823 | Bacteria | 1817 |
| 987 | nmdc:mga00v17_273990_c1 | 3300050491 | Bacteria | 1095 |
| 988 | nmdc:mga05p37_108574_c1 | 3300050507 | Bacteria | 3413 |
| 989 | nmdc:mga05p37_172030_c1 | 3300050507 | Bacteria | 2641 |
| 990 | nmdc:mga05p37_24422_c1 | 3300050507 | Bacteria | 7346 |
| 991 | nmdc:mga05p37_270310_c1 | 3300050507 | Bacteria | 2031 |
| 992 | nmdc:mga05p37_315261_c1 | 3300050507 | Bacteria | 1853 |
| 993 | nmdc:mga0qj67_27729_c1 | 3300050509 | Bacteria | 4391 |
| 994 | nmdc:mga06r32_110320_c1 | 3300050510 | Bacteria | 2706 |
| 995 | nmdc:mga08y16_112699_c1 | 3300050511 | Bacteria | 2831 |
| 996 | nmdc:mga08y16_159191_c1 | 3300050511 | Bacteria | 2346 |
| 997 | nmdc:mga0n895_168363_c1 | 3300050512 | Bacteria | 2223 |
| 998 | nmdc:mga0n895_926965_c1 | 3300050512 | Bacteria | 855 |
| 999 | nmdc:mga0rr50_11827_c1 | 3300050513 | Bacteria | 5605 |
| 1000 | nmdc:mga0rr50_133887_c1 | 3300050513 | Bacteria | 1987 |
| 1001 | nmdc:mga0rr50_215803_c1 | 3300050513 | Bacteria | 1583 |
| 1002 | nmdc:mga0rr50_98139_c1 | 3300050513 | Bacteria | 2296 |
| 1003 | nmdc:mga08x19_123982_c1 | 3300050514 | Bacteria | 1734 |
| 1004 | nmdc:mga08x19_22289_c1 | 3300050514 | Bacteria | 3922 |
| 1005 | nmdc:mga0a205_123064_c1 | 3300050515 | Bacteria | 2494 |
| 1006 | nmdc:mga0a205_93530_c1 | 3300050515 | Bacteria | 2904 |
| 1007 | Ga0495601_0000313 | 3300053077 | Bacteria | 25734 |
| 1008 | Ga0495601_0016312 | 3300053077 | Bacteria | 4501 |
| 1009 | Ga0495601_0022926 | 3300053077 | Bacteria | 3836 |
| 1010 | Ga0495601_0050349 | 3300053077 | Bacteria | 2627 |
| 1011 | Ga0495601_0064330 | 3300053077 | Bacteria | 2332 |
| 1012 | Ga0495601_0106150 | 3300053077 | Bacteria | 1816 |
| 1013 | Ga0495601_0180865 | 3300053077 | Bacteria | 1379 |
| 1014 | Ga0495612_0037473 | 3300053078 | Bacteria | 1969 |
| 1015 | Ga0495612_0040271 | 3300053078 | Bacteria | 1903 |
| 1016 | Ga0495612_0074261 | 3300053078 | Bacteria | 1421 |
| 1017 | Ga0495612_0088157 | 3300053078 | Bacteria | 1310 |
| 1018 | Ga0495619_0005391 | 3300053085 | Bacteria | 8102 |
| 1019 | Ga0495619_0006346 | 3300053085 | Bacteria | 7495 |
| 1020 | Ga0495619_0031125 | 3300053085 | Bacteria | 3456 |
| 1021 | Ga0495619_0138371 | 3300053085 | Bacteria | 1675 |
| 1022 | Ga0495619_0186611 | 3300053085 | Bacteria | 1435 |
| 1023 | Ga0501084_0036663 | 3300054114 | Bacteria | 4096 |
| 1024 | Ga0590077_022636 | 3300059426 | Bacteria | 1342 |
| 1025 | Ga0501082_0037979 | 3300060353 | Bacteria | 4153 |
| 1026 | Ga0501082_0218065 | 3300060353 | Bacteria | 1660 |
| 1027 | Ga0466962_0004666 | 3300061719 | Bacteria | 6580 |
| 1028 | Ga0466962_0006290 | 3300061719 | Bacteria | 5705 |
| 1029 | Ga0466962_0012287 | 3300061719 | Bacteria | 4116 |
| 1030 | Ga0466962_0035560 | 3300061719 | Bacteria | 2385 |
| 1031 | Ga0530510_0005837 | 3300061734 | Bacteria | 8532 |
| 1032 | Ga0530510_0123401 | 3300061734 | Bacteria | 1903 |
| 1033 | Ga0530510_0167468 | 3300061734 | Bacteria | 1627 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026121 | Ga0207683_10367784 | Ga0207683_103677842 | 238 |
| 2 | 3300050512 | nmdc:mga0n895_926965_c1 | nmdc:mga0n895_926965_c1_11_778 | 240 |
| 3 | 3300044694 | Ga0466963_0020303 | Ga0466963_0020303_1815_2654 | 241 |
| 4 | 3300047321 | Ga0495676_0140450 | Ga0495676_0140450_371_1264 | 251 |
| 5 | 3300009093 | Ga0105240_10094971 | Ga0105240_100949712 | 252 |
| 6 | 3300025913 | Ga0207695_10185683 | Ga0207695_101856832 | 252 |
| 7 | 3300035172 | Ga0373955_0056223 | Ga0373955_0056223_1191_2039 | 252 |
| 8 | 3300035724 | Ga0373933_0028542 | Ga0373933_0028542_1242_2090 | 252 |
| 9 | 3300046511 | Ga0495608_0002720 | Ga0495608_0002720_3692_4540 | 252 |
| 10 | 3300046514 | Ga0495618_0038908 | Ga0495618_0038908_1223_2071 | 252 |
| 11 | 3300047322 | Ga0495680_0002766 | Ga0495680_0002766_1340_2188 | 252 |
| 12 | 3300047471 | Ga0495684_0027520 | Ga0495684_0027520_1560_2408 | 252 |
| 13 | 3300005329 | Ga0070683_100026294 | Ga0070683_1000262943 | 254 |
| 14 | 3300005535 | Ga0070684_100031140 | Ga0070684_1000311403 | 254 |
| 15 | 3300009148 | Ga0105243_10320362 | Ga0105243_103203622 | 254 |
| 16 | 3300010375 | Ga0105239_10037540 | Ga0105239_100375402 | 254 |
| 17 | 3300025901 | Ga0207688_10018666 | Ga0207688_100186662 | 254 |
| 18 | 3300025927 | Ga0207687_10067416 | Ga0207687_100674162 | 254 |
| 19 | 3300048912 | Ga0496109_0055983 | Ga0496109_0055983_2035_2925 | 254 |
| 20 | 3300044693 | Ga0466961_0196251 | Ga0466961_0196251_252_1136 | 255 |
| 21 | 3300006051 | Ga0075364_10272592 | Ga0075364_102725922 | 256 |
| 22 | 3300050491 | nmdc:mga00v17_273990_c1 | nmdc:mga00v17_273990_c1_106_993 | 256 |
| 23 | 3300037466 | Ga0395898_0710203 | Ga0395898_0710203_94_930 | 257 |
| 24 | 3300045976 | Ga0466967_0086585 | Ga0466967_0086585_1583_2476 | 257 |
| 25 | 3300006846 | Ga0075430_100071532 | Ga0075430_1000715323 | 259 |
| 26 | 3300006852 | Ga0075433_10507689 | Ga0075433_105076891 | 259 |
| 27 | 3300009093 | Ga0105240_10359770 | Ga0105240_103597702 | 259 |
| 28 | 3300009147 | Ga0114129_10481359 | Ga0114129_104813592 | 259 |
| 29 | 3300037312 | Ga0395899_0014532 | Ga0395899_0014532_1267_2154 | 259 |
| 30 | 3300037312 | Ga0395899_0129833 | Ga0395899_0129833_199_1086 | 259 |
| 31 | 3300037418 | Ga0395900_0093962 | Ga0395900_0093962_1209_2096 | 259 |
| 32 | 3300037418 | Ga0395900_0122367 | Ga0395900_0122367_1046_1933 | 259 |
| 33 | 3300037466 | Ga0395898_0013807 | Ga0395898_0013807_608_1495 | 259 |
| 34 | 3300037466 | Ga0395898_0061284 | Ga0395898_0061284_1609_2496 | 259 |
| 35 | 3300037471 | Ga0395905_0052866 | Ga0395905_0052866_2083_2970 | 259 |
| 36 | 3300038443 | Ga0395901_0006426 | Ga0395901_0006426_3122_4009 | 259 |
| 37 | 3300038443 | Ga0395901_0359095 | Ga0395901_0359095_77_964 | 259 |
| 38 | 3300046455 | Ga0495603_0076911 | Ga0495603_0076911_52_939 | 259 |
| 39 | 3300046500 | Ga0495596_0069062 | Ga0495596_0069062_23_910 | 259 |
| 40 | 3300046501 | Ga0495607_0060191 | Ga0495607_0060191_642_1529 | 259 |
| 41 | 3300046501 | Ga0495607_0166365 | Ga0495607_0166365_207_1094 | 259 |
| 42 | 3300046615 | Ga0495656_0092264 | Ga0495656_0092264_34_921 | 259 |
| 43 | 3300046615 | Ga0495656_0140061 | Ga0495656_0140061_61_948 | 259 |
| 44 | 3300046674 | Ga0495588_0114027 | Ga0495588_0114027_257_1144 | 259 |
| 45 | 3300046692 | Ga0495671_0046187 | Ga0495671_0046187_626_1513 | 259 |
| 46 | 3300050507 | nmdc:mga05p37_172030_c1 | nmdc:mga05p37_172030_c1_455_1354 | 259 |
| 47 | 3300050509 | nmdc:mga0qj67_27729_c1 | nmdc:mga0qj67_27729_c1_3134_4033 | 259 |
| 48 | 3300050515 | nmdc:mga0a205_93530_c1 | nmdc:mga0a205_93530_c1_484_1371 | 259 |
| 49 | 3300005329 | Ga0070683_100026519 | Ga0070683_1000265194 | 260 |
| 50 | 3300005439 | Ga0070711_100203315 | Ga0070711_1002033152 | 260 |
| 51 | 3300005535 | Ga0070684_100015547 | Ga0070684_1000155473 | 260 |
| 52 | 3300005564 | Ga0070664_100038075 | Ga0070664_1000380753 | 260 |
| 53 | 3300005577 | Ga0068857_100002049 | Ga0068857_1000020494 | 260 |
| 54 | 3300025916 | Ga0207663_10035912 | Ga0207663_100359122 | 260 |
| 55 | 3300025944 | Ga0207661_10059310 | Ga0207661_100593102 | 260 |
| 56 | 3300026116 | Ga0207674_10003294 | Ga0207674_100032945 | 260 |
| 57 | 3300046459 | Ga0495629_0120735 | Ga0495629_0120735_920_1813 | 260 |
| 58 | 3300047322 | Ga0495680_0188464 | Ga0495680_0188464_435_1328 | 260 |
| 59 | 3300005329 | Ga0070683_100059085 | Ga0070683_1000590852 | 261 |
| 60 | 3300005347 | Ga0070668_100099447 | Ga0070668_1000994472 | 261 |
| 61 | 3300005436 | Ga0070713_100153066 | Ga0070713_1001530661 | 261 |
| 62 | 3300005439 | Ga0070711_100267971 | Ga0070711_1002679712 | 261 |
| 63 | 3300005518 | Ga0070699_100403485 | Ga0070699_1004034851 | 261 |
| 64 | 3300005535 | Ga0070684_100177024 | Ga0070684_1001770242 | 261 |
| 65 | 3300005614 | Ga0068856_100152871 | Ga0068856_1001528712 | 261 |
| 66 | 3300006028 | Ga0070717_10060586 | Ga0070717_100605863 | 261 |
| 67 | 3300025916 | Ga0207663_10092737 | Ga0207663_100927373 | 261 |
| 68 | 3300025928 | Ga0207700_10010214 | Ga0207700_100102143 | 261 |
| 69 | 3300025929 | Ga0207664_10002009 | Ga0207664_100020099 | 261 |
| 70 | 3300025944 | Ga0207661_10073908 | Ga0207661_100739082 | 261 |
| 71 | 3300025972 | Ga0207668_10229799 | Ga0207668_102297992 | 261 |
| 72 | 3300026078 | Ga0207702_10315948 | Ga0207702_103159482 | 261 |
| 73 | 3300035692 | Ga0373935_0017406 | Ga0373935_0017406_1607_2497 | 261 |
| 74 | 3300046473 | Ga0495582_0008803 | Ga0495582_0008803_3138_4028 | 261 |
| 75 | 3300046531 | Ga0495665_0129482 | Ga0495665_0129482_116_1006 | 261 |
| 76 | 3300046535 | Ga0495586_0085483 | Ga0495586_0085483_410_1300 | 261 |
| 77 | 3300046681 | Ga0495647_0031045 | Ga0495647_0031045_516_1406 | 261 |
| 78 | 3300046689 | Ga0495613_0026998 | Ga0495613_0026998_2084_2974 | 261 |
| 79 | 3300046690 | Ga0495624_0070883 | Ga0495624_0070883_856_1746 | 261 |
| 80 | 3300047315 | Ga0495581_0002069 | Ga0495581_0002069_4597_5487 | 261 |
| 81 | 3300047321 | Ga0495676_0018217 | Ga0495676_0018217_1256_2146 | 261 |
| 82 | 3300031242 | Ga0265329_10089138 | Ga0265329_100891381 | 262 |
| 83 | 3300046529 | Ga0495652_0214915 | Ga0495652_0214915_77_970 | 262 |
| 84 | 3300031251 | Ga0265327_10074592 | Ga0265327_100745922 | 263 |
| 85 | 3300035410 | Ga0373924_0111493 | Ga0373924_0111493_175_1026 | 263 |
| 86 | 3300046529 | Ga0495652_0229632 | Ga0495652_0229632_352_1242 | 263 |
| 87 | 3300025934 | Ga0207686_10365457 | Ga0207686_103654572 | 264 |
| 88 | 3300026089 | Ga0207648_10098634 | Ga0207648_100986343 | 264 |
| 89 | 3300025933 | Ga0207706_10328655 | Ga0207706_103286552 | 265 |
| 90 | 3300028800 | Ga0265338_10011694 | Ga0265338_100116947 | 267 |
| 91 | 3300031251 | Ga0265327_10007023 | Ga0265327_100070234 | 267 |
| 92 | 3300039438 | Ga0436360_0394144 | Ga0436360_0394144_392_1285 | 267 |
| 93 | 3300035724 | Ga0373933_0136809 | Ga0373933_0136809_55_948 | 268 |
| 94 | 3300049583 | Ga0501067_0014659 | Ga0501067_0014659_620_1507 | 268 |
| 95 | 3300049585 | Ga0501069_0099886 | Ga0501069_0099886_337_1224 | 268 |
| 96 | 3300006847 | Ga0075431_100030600 | Ga0075431_1000306002 | 269 |
| 97 | 3300028563 | Ga0265319_1003192 | Ga0265319_10031921 | 269 |
| 98 | 3300028573 | Ga0265334_10079001 | Ga0265334_100790012 | 269 |
| 99 | 3300028577 | Ga0265318_10003754 | Ga0265318_100037547 | 269 |
| 100 | 3300028654 | Ga0265322_10027343 | Ga0265322_100273431 | 269 |
| 101 | 3300028800 | Ga0265338_10014556 | Ga0265338_100145561 | 269 |
| 102 | 3300031235 | Ga0265330_10151185 | Ga0265330_101511851 | 269 |
| 103 | 3300031240 | Ga0265320_10007161 | Ga0265320_100071615 | 269 |
| 104 | 3300031241 | Ga0265325_10005433 | Ga0265325_100054335 | 269 |
| 105 | 3300031247 | Ga0265340_10061620 | Ga0265340_100616202 | 269 |
| 106 | 3300031249 | Ga0265339_10026079 | Ga0265339_100260792 | 269 |
| 107 | 3300031344 | Ga0265316_10011381 | Ga0265316_1001138110 | 269 |
| 108 | 3300031711 | Ga0265314_10018847 | Ga0265314_100188474 | 269 |
| 109 | 3300031712 | Ga0265342_10005444 | Ga0265342_100054445 | 269 |
| 110 | 3300032126 | Ga0307415_100138683 | Ga0307415_1001386832 | 269 |
| 111 | 3300042013 | Ga0439456_024456 | Ga0439456_024456_90_971 | 269 |
| 112 | 3300050507 | nmdc:mga05p37_108574_c1 | nmdc:mga05p37_108574_c1_1357_2238 | 269 |
| 113 | 3300005434 | Ga0070709_10069679 | Ga0070709_100696792 | 270 |
| 114 | 3300005435 | Ga0070714_100013212 | Ga0070714_1000132122 | 270 |
| 115 | 3300006173 | Ga0070716_100123972 | Ga0070716_1001239722 | 270 |
| 116 | 3300009147 | Ga0114129_10374721 | Ga0114129_103747212 | 270 |
| 117 | 3300028558 | Ga0265326_10051843 | Ga0265326_100518431 | 270 |
| 118 | 3300028563 | Ga0265319_1051171 | Ga0265319_10511712 | 270 |
| 119 | 3300028573 | Ga0265334_10006423 | Ga0265334_100064234 | 270 |
| 120 | 3300028577 | Ga0265318_10000315 | Ga0265318_100003152 | 270 |
| 121 | 3300028654 | Ga0265322_10025979 | Ga0265322_100259792 | 270 |
| 122 | 3300028800 | Ga0265338_10065694 | Ga0265338_100656942 | 270 |
| 123 | 3300031238 | Ga0265332_10006779 | Ga0265332_100067791 | 270 |
| 124 | 3300031239 | Ga0265328_10003597 | Ga0265328_100035975 | 270 |
| 125 | 3300031240 | Ga0265320_10057555 | Ga0265320_100575552 | 270 |
| 126 | 3300031241 | Ga0265325_10000170 | Ga0265325_100001702 | 270 |
| 127 | 3300031242 | Ga0265329_10020907 | Ga0265329_100209071 | 270 |
| 128 | 3300031247 | Ga0265340_10075987 | Ga0265340_100759872 | 270 |
| 129 | 3300031249 | Ga0265339_10030019 | Ga0265339_100300192 | 270 |
| 130 | 3300031250 | Ga0265331_10001277 | Ga0265331_1000127713 | 270 |
| 131 | 3300031251 | Ga0265327_10039105 | Ga0265327_100391052 | 270 |
| 132 | 3300031344 | Ga0265316_10009416 | Ga0265316_100094161 | 270 |
| 133 | 3300031712 | Ga0265342_10006088 | Ga0265342_100060881 | 270 |
| 134 | 3300046517 | Ga0495630_0009799 | Ga0495630_0009799_3316_4224 | 270 |
| 135 | 3300046535 | Ga0495586_0020074 | Ga0495586_0020074_2461_3369 | 270 |
| 136 | 3300046642 | Ga0495634_0031612 | Ga0495634_0031612_970_1878 | 270 |
| 137 | 3300046683 | Ga0495658_0015566 | Ga0495658_0015566_1182_2090 | 270 |
| 138 | 3300046689 | Ga0495613_0110740 | Ga0495613_0110740_886_1794 | 270 |
| 139 | 3300047319 | Ga0495674_0032285 | Ga0495674_0032285_3256_4164 | 270 |
| 140 | 3300048906 | Ga0496103_0005447 | Ga0496103_0005447_362_1210 | 272 |
| 141 | 3300048913 | Ga0496110_0011943 | Ga0496110_0011943_6273_7121 | 272 |
| 142 | 3300049581 | Ga0501047_0247748 | Ga0501047_0247748_300_1193 | 272 |
| 143 | 3300049586 | Ga0501070_0206354 | Ga0501070_0206354_254_1147 | 272 |
| 144 | 3300049588 | Ga0501072_0002912 | Ga0501072_0002912_2447_3340 | 272 |
| 145 | 3300049590 | Ga0501074_0146850 | Ga0501074_0146850_380_1273 | 272 |
| 146 | 3300049741 | Ga0501079_0078856 | Ga0501079_0078856_423_1316 | 272 |
| 147 | 3300049742 | Ga0501080_0017611 | Ga0501080_0017611_1885_2778 | 272 |
| 148 | 3300049744 | Ga0501083_0001129 | Ga0501083_0001129_588_1481 | 272 |
| 149 | 3300005327 | Ga0070658_10112980 | Ga0070658_101129802 | 273 |
| 150 | 3300025909 | Ga0207705_10105746 | Ga0207705_101057462 | 273 |
| 151 | 3300031995 | Ga0307409_100138894 | Ga0307409_1001388942 | 273 |
| 152 | 3300032002 | Ga0307416_100045473 | Ga0307416_1000454732 | 273 |
| 153 | 3300032005 | Ga0307411_10432514 | Ga0307411_104325142 | 273 |
| 154 | 3300032126 | Ga0307415_100001487 | Ga0307415_1000014878 | 273 |
| 155 | 3300037312 | Ga0395899_0025933 | Ga0395899_0025933_3030_3917 | 273 |
| 156 | 3300037418 | Ga0395900_0033157 | Ga0395900_0033157_3282_4124 | 273 |
| 157 | 3300037418 | Ga0395900_0080687 | Ga0395900_0080687_1463_2350 | 273 |
| 158 | 3300037466 | Ga0395898_0007704 | Ga0395898_0007704_2297_3184 | 273 |
| 159 | 3300037466 | Ga0395898_0316661 | Ga0395898_0316661_12_854 | 273 |
| 160 | 3300037471 | Ga0395905_0006381 | Ga0395905_0006381_9449_10291 | 273 |
| 161 | 3300037471 | Ga0395905_0023180 | Ga0395905_0023180_1463_2350 | 273 |
| 162 | 3300038443 | Ga0395901_0058774 | Ga0395901_0058774_1852_2694 | 273 |
| 163 | 3300038443 | Ga0395901_0126537 | Ga0395901_0126537_47_934 | 273 |
| 164 | 3300049575 | Ga0501039_0421906 | Ga0501039_0421906_171_1001 | 273 |
| 165 | 3300049593 | Ga0501077_0146994 | Ga0501077_0146994_620_1450 | 273 |
| 166 | 3300005327 | Ga0070658_10003082 | Ga0070658_1000308210 | 274 |
| 167 | 3300005435 | Ga0070714_100435120 | Ga0070714_1004351201 | 274 |
| 168 | 3300005563 | Ga0068855_100085831 | Ga0068855_1000858313 | 274 |
| 169 | 3300005614 | Ga0068856_100210424 | Ga0068856_1002104242 | 274 |
| 170 | 3300006175 | Ga0070712_100079294 | Ga0070712_1000792942 | 274 |
| 171 | 3300009093 | Ga0105240_10186695 | Ga0105240_101866952 | 274 |
| 172 | 3300013100 | Ga0157373_10121168 | Ga0157373_101211681 | 274 |
| 173 | 3300013104 | Ga0157370_10064257 | Ga0157370_100642572 | 274 |
| 174 | 3300013104 | Ga0157370_10118798 | Ga0157370_101187982 | 274 |
| 175 | 3300013105 | Ga0157369_10088380 | Ga0157369_100883803 | 274 |
| 176 | 3300020069 | Ga0197907_11090182 | Ga0197907_110901822 | 274 |
| 177 | 3300020070 | Ga0206356_10497752 | Ga0206356_104977521 | 274 |
| 178 | 3300020082 | Ga0206353_10670244 | Ga0206353_106702442 | 274 |
| 179 | 3300025909 | Ga0207705_10157899 | Ga0207705_101578992 | 274 |
| 180 | 3300025915 | Ga0207693_10276878 | Ga0207693_102768782 | 274 |
| 181 | 3300025919 | Ga0207657_10013989 | Ga0207657_100139895 | 274 |
| 182 | 3300025924 | Ga0207694_10368117 | Ga0207694_103681171 | 274 |
| 183 | 3300037466 | Ga0395898_0053081 | Ga0395898_0053081_407_1303 | 274 |
| 184 | 3300037471 | Ga0395905_0018237 | Ga0395905_0018237_5205_6101 | 274 |
| 185 | 3300038443 | Ga0395901_0018217 | Ga0395901_0018217_6130_7026 | 274 |
| 186 | 3300048915 | Ga0496112_0239766 | Ga0496112_0239766_218_1114 | 274 |
| 187 | 3300005327 | Ga0070658_10007291 | Ga0070658_100072917 | 275 |
| 188 | 3300005337 | Ga0070682_100134503 | Ga0070682_1001345032 | 275 |
| 189 | 3300025909 | Ga0207705_10034013 | Ga0207705_100340133 | 275 |
| 190 | 3300025949 | Ga0207667_10157764 | Ga0207667_101577641 | 275 |
| 191 | 3300031240 | Ga0265320_10016743 | Ga0265320_100167432 | 275 |
| 192 | 3300031249 | Ga0265339_10031373 | Ga0265339_100313732 | 275 |
| 193 | 3300031711 | Ga0265314_10020861 | Ga0265314_100208613 | 275 |
| 194 | 3300031712 | Ga0265342_10055751 | Ga0265342_100557512 | 275 |
| 195 | 3300032002 | Ga0307416_100122315 | Ga0307416_1001223153 | 275 |
| 196 | 3300042146 | Ga0450907_015470 | Ga0450907_015470_338_1237 | 275 |
| 197 | 3300046536 | Ga0495587_0116283 | Ga0495587_0116283_248_1138 | 275 |
| 198 | 3300046559 | Ga0495667_0033428 | Ga0495667_0033428_1327_2217 | 275 |
| 199 | 3300046679 | Ga0495623_0082329 | Ga0495623_0082329_866_1756 | 275 |
| 200 | 3300048088 | Ga0495602_0062805 | Ga0495602_0062805_243_1133 | 275 |
| 201 | 3300005435 | Ga0070714_100014958 | Ga0070714_1000149583 | 276 |
| 202 | 3300005436 | Ga0070713_100043209 | Ga0070713_1000432093 | 276 |
| 203 | 3300005467 | Ga0070706_100179072 | Ga0070706_1001790721 | 276 |
| 204 | 3300005616 | Ga0068852_100462689 | Ga0068852_1004626891 | 276 |
| 205 | 3300006028 | Ga0070717_10001757 | Ga0070717_1000175714 | 276 |
| 206 | 3300009094 | Ga0111539_10123999 | Ga0111539_101239992 | 276 |
| 207 | 3300013100 | Ga0157373_10179650 | Ga0157373_101796502 | 276 |
| 208 | 3300025922 | Ga0207646_10112691 | Ga0207646_101126911 | 276 |
| 209 | 3300025928 | Ga0207700_10074122 | Ga0207700_100741222 | 276 |
| 210 | 3300025929 | Ga0207664_10003758 | Ga0207664_100037588 | 276 |
| 211 | 3300026142 | Ga0207698_10735967 | Ga0207698_107359671 | 276 |
| 212 | 3300037312 | Ga0395899_0061735 | Ga0395899_0061735_1377_2270 | 276 |
| 213 | 3300037471 | Ga0395905_0221312 | Ga0395905_0221312_744_1637 | 276 |
| 214 | 3300038443 | Ga0395901_0145677 | Ga0395901_0145677_216_1109 | 276 |
| 215 | 3300050511 | nmdc:mga08y16_112699_c1 | nmdc:mga08y16_112699_c1_163_1050 | 276 |
| 216 | 3300053085 | Ga0495619_0186611 | Ga0495619_0186611_192_1064 | 276 |
| 217 | 3300005471 | Ga0070698_100042244 | Ga0070698_1000422442 | 277 |
| 218 | 3300005983 | Ga0081540_1017483 | Ga0081540_10174833 | 277 |
| 219 | 3300006058 | Ga0075432_10011481 | Ga0075432_100114812 | 277 |
| 220 | 3300006844 | Ga0075428_100030779 | Ga0075428_1000307793 | 277 |
| 221 | 3300006847 | Ga0075431_100102635 | Ga0075431_1001026353 | 277 |
| 222 | 3300006852 | Ga0075433_10021680 | Ga0075433_100216803 | 277 |
| 223 | 3300006871 | Ga0075434_100099755 | Ga0075434_1000997553 | 277 |
| 224 | 3300006914 | Ga0075436_100006811 | Ga0075436_1000068115 | 277 |
| 225 | 3300009094 | Ga0111539_10029561 | Ga0111539_100295612 | 277 |
| 226 | 3300009147 | Ga0114129_10017054 | Ga0114129_100170546 | 277 |
| 227 | 3300027907 | Ga0207428_10012037 | Ga0207428_100120377 | 277 |
| 228 | 3300031995 | Ga0307409_100044618 | Ga0307409_1000446183 | 277 |
| 229 | 3300037312 | Ga0395899_0004010 | Ga0395899_0004010_9318_10208 | 277 |
| 230 | 3300037418 | Ga0395900_0003593 | Ga0395900_0003593_9111_10001 | 277 |
| 231 | 3300037466 | Ga0395898_0001134 | Ga0395898_0001134_33486_34376 | 277 |
| 232 | 3300037471 | Ga0395905_0002236 | Ga0395905_0002236_8167_9057 | 277 |
| 233 | 3300038443 | Ga0395901_0040926 | Ga0395901_0040926_781_1671 | 277 |
| 234 | 3300050507 | nmdc:mga05p37_24422_c1 | nmdc:mga05p37_24422_c1_6312_7199 | 277 |
| 235 | 3300050510 | nmdc:mga06r32_110320_c1 | nmdc:mga06r32_110320_c1_1287_2174 | 277 |
| 236 | 3300050511 | nmdc:mga08y16_159191_c1 | nmdc:mga08y16_159191_c1_368_1255 | 277 |
| 237 | 3300050513 | nmdc:mga0rr50_215803_c1 | nmdc:mga0rr50_215803_c1_430_1317 | 277 |
| 238 | 3300050514 | nmdc:mga08x19_123982_c1 | nmdc:mga08x19_123982_c1_607_1494 | 277 |
| 239 | 3300053078 | Ga0495612_0074261 | Ga0495612_0074261_533_1384 | 277 |
| 240 | 3300005471 | Ga0070698_100185561 | Ga0070698_1001855612 | 278 |
| 241 | 3300025929 | Ga0207664_10102183 | Ga0207664_101021834 | 278 |
| 242 | 3300031241 | Ga0265325_10033619 | Ga0265325_100336192 | 278 |
| 243 | 3300031250 | Ga0265331_10123830 | Ga0265331_101238302 | 278 |
| 244 | 3300031595 | Ga0265313_10014891 | Ga0265313_100148913 | 278 |
| 245 | 3300039450 | Ga0436363_0255584 | Ga0436363_0255584_20_910 | 278 |
| 246 | 3300044706 | Ga0466964_0025736 | Ga0466964_0025736_547_1440 | 278 |
| 247 | 3300045976 | Ga0466967_0008229 | Ga0466967_0008229_6632_7525 | 278 |
| 248 | 3300028573 | Ga0265334_10062399 | Ga0265334_100623992 | 279 |
| 249 | 3300005445 | Ga0070708_100078706 | Ga0070708_1000787063 | 280 |
| 250 | 3300005467 | Ga0070706_100019076 | Ga0070706_1000190762 | 280 |
| 251 | 3300005468 | Ga0070707_100024924 | Ga0070707_1000249242 | 280 |
| 252 | 3300005468 | Ga0070707_100072210 | Ga0070707_1000722104 | 280 |
| 253 | 3300005468 | Ga0070707_100271698 | Ga0070707_1002716982 | 280 |
| 254 | 3300005471 | Ga0070698_100468510 | Ga0070698_1004685101 | 280 |
| 255 | 3300005518 | Ga0070699_100034351 | Ga0070699_1000343513 | 280 |
| 256 | 3300014745 | Ga0157377_10029358 | Ga0157377_100293582 | 280 |
| 257 | 3300025910 | Ga0207684_10008644 | Ga0207684_100086445 | 280 |
| 258 | 3300025916 | Ga0207663_10260222 | Ga0207663_102602222 | 280 |
| 259 | 3300025922 | Ga0207646_10013769 | Ga0207646_100137695 | 280 |
| 260 | 3300025922 | Ga0207646_10237744 | Ga0207646_102377442 | 280 |
| 261 | 3300045049 | Ga0466959_0082665 | Ga0466959_0082665_80_973 | 280 |
| 262 | 3300005327 | Ga0070658_10086715 | Ga0070658_100867152 | 281 |
| 263 | 3300005329 | Ga0070683_100111524 | Ga0070683_1001115242 | 281 |
| 264 | 3300005336 | Ga0070680_100026140 | Ga0070680_1000261405 | 281 |
| 265 | 3300005337 | Ga0070682_100199876 | Ga0070682_1001998761 | 281 |
| 266 | 3300005339 | Ga0070660_100049573 | Ga0070660_1000495731 | 281 |
| 267 | 3300005339 | Ga0070660_100069829 | Ga0070660_1000698292 | 281 |
| 268 | 3300005344 | Ga0070661_100164052 | Ga0070661_1001640522 | 281 |
| 269 | 3300005366 | Ga0070659_100013732 | Ga0070659_1000137325 | 281 |
| 270 | 3300005366 | Ga0070659_100067593 | Ga0070659_1000675932 | 281 |
| 271 | 3300005458 | Ga0070681_10018844 | Ga0070681_100188442 | 281 |
| 272 | 3300005458 | Ga0070681_10121004 | Ga0070681_101210042 | 281 |
| 273 | 3300005458 | Ga0070681_10299753 | Ga0070681_102997532 | 281 |
| 274 | 3300005530 | Ga0070679_100084278 | Ga0070679_1000842782 | 281 |
| 275 | 3300013100 | Ga0157373_10082421 | Ga0157373_100824212 | 281 |
| 276 | 3300014497 | Ga0182008_10003241 | Ga0182008_100032419 | 281 |
| 277 | 3300014497 | Ga0182008_10053879 | Ga0182008_100538792 | 281 |
| 278 | 3300015261 | Ga0182006_1020518 | Ga0182006_10205182 | 281 |
| 279 | 3300020070 | Ga0206356_10423288 | Ga0206356_104232882 | 281 |
| 280 | 3300020082 | Ga0206353_11481888 | Ga0206353_114818885 | 281 |
| 281 | 3300025912 | Ga0207707_10204089 | Ga0207707_102040891 | 281 |
| 282 | 3300025912 | Ga0207707_10457140 | Ga0207707_104571401 | 281 |
| 283 | 3300025917 | Ga0207660_10066539 | Ga0207660_100665392 | 281 |
| 284 | 3300025919 | Ga0207657_10003276 | Ga0207657_1000327613 | 281 |
| 285 | 3300025919 | Ga0207657_10013935 | Ga0207657_100139353 | 281 |
| 286 | 3300025921 | Ga0207652_10085686 | Ga0207652_100856863 | 281 |
| 287 | 3300025921 | Ga0207652_10339305 | Ga0207652_103393052 | 281 |
| 288 | 3300025932 | Ga0207690_10053416 | Ga0207690_100534162 | 281 |
| 289 | 3300025944 | Ga0207661_10080393 | Ga0207661_100803932 | 281 |
| 290 | 3300025949 | Ga0207667_10618635 | Ga0207667_106186351 | 281 |
| 291 | 3300026041 | Ga0207639_10415883 | Ga0207639_104158832 | 281 |
| 292 | 3300035692 | Ga0373935_0201190 | Ga0373935_0201190_250_1146 | 281 |
| 293 | 3300037418 | Ga0395900_0589635 | Ga0395900_0589635_146_1042 | 281 |
| 294 | 3300044901 | Ga0466960_0040342 | Ga0466960_0040342_575_1465 | 281 |
| 295 | 3300044901 | Ga0466960_0143022 | Ga0466960_0143022_308_1204 | 281 |
| 296 | 3300046463 | Ga0495653_0017311 | Ga0495653_0017311_4657_5550 | 281 |
| 297 | 3300046559 | Ga0495667_0081995 | Ga0495667_0081995_932_1825 | 281 |
| 298 | 3300048909 | Ga0496106_0016966 | Ga0496106_0016966_4230_5123 | 281 |
| 299 | 3300048910 | Ga0496107_0003668 | Ga0496107_0003668_4350_5243 | 281 |
| 300 | 3300048915 | Ga0496112_0003989 | Ga0496112_0003989_3572_4465 | 281 |
| 301 | 3300005329 | Ga0070683_100098610 | Ga0070683_1000986102 | 282 |
| 302 | 3300005336 | Ga0070680_100038676 | Ga0070680_1000386762 | 282 |
| 303 | 3300005456 | Ga0070678_100507236 | Ga0070678_1005072361 | 282 |
| 304 | 3300005458 | Ga0070681_10053300 | Ga0070681_100533002 | 282 |
| 305 | 3300005530 | Ga0070679_100395319 | Ga0070679_1003953191 | 282 |
| 306 | 3300005535 | Ga0070684_100038193 | Ga0070684_1000381934 | 282 |
| 307 | 3300005535 | Ga0070684_100108789 | Ga0070684_1001087892 | 282 |
| 308 | 3300020082 | Ga0206353_11330602 | Ga0206353_113306022 | 282 |
| 309 | 3300025912 | Ga0207707_10029476 | Ga0207707_100294763 | 282 |
| 310 | 3300025917 | Ga0207660_10274374 | Ga0207660_102743742 | 282 |
| 311 | 3300025929 | Ga0207664_10130266 | Ga0207664_101302662 | 282 |
| 312 | 3300025944 | Ga0207661_10019465 | Ga0207661_100194655 | 282 |
| 313 | 3300035083 | Ga0373926_0004191 | Ga0373926_0004191_3104_4000 | 282 |
| 314 | 3300035116 | Ga0373945_0012531 | Ga0373945_0012531_1603_2499 | 282 |
| 315 | 3300035170 | Ga0373943_0000485 | Ga0373943_0000485_11832_12728 | 282 |
| 316 | 3300035171 | Ga0373946_0014141 | Ga0373946_0014141_949_1845 | 282 |
| 317 | 3300035692 | Ga0373935_0176799 | Ga0373935_0176799_99_995 | 282 |
| 318 | 3300035725 | Ga0373947_0002997 | Ga0373947_0002997_3751_4647 | 282 |
| 319 | 3300037068 | Ga0373925_0009978 | Ga0373925_0009978_4283_5179 | 282 |
| 320 | 3300044694 | Ga0466963_0001715 | Ga0466963_0001715_9118_10011 | 282 |
| 321 | 3300044694 | Ga0466963_0007445 | Ga0466963_0007445_5434_6327 | 282 |
| 322 | 3300044694 | Ga0466963_0012911 | Ga0466963_0012911_686_1579 | 282 |
| 323 | 3300044706 | Ga0466964_0027129 | Ga0466964_0027129_1315_2208 | 282 |
| 324 | 3300044842 | Ga0466957_0227357 | Ga0466957_0227357_86_979 | 282 |
| 325 | 3300045836 | Ga0466958_0021267 | Ga0466958_0021267_1917_2810 | 282 |
| 326 | 3300045836 | Ga0466958_0077428 | Ga0466958_0077428_1046_1939 | 282 |
| 327 | 3300045976 | Ga0466967_0012380 | Ga0466967_0012380_2612_3505 | 282 |
| 328 | 3300045976 | Ga0466967_0026636 | Ga0466967_0026636_1209_2102 | 282 |
| 329 | 3300045976 | Ga0466967_0027483 | Ga0466967_0027483_1062_1955 | 282 |
| 330 | 3300045976 | Ga0466967_0035678 | Ga0466967_0035678_2127_3020 | 282 |
| 331 | 3300045976 | Ga0466967_0101661 | Ga0466967_0101661_986_1879 | 282 |
| 332 | 3300045976 | Ga0466967_0126011 | Ga0466967_0126011_1341_2234 | 282 |
| 333 | 3300046459 | Ga0495629_0017474 | Ga0495629_0017474_3410_4306 | 282 |
| 334 | 3300046461 | Ga0495641_0008094 | Ga0495641_0008094_1212_2108 | 282 |
| 335 | 3300046463 | Ga0495653_0069725 | Ga0495653_0069725_1090_1986 | 282 |
| 336 | 3300046472 | Ga0495580_0037730 | Ga0495580_0037730_1288_2184 | 282 |
| 337 | 3300046473 | Ga0495582_0000560 | Ga0495582_0000560_8858_9754 | 282 |
| 338 | 3300046475 | Ga0495639_0000517 | Ga0495639_0000517_11807_12703 | 282 |
| 339 | 3300046476 | Ga0495662_0028122 | Ga0495662_0028122_897_1793 | 282 |
| 340 | 3300046517 | Ga0495630_0001418 | Ga0495630_0001418_11615_12511 | 282 |
| 341 | 3300046526 | Ga0495666_0000186 | Ga0495666_0000186_13936_14832 | 282 |
| 342 | 3300046529 | Ga0495652_0043635 | Ga0495652_0043635_229_1125 | 282 |
| 343 | 3300046531 | Ga0495665_0035777 | Ga0495665_0035777_834_1730 | 282 |
| 344 | 3300046533 | Ga0495640_0028051 | Ga0495640_0028051_2326_3222 | 282 |
| 345 | 3300046559 | Ga0495667_0129403 | Ga0495667_0129403_674_1570 | 282 |
| 346 | 3300046642 | Ga0495634_0033819 | Ga0495634_0033819_339_1235 | 282 |
| 347 | 3300046681 | Ga0495647_0000811 | Ga0495647_0000811_2439_3335 | 282 |
| 348 | 3300046683 | Ga0495658_0001241 | Ga0495658_0001241_8095_8991 | 282 |
| 349 | 3300046689 | Ga0495613_0017903 | Ga0495613_0017903_649_1545 | 282 |
| 350 | 3300046690 | Ga0495624_0008189 | Ga0495624_0008189_639_1535 | 282 |
| 351 | 3300047315 | Ga0495581_0003648 | Ga0495581_0003648_1212_2108 | 282 |
| 352 | 3300047321 | Ga0495676_0134668 | Ga0495676_0134668_639_1535 | 282 |
| 353 | 3300047322 | Ga0495680_0018302 | Ga0495680_0018302_29_925 | 282 |
| 354 | 3300047673 | Ga0495593_0000358 | Ga0495593_0000358_6633_7529 | 282 |
| 355 | 3300048913 | Ga0496110_0372610 | Ga0496110_0372610_173_1060 | 282 |
| 356 | 3300048915 | Ga0496112_0090149 | Ga0496112_0090149_1541_2434 | 282 |
| 357 | 3300061719 | Ga0466962_0035560 | Ga0466962_0035560_1005_1898 | 282 |
| 358 | 3300020081 | Ga0206354_10463591 | Ga0206354_104635912 | 283 |
| 359 | 3300020082 | Ga0206353_10028453 | Ga0206353_100284539 | 283 |
| 360 | 3300025912 | Ga0207707_10035228 | Ga0207707_100352283 | 283 |
| 361 | 3300025944 | Ga0207661_10038781 | Ga0207661_100387811 | 283 |
| 362 | 3300044694 | Ga0466963_0063714 | Ga0466963_0063714_1260_2153 | 283 |
| 363 | 3300045976 | Ga0466967_0017082 | Ga0466967_0017082_4557_5450 | 283 |
| 364 | 3300005435 | Ga0070714_100024655 | Ga0070714_1000246552 | 284 |
| 365 | 3300005436 | Ga0070713_100067966 | Ga0070713_1000679662 | 284 |
| 366 | 3300005437 | Ga0070710_10071628 | Ga0070710_100716282 | 284 |
| 367 | 3300005439 | Ga0070711_100243066 | Ga0070711_1002430662 | 284 |
| 368 | 3300005455 | Ga0070663_100095759 | Ga0070663_1000957592 | 284 |
| 369 | 3300005456 | Ga0070678_100189116 | Ga0070678_1001891162 | 284 |
| 370 | 3300005546 | Ga0070696_100023241 | Ga0070696_1000232413 | 284 |
| 371 | 3300005547 | Ga0070693_100002395 | Ga0070693_1000023954 | 284 |
| 372 | 3300005614 | Ga0068856_100312703 | Ga0068856_1003127032 | 284 |
| 373 | 3300006028 | Ga0070717_10138621 | Ga0070717_101386212 | 284 |
| 374 | 3300006173 | Ga0070716_100001535 | Ga0070716_1000015353 | 284 |
| 375 | 3300006175 | Ga0070712_100234681 | Ga0070712_1002346812 | 284 |
| 376 | 3300006237 | Ga0097621_100018984 | Ga0097621_1000189843 | 284 |
| 377 | 3300006358 | Ga0068871_100157329 | Ga0068871_1001573292 | 284 |
| 378 | 3300007076 | Ga0075435_100530932 | Ga0075435_1005309321 | 284 |
| 379 | 3300009174 | Ga0105241_10074742 | Ga0105241_100747422 | 284 |
| 380 | 3300014969 | Ga0157376_10055099 | Ga0157376_100550992 | 284 |
| 381 | 3300025898 | Ga0207692_10044508 | Ga0207692_100445082 | 284 |
| 382 | 3300025905 | Ga0207685_10045598 | Ga0207685_100455982 | 284 |
| 383 | 3300025906 | Ga0207699_10047467 | Ga0207699_100474672 | 284 |
| 384 | 3300025906 | Ga0207699_10135583 | Ga0207699_101355831 | 284 |
| 385 | 3300025915 | Ga0207693_10066768 | Ga0207693_100667682 | 284 |
| 386 | 3300025915 | Ga0207693_10168483 | Ga0207693_101684832 | 284 |
| 387 | 3300025916 | Ga0207663_10015092 | Ga0207663_100150922 | 284 |
| 388 | 3300025928 | Ga0207700_10170157 | Ga0207700_101701572 | 284 |
| 389 | 3300025929 | Ga0207664_10038872 | Ga0207664_100388723 | 284 |
| 390 | 3300025939 | Ga0207665_10000494 | Ga0207665_100004943 | 284 |
| 391 | 3300026067 | Ga0207678_10080789 | Ga0207678_100807893 | 284 |
| 392 | 3300026121 | Ga0207683_10000425 | Ga0207683_100004252 | 284 |
| 393 | 3300034819 | Ga0373958_0003682 | Ga0373958_0003682_875_1765 | 284 |
| 394 | 3300035090 | Ga0373949_0025914 | Ga0373949_0025914_262_1152 | 284 |
| 395 | 3300035121 | Ga0373960_0021080 | Ga0373960_0021080_175_1065 | 284 |
| 396 | 3300035242 | Ga0373962_0026692 | Ga0373962_0026692_259_1149 | 284 |
| 397 | 3300035691 | Ga0373931_0024091 | Ga0373931_0024091_1171_2061 | 284 |
| 398 | 3300037312 | Ga0395899_0011275 | Ga0395899_0011275_4964_5857 | 284 |
| 399 | 3300037418 | Ga0395900_0002828 | Ga0395900_0002828_4836_5732 | 284 |
| 400 | 3300037418 | Ga0395900_0172585 | Ga0395900_0172585_509_1402 | 284 |
| 401 | 3300037466 | Ga0395898_0049785 | Ga0395898_0049785_1521_2414 | 284 |
| 402 | 3300037466 | Ga0395898_0072008 | Ga0395898_0072008_2390_3286 | 284 |
| 403 | 3300037471 | Ga0395905_0012265 | Ga0395905_0012265_3880_4776 | 284 |
| 404 | 3300037471 | Ga0395905_0025136 | Ga0395905_0025136_309_1202 | 284 |
| 405 | 3300038443 | Ga0395901_0060585 | Ga0395901_0060585_2748_3644 | 284 |
| 406 | 3300038443 | Ga0395901_0133811 | Ga0395901_0133811_799_1692 | 284 |
| 407 | 3300045976 | Ga0466967_0098881 | Ga0466967_0098881_1575_2471 | 284 |
| 408 | 3300048906 | Ga0496103_0012699 | Ga0496103_0012699_2481_3371 | 284 |
| 409 | 3300048909 | Ga0496106_0160704 | Ga0496106_0160704_679_1569 | 284 |
| 410 | 3300048911 | Ga0496108_0128285 | Ga0496108_0128285_480_1370 | 284 |
| 411 | 3300048912 | Ga0496109_0279857 | Ga0496109_0279857_216_1106 | 284 |
| 412 | 3300048915 | Ga0496112_0342378 | Ga0496112_0342378_373_1263 | 284 |
| 413 | 3300048916 | Ga0496113_0041307 | Ga0496113_0041307_425_1315 | 284 |
| 414 | 3300048918 | Ga0496115_0024979 | Ga0496115_0024979_2120_3010 | 284 |
| 415 | 3300050512 | nmdc:mga0n895_168363_c1 | nmdc:mga0n895_168363_c1_19_912 | 284 |
| 416 | 3300050513 | nmdc:mga0rr50_133887_c1 | nmdc:mga0rr50_133887_c1_172_1065 | 284 |
| 417 | 3300005539 | Ga0068853_100040622 | Ga0068853_1000406222 | 285 |
| 418 | 3300005578 | Ga0068854_100015581 | Ga0068854_1000155812 | 285 |
| 419 | 3300005614 | Ga0068856_100076345 | Ga0068856_1000763452 | 285 |
| 420 | 3300005981 | Ga0081538_10101850 | Ga0081538_101018501 | 285 |
| 421 | 3300009093 | Ga0105240_10065989 | Ga0105240_100659893 | 285 |
| 422 | 3300009174 | Ga0105241_10019064 | Ga0105241_100190643 | 285 |
| 423 | 3300010375 | Ga0105239_10036040 | Ga0105239_100360402 | 285 |
| 424 | 3300020069 | Ga0197907_11177942 | Ga0197907_111779421 | 285 |
| 425 | 3300020078 | Ga0206352_10445858 | Ga0206352_104458581 | 285 |
| 426 | 3300022467 | Ga0224712_10146589 | Ga0224712_101465891 | 285 |
| 427 | 3300025904 | Ga0207647_10002020 | Ga0207647_1000202011 | 285 |
| 428 | 3300025910 | Ga0207684_10274939 | Ga0207684_102749392 | 285 |
| 429 | 3300025911 | Ga0207654_10020346 | Ga0207654_100203462 | 285 |
| 430 | 3300025913 | Ga0207695_10004382 | Ga0207695_1000438214 | 285 |
| 431 | 3300025914 | Ga0207671_10004661 | Ga0207671_100046613 | 285 |
| 432 | 3300025924 | Ga0207694_10007484 | Ga0207694_100074843 | 285 |
| 433 | 3300025972 | Ga0207668_10043093 | Ga0207668_100430931 | 285 |
| 434 | 3300025981 | Ga0207640_10076784 | Ga0207640_100767842 | 285 |
| 435 | 3300026067 | Ga0207678_10023982 | Ga0207678_100239823 | 285 |
| 436 | 3300033179 | Ga0307507_10102391 | Ga0307507_101023912 | 285 |
| 437 | 3300044693 | Ga0466961_0029685 | Ga0466961_0029685_2527_3432 | 285 |
| 438 | 3300044765 | Ga0466970_0010391 | Ga0466970_0010391_1280_2185 | 285 |
| 439 | 3300046462 | Ga0495651_0075725 | Ga0495651_0075725_1596_2504 | 285 |
| 440 | 3300046462 | Ga0495651_0106769 | Ga0495651_0106769_1121_2032 | 285 |
| 441 | 3300046516 | Ga0495628_0037003 | Ga0495628_0037003_2822_3730 | 285 |
| 442 | 3300046529 | Ga0495652_0019058 | Ga0495652_0019058_5156_6064 | 285 |
| 443 | 3300046543 | Ga0495645_0055960 | Ga0495645_0055960_649_1557 | 285 |
| 444 | 3300046809 | Ga0495600_0182927 | Ga0495600_0182927_88_996 | 285 |
| 445 | 3300047315 | Ga0495581_0099162 | Ga0495581_0099162_774_1682 | 285 |
| 446 | 3300049568 | Ga0501031_0008119 | Ga0501031_0008119_1013_1888 | 285 |
| 447 | 3300049570 | Ga0501033_0073085 | Ga0501033_0073085_1101_1976 | 285 |
| 448 | 3300049572 | Ga0501036_0026468 | Ga0501036_0026468_1686_2561 | 285 |
| 449 | 3300049575 | Ga0501039_0025405 | Ga0501039_0025405_1387_2262 | 285 |
| 450 | 3300049576 | Ga0501040_0035637 | Ga0501040_0035637_289_1164 | 285 |
| 451 | 3300049577 | Ga0501041_0002691 | Ga0501041_0002691_161_1036 | 285 |
| 452 | 3300049578 | Ga0501042_0006512 | Ga0501042_0006512_1611_2486 | 285 |
| 453 | 3300049582 | Ga0501048_0012008 | Ga0501048_0012008_208_1083 | 285 |
| 454 | 3300049586 | Ga0501070_0076082 | Ga0501070_0076082_1351_2226 | 285 |
| 455 | 3300049588 | Ga0501072_0008797 | Ga0501072_0008797_354_1229 | 285 |
| 456 | 3300049591 | Ga0501075_0011065 | Ga0501075_0011065_3776_4651 | 285 |
| 457 | 3300049592 | Ga0501076_0002641 | Ga0501076_0002641_5436_6311 | 285 |
| 458 | 3300049593 | Ga0501077_0014568 | Ga0501077_0014568_3446_4321 | 285 |
| 459 | 3300049741 | Ga0501079_0107983 | Ga0501079_0107983_416_1291 | 285 |
| 460 | 3300049743 | Ga0501081_0024489 | Ga0501081_0024489_1571_2446 | 285 |
| 461 | 3300053077 | Ga0495601_0064330 | Ga0495601_0064330_1163_2074 | 285 |
| 462 | 3300053077 | Ga0495601_0180865 | Ga0495601_0180865_262_1167 | 285 |
| 463 | 3300053078 | Ga0495612_0037473 | Ga0495612_0037473_912_1823 | 285 |
| 464 | 3300053085 | Ga0495619_0138371 | Ga0495619_0138371_688_1599 | 285 |
| 465 | 3300054114 | Ga0501084_0036663 | Ga0501084_0036663_1541_2416 | 285 |
| 466 | 3300060353 | Ga0501082_0037979 | Ga0501082_0037979_2263_3138 | 285 |
| 467 | 3300061734 | Ga0530510_0005837 | Ga0530510_0005837_2850_3725 | 285 |
| 468 | 3300005434 | Ga0070709_10026418 | Ga0070709_100264182 | 286 |
| 469 | 3300005435 | Ga0070714_100050308 | Ga0070714_1000503082 | 286 |
| 470 | 3300005436 | Ga0070713_100011866 | Ga0070713_1000118666 | 286 |
| 471 | 3300005437 | Ga0070710_10003409 | Ga0070710_100034092 | 286 |
| 472 | 3300005439 | Ga0070711_100045049 | Ga0070711_1000450493 | 286 |
| 473 | 3300006028 | Ga0070717_10034875 | Ga0070717_100348752 | 286 |
| 474 | 3300006163 | Ga0070715_10001705 | Ga0070715_100017057 | 286 |
| 475 | 3300006173 | Ga0070716_100000830 | Ga0070716_1000008302 | 286 |
| 476 | 3300006175 | Ga0070712_100024636 | Ga0070712_1000246362 | 286 |
| 477 | 3300009101 | Ga0105247_10049845 | Ga0105247_100498452 | 286 |
| 478 | 3300044683 | Ga0466965_0065176 | Ga0466965_0065176_175_1053 | 286 |
| 479 | 3300046455 | Ga0495603_0007259 | Ga0495603_0007259_1621_2520 | 286 |
| 480 | 3300005544 | Ga0070686_100164479 | Ga0070686_1001644791 | 287 |
| 481 | 3300005614 | Ga0068856_100046531 | Ga0068856_1000465316 | 287 |
| 482 | 3300006028 | Ga0070717_10128226 | Ga0070717_101282262 | 287 |
| 483 | 3300025900 | Ga0207710_10074222 | Ga0207710_100742222 | 287 |
| 484 | 3300025906 | Ga0207699_10037107 | Ga0207699_100371072 | 287 |
| 485 | 3300025915 | Ga0207693_10001266 | Ga0207693_100012662 | 287 |
| 486 | 3300025927 | Ga0207687_10023728 | Ga0207687_100237282 | 287 |
| 487 | 3300025928 | Ga0207700_10030891 | Ga0207700_100308912 | 287 |
| 488 | 3300025929 | Ga0207664_10053180 | Ga0207664_100531802 | 287 |
| 489 | 3300025929 | Ga0207664_10575544 | Ga0207664_105755441 | 287 |
| 490 | 3300025929 | Ga0207664_10591130 | Ga0207664_105911301 | 287 |
| 491 | 3300025939 | Ga0207665_10000793 | Ga0207665_1000079321 | 287 |
| 492 | 3300034820 | Ga0373959_0010585 | Ga0373959_0010585_405_1295 | 287 |
| 493 | 3300035691 | Ga0373931_0063205 | Ga0373931_0063205_104_997 | 287 |
| 494 | 3300037312 | Ga0395899_0006507 | Ga0395899_0006507_1602_2489 | 287 |
| 495 | 3300037418 | Ga0395900_0006278 | Ga0395900_0006278_4269_5156 | 287 |
| 496 | 3300037466 | Ga0395898_0109197 | Ga0395898_0109197_889_1776 | 287 |
| 497 | 3300038443 | Ga0395901_0020672 | Ga0395901_0020672_877_1764 | 287 |
| 498 | 3300044656 | Ga0466969_0073565 | Ga0466969_0073565_336_1229 | 287 |
| 499 | 3300044842 | Ga0466957_0105532 | Ga0466957_0105532_283_1176 | 287 |
| 500 | 3300045976 | Ga0466967_0068385 | Ga0466967_0068385_1831_2727 | 287 |
| 501 | 3300048903 | Ga0496100_0076117 | Ga0496100_0076117_601_1494 | 287 |
| 502 | 3300048904 | Ga0496101_0076125 | Ga0496101_0076125_1258_2151 | 287 |
| 503 | 3300048905 | Ga0496102_0148864 | Ga0496102_0148864_1067_1960 | 287 |
| 504 | 3300048907 | Ga0496104_0047719 | Ga0496104_0047719_2405_3298 | 287 |
| 505 | 3300048908 | Ga0496105_0153980 | Ga0496105_0153980_915_1808 | 287 |
| 506 | 3300048908 | Ga0496105_0429524 | Ga0496105_0429524_76_969 | 287 |
| 507 | 3300048909 | Ga0496106_0014103 | Ga0496106_0014103_3708_4601 | 287 |
| 508 | 3300048910 | Ga0496107_0022333 | Ga0496107_0022333_3071_3964 | 287 |
| 509 | 3300048911 | Ga0496108_0024398 | Ga0496108_0024398_1180_2073 | 287 |
| 510 | 3300048911 | Ga0496108_0305360 | Ga0496108_0305360_289_1182 | 287 |
| 511 | 3300048912 | Ga0496109_0113334 | Ga0496109_0113334_385_1278 | 287 |
| 512 | 3300048912 | Ga0496109_0138252 | Ga0496109_0138252_685_1578 | 287 |
| 513 | 3300048913 | Ga0496110_0204690 | Ga0496110_0204690_411_1304 | 287 |
| 514 | 3300048914 | Ga0496111_0007486 | Ga0496111_0007486_3861_4754 | 287 |
| 515 | 3300048914 | Ga0496111_0073513 | Ga0496111_0073513_298_1191 | 287 |
| 516 | 3300048915 | Ga0496112_0206812 | Ga0496112_0206812_977_1870 | 287 |
| 517 | 3300048917 | Ga0496114_0021288 | Ga0496114_0021288_1343_2236 | 287 |
| 518 | 3300048917 | Ga0496114_0067293 | Ga0496114_0067293_1239_2132 | 287 |
| 519 | 3300048918 | Ga0496115_0159740 | Ga0496115_0159740_700_1593 | 287 |
| 520 | 3300049583 | Ga0501067_0113394 | Ga0501067_0113394_389_1282 | 287 |
| 521 | 3300061734 | Ga0530510_0167468 | Ga0530510_0167468_663_1556 | 287 |
| 522 | 3300005336 | Ga0070680_100022930 | Ga0070680_1000229303 | 288 |
| 523 | 3300005341 | Ga0070691_10068193 | Ga0070691_100681931 | 288 |
| 524 | 3300005458 | Ga0070681_10060073 | Ga0070681_100600732 | 288 |
| 525 | 3300005547 | Ga0070693_100051817 | Ga0070693_1000518172 | 288 |
| 526 | 3300005578 | Ga0068854_100095963 | Ga0068854_1000959632 | 288 |
| 527 | 3300013307 | Ga0157372_10417496 | Ga0157372_104174962 | 288 |
| 528 | 3300026121 | Ga0207683_10114597 | Ga0207683_101145972 | 288 |
| 529 | 3300037418 | Ga0395900_0276367 | Ga0395900_0276367_676_1560 | 288 |
| 530 | 3300038443 | Ga0395901_0122764 | Ga0395901_0122764_957_1841 | 288 |
| 531 | 3300005981 | Ga0081538_10084936 | Ga0081538_100849362 | 289 |
| 532 | 3300042156 | Ga0439446_0049625 | Ga0439446_0049625_319_1215 | 289 |
| 533 | 3300005467 | Ga0070706_100482644 | Ga0070706_1004826442 | 290 |
| 534 | 3300005471 | Ga0070698_100257731 | Ga0070698_1002577311 | 290 |
| 535 | 3300005518 | Ga0070699_100042226 | Ga0070699_1000422262 | 290 |
| 536 | 3300005536 | Ga0070697_100163675 | Ga0070697_1001636752 | 290 |
| 537 | 3300005563 | Ga0068855_100005058 | Ga0068855_1000050584 | 290 |
| 538 | 3300007076 | Ga0075435_100425225 | Ga0075435_1004252251 | 290 |
| 539 | 3300013104 | Ga0157370_10014977 | Ga0157370_100149777 | 290 |
| 540 | 3300025944 | Ga0207661_10127929 | Ga0207661_101279292 | 290 |
| 541 | 3300035692 | Ga0373935_0049449 | Ga0373935_0049449_867_1763 | 290 |
| 542 | 3300035725 | Ga0373947_0038498 | Ga0373947_0038498_972_1868 | 290 |
| 543 | 3300042001 | Ga0439441_017247 | Ga0439441_017247_165_1052 | 290 |
| 544 | 3300042435 | Ga0439434_0075977 | Ga0439434_0075977_127_1014 | 290 |
| 545 | 3300044694 | Ga0466963_0033509 | Ga0466963_0033509_565_1458 | 290 |
| 546 | 3300044706 | Ga0466964_0024881 | Ga0466964_0024881_510_1403 | 290 |
| 547 | 3300044842 | Ga0466957_0321994 | Ga0466957_0321994_104_997 | 290 |
| 548 | 3300045836 | Ga0466958_0058286 | Ga0466958_0058286_181_1074 | 290 |
| 549 | 3300046689 | Ga0495613_0326211 | Ga0495613_0326211_92_985 | 290 |
| 550 | 3300005468 | Ga0070707_100012755 | Ga0070707_1000127553 | 291 |
| 551 | 3300005937 | Ga0081455_10010754 | Ga0081455_100107545 | 291 |
| 552 | 3300009177 | Ga0105248_10352222 | Ga0105248_103522222 | 291 |
| 553 | 3300025941 | Ga0207711_10577988 | Ga0207711_105779881 | 291 |
| 554 | 3300044693 | Ga0466961_0203402 | Ga0466961_0203402_205_1098 | 291 |
| 555 | 3300044694 | Ga0466963_0056151 | Ga0466963_0056151_650_1540 | 291 |
| 556 | 3300044719 | Ga0466971_0003347 | Ga0466971_0003347_5581_6471 | 291 |
| 557 | 3300044719 | Ga0466971_0077790 | Ga0466971_0077790_409_1302 | 291 |
| 558 | 3300044735 | Ga0466968_0032397 | Ga0466968_0032397_948_1841 | 291 |
| 559 | 3300044765 | Ga0466970_0135172 | Ga0466970_0135172_290_1183 | 291 |
| 560 | 3300045049 | Ga0466959_0104340 | Ga0466959_0104340_1075_1968 | 291 |
| 561 | 3300045836 | Ga0466958_0000655 | Ga0466958_0000655_4158_5048 | 291 |
| 562 | 3300048918 | Ga0496115_0415806 | Ga0496115_0415806_30_917 | 291 |
| 563 | 3300049577 | Ga0501041_0172052 | Ga0501041_0172052_149_1033 | 291 |
| 564 | 3300049580 | Ga0501046_0111991 | Ga0501046_0111991_374_1282 | 291 |
| 565 | 3300049588 | Ga0501072_0083649 | Ga0501072_0083649_1446_2330 | 291 |
| 566 | 3300049591 | Ga0501075_0258859 | Ga0501075_0258859_202_1110 | 291 |
| 567 | 3300049593 | Ga0501077_0001491 | Ga0501077_0001491_11723_12631 | 291 |
| 568 | 3300049743 | Ga0501081_0047735 | Ga0501081_0047735_1634_2542 | 291 |
| 569 | 3300060353 | Ga0501082_0218065 | Ga0501082_0218065_603_1511 | 291 |
| 570 | 3300061734 | Ga0530510_0123401 | Ga0530510_0123401_296_1180 | 291 |
| 571 | 3300005336 | Ga0070680_100189518 | Ga0070680_1001895182 | 292 |
| 572 | 3300005366 | Ga0070659_100082730 | Ga0070659_1000827302 | 292 |
| 573 | 3300005367 | Ga0070667_100513408 | Ga0070667_1005134082 | 292 |
| 574 | 3300005434 | Ga0070709_10112469 | Ga0070709_101124692 | 292 |
| 575 | 3300005434 | Ga0070709_10138958 | Ga0070709_101389582 | 292 |
| 576 | 3300005434 | Ga0070709_10177128 | Ga0070709_101771282 | 292 |
| 577 | 3300005435 | Ga0070714_100024816 | Ga0070714_1000248165 | 292 |
| 578 | 3300005435 | Ga0070714_100055758 | Ga0070714_1000557583 | 292 |
| 579 | 3300005435 | Ga0070714_100088439 | Ga0070714_1000884392 | 292 |
| 580 | 3300005435 | Ga0070714_100098020 | Ga0070714_1000980202 | 292 |
| 581 | 3300005436 | Ga0070713_100080971 | Ga0070713_1000809713 | 292 |
| 582 | 3300005437 | Ga0070710_10020879 | Ga0070710_100208792 | 292 |
| 583 | 3300005437 | Ga0070710_10024050 | Ga0070710_100240503 | 292 |
| 584 | 3300005439 | Ga0070711_100011594 | Ga0070711_1000115942 | 292 |
| 585 | 3300005439 | Ga0070711_100021763 | Ga0070711_1000217632 | 292 |
| 586 | 3300005439 | Ga0070711_100282579 | Ga0070711_1002825792 | 292 |
| 587 | 3300005440 | Ga0070705_100002740 | Ga0070705_1000027405 | 292 |
| 588 | 3300005441 | Ga0070700_100317621 | Ga0070700_1003176211 | 292 |
| 589 | 3300005444 | Ga0070694_100047568 | Ga0070694_1000475683 | 292 |
| 590 | 3300005444 | Ga0070694_100104451 | Ga0070694_1001044512 | 292 |
| 591 | 3300005445 | Ga0070708_100010130 | Ga0070708_1000101302 | 292 |
| 592 | 3300005445 | Ga0070708_100317867 | Ga0070708_1003178672 | 292 |
| 593 | 3300005455 | Ga0070663_100403726 | Ga0070663_1004037261 | 292 |
| 594 | 3300005458 | Ga0070681_10058249 | Ga0070681_100582494 | 292 |
| 595 | 3300005458 | Ga0070681_10435258 | Ga0070681_104352582 | 292 |
| 596 | 3300005467 | Ga0070706_100240140 | Ga0070706_1002401402 | 292 |
| 597 | 3300005468 | Ga0070707_100001067 | Ga0070707_1000010672 | 292 |
| 598 | 3300005468 | Ga0070707_100179368 | Ga0070707_1001793682 | 292 |
| 599 | 3300005471 | Ga0070698_100127089 | Ga0070698_1001270892 | 292 |
| 600 | 3300005518 | Ga0070699_100134460 | Ga0070699_1001344602 | 292 |
| 601 | 3300005530 | Ga0070679_100211271 | Ga0070679_1002112712 | 292 |
| 602 | 3300005535 | Ga0070684_100051304 | Ga0070684_1000513043 | 292 |
| 603 | 3300005544 | Ga0070686_100344612 | Ga0070686_1003446121 | 292 |
| 604 | 3300005545 | Ga0070695_100000028 | Ga0070695_10000002850 | 292 |
| 605 | 3300005545 | Ga0070695_100059393 | Ga0070695_1000593932 | 292 |
| 606 | 3300005546 | Ga0070696_100024291 | Ga0070696_1000242912 | 292 |
| 607 | 3300005547 | Ga0070693_100052885 | Ga0070693_1000528852 | 292 |
| 608 | 3300005549 | Ga0070704_100030744 | Ga0070704_1000307443 | 292 |
| 609 | 3300005549 | Ga0070704_100296520 | Ga0070704_1002965202 | 292 |
| 610 | 3300006028 | Ga0070717_10017134 | Ga0070717_100171344 | 292 |
| 611 | 3300006028 | Ga0070717_10491595 | Ga0070717_104915952 | 292 |
| 612 | 3300006163 | Ga0070715_10003612 | Ga0070715_100036122 | 292 |
| 613 | 3300006173 | Ga0070716_100306096 | Ga0070716_1003060961 | 292 |
| 614 | 3300006175 | Ga0070712_100004474 | Ga0070712_1000044746 | 292 |
| 615 | 3300006175 | Ga0070712_100013288 | Ga0070712_1000132883 | 292 |
| 616 | 3300006175 | Ga0070712_100019657 | Ga0070712_1000196573 | 292 |
| 617 | 3300006358 | Ga0068871_100227165 | Ga0068871_1002271652 | 292 |
| 618 | 3300006914 | Ga0075436_100206907 | Ga0075436_1002069071 | 292 |
| 619 | 3300009093 | Ga0105240_10565926 | Ga0105240_105659262 | 292 |
| 620 | 3300009147 | Ga0114129_10048955 | Ga0114129_100489553 | 292 |
| 621 | 3300009148 | Ga0105243_10113711 | Ga0105243_101137112 | 292 |
| 622 | 3300009174 | Ga0105241_10152458 | Ga0105241_101524582 | 292 |
| 623 | 3300009174 | Ga0105241_10556005 | Ga0105241_105560051 | 292 |
| 624 | 3300009176 | Ga0105242_10058539 | Ga0105242_100585393 | 292 |
| 625 | 3300009551 | Ga0105238_10257767 | Ga0105238_102577672 | 292 |
| 626 | 3300010159 | Ga0099796_10025949 | Ga0099796_100259491 | 292 |
| 627 | 3300010375 | Ga0105239_10240441 | Ga0105239_102404412 | 292 |
| 628 | 3300013105 | Ga0157369_10079582 | Ga0157369_100795822 | 292 |
| 629 | 3300013296 | Ga0157374_10060145 | Ga0157374_100601454 | 292 |
| 630 | 3300013306 | Ga0163162_10440117 | Ga0163162_104401171 | 292 |
| 631 | 3300013307 | Ga0157372_10066175 | Ga0157372_100661752 | 292 |
| 632 | 3300013307 | Ga0157372_10306046 | Ga0157372_103060462 | 292 |
| 633 | 3300014969 | Ga0157376_10078082 | Ga0157376_100780822 | 292 |
| 634 | 3300021441 | Ga0213871_10026056 | Ga0213871_100260562 | 292 |
| 635 | 3300025885 | Ga0207653_10011312 | Ga0207653_100113122 | 292 |
| 636 | 3300025898 | Ga0207692_10023153 | Ga0207692_100231532 | 292 |
| 637 | 3300025906 | Ga0207699_10091303 | Ga0207699_100913032 | 292 |
| 638 | 3300025906 | Ga0207699_10114712 | Ga0207699_101147122 | 292 |
| 639 | 3300025910 | Ga0207684_10133559 | Ga0207684_101335592 | 292 |
| 640 | 3300025911 | Ga0207654_10179479 | Ga0207654_101794792 | 292 |
| 641 | 3300025912 | Ga0207707_10108051 | Ga0207707_101080512 | 292 |
| 642 | 3300025914 | Ga0207671_10224856 | Ga0207671_102248562 | 292 |
| 643 | 3300025915 | Ga0207693_10000126 | Ga0207693_1000012617 | 292 |
| 644 | 3300025915 | Ga0207693_10000586 | Ga0207693_1000058618 | 292 |
| 645 | 3300025915 | Ga0207693_10004553 | Ga0207693_100045538 | 292 |
| 646 | 3300025916 | Ga0207663_10047454 | Ga0207663_100474542 | 292 |
| 647 | 3300025916 | Ga0207663_10094468 | Ga0207663_100944682 | 292 |
| 648 | 3300025916 | Ga0207663_10333105 | Ga0207663_103331052 | 292 |
| 649 | 3300025921 | Ga0207652_10056227 | Ga0207652_100562272 | 292 |
| 650 | 3300025922 | Ga0207646_10007593 | Ga0207646_100075934 | 292 |
| 651 | 3300025924 | Ga0207694_10578222 | Ga0207694_105782221 | 292 |
| 652 | 3300025928 | Ga0207700_10307581 | Ga0207700_103075812 | 292 |
| 653 | 3300025929 | Ga0207664_10007986 | Ga0207664_100079868 | 292 |
| 654 | 3300025929 | Ga0207664_10024595 | Ga0207664_100245954 | 292 |
| 655 | 3300025929 | Ga0207664_10039781 | Ga0207664_100397813 | 292 |
| 656 | 3300025929 | Ga0207664_10144588 | Ga0207664_101445882 | 292 |
| 657 | 3300025929 | Ga0207664_10152646 | Ga0207664_101526461 | 292 |
| 658 | 3300025935 | Ga0207709_10067404 | Ga0207709_100674042 | 292 |
| 659 | 3300025939 | Ga0207665_10022156 | Ga0207665_100221561 | 292 |
| 660 | 3300025939 | Ga0207665_10112145 | Ga0207665_101121452 | 292 |
| 661 | 3300026121 | Ga0207683_10003390 | Ga0207683_100033909 | 292 |
| 662 | 3300028556 | Ga0265337_1025049 | Ga0265337_10250491 | 292 |
| 663 | 3300028666 | Ga0265336_10003988 | Ga0265336_100039883 | 292 |
| 664 | 3300028666 | Ga0265336_10028972 | Ga0265336_100289721 | 292 |
| 665 | 3300028800 | Ga0265338_10003714 | Ga0265338_1000371414 | 292 |
| 666 | 3300028800 | Ga0265338_10025017 | Ga0265338_100250173 | 292 |
| 667 | 3300031249 | Ga0265339_10001965 | Ga0265339_1000196512 | 292 |
| 668 | 3300031251 | Ga0265327_10112388 | Ga0265327_101123881 | 292 |
| 669 | 3300031344 | Ga0265316_10006316 | Ga0265316_100063162 | 292 |
| 670 | 3300031595 | Ga0265313_10004551 | Ga0265313_100045515 | 292 |
| 671 | 3300031595 | Ga0265313_10030777 | Ga0265313_100307772 | 292 |
| 672 | 3300031711 | Ga0265314_10002877 | Ga0265314_1000287712 | 292 |
| 673 | 3300031712 | Ga0265342_10043074 | Ga0265342_100430742 | 292 |
| 674 | 3300034817 | Ga0373948_0009199 | Ga0373948_0009199_234_1136 | 292 |
| 675 | 3300034818 | Ga0373950_0004352 | Ga0373950_0004352_916_1818 | 292 |
| 676 | 3300034819 | Ga0373958_0008772 | Ga0373958_0008772_242_1144 | 292 |
| 677 | 3300035085 | Ga0373929_0004041 | Ga0373929_0004041_1421_2323 | 292 |
| 678 | 3300035088 | Ga0373940_0010255 | Ga0373940_0010255_212_1114 | 292 |
| 679 | 3300035090 | Ga0373949_0004829 | Ga0373949_0004829_1739_2641 | 292 |
| 680 | 3300035091 | Ga0373951_0006426 | Ga0373951_0006426_1509_2411 | 292 |
| 681 | 3300035115 | Ga0373941_0014138 | Ga0373941_0014138_525_1427 | 292 |
| 682 | 3300035119 | Ga0373956_0098723 | Ga0373956_0098723_203_1099 | 292 |
| 683 | 3300035121 | Ga0373960_0022792 | Ga0373960_0022792_635_1537 | 292 |
| 684 | 3300035207 | Ga0373942_0009194 | Ga0373942_0009194_421_1323 | 292 |
| 685 | 3300035242 | Ga0373962_0015267 | Ga0373962_0015267_306_1208 | 292 |
| 686 | 3300035691 | Ga0373931_0055222 | Ga0373931_0055222_85_987 | 292 |
| 687 | 3300035724 | Ga0373933_0075786 | Ga0373933_0075786_1016_1912 | 292 |
| 688 | 3300036401 | Ga0373937_0003925 | Ga0373937_0003925_3682_4578 | 292 |
| 689 | 3300037312 | Ga0395899_0006761 | Ga0395899_0006761_7538_8431 | 292 |
| 690 | 3300037312 | Ga0395899_0036950 | Ga0395899_0036950_1130_2023 | 292 |
| 691 | 3300037418 | Ga0395900_0061528 | Ga0395900_0061528_1880_2773 | 292 |
| 692 | 3300037418 | Ga0395900_0192711 | Ga0395900_0192711_451_1344 | 292 |
| 693 | 3300037466 | Ga0395898_0005553 | Ga0395898_0005553_4327_5220 | 292 |
| 694 | 3300037466 | Ga0395898_0027207 | Ga0395898_0027207_3178_4065 | 292 |
| 695 | 3300037466 | Ga0395898_0158144 | Ga0395898_0158144_995_1888 | 292 |
| 696 | 3300037471 | Ga0395905_0010133 | Ga0395905_0010133_7631_8524 | 292 |
| 697 | 3300037471 | Ga0395905_0056536 | Ga0395905_0056536_1872_2759 | 292 |
| 698 | 3300037471 | Ga0395905_0364826 | Ga0395905_0364826_29_922 | 292 |
| 699 | 3300038443 | Ga0395901_0136438 | Ga0395901_0136438_876_1769 | 292 |
| 700 | 3300039438 | Ga0436360_0881869 | Ga0436360_0881869_4667_5566 | 292 |
| 701 | 3300044656 | Ga0466969_0000749 | Ga0466969_0000749_6986_7882 | 292 |
| 702 | 3300044656 | Ga0466969_0007379 | Ga0466969_0007379_1560_2453 | 292 |
| 703 | 3300044683 | Ga0466965_0013039 | Ga0466965_0013039_2932_3828 | 292 |
| 704 | 3300044683 | Ga0466965_0138536 | Ga0466965_0138536_163_1059 | 292 |
| 705 | 3300044684 | Ga0466966_0039970 | Ga0466966_0039970_1033_1929 | 292 |
| 706 | 3300044684 | Ga0466966_0103162 | Ga0466966_0103162_698_1591 | 292 |
| 707 | 3300044693 | Ga0466961_0000560 | Ga0466961_0000560_22635_23531 | 292 |
| 708 | 3300044693 | Ga0466961_0014772 | Ga0466961_0014772_2384_3280 | 292 |
| 709 | 3300044693 | Ga0466961_0076948 | Ga0466961_0076948_1075_1971 | 292 |
| 710 | 3300044693 | Ga0466961_0097789 | Ga0466961_0097789_745_1638 | 292 |
| 711 | 3300044694 | Ga0466963_0000355 | Ga0466963_0000355_11403_12299 | 292 |
| 712 | 3300044694 | Ga0466963_0001329 | Ga0466963_0001329_2490_3386 | 292 |
| 713 | 3300044694 | Ga0466963_0005352 | Ga0466963_0005352_6197_7093 | 292 |
| 714 | 3300044694 | Ga0466963_0012463 | Ga0466963_0012463_1141_2037 | 292 |
| 715 | 3300044694 | Ga0466963_0012733 | Ga0466963_0012733_1275_2171 | 292 |
| 716 | 3300044694 | Ga0466963_0013492 | Ga0466963_0013492_2856_3752 | 292 |
| 717 | 3300044694 | Ga0466963_0038888 | Ga0466963_0038888_600_1496 | 292 |
| 718 | 3300044694 | Ga0466963_0049915 | Ga0466963_0049915_75_974 | 292 |
| 719 | 3300044694 | Ga0466963_0055778 | Ga0466963_0055778_231_1124 | 292 |
| 720 | 3300044694 | Ga0466963_0059013 | Ga0466963_0059013_1204_2100 | 292 |
| 721 | 3300044694 | Ga0466963_0078684 | Ga0466963_0078684_1057_1953 | 292 |
| 722 | 3300044694 | Ga0466963_0095686 | Ga0466963_0095686_604_1500 | 292 |
| 723 | 3300044694 | Ga0466963_0292901 | Ga0466963_0292901_69_965 | 292 |
| 724 | 3300044706 | Ga0466964_0000982 | Ga0466964_0000982_7956_8852 | 292 |
| 725 | 3300044706 | Ga0466964_0024366 | Ga0466964_0024366_1021_1917 | 292 |
| 726 | 3300044706 | Ga0466964_0037728 | Ga0466964_0037728_451_1347 | 292 |
| 727 | 3300044706 | Ga0466964_0042827 | Ga0466964_0042827_838_1734 | 292 |
| 728 | 3300044719 | Ga0466971_0005127 | Ga0466971_0005127_1751_2647 | 292 |
| 729 | 3300044719 | Ga0466971_0007091 | Ga0466971_0007091_2937_3833 | 292 |
| 730 | 3300044719 | Ga0466971_0007850 | Ga0466971_0007850_1987_2880 | 292 |
| 731 | 3300044719 | Ga0466971_0017867 | Ga0466971_0017867_1540_2433 | 292 |
| 732 | 3300044735 | Ga0466968_0000662 | Ga0466968_0000662_3583_4479 | 292 |
| 733 | 3300044735 | Ga0466968_0005087 | Ga0466968_0005087_1507_2403 | 292 |
| 734 | 3300044765 | Ga0466970_0006693 | Ga0466970_0006693_4428_5324 | 292 |
| 735 | 3300044842 | Ga0466957_0004105 | Ga0466957_0004105_1105_2001 | 292 |
| 736 | 3300044842 | Ga0466957_0021190 | Ga0466957_0021190_1268_2164 | 292 |
| 737 | 3300044842 | Ga0466957_0027919 | Ga0466957_0027919_1947_2843 | 292 |
| 738 | 3300044842 | Ga0466957_0032093 | Ga0466957_0032093_2133_3029 | 292 |
| 739 | 3300044842 | Ga0466957_0112142 | Ga0466957_0112142_748_1641 | 292 |
| 740 | 3300044901 | Ga0466960_0012397 | Ga0466960_0012397_1151_2047 | 292 |
| 741 | 3300045049 | Ga0466959_0001794 | Ga0466959_0001794_4927_5823 | 292 |
| 742 | 3300045049 | Ga0466959_0005411 | Ga0466959_0005411_4889_5785 | 292 |
| 743 | 3300045049 | Ga0466959_0019863 | Ga0466959_0019863_3838_4731 | 292 |
| 744 | 3300045049 | Ga0466959_0033367 | Ga0466959_0033367_2806_3702 | 292 |
| 745 | 3300045836 | Ga0466958_0001851 | Ga0466958_0001851_6485_7381 | 292 |
| 746 | 3300045836 | Ga0466958_0007203 | Ga0466958_0007203_3096_3992 | 292 |
| 747 | 3300045836 | Ga0466958_0007899 | Ga0466958_0007899_3459_4352 | 292 |
| 748 | 3300045836 | Ga0466958_0014393 | Ga0466958_0014393_787_1683 | 292 |
| 749 | 3300045836 | Ga0466958_0014823 | Ga0466958_0014823_290_1186 | 292 |
| 750 | 3300045836 | Ga0466958_0019682 | Ga0466958_0019682_1302_2198 | 292 |
| 751 | 3300045836 | Ga0466958_0031370 | Ga0466958_0031370_425_1321 | 292 |
| 752 | 3300045836 | Ga0466958_0032176 | Ga0466958_0032176_115_1011 | 292 |
| 753 | 3300045836 | Ga0466958_0067638 | Ga0466958_0067638_470_1366 | 292 |
| 754 | 3300045976 | Ga0466967_0000219 | Ga0466967_0000219_4541_5437 | 292 |
| 755 | 3300045976 | Ga0466967_0002872 | Ga0466967_0002872_2591_3487 | 292 |
| 756 | 3300045976 | Ga0466967_0003820 | Ga0466967_0003820_1961_2857 | 292 |
| 757 | 3300045976 | Ga0466967_0022408 | Ga0466967_0022408_338_1234 | 292 |
| 758 | 3300045976 | Ga0466967_0027813 | Ga0466967_0027813_2476_3372 | 292 |
| 759 | 3300045976 | Ga0466967_0044675 | Ga0466967_0044675_1418_2314 | 292 |
| 760 | 3300045976 | Ga0466967_0081285 | Ga0466967_0081285_1756_2652 | 292 |
| 761 | 3300045976 | Ga0466967_0102031 | Ga0466967_0102031_836_1729 | 292 |
| 762 | 3300045976 | Ga0466967_0137409 | Ga0466967_0137409_564_1463 | 292 |
| 763 | 3300045976 | Ga0466967_0170459 | Ga0466967_0170459_367_1266 | 292 |
| 764 | 3300045976 | Ga0466967_0203006 | Ga0466967_0203006_145_1041 | 292 |
| 765 | 3300045976 | Ga0466967_0258890 | Ga0466967_0258890_134_1030 | 292 |
| 766 | 3300045976 | Ga0466967_0274350 | Ga0466967_0274350_40_936 | 292 |
| 767 | 3300045976 | Ga0466967_0383746 | Ga0466967_0383746_330_1226 | 292 |
| 768 | 3300046454 | Ga0495592_0001003 | Ga0495592_0001003_17516_18412 | 292 |
| 769 | 3300046454 | Ga0495592_0002313 | Ga0495592_0002313_6744_7640 | 292 |
| 770 | 3300046454 | Ga0495592_0054383 | Ga0495592_0054383_564_1460 | 292 |
| 771 | 3300046454 | Ga0495592_0112200 | Ga0495592_0112200_56_949 | 292 |
| 772 | 3300046459 | Ga0495629_0050680 | Ga0495629_0050680_187_1083 | 292 |
| 773 | 3300046459 | Ga0495629_0090116 | Ga0495629_0090116_1214_2110 | 292 |
| 774 | 3300046459 | Ga0495629_0222685 | Ga0495629_0222685_248_1144 | 292 |
| 775 | 3300046461 | Ga0495641_0028643 | Ga0495641_0028643_925_1821 | 292 |
| 776 | 3300046462 | Ga0495651_0000038 | Ga0495651_0000038_53509_54405 | 292 |
| 777 | 3300046462 | Ga0495651_0054468 | Ga0495651_0054468_1547_2443 | 292 |
| 778 | 3300046463 | Ga0495653_0014400 | Ga0495653_0014400_1897_2793 | 292 |
| 779 | 3300046476 | Ga0495662_0102568 | Ga0495662_0102568_71_967 | 292 |
| 780 | 3300046477 | Ga0495664_0136747 | Ga0495664_0136747_285_1181 | 292 |
| 781 | 3300046501 | Ga0495607_0096921 | Ga0495607_0096921_379_1272 | 292 |
| 782 | 3300046511 | Ga0495608_0019558 | Ga0495608_0019558_2156_3052 | 292 |
| 783 | 3300046514 | Ga0495618_0001861 | Ga0495618_0001861_12259_13155 | 292 |
| 784 | 3300046516 | Ga0495628_0000025 | Ga0495628_0000025_101191_102087 | 292 |
| 785 | 3300046516 | Ga0495628_0034135 | Ga0495628_0034135_2436_3332 | 292 |
| 786 | 3300046517 | Ga0495630_0231149 | Ga0495630_0231149_230_1123 | 292 |
| 787 | 3300046523 | Ga0495644_0002988 | Ga0495644_0002988_5225_6118 | 292 |
| 788 | 3300046529 | Ga0495652_0000088 | Ga0495652_0000088_53529_54425 | 292 |
| 789 | 3300046529 | Ga0495652_0041133 | Ga0495652_0041133_1775_2671 | 292 |
| 790 | 3300046529 | Ga0495652_0227150 | Ga0495652_0227150_83_976 | 292 |
| 791 | 3300046533 | Ga0495640_0160401 | Ga0495640_0160401_257_1153 | 292 |
| 792 | 3300046536 | Ga0495587_0002637 | Ga0495587_0002637_4249_5145 | 292 |
| 793 | 3300046536 | Ga0495587_0108668 | Ga0495587_0108668_67_963 | 292 |
| 794 | 3300046543 | Ga0495645_0000024 | Ga0495645_0000024_53504_54400 | 292 |
| 795 | 3300046543 | Ga0495645_0009655 | Ga0495645_0009655_4523_5419 | 292 |
| 796 | 3300046559 | Ga0495667_0002973 | Ga0495667_0002973_10226_11122 | 292 |
| 797 | 3300046559 | Ga0495667_0041717 | Ga0495667_0041717_754_1650 | 292 |
| 798 | 3300046615 | Ga0495656_0001592 | Ga0495656_0001592_597_1490 | 292 |
| 799 | 3300046642 | Ga0495634_0052255 | Ga0495634_0052255_1804_2700 | 292 |
| 800 | 3300046642 | Ga0495634_0246242 | Ga0495634_0246242_154_1050 | 292 |
| 801 | 3300046663 | Ga0495635_0015180 | Ga0495635_0015180_2927_3823 | 292 |
| 802 | 3300046675 | Ga0495657_0022864 | Ga0495657_0022864_545_1441 | 292 |
| 803 | 3300046675 | Ga0495657_0038995 | Ga0495657_0038995_1195_2091 | 292 |
| 804 | 3300046675 | Ga0495657_0159811 | Ga0495657_0159811_330_1223 | 292 |
| 805 | 3300046678 | Ga0495599_0000019 | Ga0495599_0000019_39389_40285 | 292 |
| 806 | 3300046678 | Ga0495599_0117614 | Ga0495599_0117614_651_1547 | 292 |
| 807 | 3300046679 | Ga0495623_0000032 | Ga0495623_0000032_66854_67750 | 292 |
| 808 | 3300046680 | Ga0495646_0087168 | Ga0495646_0087168_434_1330 | 292 |
| 809 | 3300046681 | Ga0495647_0021859 | Ga0495647_0021859_826_1722 | 292 |
| 810 | 3300046681 | Ga0495647_0022573 | Ga0495647_0022573_1268_2164 | 292 |
| 811 | 3300046683 | Ga0495658_0029375 | Ga0495658_0029375_204_1100 | 292 |
| 812 | 3300046794 | Ga0495589_0045883 | Ga0495589_0045883_803_1696 | 292 |
| 813 | 3300046809 | Ga0495600_0034542 | Ga0495600_0034542_2097_2993 | 292 |
| 814 | 3300046809 | Ga0495600_0123192 | Ga0495600_0123192_376_1272 | 292 |
| 815 | 3300046809 | Ga0495600_0143721 | Ga0495600_0143721_587_1480 | 292 |
| 816 | 3300047317 | Ga0495604_0000128 | Ga0495604_0000128_9321_10217 | 292 |
| 817 | 3300047317 | Ga0495604_0086098 | Ga0495604_0086098_647_1543 | 292 |
| 818 | 3300047317 | Ga0495604_0183546 | Ga0495604_0183546_517_1413 | 292 |
| 819 | 3300047319 | Ga0495674_0065311 | Ga0495674_0065311_1817_2713 | 292 |
| 820 | 3300047319 | Ga0495674_0080843 | Ga0495674_0080843_16_912 | 292 |
| 821 | 3300047322 | Ga0495680_0018043 | Ga0495680_0018043_3612_4508 | 292 |
| 822 | 3300047322 | Ga0495680_0044914 | Ga0495680_0044914_435_1331 | 292 |
| 823 | 3300047322 | Ga0495680_0256521 | Ga0495680_0256521_255_1148 | 292 |
| 824 | 3300047444 | Ga0495675_0000007 | Ga0495675_0000007_108236_109132 | 292 |
| 825 | 3300047471 | Ga0495684_0019114 | Ga0495684_0019114_2501_3397 | 292 |
| 826 | 3300047471 | Ga0495684_0029481 | Ga0495684_0029481_541_1437 | 292 |
| 827 | 3300048088 | Ga0495602_0000246 | Ga0495602_0000246_7121_8017 | 292 |
| 828 | 3300048088 | Ga0495602_0121928 | Ga0495602_0121928_1184_2077 | 292 |
| 829 | 3300048903 | Ga0496100_0143962 | Ga0496100_0143962_455_1348 | 292 |
| 830 | 3300048903 | Ga0496100_0194042 | Ga0496100_0194042_312_1208 | 292 |
| 831 | 3300048903 | Ga0496100_0287729 | Ga0496100_0287729_181_1077 | 292 |
| 832 | 3300048905 | Ga0496102_0015928 | Ga0496102_0015928_5563_6462 | 292 |
| 833 | 3300048905 | Ga0496102_0300361 | Ga0496102_0300361_392_1285 | 292 |
| 834 | 3300048906 | Ga0496103_0031665 | Ga0496103_0031665_562_1461 | 292 |
| 835 | 3300048906 | Ga0496103_0043277 | Ga0496103_0043277_958_1860 | 292 |
| 836 | 3300048907 | Ga0496104_0002359 | Ga0496104_0002359_4106_5002 | 292 |
| 837 | 3300048907 | Ga0496104_0003973 | Ga0496104_0003973_9029_9931 | 292 |
| 838 | 3300048907 | Ga0496104_0136424 | Ga0496104_0136424_617_1513 | 292 |
| 839 | 3300048908 | Ga0496105_0003530 | Ga0496105_0003530_6515_7411 | 292 |
| 840 | 3300048908 | Ga0496105_0018165 | Ga0496105_0018165_1059_1961 | 292 |
| 841 | 3300048908 | Ga0496105_0103642 | Ga0496105_0103642_396_1292 | 292 |
| 842 | 3300048908 | Ga0496105_0172311 | Ga0496105_0172311_562_1455 | 292 |
| 843 | 3300048909 | Ga0496106_0100183 | Ga0496106_0100183_1086_1988 | 292 |
| 844 | 3300048910 | Ga0496107_0206775 | Ga0496107_0206775_521_1417 | 292 |
| 845 | 3300048911 | Ga0496108_0016705 | Ga0496108_0016705_2979_3875 | 292 |
| 846 | 3300048911 | Ga0496108_0018902 | Ga0496108_0018902_4197_5090 | 292 |
| 847 | 3300048912 | Ga0496109_0001544 | Ga0496109_0001544_5060_5956 | 292 |
| 848 | 3300048912 | Ga0496109_0044409 | Ga0496109_0044409_1668_2561 | 292 |
| 849 | 3300048913 | Ga0496110_0090840 | Ga0496110_0090840_449_1342 | 292 |
| 850 | 3300048913 | Ga0496110_0156666 | Ga0496110_0156666_1085_1987 | 292 |
| 851 | 3300048914 | Ga0496111_0057934 | Ga0496111_0057934_1676_2572 | 292 |
| 852 | 3300048914 | Ga0496111_0120089 | Ga0496111_0120089_835_1737 | 292 |
| 853 | 3300048914 | Ga0496111_0241902 | Ga0496111_0241902_281_1180 | 292 |
| 854 | 3300048915 | Ga0496112_0032775 | Ga0496112_0032775_3680_4573 | 292 |
| 855 | 3300048916 | Ga0496113_0029569 | Ga0496113_0029569_1122_2015 | 292 |
| 856 | 3300048917 | Ga0496114_0011285 | Ga0496114_0011285_5401_6297 | 292 |
| 857 | 3300048917 | Ga0496114_0131769 | Ga0496114_0131769_754_1656 | 292 |
| 858 | 3300048917 | Ga0496114_0228206 | Ga0496114_0228206_386_1282 | 292 |
| 859 | 3300048918 | Ga0496115_0105449 | Ga0496115_0105449_901_1803 | 292 |
| 860 | 3300048918 | Ga0496115_0377945 | Ga0496115_0377945_166_1062 | 292 |
| 861 | 3300049581 | Ga0501047_0053297 | Ga0501047_0053297_2878_3765 | 292 |
| 862 | 3300049585 | Ga0501069_0050934 | Ga0501069_0050934_1235_2131 | 292 |
| 863 | 3300049589 | Ga0501073_0121549 | Ga0501073_0121549_568_1455 | 292 |
| 864 | 3300050507 | nmdc:mga05p37_315261_c1 | nmdc:mga05p37_315261_c1_643_1545 | 292 |
| 865 | 3300050513 | nmdc:mga0rr50_11827_c1 | nmdc:mga0rr50_11827_c1_719_1612 | 292 |
| 866 | 3300050514 | nmdc:mga08x19_22289_c1 | nmdc:mga08x19_22289_c1_1224_2126 | 292 |
| 867 | 3300053077 | Ga0495601_0000313 | Ga0495601_0000313_17516_18412 | 292 |
| 868 | 3300053077 | Ga0495601_0016312 | Ga0495601_0016312_68_964 | 292 |
| 869 | 3300053077 | Ga0495601_0022926 | Ga0495601_0022926_1251_2147 | 292 |
| 870 | 3300053077 | Ga0495601_0050349 | Ga0495601_0050349_742_1638 | 292 |
| 871 | 3300053077 | Ga0495601_0106150 | Ga0495601_0106150_498_1394 | 292 |
| 872 | 3300053078 | Ga0495612_0040271 | Ga0495612_0040271_548_1444 | 292 |
| 873 | 3300053078 | Ga0495612_0088157 | Ga0495612_0088157_173_1069 | 292 |
| 874 | 3300053085 | Ga0495619_0005391 | Ga0495619_0005391_6091_6987 | 292 |
| 875 | 3300053085 | Ga0495619_0006346 | Ga0495619_0006346_3365_4261 | 292 |
| 876 | 3300053085 | Ga0495619_0031125 | Ga0495619_0031125_1393_2289 | 292 |
| 877 | 3300059426 | Ga0590077_022636 | Ga0590077_022636_32_928 | 292 |
| 878 | 3300061719 | Ga0466962_0004666 | Ga0466962_0004666_2762_3658 | 292 |
| 879 | 3300061719 | Ga0466962_0006290 | Ga0466962_0006290_2396_3289 | 292 |
| 880 | 3300061719 | Ga0466962_0012287 | Ga0466962_0012287_3145_4041 | 292 |
| 881 | 3300028800 | Ga0265338_10177402 | Ga0265338_101774021 | 293 |
| 882 | 3300029957 | Ga0265324_10016427 | Ga0265324_100164272 | 293 |
| 883 | 3300031548 | Ga0307408_100054954 | Ga0307408_1000549542 | 293 |
| 884 | 3300049742 | Ga0501080_0050844 | Ga0501080_0050844_1677_2567 | 293 |
| 885 | 3300049823 | Ga0501044_0226877 | Ga0501044_0226877_670_1560 | 293 |
| 886 | 3300005329 | Ga0070683_100252667 | Ga0070683_1002526671 | 294 |
| 887 | 3300005355 | Ga0070671_100019046 | Ga0070671_1000190466 | 294 |
| 888 | 3300005535 | Ga0070684_100354122 | Ga0070684_1003541221 | 294 |
| 889 | 3300005564 | Ga0070664_100534444 | Ga0070664_1005344442 | 294 |
| 890 | 3300005618 | Ga0068864_100284927 | Ga0068864_1002849272 | 294 |
| 891 | 3300005937 | Ga0081455_10005241 | Ga0081455_100052414 | 294 |
| 892 | 3300005983 | Ga0081540_1003731 | Ga0081540_10037314 | 294 |
| 893 | 3300005983 | Ga0081540_1009956 | Ga0081540_10099563 | 294 |
| 894 | 3300006852 | Ga0075433_10053501 | Ga0075433_100535011 | 294 |
| 895 | 3300006871 | Ga0075434_100113694 | Ga0075434_1001136943 | 294 |
| 896 | 3300006914 | Ga0075436_100024507 | Ga0075436_1000245073 | 294 |
| 897 | 3300007076 | Ga0075435_100228597 | Ga0075435_1002285971 | 294 |
| 898 | 3300009094 | Ga0111539_11053667 | Ga0111539_110536671 | 294 |
| 899 | 3300009098 | Ga0105245_10066994 | Ga0105245_100669942 | 294 |
| 900 | 3300009176 | Ga0105242_10185869 | Ga0105242_101858692 | 294 |
| 901 | 3300009553 | Ga0105249_10056772 | Ga0105249_100567723 | 294 |
| 902 | 3300013308 | Ga0157375_10056902 | Ga0157375_100569024 | 294 |
| 903 | 3300014325 | Ga0163163_10050648 | Ga0163163_100506485 | 294 |
| 904 | 3300014968 | Ga0157379_10297547 | Ga0157379_102975472 | 294 |
| 905 | 3300025919 | Ga0207657_10186486 | Ga0207657_101864862 | 294 |
| 906 | 3300025927 | Ga0207687_10065695 | Ga0207687_100656953 | 294 |
| 907 | 3300025928 | Ga0207700_10197544 | Ga0207700_101975442 | 294 |
| 908 | 3300025936 | Ga0207670_10096891 | Ga0207670_100968912 | 294 |
| 909 | 3300025941 | Ga0207711_10242658 | Ga0207711_102426582 | 294 |
| 910 | 3300025944 | Ga0207661_10279814 | Ga0207661_102798142 | 294 |
| 911 | 3300025960 | Ga0207651_10114056 | Ga0207651_101140562 | 294 |
| 912 | 3300025981 | Ga0207640_10233176 | Ga0207640_102331762 | 294 |
| 913 | 3300026078 | Ga0207702_10022381 | Ga0207702_100223812 | 294 |
| 914 | 3300031903 | Ga0307407_10023778 | Ga0307407_100237783 | 294 |
| 915 | 3300031995 | Ga0307409_100125795 | Ga0307409_1001257952 | 294 |
| 916 | 3300032002 | Ga0307416_100172879 | Ga0307416_1001728792 | 294 |
| 917 | 3300035170 | Ga0373943_0007678 | Ga0373943_0007678_558_1445 | 294 |
| 918 | 3300035692 | Ga0373935_0020284 | Ga0373935_0020284_2500_3387 | 294 |
| 919 | 3300035725 | Ga0373947_0019181 | Ga0373947_0019181_117_1004 | 294 |
| 920 | 3300037068 | Ga0373925_0026517 | Ga0373925_0026517_1150_2037 | 294 |
| 921 | 3300042008 | Ga0439450_014406 | Ga0439450_014406_222_1112 | 294 |
| 922 | 3300045051 | Ga0451576_0262200 | Ga0451576_0262200_820_1710 | 294 |
| 923 | 3300045051 | Ga0451576_0283072 | Ga0451576_0283072_513_1403 | 294 |
| 924 | 3300046455 | Ga0495603_0000062 | Ga0495603_0000062_28457_29344 | 294 |
| 925 | 3300046461 | Ga0495641_0011742 | Ga0495641_0011742_67_954 | 294 |
| 926 | 3300046472 | Ga0495580_0063357 | Ga0495580_0063357_306_1193 | 294 |
| 927 | 3300046473 | Ga0495582_0020372 | Ga0495582_0020372_2172_3059 | 294 |
| 928 | 3300046475 | Ga0495639_0090749 | Ga0495639_0090749_476_1363 | 294 |
| 929 | 3300046475 | Ga0495639_0162252 | Ga0495639_0162252_142_1029 | 294 |
| 930 | 3300046499 | Ga0495594_0000447 | Ga0495594_0000447_3718_4605 | 294 |
| 931 | 3300046517 | Ga0495630_0066996 | Ga0495630_0066996_530_1417 | 294 |
| 932 | 3300046557 | Ga0495622_0098689 | Ga0495622_0098689_287_1174 | 294 |
| 933 | 3300046674 | Ga0495588_0000632 | Ga0495588_0000632_14095_14982 | 294 |
| 934 | 3300046681 | Ga0495647_0070639 | Ga0495647_0070639_465_1352 | 294 |
| 935 | 3300046683 | Ga0495658_0075027 | Ga0495658_0075027_1029_1916 | 294 |
| 936 | 3300047321 | Ga0495676_0000253 | Ga0495676_0000253_19007_19894 | 294 |
| 937 | 3300047321 | Ga0495676_0075731 | Ga0495676_0075731_424_1311 | 294 |
| 938 | 3300048903 | Ga0496100_0199318 | Ga0496100_0199318_27_914 | 294 |
| 939 | 3300048904 | Ga0496101_0156241 | Ga0496101_0156241_583_1470 | 294 |
| 940 | 3300048905 | Ga0496102_0044862 | Ga0496102_0044862_2304_3191 | 294 |
| 941 | 3300048905 | Ga0496102_0272646 | Ga0496102_0272646_565_1452 | 294 |
| 942 | 3300048907 | Ga0496104_0007410 | Ga0496104_0007410_6786_7673 | 294 |
| 943 | 3300048907 | Ga0496104_0205254 | Ga0496104_0205254_557_1444 | 294 |
| 944 | 3300048908 | Ga0496105_0000042 | Ga0496105_0000042_93063_93950 | 294 |
| 945 | 3300048909 | Ga0496106_0003639 | Ga0496106_0003639_1292_2179 | 294 |
| 946 | 3300048909 | Ga0496106_0039400 | Ga0496106_0039400_331_1218 | 294 |
| 947 | 3300048910 | Ga0496107_0016603 | Ga0496107_0016603_990_1877 | 294 |
| 948 | 3300048910 | Ga0496107_0088641 | Ga0496107_0088641_1320_2207 | 294 |
| 949 | 3300048911 | Ga0496108_0001658 | Ga0496108_0001658_11837_12724 | 294 |
| 950 | 3300048911 | Ga0496108_0102798 | Ga0496108_0102798_1026_1913 | 294 |
| 951 | 3300048912 | Ga0496109_0033522 | Ga0496109_0033522_1723_2610 | 294 |
| 952 | 3300048912 | Ga0496109_0205551 | Ga0496109_0205551_390_1277 | 294 |
| 953 | 3300048913 | Ga0496110_0000050 | Ga0496110_0000050_34000_34887 | 294 |
| 954 | 3300048913 | Ga0496110_0171147 | Ga0496110_0171147_36_923 | 294 |
| 955 | 3300048913 | Ga0496110_0608915 | Ga0496110_0608915_80_967 | 294 |
| 956 | 3300048914 | Ga0496111_0000439 | Ga0496111_0000439_1465_2352 | 294 |
| 957 | 3300048914 | Ga0496111_0000734 | Ga0496111_0000734_3247_4134 | 294 |
| 958 | 3300048914 | Ga0496111_0071315 | Ga0496111_0071315_723_1610 | 294 |
| 959 | 3300048915 | Ga0496112_0028410 | Ga0496112_0028410_4359_5246 | 294 |
| 960 | 3300048916 | Ga0496113_0000348 | Ga0496113_0000348_8065_8952 | 294 |
| 961 | 3300048917 | Ga0496114_0119631 | Ga0496114_0119631_1223_2110 | 294 |
| 962 | 3300048917 | Ga0496114_0209371 | Ga0496114_0209371_236_1123 | 294 |
| 963 | 3300049587 | Ga0501071_0090727 | Ga0501071_0090727_579_1466 | 294 |
| 964 | 3300049592 | Ga0501076_0119311 | Ga0501076_0119311_1011_1898 | 294 |
| 965 | 3300050507 | nmdc:mga05p37_270310_c1 | nmdc:mga05p37_270310_c1_547_1437 | 294 |
| 966 | 3300050513 | nmdc:mga0rr50_98139_c1 | nmdc:mga0rr50_98139_c1_505_1395 | 294 |
| 967 | 3300050515 | nmdc:mga0a205_123064_c1 | nmdc:mga0a205_123064_c1_1523_2413 | 294 |
| 968 | 3300003373 | JGI25407J50210_10007465 | JGI25407J50210_100074652 | 295 |
| 969 | 3300005330 | Ga0070690_100026749 | Ga0070690_1000267492 | 295 |
| 970 | 3300005338 | Ga0068868_100042943 | Ga0068868_1000429432 | 295 |
| 971 | 3300005341 | Ga0070691_10040050 | Ga0070691_100400502 | 295 |
| 972 | 3300005343 | Ga0070687_100042135 | Ga0070687_1000421352 | 295 |
| 973 | 3300005345 | Ga0070692_10061013 | Ga0070692_100610132 | 295 |
| 974 | 3300005347 | Ga0070668_100107211 | Ga0070668_1001072112 | 295 |
| 975 | 3300005353 | Ga0070669_100061721 | Ga0070669_1000617212 | 295 |
| 976 | 3300005364 | Ga0070673_100407496 | Ga0070673_1004074962 | 295 |
| 977 | 3300005366 | Ga0070659_100041418 | Ga0070659_1000414183 | 295 |
| 978 | 3300005440 | Ga0070705_100023412 | Ga0070705_1000234123 | 295 |
| 979 | 3300005441 | Ga0070700_100038446 | Ga0070700_1000384462 | 295 |
| 980 | 3300005444 | Ga0070694_100010676 | Ga0070694_1000106762 | 295 |
| 981 | 3300005456 | Ga0070678_100039031 | Ga0070678_1000390313 | 295 |
| 982 | 3300005459 | Ga0068867_100009137 | Ga0068867_1000091376 | 295 |
| 983 | 3300005471 | Ga0070698_100323680 | Ga0070698_1003236802 | 295 |
| 984 | 3300005530 | Ga0070679_100156125 | Ga0070679_1001561252 | 295 |
| 985 | 3300005539 | Ga0068853_100182407 | Ga0068853_1001824072 | 295 |
| 986 | 3300005544 | Ga0070686_100049581 | Ga0070686_1000495813 | 295 |
| 987 | 3300005545 | Ga0070695_100106805 | Ga0070695_1001068052 | 295 |
| 988 | 3300005546 | Ga0070696_100007393 | Ga0070696_1000073936 | 295 |
| 989 | 3300005547 | Ga0070693_100025670 | Ga0070693_1000256702 | 295 |
| 990 | 3300005549 | Ga0070704_100070682 | Ga0070704_1000706822 | 295 |
| 991 | 3300005578 | Ga0068854_100037319 | Ga0068854_1000373192 | 295 |
| 992 | 3300005615 | Ga0070702_100007186 | Ga0070702_1000071862 | 295 |
| 993 | 3300005844 | Ga0068862_100193412 | Ga0068862_1001934122 | 295 |
| 994 | 3300005937 | Ga0081455_10028050 | Ga0081455_100280502 | 295 |
| 995 | 3300005937 | Ga0081455_10067713 | Ga0081455_100677132 | 295 |
| 996 | 3300005937 | Ga0081455_10079678 | Ga0081455_100796782 | 295 |
| 997 | 3300005981 | Ga0081538_10005878 | Ga0081538_100058784 | 295 |
| 998 | 3300005981 | Ga0081538_10016944 | Ga0081538_100169444 | 295 |
| 999 | 3300005983 | Ga0081540_1001832 | Ga0081540_10018327 | 295 |
| 1000 | 3300006881 | Ga0068865_100016700 | Ga0068865_1000167003 | 295 |
| 1001 | 3300009176 | Ga0105242_10028569 | Ga0105242_100285693 | 295 |
| 1002 | 3300009553 | Ga0105249_10052496 | Ga0105249_100524962 | 295 |
| 1003 | 3300013102 | Ga0157371_10152118 | Ga0157371_101521182 | 295 |
| 1004 | 3300013306 | Ga0163162_10315006 | Ga0163162_103150062 | 295 |
| 1005 | 3300014969 | Ga0157376_10270227 | Ga0157376_102702272 | 295 |
| 1006 | 3300025918 | Ga0207662_10026623 | Ga0207662_100266232 | 295 |
| 1007 | 3300025927 | Ga0207687_10252775 | Ga0207687_102527752 | 295 |
| 1008 | 3300025933 | Ga0207706_10037819 | Ga0207706_100378193 | 295 |
| 1009 | 3300025937 | Ga0207669_10037693 | Ga0207669_100376931 | 295 |
| 1010 | 3300025938 | Ga0207704_10031842 | Ga0207704_100318423 | 295 |
| 1011 | 3300025960 | Ga0207651_10353079 | Ga0207651_103530792 | 295 |
| 1012 | 3300026023 | Ga0207677_10121005 | Ga0207677_101210052 | 295 |
| 1013 | 3300026041 | Ga0207639_10299849 | Ga0207639_102998491 | 295 |
| 1014 | 3300026075 | Ga0207708_10036774 | Ga0207708_100367742 | 295 |
| 1015 | 3300026089 | Ga0207648_10003750 | Ga0207648_1000375012 | 295 |
| 1016 | 3300026118 | Ga0207675_100010036 | Ga0207675_1000100366 | 295 |
| 1017 | 3300037312 | Ga0395899_0025260 | Ga0395899_0025260_222_1109 | 295 |
| 1018 | 3300037312 | Ga0395899_0115104 | Ga0395899_0115104_770_1657 | 295 |
| 1019 | 3300037418 | Ga0395900_0004234 | Ga0395900_0004234_12965_13852 | 295 |
| 1020 | 3300037418 | Ga0395900_0165520 | Ga0395900_0165520_1254_2147 | 295 |
| 1021 | 3300037418 | Ga0395900_0331965 | Ga0395900_0331965_208_1095 | 295 |
| 1022 | 3300037466 | Ga0395898_0019229 | Ga0395898_0019229_415_1302 | 295 |
| 1023 | 3300037466 | Ga0395898_0152234 | Ga0395898_0152234_785_1672 | 295 |
| 1024 | 3300037471 | Ga0395905_0057121 | Ga0395905_0057121_2542_3429 | 295 |
| 1025 | 3300037471 | Ga0395905_0068620 | Ga0395905_0068620_46_933 | 295 |
| 1026 | 3300037471 | Ga0395905_0192110 | Ga0395905_0192110_443_1336 | 295 |
| 1027 | 3300038443 | Ga0395901_0030818 | Ga0395901_0030818_3353_4246 | 295 |
| 1028 | 3300038443 | Ga0395901_0049417 | Ga0395901_0049417_2132_3019 | 295 |
| 1029 | 3300038443 | Ga0395901_0180719 | Ga0395901_0180719_541_1428 | 295 |
| 1030 | 3300046491 | Ga0495584_0163131 | Ga0495584_0163131_137_1027 | 295 |
| 1031 | 3300046538 | Ga0495609_0062728 | Ga0495609_0062728_574_1464 | 295 |
| 1032 | 3300048917 | Ga0496114_0158162 | Ga0496114_0158162_55_945 | 295 |
| 1033 | 3300049743 | Ga0501081_0055592 | Ga0501081_0055592_402_1289 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mnf-assembly1.cif.gz_A | crystal structure of pac2 family protein from streptomyces avermitilis ma | 0.9259 | 16 | 247 |
| 5un0-assembly1.cif.gz_3 | crystal structure of mycobacterium tuberculosis proteasome-assembly chaperone homologue rv2125 | 0.9149 | 17 | 247 |
| 3mnf-assembly1.cif.gz_A | crystal structure of pac2 family protein from streptomyces avermitilis ma | 0.9108 | 16 | 247 |
| 2p90-assembly1.cif.gz_C | the crystal structure of a protein of unknown function from corynebacterium glutamicum atcc 13032 | 0.9062 | 3 | 259 |
| 2wam-assembly1.cif.gz_B | crystal structure of mycobacterium tuberculosis unknown function protein rv2714 | 0.9047 | 1 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mnfA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;PAC-like subunit | 0.9152 | 17 | 247 | 3.40.50.10900 |
| 3mnfA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;PAC-like subunit | 0.9039 | 17 | 247 | 3.40.50.10900 |
| 2p90C01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;PAC-like subunit | 0.8924 | 3 | 217 | 3.40.50.10900 |
| 2wamC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;PAC-like subunit | 0.8807 | 1 | 217 | 3.40.50.10900 |
| 3e35A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;PAC-like subunit | 0.8769 | 17 | 217 | 3.40.50.10900 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538FH41-F1-model_v4 | PAC2 family protein | 0.9912 | 1 | 257 |
|
| AF-A0A538FH13-F1-model_v4 | PAC2 family protein | 0.9904 | 1 | 142 |
|
| AF-A0A7V8XNW6-F1-model_v4 | PAC2 family protein | 0.9865 | 4 | 206 |
|
| AF-A0A382U0J3-F1-model_v4 | PAC2 family protein | 0.9798 | 4 | 192 |
|
| AF-A0A2W1AQ56-F1-model_v4 | Proteasome assembly chaperone (PAC2) family protein | 0.9783 | 4 | 254 |
GO:0000502
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar