F488664

General Info

Members Datasets Scaffolds Average Seq Length
1033 467 2067 316

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10115787|Ga0307517_101157871
Length 315
Sequence MLQQRTVKALTCAVGVGIHSGQKVELCLRPAPADTGIVFRRVDLPVPVDIPVNANSVSETRMASTISVNGEPRGPKVQTVEHLLSACSGLGLDNLYIDISGDEVPILDGSAASFVYLLQSAGIELQDAPKRFIKVLKTVEVRAGSAEDGARTLMWARLEPYHGYKLSFEIDFHHPAVDQTGQRVVFDMGSGSYKRDIARARTFGFTKDVEMARSRGLALGGSMDNAIVVDDYRVLNAEGLRYDDEFVKHKILDAIGDMYLAGKPLLAAYSAFRSGHALNNKLLRALLDDPSAYEIVSFDDEKQAPRGFADLAPAW

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
46 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
47 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
100 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
101 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
136 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
144 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
149 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
217 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
218 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
220 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
225 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
226 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
227 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
228 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
229 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
230 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
231 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
232 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
233 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
234 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
235 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
241 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
242 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
243 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
244 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
245 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
246 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
247 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
248 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
249 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
250 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
251 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
252 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
253 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
254 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
255 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
256 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
257 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
258 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
259 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
260 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
261 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
264 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
265 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
266 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
271 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
275 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
276 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
277 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
278 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
279 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
280 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
281 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
282 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
283 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
284 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
285 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
286 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
287 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
288 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
289 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
290 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
291 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
292 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
293 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
294 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
295 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
296 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
297 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
298 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
299 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
300 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
301 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
302 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
303 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
304 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
305 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
306 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
307 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
308 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
309 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
310 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
311 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
312 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
313 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
314 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
315 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
316 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
317 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
318 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
319 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
320 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
321 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
322 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
323 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
324 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
330 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
333 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
334 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
335 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
336 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
337 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
340 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
341 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
344 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
345 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
346 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
347 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
348 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
352 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
353 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
356 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
357 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
368 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
369 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
370 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
374 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
375 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
376 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
377 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
378 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
379 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
380 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
381 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
382 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
383 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
384 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
385 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
386 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
387 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
388 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
389 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
390 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
391 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
392 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
393 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
394 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
395 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
396 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
397 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
398 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
399 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
400 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
401 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
402 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
403 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
404 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
405 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
406 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
407 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
408 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
409 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
410 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
411 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
412 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
413 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
414 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
415 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
416 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
417 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
418 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
419 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
420 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
421 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
422 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
423 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
424 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
425 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
426 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
427 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
428 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
429 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
430 2643221585 Pelomonas sp. Root662 Isolate Unclassified
431 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
432 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
433 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
434 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
435 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
436 2643221656 Pelomonas sp. Root405 Isolate Unclassified
437 2643221658 Variovorax sp. Root411 Isolate Unclassified
438 2643221660 Methylibium sp. Root1272 Isolate Unclassified
439 2643221672 Variovorax sp. Root434 Isolate Unclassified
440 2643221683 Variovorax sp. Root473 Isolate Unclassified
441 2738541337 Pelomonas sp. BT06 Isolate Unclassified
442 2818991446 Variovorax sp. 1180 Isolate Unclassified
443 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
444 2831864461 Roseateles noduli HZ7 Isolate Nodule
445 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
446 2842677519 Variovorax sp. R-72495 Isolate Unclassified
447 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
448 2885198086 Variovorax sp. 679 Isolate Unclassified
449 2885211737 Variovorax sp. 553 Isolate Unclassified
450 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
451 2899924645 Variovorax sp. 369 Isolate Unclassified
452 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
453 2904456579 Variovorax sp. 2002 Isolate Unclassified
454 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
455 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
456 2928037797 Variovorax sp. 1126 Isolate Unclassified
457 2928044640 Variovorax sp. 1128 Isolate Unclassified
458 2928051484 Variovorax sp. 1133 Isolate Unclassified
459 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
460 2928070936 Variovorax gossypii 1167 Isolate Unclassified
461 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
462 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
463 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
464 2929520902 Variovorax beijingensis 502 Isolate Unclassified
465 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
466 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
467 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.55
Metatranscriptomes 0
Isolates 4.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.17
Nodule 0.77
Rhizoplane 3
Rhizosphere 67.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10115787 3300028786 Bacteria 2010
2 JGI24740J21852_10041842 3300001979 Bacteria 1377
3 JGI25156J39149_1000380 3300002705 Bacteria 28086
4 JGI25154J39366_1000915 3300002738 Bacteria 12421
5 JGI25157J39369_1000290 3300002741 Bacteria 36531
6 JGI25152J39213_1013435 3300002773 Bacteria 1708
7 JGI25150J39212_1001384 3300002774 Bacteria 6869
8 JGI25159J45721_1016485 3300002987 Bacteria 1572
9 JGI25151J46595_10013260 3300003187 Bacteria 3716
10 JGI25153J46596_10015977 3300003215 Bacteria 3031
11 rootH1_10000486 3300003316 Bacteria 10789
12 rootH1_10000486 3300003323 Bacteria 45870
13 rootH2_10010441 3300003320 Bacteria 4029
14 rootL2_10001240 3300003322 Bacteria 49675
15 rootL2_10012906 3300003322 Bacteria 12232
16 rootL2_10027680 3300003322 Bacteria 2563
17 rootH1_10024176 3300003323 Bacteria 5218
18 JGI25161J50226_1002180 3300003374 Bacteria 5216
19 Ga0055539_1000222 3300003752 Bacteria 40292
20 Ga0055539_1001236 3300003752 Bacteria 5136
21 Ga0055533_1000016 3300003756 Bacteria 396179
22 Ga0055532_1007900 3300003758 Bacteria 1348
23 Ga0055525_1000031 3300003759 Bacteria 314909
24 Ga0055525_1001027 3300003759 Bacteria 7316
25 Ga0055535_1000546 3300003761 Bacteria 32302
26 Ga0055535_1000934 3300003761 Bacteria 19510
27 Ga0055542_1000051 3300003762 Bacteria 175242
28 Ga0055529_1000333 3300003763 Bacteria 52783
29 Ga0055526_1001991 3300003771 Bacteria 14078
30 Ga0055537_1000847 3300003773 Bacteria 14872
31 Ga0055537_1013336 3300003773 Bacteria 1549
32 Ga0055524_1000052 3300003775 Bacteria 144959
33 Ga0055524_1001208 3300003775 Bacteria 15319
34 Ga0055536_1001039 3300003781 Bacteria 17571
35 Ga0055534_1006014 3300003784 Bacteria 3135
36 Ga0055534_1011734 3300003784 Bacteria 1765
37 Ga0055528_1028315 3300003790 Bacteria 1549
38 Ga0055528_1028978 3300003790 Bacteria 1512
39 Ga0055530_10000774 3300003791 Bacteria 26678
40 Ga0055530_10002673 3300003791 Bacteria 11115
41 Ga0055540_1000019 3300003792 Bacteria 210593
42 Ga0055540_1003484 3300003792 Bacteria 7593
43 Ga0055540_1004637 3300003792 Bacteria 6100
44 Ga0055540_1008483 3300003792 Bacteria 3695
45 Ga0055540_1014026 3300003792 Bacteria 2413
46 Ga0055531_10000001 3300003794 Bacteria 543586
47 Ga0055531_10003590 3300003794 Bacteria 9824
48 Ga0055543_1001268 3300004625 Bacteria 10404
49 Ga0055543_1014652 3300004625 Bacteria 1525
50 Ga0065165_1000080 3300005262 Bacteria 159638
51 Ga0065165_1000101 3300005262 Bacteria 141486
52 Ga0065165_1004873 3300005262 Bacteria 7950
53 Ga0065704_10101350 3300005289 Bacteria 2240
54 Ga0065707_10085820 3300005295 Bacteria 5869
55 Ga0070658_10191316 3300005327 Bacteria 1724
56 Ga0070676_10003063 3300005328 Bacteria 8634
57 Ga0070676_10011288 3300005328 Bacteria 4855
58 Ga0070676_10076365 3300005328 Bacteria 2022
59 Ga0070676_10216878 3300005328 Bacteria 1262
60 Ga0070683_100058877 3300005329 Bacteria 3568
61 Ga0070683_100098711 3300005329 Bacteria 2748
62 Ga0070670_100015187 3300005331 Bacteria 6610
63 Ga0070670_100034680 3300005331 Bacteria 4343
64 Ga0070670_100034757 3300005331 Bacteria 4338
65 Ga0070670_100039540 3300005331 Bacteria 4056
66 Ga0070670_100072428 3300005331 Bacteria 2959
67 Ga0070677_10044568 3300005333 Bacteria 1765
68 Ga0070677_10068212 3300005333 Bacteria 1488
69 Ga0068869_100004719 3300005334 Bacteria 8504
70 Ga0068869_100008964 3300005334 Bacteria 6476
71 Ga0068869_100039750 3300005334 Bacteria 3360
72 Ga0068869_100049512 3300005334 Bacteria 3042
73 Ga0070666_10006633 3300005335 Bacteria 7120
74 Ga0070666_10091903 3300005335 Bacteria 2086
75 Ga0070666_10212196 3300005335 Bacteria 1364
76 Ga0068868_100004253 3300005338 Bacteria 10018
77 Ga0068868_100023907 3300005338 Bacteria 4630
78 Ga0068868_100034210 3300005338 Bacteria 3922
79 Ga0068868_100042672 3300005338 Bacteria 3541
80 Ga0068868_100286998 3300005338 Bacteria 1394
81 Ga0070660_100035703 3300005339 Bacteria 3763
82 Ga0070689_100017233 3300005340 Bacteria 5301
83 Ga0070687_100039015 3300005343 Bacteria 2384
84 Ga0070661_100001817 3300005344 Bacteria 14798
85 Ga0070661_100058647 3300005344 Bacteria 2821
86 Ga0070661_100274770 3300005344 Bacteria 1306
87 Ga0070661_100285772 3300005344 Bacteria 1281
88 Ga0070669_100023109 3300005353 Bacteria 4450
89 Ga0070669_100038738 3300005353 Bacteria 3461
90 Ga0070669_100131496 3300005353 Bacteria 1920
91 Ga0070675_100002826 3300005354 Bacteria 13094
92 Ga0070675_100030113 3300005354 Bacteria 4379
93 Ga0070675_100040918 3300005354 Bacteria 3785
94 Ga0070675_100045557 3300005354 Bacteria 3589
95 Ga0070675_100057952 3300005354 Bacteria 3194
96 Ga0070675_100085309 3300005354 Bacteria 2638
97 Ga0070675_100241704 3300005354 Bacteria 1578
98 Ga0070671_100003012 3300005355 Bacteria 13118
99 Ga0070671_100025005 3300005355 Bacteria 4895
100 Ga0070671_100047724 3300005355 Bacteria 3560
101 Ga0070671_100054104 3300005355 Bacteria 3337
102 Ga0070671_100069858 3300005355 Bacteria 2929
103 Ga0070671_100082020 3300005355 Bacteria 2696
104 Ga0070671_100121894 3300005355 Bacteria 2194
105 Ga0070671_100219877 3300005355 Bacteria 1611
106 Ga0070674_100030949 3300005356 Bacteria 3541
107 Ga0070674_100032975 3300005356 Bacteria 3443
108 Ga0070674_100036248 3300005356 Bacteria 3309
109 Ga0070673_100007588 3300005364 Bacteria 7174
110 Ga0070673_100036683 3300005364 Bacteria 3729
111 Ga0070673_100044973 3300005364 Bacteria 3421
112 Ga0070673_100068030 3300005364 Bacteria 2850
113 Ga0070673_100103568 3300005364 Bacteria 2349
114 Ga0070673_100138713 3300005364 Bacteria 2049
115 Ga0070673_100234969 3300005364 Bacteria 1591
116 Ga0070688_100064028 3300005365 Bacteria 2332
117 Ga0070688_100195163 3300005365 Bacteria 1413
118 Ga0070659_100000579 3300005366 Bacteria 26725
119 Ga0070659_100008674 3300005366 Bacteria 7435
120 Ga0070659_100013962 3300005366 Bacteria 5995
121 Ga0070659_100157803 3300005366 Bacteria 1854
122 Ga0070659_100174294 3300005366 Bacteria 1763
123 Ga0070667_100013082 3300005367 Bacteria 6857
124 Ga0070667_100023040 3300005367 Bacteria 5165
125 Ga0070667_100095226 3300005367 Bacteria 2567
126 Ga0070667_100109279 3300005367 Bacteria 2396
127 Ga0070667_100144436 3300005367 Bacteria 2086
128 Ga0070701_10015321 3300005438 Bacteria 3538
129 Ga0070700_100091315 3300005441 Bacteria 1988
130 Ga0070708_100125922 3300005445 Bacteria 2368
131 Ga0070663_100025098 3300005455 Bacteria 4021
132 Ga0070678_100004941 3300005456 Bacteria 7629
133 Ga0070678_100055164 3300005456 Bacteria 2900
134 Ga0070678_100078809 3300005456 Bacteria 2490
135 Ga0070678_100096289 3300005456 Bacteria 2283
136 Ga0070678_100169634 3300005456 Bacteria 1776
137 Ga0070662_100013426 3300005457 Bacteria 5451
138 Ga0070662_100034456 3300005457 Bacteria 3570
139 Ga0070662_100079499 3300005457 Bacteria 2439
140 Ga0070662_100089545 3300005457 Bacteria 2308
141 Ga0070662_100089693 3300005457 Bacteria 2306
142 Ga0070662_100332517 3300005457 Bacteria 1241
143 Ga0068867_100004120 3300005459 Bacteria 10210
144 Ga0068867_100014291 3300005459 Bacteria 5624
145 Ga0068867_100019883 3300005459 Bacteria 4786
146 Ga0068867_100036670 3300005459 Bacteria 3561
147 Ga0068867_100095169 3300005459 Bacteria 2266
148 Ga0070685_10069079 3300005466 Bacteria 2089
149 Ga0070685_10070274 3300005466 Bacteria 2072
150 Ga0070706_100004451 3300005467 Bacteria 13531
151 Ga0070707_100030017 3300005468 Bacteria 5173
152 Ga0070679_100058210 3300005530 Bacteria 3850
153 Ga0068853_100022515 3300005539 Bacteria 5263
154 Ga0068853_100027195 3300005539 Bacteria 4806
155 Ga0068853_100103909 3300005539 Bacteria 2515
156 Ga0068853_100297298 3300005539 Bacteria 1491
157 Ga0070672_100000539 3300005543 Bacteria 22233
158 Ga0070672_100002829 3300005543 Bacteria 11117
159 Ga0070672_100013763 3300005543 Bacteria 5720
160 Ga0070672_100014204 3300005543 Bacteria 5636
161 Ga0070672_100014890 3300005543 Bacteria 5522
162 Ga0070672_100067627 3300005543 Bacteria 2831
163 Ga0070695_100083628 3300005545 Bacteria 2115
164 Ga0070693_100050798 3300005547 Bacteria 2371
165 Ga0068855_100020802 3300005563 Bacteria 7867
166 Ga0068855_100227926 3300005563 Bacteria 2087
167 Ga0070664_100003888 3300005564 Bacteria 12054
168 Ga0070664_100052052 3300005564 Bacteria 3467
169 Ga0070664_100103488 3300005564 Bacteria 2478
170 Ga0068857_100009913 3300005577 Bacteria 8268
171 Ga0068857_100010130 3300005577 Bacteria 8191
172 Ga0068857_100054535 3300005577 Bacteria 3547
173 Ga0068857_100155452 3300005577 Bacteria 2074
174 Ga0068854_100007402 3300005578 Bacteria 7012
175 Ga0068854_100027971 3300005578 Bacteria 3891
176 Ga0068854_100029629 3300005578 Bacteria 3790
177 Ga0068854_100212437 3300005578 Bacteria 1527
178 Ga0068854_100390870 3300005578 Bacteria 1148
179 Ga0068856_100003701 3300005614 Bacteria 15340
180 Ga0068856_100006672 3300005614 Bacteria 11312
181 Ga0068856_100277956 3300005614 Bacteria 1691
182 Ga0070702_100020783 3300005615 Bacteria 3444
183 Ga0068852_100026590 3300005616 Bacteria 4706
184 Ga0068852_100055928 3300005616 Bacteria 3407
185 Ga0068852_100085967 3300005616 Bacteria 2802
186 Ga0068852_100170013 3300005616 Bacteria 2042
187 Ga0068852_100530206 3300005616 Bacteria 1176
188 Ga0068859_100016999 3300005617 Bacteria 7302
189 Ga0068859_100456499 3300005617 Bacteria 1374
190 Ga0068859_100657771 3300005617 Bacteria 1140
191 Ga0068864_100004486 3300005618 Bacteria 11478
192 Ga0068864_100005423 3300005618 Bacteria 10455
193 Ga0068864_100005655 3300005618 Bacteria 10250
194 Ga0068866_10020191 3300005718 Bacteria 3048
195 Ga0068866_10049310 3300005718 Bacteria 2133
196 Ga0068861_100003800 3300005719 Bacteria 10082
197 Ga0068861_100012185 3300005719 Bacteria 5994
198 Ga0068861_100029406 3300005719 Bacteria 4020
199 Ga0068861_100048410 3300005719 Bacteria 3213
200 Ga0068861_100186709 3300005719 Bacteria 1729
201 Ga0068861_100384732 3300005719 Bacteria 1241
202 Ga0068851_10024607 3300005834 Bacteria 2949
203 Ga0068851_10033506 3300005834 Bacteria 2560
204 Ga0068851_10043285 3300005834 Bacteria 2269
205 Ga0068851_10047676 3300005834 Bacteria 2170
206 Ga0068870_10113740 3300005840 Bacteria 1549
207 Ga0068870_10113987 3300005840 Bacteria 1548
208 Ga0068863_100018169 3300005841 Bacteria 6733
209 Ga0068863_100031313 3300005841 Bacteria 5077
210 Ga0068858_100000947 3300005842 Bacteria 30015
211 Ga0068858_100013934 3300005842 Bacteria 7584
212 Ga0068858_100017782 3300005842 Bacteria 6657
213 Ga0068860_100000590 3300005843 Bacteria 43453
214 Ga0068860_100059239 3300005843 Bacteria 3641
215 Ga0068860_100062776 3300005843 Bacteria 3530
216 Ga0068862_100051041 3300005844 Bacteria 3537
217 Ga0075365_10001679 3300006038 Bacteria 10232
218 Ga0075363_100011463 3300006048 Bacteria 4245
219 Ga0075362_10015037 3300006177 Bacteria 3139
220 Ga0075362_10021544 3300006177 Bacteria 2706
221 Ga0075362_10028745 3300006177 Bacteria 2390
222 Ga0075362_10035990 3300006177 Bacteria 2163
223 Ga0075367_10004085 3300006178 Bacteria 7066
224 Ga0075367_10026150 3300006178 Bacteria 3307
225 Ga0075366_10003992 3300006195 Bacteria 7882
226 Ga0075366_10004014 3300006195 Bacteria 7866
227 Ga0075366_10005103 3300006195 Bacteria 7099
228 Ga0075366_10005573 3300006195 Bacteria 6825
229 Ga0075366_10013306 3300006195 Bacteria 4680
230 Ga0075366_10132149 3300006195 Bacteria 1506
231 Ga0075366_10133536 3300006195 Bacteria 1498
232 Ga0075366_10138842 3300006195 Bacteria 1469
233 Ga0097621_100032503 3300006237 Bacteria 4148
234 Ga0097621_100042765 3300006237 Bacteria 3650
235 Ga0097621_100102269 3300006237 Bacteria 2412
236 Ga0097621_100213414 3300006237 Bacteria 1679
237 Ga0075370_10009645 3300006353 Bacteria 5023
238 Ga0075370_10011106 3300006353 Bacteria 4722
239 Ga0075370_10014544 3300006353 Bacteria 4201
240 Ga0075370_10018864 3300006353 Bacteria 3746
241 Ga0075370_10026377 3300006353 Bacteria 3219
242 Ga0075370_10078789 3300006353 Bacteria 1892
243 Ga0075370_10081059 3300006353 Bacteria 1865
244 Ga0075430_100124636 3300006846 Bacteria 2147
245 Ga0075429_100000199 3300006880 Bacteria 39995
246 Ga0068865_100003764 3300006881 Bacteria 9103
247 Ga0068865_100221809 3300006881 Bacteria 1478
248 Ga0097620_100016998 3300006931 Bacteria 7302
249 Ga0097620_100134814 3300006931 Bacteria 2541
250 Ga0097620_100456497 3300006931 Bacteria 1374
251 Ga0097620_100657750 3300006931 Bacteria 1140
252 Ga0099823_1000108 3300006944 Bacteria 41193
253 Ga0079104_1000206 3300006946 Bacteria 82424
254 Ga0099826_10028336 3300006948 Bacteria 4098
255 Ga0105244_10005962 3300009036 Bacteria 7987
256 Ga0105240_10020056 3300009093 Bacteria 8924
257 Ga0105240_10187212 3300009093 Bacteria 2437
258 Ga0111539_10651212 3300009094 Bacteria 1227
259 Ga0105245_10056203 3300009098 Bacteria 3536
260 Ga0105245_10079449 3300009098 Bacteria 2995
261 Ga0105245_10372533 3300009098 Bacteria 1420
262 Ga0114129_10233635 3300009147 Bacteria 2475
263 Ga0105243_10017850 3300009148 Bacteria 5368
264 Ga0105243_10081131 3300009148 Bacteria 2647
265 Ga0105243_10082103 3300009148 Bacteria 2633
266 Ga0105242_10034430 3300009176 Bacteria 4060
267 Ga0105242_10041874 3300009176 Bacteria 3696
268 Ga0105242_10098902 3300009176 Bacteria 2468
269 Ga0105242_10191525 3300009176 Bacteria 1811
270 Ga0105242_10279628 3300009176 Bacteria 1515
271 Ga0105248_10000507 3300009177 Bacteria 44310
272 Ga0105248_10011351 3300009177 Bacteria 9817
273 Ga0105248_10165534 3300009177 Bacteria 2493
274 Ga0105248_10222679 3300009177 Bacteria 2124
275 Ga0105248_10241477 3300009177 Bacteria 2034
276 Ga0105248_10441834 3300009177 Bacteria 1465
277 Ga0105237_10000407 3300009545 Bacteria 61234
278 Ga0105237_10008587 3300009545 Bacteria 11047
279 Ga0105237_10121001 3300009545 Bacteria 2612
280 Ga0105237_10186286 3300009545 Bacteria 2075
281 Ga0105238_10007219 3300009551 Bacteria 11120
282 Ga0105238_10031941 3300009551 Bacteria 5357
283 Ga0105238_10034210 3300009551 Bacteria 5171
284 Ga0105238_10118970 3300009551 Bacteria 2622
285 Ga0105249_10019636 3300009553 Bacteria 6032
286 Ga0105249_10100427 3300009553 Bacteria 2720
287 Ga0105239_10000335 3300010375 Bacteria 68810
288 Ga0105239_10109818 3300010375 Bacteria 3057
289 Ga0105239_10288572 3300010375 Bacteria 1848
290 Ga0105246_10342205 3300011119 Bacteria 1223
291 Ga0157319_1000008 3300012497 Bacteria 315600
292 Ga0157373_10102499 3300013100 Bacteria 2014
293 Ga0157371_10064216 3300013102 Bacteria 2601
294 Ga0157370_10020513 3300013104 Bacteria 6599
295 Ga0157370_10062708 3300013104 Bacteria 3525
296 Ga0157369_10013318 3300013105 Bacteria 9299
297 Ga0157369_10028976 3300013105 Bacteria 6122
298 Ga0157369_10514526 3300013105 Bacteria 1238
299 Ga0157369_10527566 3300013105 Bacteria 1221
300 Ga0157374_10262529 3300013296 Bacteria 1701
301 Ga0157378_10007768 3300013297 Bacteria 9364
302 Ga0157378_10159676 3300013297 Bacteria 2107
303 Ga0157378_10230325 3300013297 Bacteria 1765
304 Ga0163162_10002118 3300013306 Bacteria 18641
305 Ga0163162_10007695 3300013306 Bacteria 10495
306 Ga0163162_10035098 3300013306 Bacteria 4994
307 Ga0163162_10045884 3300013306 Bacteria 4379
308 Ga0163162_10213321 3300013306 Bacteria 2060
309 Ga0163162_10401651 3300013306 Bacteria 1503
310 Ga0157372_10027045 3300013307 Bacteria 6244
311 Ga0157372_10088825 3300013307 Bacteria 3510
312 Ga0157375_10042105 3300013308 Bacteria 4417
313 Ga0157375_10067294 3300013308 Bacteria 3579
314 Ga0157375_10142267 3300013308 Bacteria 2527
315 Ga0157375_10224572 3300013308 Bacteria 2037
316 Ga0157375_10269509 3300013308 Bacteria 1864
317 Ga0157375_10270675 3300013308 Bacteria 1861
318 Ga0157375_10291569 3300013308 Bacteria 1795
319 Ga0163163_10017791 3300014325 Bacteria 6635
320 Ga0157380_10015082 3300014326 Bacteria 5670
321 Ga0157380_10015978 3300014326 Bacteria 5526
322 Ga0157380_10031940 3300014326 Bacteria 4045
323 Ga0157380_10191358 3300014326 Bacteria 1806
324 Ga0157380_10418226 3300014326 Bacteria 1278
325 Ga0182008_10001528 3300014497 Bacteria 15392
326 Ga0182008_10010178 3300014497 Bacteria 5041
327 Ga0182008_10011139 3300014497 Bacteria 4797
328 Ga0157377_10035813 3300014745 Bacteria 2726
329 Ga0157379_10006779 3300014968 Bacteria 9902
330 Ga0157379_10015200 3300014968 Bacteria 6752
331 Ga0157379_10015438 3300014968 Bacteria 6701
332 Ga0157379_10033209 3300014968 Bacteria 4602
333 Ga0157379_10062810 3300014968 Bacteria 3321
334 Ga0157379_10128357 3300014968 Bacteria 2282
335 Ga0157379_10290705 3300014968 Bacteria 1488
336 Ga0157376_10016718 3300014969 Bacteria 5578
337 Ga0157376_10043442 3300014969 Bacteria 3689
338 Ga0182006_1018146 3300015261 Bacteria 2978
339 Ga0163161_10043326 3300017792 Bacteria 3240
340 Ga0163161_10109278 3300017792 Bacteria 2065
341 Ga0213872_10000006 3300021361 Bacteria 249845
342 Ga0213872_10000007 3300021361 Bacteria 228206
343 Ga0213872_10000085 3300021361 Bacteria 85496
344 Ga0213872_10004397 3300021361 Bacteria 7491
345 Ga0213872_10059740 3300021361 Bacteria 1725
346 Ga0213872_10084726 3300021361 Bacteria 1421
347 Ga0213876_10101126 3300021384 Bacteria 1528
348 Ga0209436_108685 3300025208 Bacteria 1998
349 Ga0209674_100041 3300025226 Bacteria 396231
350 Ga0209672_100538 3300025228 Bacteria 20576
351 Ga0209147_102376 3300025229 Bacteria 4751
352 Ga0209563_100043 3300025230 Bacteria 397271
353 Ga0209563_100044 3300025230 Bacteria 396812
354 Ga0207427_101076 3300025231 Bacteria 11230
355 Ga0209258_100132 3300025242 Bacteria 175292
356 Ga0209258_100344 3300025242 Bacteria 68131
357 Ga0209258_100888 3300025242 Bacteria 15609
358 Ga0207425_1001109 3300025245 Bacteria 12168
359 Ga0209646_1000069 3300025246 Bacteria 230340
360 Ga0209026_1000006 3300025250 Bacteria 677225
361 Ga0209677_100096 3300025253 Bacteria 99089
362 Ga0209677_100412 3300025253 Bacteria 25554
363 Ga0209677_102293 3300025253 Bacteria 7368
364 Ga0209148_1000007 3300025254 Bacteria 1592273
365 Ga0209759_1000075 3300025256 Bacteria 176235
366 Ga0209759_1002024 3300025256 Bacteria 9607
367 Ga0209759_1002433 3300025256 Bacteria 8161
368 Ga0209129_1000084 3300025258 Bacteria 182554
369 Ga0209129_1008605 3300025258 Bacteria 2818
370 Ga0209565_1000169 3300025263 Bacteria 84839
371 Ga0209565_1000364 3300025263 Bacteria 38944
372 Ga0209565_1000456 3300025263 Bacteria 31480
373 Ga0209565_1009061 3300025263 Bacteria 2558
374 Ga0209455_1000242 3300025272 Bacteria 68131
375 Ga0209673_1000114 3300025273 Bacteria 178557
376 Ga0209673_1000916 3300025273 Bacteria 37512
377 Ga0209673_1001117 3300025273 Bacteria 29869
378 Ga0209673_1004916 3300025273 Bacteria 6958
379 Ga0209673_1007520 3300025273 Bacteria 4998
380 Ga0209673_1038210 3300025273 Bacteria 1401
381 Ga0209130_1000571 3300025284 Bacteria 36074
382 Ga0209130_1000621 3300025284 Bacteria 33935
383 Ga0209675_1000062 3300025291 Bacteria 178557
384 Ga0209675_1000631 3300025291 Bacteria 25073
385 Ga0209675_1003259 3300025291 Bacteria 7825
386 Ga0209675_1007298 3300025291 Bacteria 4269
387 Ga0209675_1012858 3300025291 Bacteria 2663
388 Ga0209676_1000817 3300025292 Bacteria 40674
389 Ga0209676_1000999 3300025292 Bacteria 33230
390 Ga0209676_1001040 3300025292 Bacteria 32079
391 Ga0209025_1000678 3300025294 Bacteria 58460
392 Ga0209025_1000719 3300025294 Bacteria 56292
393 Ga0209025_1000861 3300025294 Bacteria 47942
394 Ga0209025_1026289 3300025294 Bacteria 2927
395 Ga0209564_1000008 3300025295 Bacteria 953227
396 Ga0209564_1001058 3300025295 Bacteria 33490
397 Ga0209564_1001096 3300025295 Bacteria 32208
398 Ga0209758_1000754 3300025297 Bacteria 46944
399 Ga0209050_1000052 3300025298 Bacteria 351785
400 Ga0209050_1000137 3300025298 Bacteria 178099
401 Ga0209050_1001274 3300025298 Bacteria 28926
402 Ga0209050_1007733 3300025298 Bacteria 5932
403 Ga0209050_1009235 3300025298 Bacteria 5087
404 Ga0209050_1011538 3300025298 Bacteria 4171
405 Ga0209256_1000036 3300025299 Bacteria 386664
406 Ga0209256_1000206 3300025299 Bacteria 111425
407 Ga0209256_1000239 3300025299 Bacteria 97580
408 Ga0209256_1000413 3300025299 Bacteria 67123
409 Ga0207426_1000049 3300025302 Bacteria 401954
410 Ga0207426_1000086 3300025302 Bacteria 292089
411 Ga0207426_1000346 3300025302 Bacteria 85832
412 Ga0209051_1000015 3300025303 Bacteria 546798
413 Ga0209051_1000071 3300025303 Bacteria 210843
414 Ga0209051_1000420 3300025303 Bacteria 58383
415 Ga0209051_1000492 3300025303 Bacteria 51006
416 Ga0209051_1000824 3300025303 Bacteria 32075
417 Ga0209051_1001503 3300025303 Bacteria 19479
418 Ga0209051_1002377 3300025303 Bacteria 13590
419 Ga0209051_1004772 3300025303 Bacteria 8182
420 Ga0209257_1000033 3300025304 Bacteria 671006
421 Ga0209257_1000037 3300025304 Bacteria 612915
422 Ga0209257_1000367 3300025304 Bacteria 91077
423 Ga0209257_1002153 3300025304 Bacteria 20486
424 Ga0209257_1003430 3300025304 Bacteria 13611
425 Ga0209257_1004820 3300025304 Bacteria 10011
426 Ga0209257_1013244 3300025304 Bacteria 3695
427 Ga0207656_10045616 3300025321 Bacteria 1876
428 Ga0207655_1000477 3300025728 Bacteria 51677
429 Ga0207682_10006336 3300025893 Bacteria 4776
430 Ga0207682_10008206 3300025893 Bacteria 4140
431 Ga0207682_10025550 3300025893 Bacteria 2343
432 Ga0207682_10053371 3300025893 Bacteria 1676
433 Ga0207642_10052636 3300025899 Bacteria 1848
434 Ga0207642_10186575 3300025899 Bacteria 1134
435 Ga0207688_10024613 3300025901 Bacteria 3303
436 Ga0207688_10075128 3300025901 Bacteria 1923
437 Ga0207688_10092008 3300025901 Bacteria 1742
438 Ga0207680_10028834 3300025903 Bacteria 3110
439 Ga0207680_10069254 3300025903 Bacteria 2179
440 Ga0207645_10004942 3300025907 Bacteria 9772
441 Ga0207645_10015296 3300025907 Bacteria 5102
442 Ga0207645_10024769 3300025907 Bacteria 3887
443 Ga0207645_10221801 3300025907 Bacteria 1246
444 Ga0207643_10068116 3300025908 Bacteria 2044
445 Ga0207705_10133515 3300025909 Bacteria 1849
446 Ga0207705_10259469 3300025909 Bacteria 1326
447 Ga0207654_10108767 3300025911 Bacteria 1721
448 Ga0207707_10075456 3300025912 Bacteria 2942
449 Ga0207695_10007155 3300025913 Bacteria 14281
450 Ga0207695_10027612 3300025913 Bacteria 6316
451 Ga0207695_10038534 3300025913 Bacteria 5144
452 Ga0207695_10145947 3300025913 Bacteria 2310
453 Ga0207671_10001396 3300025914 Bacteria 28078
454 Ga0207671_10138714 3300025914 Bacteria 1872
455 Ga0207662_10023983 3300025918 Bacteria 3510
456 Ga0207662_10067829 3300025918 Bacteria 2152
457 Ga0207657_10012206 3300025919 Bacteria 8489
458 Ga0207657_10018610 3300025919 Bacteria 6621
459 Ga0207657_10054802 3300025919 Bacteria 3446
460 Ga0207657_10133950 3300025919 Bacteria 2029
461 Ga0207657_10157857 3300025919 Bacteria 1844
462 Ga0207657_10210194 3300025919 Bacteria 1562
463 Ga0207649_10001310 3300025920 Bacteria 14847
464 Ga0207649_10002844 3300025920 Bacteria 9546
465 Ga0207652_10146300 3300025921 Bacteria 2115
466 Ga0207646_10044519 3300025922 Bacteria 3984
467 Ga0207681_10022145 3300025923 Bacteria 4048
468 Ga0207681_10025887 3300025923 Bacteria 3779
469 Ga0207694_10016952 3300025924 Bacteria 5504
470 Ga0207694_10114665 3300025924 Bacteria 2146
471 Ga0207694_10119093 3300025924 Bacteria 2107
472 Ga0207650_10001668 3300025925 Bacteria 15808
473 Ga0207650_10044550 3300025925 Bacteria 3261
474 Ga0207650_10097792 3300025925 Bacteria 2254
475 Ga0207650_10101461 3300025925 Bacteria 2216
476 Ga0207650_10104542 3300025925 Bacteria 2185
477 Ga0207650_10136217 3300025925 Bacteria 1926
478 Ga0207659_10010662 3300025926 Bacteria 5779
479 Ga0207659_10041398 3300025926 Bacteria 3226
480 Ga0207659_10074502 3300025926 Bacteria 2488
481 Ga0207659_10079670 3300025926 Bacteria 2417
482 Ga0207659_10105241 3300025926 Bacteria 2135
483 Ga0207659_10125147 3300025926 Bacteria 1976
484 Ga0207687_10015473 3300025927 Bacteria 5003
485 Ga0207687_10075138 3300025927 Bacteria 2424
486 Ga0207687_10080592 3300025927 Bacteria 2350
487 Ga0207687_10093522 3300025927 Bacteria 2198
488 Ga0207687_10358040 3300025927 Bacteria 1190
489 Ga0207644_10001504 3300025931 Bacteria 15026
490 Ga0207644_10019986 3300025931 Bacteria 4549
491 Ga0207644_10022834 3300025931 Bacteria 4277
492 Ga0207644_10038881 3300025931 Bacteria 3355
493 Ga0207644_10053967 3300025931 Bacteria 2893
494 Ga0207644_10111137 3300025931 Bacteria 2072
495 Ga0207644_10264405 3300025931 Bacteria 1377
496 Ga0207690_10000935 3300025932 Bacteria 18686
497 Ga0207690_10058270 3300025932 Bacteria 2612
498 Ga0207690_10201856 3300025932 Bacteria 1511
499 Ga0207690_10208687 3300025932 Bacteria 1488
500 Ga0207706_10001677 3300025933 Bacteria 21872
501 Ga0207706_10015194 3300025933 Bacteria 6967
502 Ga0207706_10023606 3300025933 Bacteria 5522
503 Ga0207706_10024928 3300025933 Bacteria 5362
504 Ga0207706_10074501 3300025933 Bacteria 2985
505 Ga0207706_10096025 3300025933 Bacteria 2607
506 Ga0207706_10250986 3300025933 Bacteria 1545
507 Ga0207686_10063273 3300025934 Bacteria 2352
508 Ga0207686_10101993 3300025934 Bacteria 1918
509 Ga0207686_10175382 3300025934 Bacteria 1515
510 Ga0207709_10003126 3300025935 Bacteria 9959
511 Ga0207709_10026566 3300025935 Bacteria 3327
512 Ga0207709_10041375 3300025935 Bacteria 2765
513 Ga0207669_10019249 3300025937 Bacteria 3549
514 Ga0207669_10088509 3300025937 Bacteria 2008
515 Ga0207669_10223557 3300025937 Bacteria 1383
516 Ga0207704_10001522 3300025938 Bacteria 10396
517 Ga0207704_10063144 3300025938 Bacteria 2307
518 Ga0207665_10147025 3300025939 Bacteria 1685
519 Ga0207691_10002799 3300025940 Bacteria 17002
520 Ga0207691_10013171 3300025940 Bacteria 7920
521 Ga0207691_10013705 3300025940 Bacteria 7746
522 Ga0207691_10017465 3300025940 Bacteria 6803
523 Ga0207691_10023638 3300025940 Bacteria 5787
524 Ga0207691_10063825 3300025940 Bacteria 3339
525 Ga0207691_10076093 3300025940 Bacteria 3025
526 Ga0207691_10079947 3300025940 Bacteria 2942
527 Ga0207691_10143614 3300025940 Bacteria 2102
528 Ga0207691_10200916 3300025940 Bacteria 1735
529 Ga0207711_10010766 3300025941 Bacteria 7604
530 Ga0207711_10060531 3300025941 Bacteria 3263
531 Ga0207711_10088812 3300025941 Bacteria 2714
532 Ga0207711_10105438 3300025941 Bacteria 2500
533 Ga0207689_10002606 3300025942 Bacteria 16685
534 Ga0207689_10031970 3300025942 Bacteria 4377
535 Ga0207661_10123149 3300025944 Bacteria 2211
536 Ga0207661_10173487 3300025944 Bacteria 1878
537 Ga0207679_10000730 3300025945 Bacteria 21864
538 Ga0207679_10062285 3300025945 Bacteria 2779
539 Ga0207667_10001651 3300025949 Bacteria 28107
540 Ga0207667_10049107 3300025949 Bacteria 4459
541 Ga0207667_10129158 3300025949 Bacteria 2603
542 Ga0207651_10001009 3300025960 Bacteria 12449
543 Ga0207651_10069470 3300025960 Bacteria 2487
544 Ga0207651_10110736 3300025960 Bacteria 2060
545 Ga0207651_10239377 3300025960 Bacteria 1478
546 Ga0207712_10017241 3300025961 Bacteria 4688
547 Ga0207712_10075415 3300025961 Bacteria 2438
548 Ga0207640_10190473 3300025981 Bacteria 1546
549 Ga0207640_10283987 3300025981 Bacteria 1301
550 Ga0207658_10153500 3300025986 Bacteria 1879
551 Ga0207677_10002324 3300026023 Bacteria 9980
552 Ga0207677_10003785 3300026023 Bacteria 8038
553 Ga0207677_10047610 3300026023 Bacteria 2880
554 Ga0207677_10226804 3300026023 Bacteria 1502
555 Ga0207703_10003131 3300026035 Bacteria 13968
556 Ga0207703_10021976 3300026035 Bacteria 4996
557 Ga0207703_10024701 3300026035 Bacteria 4728
558 Ga0207703_10092993 3300026035 Bacteria 2539
559 Ga0207639_10004276 3300026041 Bacteria 9629
560 Ga0207678_10024830 3300026067 Bacteria 5232
561 Ga0207678_10062383 3300026067 Bacteria 3204
562 Ga0207702_10000305 3300026078 Bacteria 56491
563 Ga0207702_10027017 3300026078 Bacteria 4766
564 Ga0207702_10091496 3300026078 Bacteria 2664
565 Ga0207702_10231198 3300026078 Bacteria 1728
566 Ga0207641_10081706 3300026088 Bacteria 2806
567 Ga0207641_10112043 3300026088 Bacteria 2420
568 Ga0207648_10005380 3300026089 Bacteria 12909
569 Ga0207648_10015510 3300026089 Bacteria 7004
570 Ga0207648_10048878 3300026089 Bacteria 3703
571 Ga0207648_10128026 3300026089 Bacteria 2234
572 Ga0207648_10160550 3300026089 Bacteria 1985
573 Ga0207648_10175499 3300026089 Bacteria 1895
574 Ga0207648_10448174 3300026089 Bacteria 1175
575 Ga0207676_10001457 3300026095 Bacteria 17601
576 Ga0207676_10014960 3300026095 Bacteria 5590
577 Ga0207676_10043123 3300026095 Bacteria 3471
578 Ga0207674_10021674 3300026116 Bacteria 6918
579 Ga0207674_10040752 3300026116 Bacteria 4808
580 Ga0207674_10097874 3300026116 Bacteria 2918
581 Ga0207674_10218345 3300026116 Bacteria 1855
582 Ga0207674_10315926 3300026116 Bacteria 1511
583 Ga0207674_10360743 3300026116 Bacteria 1405
584 Ga0207675_100002976 3300026118 Bacteria 16669
585 Ga0207675_100005040 3300026118 Bacteria 12712
586 Ga0207675_100074722 3300026118 Bacteria 3172
587 Ga0207675_100080010 3300026118 Bacteria 3063
588 Ga0207675_100360220 3300026118 Bacteria 1427
589 Ga0207683_10030578 3300026121 Bacteria 4666
590 Ga0207683_10063818 3300026121 Bacteria 3245
591 Ga0207683_10090581 3300026121 Bacteria 2724
592 Ga0207683_10131412 3300026121 Bacteria 2252
593 Ga0207683_10134438 3300026121 Bacteria 2226
594 Ga0207698_10059078 3300026142 Bacteria 2976
595 Ga0207698_10085339 3300026142 Bacteria 2563
596 Ga0207698_10392828 3300026142 Bacteria 1323
597 Ga0207698_10416644 3300026142 Bacteria 1288
598 Ga0207698_10434480 3300026142 Bacteria 1263
599 Ga0209281_1000259 3300027111 Bacteria 101905
600 Ga0209389_1001550 3300027296 Bacteria 16381
601 Ga0209371_1012540 3300027312 Bacteria 2442
602 Ga0209282_1001433 3300027666 Bacteria 13109
603 Ga0209813_10027106 3300027866 Bacteria 1661
604 Ga0209813_10064218 3300027866 Bacteria 1179
605 Ga0268266_10029102 3300028379 Bacteria 4695
606 Ga0268266_10138127 3300028379 Bacteria 2185
607 Ga0268265_10035450 3300028380 Bacteria 3645
608 Ga0268265_10080194 3300028380 Bacteria 2573
609 Ga0268265_10402325 3300028380 Bacteria 1266
610 Ga0268264_10000991 3300028381 Bacteria 28937
611 Ga0268264_10017985 3300028381 Bacteria 5781
612 Ga0268264_10038937 3300028381 Bacteria 3926
613 Ga0268264_10040703 3300028381 Bacteria 3840
614 Ga0268264_10623235 3300028381 Bacteria 1065
615 Ga0265334_10006510 3300028573 Bacteria 5029
616 Ga0265336_10000013 3300028666 Bacteria 252156
617 Ga0307517_10000131 3300028786 Bacteria 113233
618 Ga0307515_10000011 3300028794 Bacteria 633903
619 Ga0307515_10002251 3300028794 Bacteria 42303
620 Ga0307515_10003079 3300028794 Bacteria 35329
621 Ga0307515_10003449 3300028794 Bacteria 33283
622 Ga0307515_10009653 3300028794 Bacteria 18622
623 Ga0307515_10009817 3300028794 Bacteria 18442
624 Ga0307515_10020437 3300028794 Bacteria 11812
625 Ga0307515_10056041 3300028794 Bacteria 5739
626 Ga0307515_10091473 3300028794 Bacteria 3801
627 Ga0307515_10169786 3300028794 Bacteria 2180
628 Ga0307515_10201434 3300028794 Bacteria 1865
629 Ga0265324_10001846 3300029957 Bacteria 11474
630 Ga0268256_1026534 3300030500 Bacteria 1454
631 Ga0307511_10055559 3300030521 Bacteria 3107
632 Ga0307512_10078314 3300030522 Bacteria 2396
633 Ga0316176_1040348 3300030732 Bacteria 1630
634 Ga0314311_1170456 3300030733 Bacteria 1824
635 Ga0316179_1078834 3300030734 Bacteria 5092
636 Ga0316183_1136313 3300030742 Bacteria 4845
637 Ga0265329_10008613 3300031242 Bacteria 3855
638 Ga0265331_10009176 3300031250 Bacteria 5577
639 Ga0265327_10000012 3300031251 Bacteria 530403
640 Ga0265327_10000056 3300031251 Bacteria 243974
641 Ga0265327_10001807 3300031251 Bacteria 25067
642 Ga0265316_10002321 3300031344 Bacteria 19887
643 Ga0307513_10003077 3300031456 Bacteria 22757
644 Ga0307513_10019900 3300031456 Bacteria 7975
645 Ga0307513_10043735 3300031456 Bacteria 4915
646 Ga0307513_10059994 3300031456 Bacteria 4035
647 Ga0307513_10361519 3300031456 Bacteria 1196
648 Ga0307509_10000871 3300031507 Bacteria 52060
649 Ga0307509_10009460 3300031507 Bacteria 12180
650 Ga0307509_10022255 3300031507 Bacteria 7152
651 Ga0307509_10028400 3300031507 Bacteria 6220
652 Ga0307509_10195687 3300031507 Bacteria 1866
653 Ga0307509_10203426 3300031507 Bacteria 1814
654 Ga0307509_10215244 3300031507 Bacteria 1741
655 Ga0307509_10252867 3300031507 Bacteria 1544
656 Ga0307408_100000037 3300031548 Bacteria 187096
657 Ga0307408_100158050 3300031548 Bacteria 1797
658 Ga0307408_100164324 3300031548 Bacteria 1766
659 Ga0307408_100193482 3300031548 Bacteria 1640
660 Ga0307508_10000123 3300031616 Bacteria 92439
661 Ga0307508_10000349 3300031616 Bacteria 56002
662 Ga0307508_10002230 3300031616 Bacteria 20644
663 Ga0307508_10272356 3300031616 Bacteria 1287
664 Ga0307514_10000355 3300031649 Bacteria 106758
665 Ga0307514_10010918 3300031649 Bacteria 7584
666 Ga0307514_10020837 3300031649 Bacteria 5346
667 Ga0265314_10047625 3300031711 Bacteria 3015
668 Ga0265342_10114117 3300031712 Bacteria 1526
669 Ga0307516_10000303 3300031730 Bacteria 63898
670 Ga0307516_10008217 3300031730 Bacteria 11852
671 Ga0307516_10050751 3300031730 Bacteria 4068
672 Ga0307516_10175736 3300031730 Bacteria 1878
673 Ga0307405_10012268 3300031731 Bacteria 4528
674 Ga0307405_10021412 3300031731 Bacteria 3633
675 Ga0307405_10102759 3300031731 Bacteria 1920
676 Ga0307405_10411825 3300031731 Bacteria 1061
677 Ga0307413_10382363 3300031824 Bacteria 1097
678 Ga0307406_10005195 3300031901 Bacteria 7110
679 Ga0307406_10054939 3300031901 Bacteria 2544
680 Ga0307406_10068104 3300031901 Bacteria 2323
681 Ga0307406_10163773 3300031901 Bacteria 1602
682 Ga0307412_10031153 3300031911 Bacteria 3365
683 Ga0307412_10063769 3300031911 Bacteria 2487
684 Ga0307412_10115767 3300031911 Bacteria 1922
685 Ga0307412_10134175 3300031911 Bacteria 1803
686 Ga0307409_100000926 3300031995 Bacteria 13646
687 Ga0307409_100086215 3300031995 Bacteria 2555
688 Ga0307409_100239027 3300031995 Bacteria 1652
689 Ga0307416_100003028 3300032002 Bacteria 9820
690 Ga0307416_100005442 3300032002 Bacteria 7821
691 Ga0307416_100032643 3300032002 Bacteria 3937
692 Ga0307416_100083294 3300032002 Bacteria 2713
693 Ga0307416_100096192 3300032002 Bacteria 2560
694 Ga0307414_10003263 3300032004 Bacteria 8645
695 Ga0307414_10132690 3300032004 Bacteria 1936
696 Ga0307414_10177876 3300032004 Bacteria 1708
697 Ga0307414_10264358 3300032004 Bacteria 1437
698 Ga0307411_10005122 3300032005 Bacteria 6398
699 Ga0307411_10026791 3300032005 Bacteria 3476
700 Ga0307411_10026968 3300032005 Bacteria 3467
701 Ga0307411_10316605 3300032005 Bacteria 1258
702 Ga0307415_100014487 3300032126 Bacteria 4638
703 Ga0307415_100022072 3300032126 Bacteria 3924
704 Ga0307507_10099711 3300033179 Bacteria 2438
705 Ga0307510_10024879 3300033180 Bacteria 6912
706 Ga0307510_10058456 3300033180 Bacteria 3991
707 Ga0307510_10068523 3300033180 Bacteria 3559
708 Ga0373948_0011730 3300034817 Bacteria 1555
709 Ga0373950_0006113 3300034818 Bacteria 1824
710 Ga0373940_0023282 3300035088 Bacteria 1597
711 Ga0373932_0010384 3300035112 Bacteria 2252
712 Ga0373932_0048541 3300035112 Bacteria 1251
713 Ga0373955_0131767 3300035172 Bacteria 1460
714 Ga0373924_0132353 3300035410 Bacteria 1085
715 Ga0373931_0000480 3300035691 Bacteria 16287
716 Ga0373931_0002140 3300035691 Bacteria 8696
717 Ga0373931_0008075 3300035691 Bacteria 4981
718 Ga0373931_0047189 3300035691 Bacteria 2279
719 Ga0373931_0189316 3300035691 Bacteria 1223
720 Ga0373935_0162930 3300035692 Bacteria 1521
721 Ga0373947_0079558 3300035725 Bacteria 2026
722 Ga0373937_0083884 3300036401 Bacteria 2948
723 Ga0373937_0121014 3300036401 Bacteria 2439
724 Ga0373925_0004190 3300037068 Bacteria 10946
725 Ga0373925_0043282 3300037068 Bacteria 3341
726 Ga0395899_0001142 3300037312 Bacteria 23518
727 Ga0395898_0000283 3300037466 Bacteria 122630
728 Ga0395898_0017273 3300037466 Bacteria 7370
729 Ga0395898_0028719 3300037466 Bacteria 5574
730 Ga0395898_0510687 3300037466 Bacteria 1143
731 Ga0395905_0000117 3300037471 Bacteria 133291
732 Ga0395905_0000474 3300037471 Bacteria 55503
733 Ga0395905_0002201 3300037471 Bacteria 22018
734 Ga0395905_0005150 3300037471 Bacteria 13415
735 Ga0395905_0090405 3300037471 Bacteria 2870
736 Ga0395905_0362289 3300037471 Bacteria 1342
737 Ga0395901_0011124 3300038443 Bacteria 9121
738 Ga0436365_1372925 3300039437 Bacteria 1599
739 Ga0436361_0019641 3300039447 Bacteria 127735
740 Ga0436361_0080882 3300039447 Bacteria 1537
741 Ga0436361_0163583 3300039447 Bacteria 173204
742 Ga0436361_0328630 3300039447 Bacteria 6697
743 Ga0436361_0360217 3300039447 Bacteria 9488
744 Ga0436361_0484071 3300039447 Bacteria 47769
745 Ga0436361_0869713 3300039447 Bacteria 3016
746 Ga0451853_2460991 3300041512 Bacteria 2303
747 Ga0439431_0005707 3300041997 Bacteria 2745
748 Ga0439437_000193 3300042000 Bacteria 5272
749 Ga0439449_0001342 3300042007 Bacteria 9637
750 Ga0450917_000061 3300042120 Bacteria 5956
751 Ga0450919_000622 3300042121 Bacteria 4483
752 Ga0450923_003185 3300042125 Bacteria 2449
753 Ga0450923_014087 3300042125 Bacteria 1479
754 Ga0450890_001292 3300042127 Bacteria 3621
755 Ga0450890_001944 3300042127 Bacteria 2919
756 Ga0450892_000146 3300042130 Bacteria 8168
757 Ga0450898_009583 3300042134 Bacteria 1552
758 Ga0450889_000033 3300042144 Bacteria 11861
759 Ga0450906_013652 3300042145 Bacteria 1495
760 Ga0439434_0000557 3300042435 Bacteria 10724
761 Ga0439434_0054390 3300042435 Bacteria 1245
762 Ga0439464_0008881 3300042439 Bacteria 2635
763 Ga0439460_0010055 3300042461 Bacteria 2413
764 Ga0450918_000307 3300042531 Bacteria 10947
765 Ga0450918_000609 3300042531 Bacteria 7669
766 Ga0451577_0001078 3300042876 Bacteria 39114
767 Ga0451577_0036086 3300042876 Bacteria 4452
768 Ga0451577_0069045 3300042876 Bacteria 3151
769 Ga0466969_0000013 3300044656 Bacteria 111537
770 Ga0466969_0005945 3300044656 Bacteria 6492
771 Ga0466969_0056440 3300044656 Bacteria 1917
772 Ga0466969_0062657 3300044656 Bacteria 1803
773 Ga0466972_0012974 3300044658 Bacteria 4187
774 Ga0466965_0001440 3300044683 Bacteria 9598
775 Ga0466965_0047910 3300044683 Bacteria 2116
776 Ga0466966_0009951 3300044684 Bacteria 6302
777 Ga0466966_0021167 3300044684 Bacteria 4270
778 Ga0466966_0066520 3300044684 Bacteria 2264
779 Ga0466961_0013192 3300044693 Bacteria 5286
780 Ga0466961_0017265 3300044693 Bacteria 4634
781 Ga0466961_0045198 3300044693 Bacteria 2817
782 Ga0466961_0051807 3300044693 Bacteria 2620
783 Ga0466961_0191015 3300044693 Bacteria 1269
784 Ga0466963_0018170 3300044694 Bacteria 4392
785 Ga0466964_0002927 3300044706 Bacteria 6163
786 Ga0453684_0020777 3300044712 Bacteria 9869
787 Ga0453684_0212062 3300044712 Bacteria 2250
788 Ga0453684_0253101 3300044712 Bacteria 2022
789 Ga0453684_0299700 3300044712 Bacteria 1827
790 Ga0466971_0012889 3300044719 Bacteria 3666
791 Ga0466971_0044275 3300044719 Bacteria 1998
792 Ga0466971_0045502 3300044719 Bacteria 1971
793 Ga0466960_0077866 3300044901 Bacteria 1664
794 Ga0466959_0013538 3300045049 Bacteria 5912
795 Ga0466959_0079990 3300045049 Bacteria 2356
796 Ga0466959_0320452 3300045049 Bacteria 1060
797 Ga0451576_0015485 3300045051 Bacteria 8445
798 Ga0451576_0056008 3300045051 Bacteria 4124
799 Ga0451576_0073488 3300045051 Bacteria 3558
800 Ga0451576_0183228 3300045051 Bacteria 2186
801 Ga0466958_0046375 3300045836 Bacteria 2622
802 Ga0466967_0013196 3300045976 Bacteria 6371
803 Ga0495592_0004276 3300046454 Bacteria 10439
804 Ga0495590_0029475 3300046457 Bacteria 1924
805 Ga0495629_0036078 3300046459 Bacteria 3493
806 Ga0495638_0108498 3300046460 Bacteria 1651
807 Ga0495638_0202346 3300046460 Bacteria 1120
808 Ga0495650_0006312 3300046471 Bacteria 7413
809 Ga0495650_0020411 3300046471 Bacteria 3232
810 Ga0495605_0039118 3300046474 Bacteria 2377
811 Ga0495585_0059305 3300046492 Bacteria 2109
812 Ga0495583_0000081 3300046506 Bacteria 168304
813 Ga0495583_0045661 3300046506 Bacteria 2025
814 Ga0495606_0001086 3300046507 Bacteria 38950
815 Ga0495610_0042868 3300046512 Bacteria 2259
816 Ga0495616_0000726 3300046513 Bacteria 24323
817 Ga0495630_0098717 3300046517 Bacteria 2209
818 Ga0495631_0070588 3300046518 Bacteria 1510
819 Ga0495632_0017229 3300046519 Bacteria 3994
820 Ga0495637_0077224 3300046520 Bacteria 1333
821 Ga0495652_0335607 3300046529 Bacteria 1088
822 Ga0495586_0038746 3300046535 Bacteria 2561
823 Ga0495621_0004221 3300046539 Bacteria 4015
824 Ga0495621_0021148 3300046539 Bacteria 2142
825 Ga0495597_0007632 3300046542 Bacteria 5474
826 Ga0495645_0324077 3300046543 Bacteria 999
827 Ga0495622_0081799 3300046557 Bacteria 1486
828 Ga0495668_0059994 3300046616 Bacteria 2099
829 Ga0495668_0068365 3300046616 Bacteria 1954
830 Ga0495625_0001179 3300046660 Bacteria 33575
831 Ga0495625_0004883 3300046660 Bacteria 12496
832 Ga0495625_0006045 3300046660 Bacteria 10869
833 Ga0495625_0068980 3300046660 Bacteria 2484
834 Ga0495625_0120654 3300046660 Bacteria 1784
835 Ga0495588_0054017 3300046674 Bacteria 2072
836 Ga0495647_0090336 3300046681 Bacteria 1255
837 Ga0495658_0047252 3300046683 Bacteria 2423
838 Ga0495658_0058506 3300046683 Bacteria 2205
839 Ga0495658_0074436 3300046683 Bacteria 1979
840 Ga0495669_0037133 3300046684 Bacteria 2155
841 Ga0495669_0059037 3300046684 Bacteria 1732
842 Ga0495613_0323642 3300046689 Bacteria 1064
843 Ga0495671_0018499 3300046692 Bacteria 3697
844 Ga0495649_0000287 3300046694 Bacteria 44649
845 Ga0495649_0009613 3300046694 Bacteria 5732
846 Ga0495589_0002102 3300046794 Bacteria 11247
847 Ga0495660_0043906 3300046810 Bacteria 2461
848 Ga0495676_0007401 3300047321 Bacteria 10075
849 Ga0495676_0038732 3300047321 Bacteria 3957
850 Ga0495687_000582 3300047443 Bacteria 42863
851 Ga0495687_003343 3300047443 Bacteria 11726
852 Ga0495681_0024990 3300047470 Bacteria 3133
853 Ga0495684_0108284 3300047471 Bacteria 2099
854 Ga0495686_0062267 3300047472 Bacteria 2315
855 Ga0495593_0002204 3300047673 Bacteria 11664
856 Ga0495593_0025973 3300047673 Bacteria 3238
857 Ga0495602_0220129 3300048088 Bacteria 1434
858 Ga0495614_0154627 3300048089 Bacteria 1024
859 Ga0496100_0034311 3300048903 Bacteria 3183
860 Ga0496102_0052953 3300048905 Bacteria 3699
861 Ga0496103_0102424 3300048906 Bacteria 1813
862 Ga0496104_0067251 3300048907 Bacteria 3404
863 Ga0496104_0214146 3300048907 Bacteria 1838
864 Ga0496104_0226033 3300048907 Bacteria 1784
865 Ga0496105_0046450 3300048908 Bacteria 3584
866 Ga0496105_0062626 3300048908 Bacteria 3070
867 Ga0496105_0159229 3300048908 Bacteria 1854
868 Ga0496105_0210749 3300048908 Bacteria 1584
869 Ga0496106_0004527 3300048909 Bacteria 10296
870 Ga0496107_0006316 3300048910 Bacteria 8145
871 Ga0496108_0137119 3300048911 Bacteria 2106
872 Ga0496108_0228730 3300048911 Bacteria 1617
873 Ga0496108_0252487 3300048911 Bacteria 1534
874 Ga0496109_0010731 3300048912 Bacteria 7841
875 Ga0496109_0075411 3300048912 Bacteria 3101
876 Ga0496109_0123433 3300048912 Bacteria 2414
877 Ga0496109_0176816 3300048912 Bacteria 2004
878 Ga0496109_0256161 3300048912 Bacteria 1648
879 Ga0496109_0455003 3300048912 Bacteria 1209
880 Ga0496110_0007885 3300048913 Bacteria 8528
881 Ga0496110_0041580 3300048913 Bacteria 4012
882 Ga0496111_0334603 3300048914 Bacteria 1121
883 Ga0496112_0011308 3300048915 Bacteria 8144
884 Ga0496114_0038217 3300048917 Bacteria 3971
885 Ga0496114_0051763 3300048917 Bacteria 3419
886 Ga0496115_0018225 3300048918 Bacteria 5386
887 Ga0496116_0095988 3300048919 Bacteria 1787
888 Ga0496117_0045596 3300048920 Bacteria 3164
889 Ga0496118_0006245 3300048921 Bacteria 13169
890 Ga0496118_0017827 3300048921 Bacteria 6441
891 Ga0496121_0023572 3300048924 Bacteria 5921
892 Ga0496121_0143192 3300048924 Bacteria 1770
893 Ga0496124_0001458 3300048927 Bacteria 34900
894 Ga0496125_0005030 3300048928 Bacteria 14929
895 Ga0496125_0124973 3300048928 Bacteria 1825
896 Ga0496126_0199588 3300048929 Bacteria 1690
897 Ga0496126_0229401 3300048929 Bacteria 1556
898 Ga0495682_0049139 3300049460 Bacteria 1537
899 Ga0501297_011568 3300049520 Bacteria 1014
900 Ga0501298_010416 3300049521 Bacteria 1601
901 Ga0501300_001415 3300049523 Bacteria 3595
902 Ga0501034_0077062 3300049571 Bacteria 3340
903 Ga0501034_0118662 3300049571 Bacteria 2632
904 Ga0501047_0019851 3300049581 Bacteria 6450
905 Ga0501198_000001 3300049649 Bacteria 234552
906 Ga0501202_005882 3300049652 Bacteria 2181
907 Ga0501206_001533 3300049653 Bacteria 2880
908 Ga0501207_012428 3300049654 Bacteria 1280
909 Ga0501211_000219 3300049658 Bacteria 4955
910 Ga0501222_000004 3300049662 Bacteria 136139
911 Ga0501222_000467 3300049662 Bacteria 6041
912 Ga0501249_003842 3300049679 Bacteria 3032
913 Ga0501253_005537 3300049683 Bacteria 1662
914 Ga0501257_039065 3300049686 Bacteria 1162
915 Ga0501258_000186 3300049687 Bacteria 3647
916 Ga0501261_002913 3300049690 Bacteria 2102
917 Ga0501221_002045 3300049704 Bacteria 3358
918 Ga0501225_0004943 3300049705 Bacteria 3940
919 Ga0501225_0016453 3300049705 Bacteria 2057
920 Ga0501229_000371 3300049706 Bacteria 5068
921 Ga0501080_0060974 3300049742 Bacteria 3512
922 Ga0501262_001380 3300049759 Bacteria 2724
923 Ga0501265_003561 3300049762 Bacteria 1768
924 Ga0501271_002697 3300049768 Bacteria 1601
925 Ga0501272_000700 3300049769 Bacteria 3024
926 Ga0501035_0033229 3300049822 Bacteria 4691
927 nmdc:mga03683_10973_c1 3300050489 Bacteria 3263
928 nmdc:mga03683_22760_c1 3300050489 Bacteria 2432
929 nmdc:mga03683_5023_c1 3300050489 Bacteria 4433
930 nmdc:mga03n38_16306_c1 3300050490 Bacteria 2888
931 nmdc:mga03n38_32716_c1 3300050490 Bacteria 2206
932 nmdc:mga03n38_36024_c1 3300050490 Bacteria 2125
933 nmdc:mga0k408_10183_c1 3300050493 Bacteria 5082
934 nmdc:mga0k408_137371_c1 3300050493 Bacteria 1453
935 nmdc:mga0k408_15567_c1 3300050493 Bacteria 4205
936 nmdc:mga0k408_189618_c1 3300050493 Bacteria 1227
937 nmdc:mga0k408_201803_c1 3300050493 Bacteria 1187
938 nmdc:mga0k408_22319_c1 3300050493 Bacteria 3564
939 nmdc:mga0k408_2564_c1 3300050493 Bacteria 8432
940 nmdc:mga0k408_33438_c1 3300050493 Bacteria 2941
941 nmdc:mga0k408_4053_c1 3300050493 Bacteria 7772
942 nmdc:mga0k408_4958_c1 3300050493 Bacteria 7055
943 nmdc:mga0k408_63664_c1 3300050493 Bacteria 2146
944 nmdc:mga0k408_66089_c1 3300050493 Bacteria 2106
945 nmdc:mga0k408_8218_c1 3300050493 Bacteria 5594
946 nmdc:mga0k408_93998_c1 3300050493 Bacteria 1763
947 nmdc:mga06z11_37401_c1 3300050494 Bacteria 2403
948 nmdc:mga06z11_44644_c1 3300050494 Bacteria 2236
949 nmdc:mga04h51_70934_c1 3300050495 Bacteria 1216
950 nmdc:mga07m45_16377_c1 3300050496 Bacteria 3970
951 nmdc:mga07m45_2094_c1 3300050496 Bacteria 9264
952 nmdc:mga07m45_38799_c1 3300050496 Bacteria 2660
953 nmdc:mga07m45_4892_c1 3300050496 Bacteria 6600
954 nmdc:mga07m45_5767_c1 3300050496 Bacteria 6199
955 nmdc:mga07m45_65014_c1 3300050496 Bacteria 2071
956 nmdc:mga07m45_7026_c1 3300050496 Bacteria 5728
957 nmdc:mga07m45_78799_c1 3300050496 Bacteria 1880
958 nmdc:mga07m45_81_c1 3300050496 Bacteria 35778
959 nmdc:mga07m45_89611_c1 3300050496 Bacteria 1762
960 nmdc:mga07m45_9218_c1 3300050496 Bacteria 5108
961 nmdc:mga09592_1146_c1 3300050508 Bacteria 21139
962 nmdc:mga0qj67_116730_c1 3300050509 Bacteria 2157
963 Ga0500610_0004460 3300053079 Bacteria 5566
964 Ga0500610_0012136 3300053079 Bacteria 3955
965 Ga0500635_0000011 3300053080 Bacteria 144219
966 Ga0500643_022086 3300053087 Bacteria 2054
967 Ga0500644_0001695 3300053088 Bacteria 5745
968 Ga0500651_0000067 3300053093 Bacteria 67673
969 Ga0500651_0010814 3300053093 Bacteria 5484
970 Ga0500571_000088 3300053110 Bacteria 29136
971 Ga0500594_0002317 3300053118 Bacteria 4130
972 Ga0500594_0003170 3300053118 Bacteria 3601
973 Ga0500607_003160 3300053121 Bacteria 12287
974 Ga0500618_033455 3300053125 Bacteria 1199
975 Ga0500658_0001848 3300053134 Bacteria 8325
976 Ga0500658_0046863 3300053134 Bacteria 1752
977 Ga0500559_0001207 3300053136 Bacteria 15383
978 Ga0500568_0007294 3300053139 Bacteria 5437
979 Ga0500573_0158255 3300053140 Bacteria 1235
980 Ga0500619_005909 3300053154 Bacteria 2776
981 Ga0500622_0009720 3300053156 Bacteria 5313
982 Ga0500627_0001479 3300053158 Bacteria 6584
983 Ga0500634_0030761 3300053161 Bacteria 2926
984 Ga0500645_001523 3300053730 Bacteria 11600
985 Ga0500596_008364 3300053735 Bacteria 1653
986 Ga0500587_001369 3300053739 Bacteria 3437
987 Ga0590071_005488 3300059421 Bacteria 3047
988 Ga0466962_0001662 3300061719 Bacteria 10428
989 2513228780 2513020051 Bacteria 6053213
990 2587759365 2585428062 Bacteria 6842168
991 2599620871 2599185214 Bacteria 8209958
992 2599674323 2599185226 Bacteria 8233575
993 2599678513 2599185227 Bacteria 8246414
994 2599690382 2599185229 Bacteria 8216126
995 2643743229 2643221544 Bacteria 5886209
996 2643932751 2643221585 Bacteria 5812563
997 2644161342 2643221628 Bacteria 5745828
998 2644218355 2643221639 Bacteria 6649903
999 2644243362 2643221644 Bacteria 6865017
1000 2644260246 2643221646 Bacteria 6433402
1001 2644303034 2643221654 Bacteria 5273570
1002 2644314001 2643221656 Bacteria 5809961
1003 2644324059 2643221658 Bacteria 6064537
1004 2644340829 2643221660 Bacteria 4208257
1005 2644400757 2643221672 Bacteria 6322190
1006 2644465996 2643221683 Bacteria 5749203
1007 2739056095 2738541337 Bacteria 6183410
1008 2819601994 2818991446 Bacteria 7757362
1009 2831269823 2831265667 Bacteria 7184833
1010 2831869135 2831864461 Bacteria 6502356
1011 2838055159 2838054893 Bacteria 7451788
1012 2842680907 2842677519 Bacteria 5615038
1013 2885196702 2885192300 Bacteria 5882526
1014 2885201844 2885198086 Bacteria 7212419
1015 2885215446 2885211737 Bacteria 7212420
1016 2886849293 2886848708 Bacteria 5632523
1017 2886853290 2886848708 Bacteria 5632523
1018 2899927249 2899924645 Bacteria 7487985
1019 2904453995 2904449895 Bacteria 6927402
1020 2904459467 2904456579 Bacteria 6819253
1021 2904546121 2904541872 Bacteria 8915136
1022 2919465425 2919462493 Bacteria 5817112
1023 2928042836 2928037797 Bacteria 7273642
1024 2928048737 2928044640 Bacteria 7271509
1025 2928055069 2928051484 Bacteria 7773759
1026 2928068495 2928064002 Bacteria 7419480
1027 2928073599 2928070936 Bacteria 8062541
1028 2928089698 2928084124 Bacteria 7159212
1029 2928117246 2928115317 Bacteria 6477646
1030 2929161318 2929160207 Bacteria 9075316
1031 2929521581 2929520902 Bacteria 6765052
1032 2945949783 2945945610 Bacteria 5951079
1033 2945973806 2945972063 Bacteria 6086495
1034 2954770601 2954767861 Bacteria 5535784
1035 Ga0307517_10115787
1036 JGI24740J21852_10041842
1037 JGI25156J39149_1000380
1038 JGI25154J39366_1000915
1039 JGI25157J39369_1000290
1040 JGI25152J39213_1013435
1041 JGI25150J39212_1001384
1042 JGI25159J45721_1016485
1043 JGI25151J46595_10013260
1044 JGI25153J46596_10015977
1045 rootH1_10000486
1046 rootH2_10010441
1047 rootL2_10001240
1048 rootL2_10012906
1049 rootL2_10027680
1050 rootH1_10024176
1051 JGI25161J50226_1002180
1052 Ga0055539_1000222
1053 Ga0055539_1001236
1054 Ga0055533_1000016
1055 Ga0055532_1007900
1056 Ga0055525_1000031
1057 Ga0055525_1001027
1058 Ga0055535_1000546
1059 Ga0055535_1000934
1060 Ga0055542_1000051
1061 Ga0055529_1000333
1062 Ga0055526_1001991
1063 Ga0055537_1000847
1064 Ga0055537_1013336
1065 Ga0055524_1000052
1066 Ga0055524_1001208
1067 Ga0055536_1001039
1068 Ga0055534_1006014
1069 Ga0055534_1011734
1070 Ga0055528_1028315
1071 Ga0055528_1028978
1072 Ga0055530_10000774
1073 Ga0055530_10002673
1074 Ga0055540_1000019
1075 Ga0055540_1003484
1076 Ga0055540_1004637
1077 Ga0055540_1008483
1078 Ga0055540_1014026
1079 Ga0055531_10000001
1080 Ga0055531_10003590
1081 Ga0055543_1001268
1082 Ga0055543_1014652
1083 Ga0065165_1000080
1084 Ga0065165_1000101
1085 Ga0065165_1004873
1086 Ga0065704_10101350
1087 Ga0065707_10085820
1088 Ga0070658_10191316
1089 Ga0070676_10003063
1090 Ga0070676_10011288
1091 Ga0070676_10076365
1092 Ga0070676_10216878
1093 Ga0070683_100058877
1094 Ga0070683_100098711
1095 Ga0070670_100015187
1096 Ga0070670_100034680
1097 Ga0070670_100034757
1098 Ga0070670_100039540
1099 Ga0070670_100072428
1100 Ga0070677_10044568
1101 Ga0070677_10068212
1102 Ga0068869_100004719
1103 Ga0068869_100008964
1104 Ga0068869_100039750
1105 Ga0068869_100049512
1106 Ga0070666_10006633
1107 Ga0070666_10091903
1108 Ga0070666_10212196
1109 Ga0068868_100004253
1110 Ga0068868_100023907
1111 Ga0068868_100034210
1112 Ga0068868_100042672
1113 Ga0068868_100286998
1114 Ga0070660_100035703
1115 Ga0070689_100017233
1116 Ga0070687_100039015
1117 Ga0070661_100001817
1118 Ga0070661_100058647
1119 Ga0070661_100274770
1120 Ga0070661_100285772
1121 Ga0070669_100023109
1122 Ga0070669_100038738
1123 Ga0070669_100131496
1124 Ga0070675_100002826
1125 Ga0070675_100030113
1126 Ga0070675_100040918
1127 Ga0070675_100045557
1128 Ga0070675_100057952
1129 Ga0070675_100085309
1130 Ga0070675_100241704
1131 Ga0070671_100003012
1132 Ga0070671_100025005
1133 Ga0070671_100047724
1134 Ga0070671_100054104
1135 Ga0070671_100069858
1136 Ga0070671_100082020
1137 Ga0070671_100121894
1138 Ga0070671_100219877
1139 Ga0070674_100030949
1140 Ga0070674_100032975
1141 Ga0070674_100036248
1142 Ga0070673_100007588
1143 Ga0070673_100036683
1144 Ga0070673_100044973
1145 Ga0070673_100068030
1146 Ga0070673_100103568
1147 Ga0070673_100138713
1148 Ga0070673_100234969
1149 Ga0070688_100064028
1150 Ga0070688_100195163
1151 Ga0070659_100000579
1152 Ga0070659_100008674
1153 Ga0070659_100013962
1154 Ga0070659_100157803
1155 Ga0070659_100174294
1156 Ga0070667_100013082
1157 Ga0070667_100023040
1158 Ga0070667_100095226
1159 Ga0070667_100109279
1160 Ga0070667_100144436
1161 Ga0070701_10015321
1162 Ga0070700_100091315
1163 Ga0070708_100125922
1164 Ga0070663_100025098
1165 Ga0070678_100004941
1166 Ga0070678_100055164
1167 Ga0070678_100078809
1168 Ga0070678_100096289
1169 Ga0070678_100169634
1170 Ga0070662_100013426
1171 Ga0070662_100034456
1172 Ga0070662_100079499
1173 Ga0070662_100089545
1174 Ga0070662_100089693
1175 Ga0070662_100332517
1176 Ga0068867_100004120
1177 Ga0068867_100014291
1178 Ga0068867_100019883
1179 Ga0068867_100036670
1180 Ga0068867_100095169
1181 Ga0070685_10069079
1182 Ga0070685_10070274
1183 Ga0070706_100004451
1184 Ga0070707_100030017
1185 Ga0070679_100058210
1186 Ga0068853_100022515
1187 Ga0068853_100027195
1188 Ga0068853_100103909
1189 Ga0068853_100297298
1190 Ga0070672_100000539
1191 Ga0070672_100002829
1192 Ga0070672_100013763
1193 Ga0070672_100014204
1194 Ga0070672_100014890
1195 Ga0070672_100067627
1196 Ga0070695_100083628
1197 Ga0070693_100050798
1198 Ga0068855_100020802
1199 Ga0068855_100227926
1200 Ga0070664_100003888
1201 Ga0070664_100052052
1202 Ga0070664_100103488
1203 Ga0068857_100009913
1204 Ga0068857_100010130
1205 Ga0068857_100054535
1206 Ga0068857_100155452
1207 Ga0068854_100007402
1208 Ga0068854_100027971
1209 Ga0068854_100029629
1210 Ga0068854_100212437
1211 Ga0068854_100390870
1212 Ga0068856_100003701
1213 Ga0068856_100006672
1214 Ga0068856_100277956
1215 Ga0070702_100020783
1216 Ga0068852_100026590
1217 Ga0068852_100055928
1218 Ga0068852_100085967
1219 Ga0068852_100170013
1220 Ga0068852_100530206
1221 Ga0068859_100016999
1222 Ga0068859_100456499
1223 Ga0068859_100657771
1224 Ga0068864_100004486
1225 Ga0068864_100005423
1226 Ga0068864_100005655
1227 Ga0068866_10020191
1228 Ga0068866_10049310
1229 Ga0068861_100003800
1230 Ga0068861_100012185
1231 Ga0068861_100029406
1232 Ga0068861_100048410
1233 Ga0068861_100186709
1234 Ga0068861_100384732
1235 Ga0068851_10024607
1236 Ga0068851_10033506
1237 Ga0068851_10043285
1238 Ga0068851_10047676
1239 Ga0068870_10113740
1240 Ga0068870_10113987
1241 Ga0068863_100018169
1242 Ga0068863_100031313
1243 Ga0068858_100000947
1244 Ga0068858_100013934
1245 Ga0068858_100017782
1246 Ga0068860_100000590
1247 Ga0068860_100059239
1248 Ga0068860_100062776
1249 Ga0068862_100051041
1250 Ga0075365_10001679
1251 Ga0075363_100011463
1252 Ga0075362_10015037
1253 Ga0075362_10021544
1254 Ga0075362_10028745
1255 Ga0075362_10035990
1256 Ga0075367_10004085
1257 Ga0075367_10026150
1258 Ga0075366_10003992
1259 Ga0075366_10004014
1260 Ga0075366_10005103
1261 Ga0075366_10005573
1262 Ga0075366_10013306
1263 Ga0075366_10132149
1264 Ga0075366_10133536
1265 Ga0075366_10138842
1266 Ga0097621_100032503
1267 Ga0097621_100042765
1268 Ga0097621_100102269
1269 Ga0097621_100213414
1270 Ga0075370_10009645
1271 Ga0075370_10011106
1272 Ga0075370_10014544
1273 Ga0075370_10018864
1274 Ga0075370_10026377
1275 Ga0075370_10078789
1276 Ga0075370_10081059
1277 Ga0075430_100124636
1278 Ga0075429_100000199
1279 Ga0068865_100003764
1280 Ga0068865_100221809
1281 Ga0097620_100016998
1282 Ga0097620_100134814
1283 Ga0097620_100456497
1284 Ga0097620_100657750
1285 Ga0099823_1000108
1286 Ga0079104_1000206
1287 Ga0099826_10028336
1288 Ga0105244_10005962
1289 Ga0105240_10020056
1290 Ga0105240_10187212
1291 Ga0111539_10651212
1292 Ga0105245_10056203
1293 Ga0105245_10079449
1294 Ga0105245_10372533
1295 Ga0114129_10233635
1296 Ga0105243_10017850
1297 Ga0105243_10081131
1298 Ga0105243_10082103
1299 Ga0105242_10034430
1300 Ga0105242_10041874
1301 Ga0105242_10098902
1302 Ga0105242_10191525
1303 Ga0105242_10279628
1304 Ga0105248_10000507
1305 Ga0105248_10011351
1306 Ga0105248_10165534
1307 Ga0105248_10222679
1308 Ga0105248_10241477
1309 Ga0105248_10441834
1310 Ga0105237_10000407
1311 Ga0105237_10008587
1312 Ga0105237_10121001
1313 Ga0105237_10186286
1314 Ga0105238_10007219
1315 Ga0105238_10031941
1316 Ga0105238_10034210
1317 Ga0105238_10118970
1318 Ga0105249_10019636
1319 Ga0105249_10100427
1320 Ga0105239_10000335
1321 Ga0105239_10109818
1322 Ga0105239_10288572
1323 Ga0105246_10342205
1324 Ga0157319_1000008
1325 Ga0157373_10102499
1326 Ga0157371_10064216
1327 Ga0157370_10020513
1328 Ga0157370_10062708
1329 Ga0157369_10013318
1330 Ga0157369_10028976
1331 Ga0157369_10514526
1332 Ga0157369_10527566
1333 Ga0157374_10262529
1334 Ga0157378_10007768
1335 Ga0157378_10159676
1336 Ga0157378_10230325
1337 Ga0163162_10002118
1338 Ga0163162_10007695
1339 Ga0163162_10035098
1340 Ga0163162_10045884
1341 Ga0163162_10213321
1342 Ga0163162_10401651
1343 Ga0157372_10027045
1344 Ga0157372_10088825
1345 Ga0157375_10042105
1346 Ga0157375_10067294
1347 Ga0157375_10142267
1348 Ga0157375_10224572
1349 Ga0157375_10269509
1350 Ga0157375_10270675
1351 Ga0157375_10291569
1352 Ga0163163_10017791
1353 Ga0157380_10015082
1354 Ga0157380_10015978
1355 Ga0157380_10031940
1356 Ga0157380_10191358
1357 Ga0157380_10418226
1358 Ga0182008_10001528
1359 Ga0182008_10010178
1360 Ga0182008_10011139
1361 Ga0157377_10035813
1362 Ga0157379_10006779
1363 Ga0157379_10015200
1364 Ga0157379_10015438
1365 Ga0157379_10033209
1366 Ga0157379_10062810
1367 Ga0157379_10128357
1368 Ga0157379_10290705
1369 Ga0157376_10016718
1370 Ga0157376_10043442
1371 Ga0182006_1018146
1372 Ga0163161_10043326
1373 Ga0163161_10109278
1374 Ga0213872_10000006
1375 Ga0213872_10000007
1376 Ga0213872_10000085
1377 Ga0213872_10004397
1378 Ga0213872_10059740
1379 Ga0213872_10084726
1380 Ga0213876_10101126
1381 Ga0209436_108685
1382 Ga0209674_100041
1383 Ga0209672_100538
1384 Ga0209147_102376
1385 Ga0209563_100043
1386 Ga0209563_100044
1387 Ga0207427_101076
1388 Ga0209258_100132
1389 Ga0209258_100344
1390 Ga0209258_100888
1391 Ga0207425_1001109
1392 Ga0209646_1000069
1393 Ga0209026_1000006
1394 Ga0209677_100096
1395 Ga0209677_100412
1396 Ga0209677_102293
1397 Ga0209148_1000007
1398 Ga0209759_1000075
1399 Ga0209759_1002024
1400 Ga0209759_1002433
1401 Ga0209129_1000084
1402 Ga0209129_1008605
1403 Ga0209565_1000169
1404 Ga0209565_1000364
1405 Ga0209565_1000456
1406 Ga0209565_1009061
1407 Ga0209455_1000242
1408 Ga0209673_1000114
1409 Ga0209673_1000916
1410 Ga0209673_1001117
1411 Ga0209673_1004916
1412 Ga0209673_1007520
1413 Ga0209673_1038210
1414 Ga0209130_1000571
1415 Ga0209130_1000621
1416 Ga0209675_1000062
1417 Ga0209675_1000631
1418 Ga0209675_1003259
1419 Ga0209675_1007298
1420 Ga0209675_1012858
1421 Ga0209676_1000817
1422 Ga0209676_1000999
1423 Ga0209676_1001040
1424 Ga0209025_1000678
1425 Ga0209025_1000719
1426 Ga0209025_1000861
1427 Ga0209025_1026289
1428 Ga0209564_1000008
1429 Ga0209564_1001058
1430 Ga0209564_1001096
1431 Ga0209758_1000754
1432 Ga0209050_1000052
1433 Ga0209050_1000137
1434 Ga0209050_1001274
1435 Ga0209050_1007733
1436 Ga0209050_1009235
1437 Ga0209050_1011538
1438 Ga0209256_1000036
1439 Ga0209256_1000206
1440 Ga0209256_1000239
1441 Ga0209256_1000413
1442 Ga0207426_1000049
1443 Ga0207426_1000086
1444 Ga0207426_1000346
1445 Ga0209051_1000015
1446 Ga0209051_1000071
1447 Ga0209051_1000420
1448 Ga0209051_1000492
1449 Ga0209051_1000824
1450 Ga0209051_1001503
1451 Ga0209051_1002377
1452 Ga0209051_1004772
1453 Ga0209257_1000033
1454 Ga0209257_1000037
1455 Ga0209257_1000367
1456 Ga0209257_1002153
1457 Ga0209257_1003430
1458 Ga0209257_1004820
1459 Ga0209257_1013244
1460 Ga0207656_10045616
1461 Ga0207655_1000477
1462 Ga0207682_10006336
1463 Ga0207682_10008206
1464 Ga0207682_10025550
1465 Ga0207682_10053371
1466 Ga0207642_10052636
1467 Ga0207642_10186575
1468 Ga0207688_10024613
1469 Ga0207688_10075128
1470 Ga0207688_10092008
1471 Ga0207680_10028834
1472 Ga0207680_10069254
1473 Ga0207645_10004942
1474 Ga0207645_10015296
1475 Ga0207645_10024769
1476 Ga0207645_10221801
1477 Ga0207643_10068116
1478 Ga0207705_10133515
1479 Ga0207705_10259469
1480 Ga0207654_10108767
1481 Ga0207707_10075456
1482 Ga0207695_10007155
1483 Ga0207695_10027612
1484 Ga0207695_10038534
1485 Ga0207695_10145947
1486 Ga0207671_10001396
1487 Ga0207671_10138714
1488 Ga0207662_10023983
1489 Ga0207662_10067829
1490 Ga0207657_10012206
1491 Ga0207657_10018610
1492 Ga0207657_10054802
1493 Ga0207657_10133950
1494 Ga0207657_10157857
1495 Ga0207657_10210194
1496 Ga0207649_10001310
1497 Ga0207649_10002844
1498 Ga0207652_10146300
1499 Ga0207646_10044519
1500 Ga0207681_10022145
1501 Ga0207681_10025887
1502 Ga0207694_10016952
1503 Ga0207694_10114665
1504 Ga0207694_10119093
1505 Ga0207650_10001668
1506 Ga0207650_10044550
1507 Ga0207650_10097792
1508 Ga0207650_10101461
1509 Ga0207650_10104542
1510 Ga0207650_10136217
1511 Ga0207659_10010662
1512 Ga0207659_10041398
1513 Ga0207659_10074502
1514 Ga0207659_10079670
1515 Ga0207659_10105241
1516 Ga0207659_10125147
1517 Ga0207687_10015473
1518 Ga0207687_10075138
1519 Ga0207687_10080592
1520 Ga0207687_10093522
1521 Ga0207687_10358040
1522 Ga0207644_10001504
1523 Ga0207644_10019986
1524 Ga0207644_10022834
1525 Ga0207644_10038881
1526 Ga0207644_10053967
1527 Ga0207644_10111137
1528 Ga0207644_10264405
1529 Ga0207690_10000935
1530 Ga0207690_10058270
1531 Ga0207690_10201856
1532 Ga0207690_10208687
1533 Ga0207706_10001677
1534 Ga0207706_10015194
1535 Ga0207706_10023606
1536 Ga0207706_10024928
1537 Ga0207706_10074501
1538 Ga0207706_10096025
1539 Ga0207706_10250986
1540 Ga0207686_10063273
1541 Ga0207686_10101993
1542 Ga0207686_10175382
1543 Ga0207709_10003126
1544 Ga0207709_10026566
1545 Ga0207709_10041375
1546 Ga0207669_10019249
1547 Ga0207669_10088509
1548 Ga0207669_10223557
1549 Ga0207704_10001522
1550 Ga0207704_10063144
1551 Ga0207665_10147025
1552 Ga0207691_10002799
1553 Ga0207691_10013171
1554 Ga0207691_10013705
1555 Ga0207691_10017465
1556 Ga0207691_10023638
1557 Ga0207691_10063825
1558 Ga0207691_10076093
1559 Ga0207691_10079947
1560 Ga0207691_10143614
1561 Ga0207691_10200916
1562 Ga0207711_10010766
1563 Ga0207711_10060531
1564 Ga0207711_10088812
1565 Ga0207711_10105438
1566 Ga0207689_10002606
1567 Ga0207689_10031970
1568 Ga0207661_10123149
1569 Ga0207661_10173487
1570 Ga0207679_10000730
1571 Ga0207679_10062285
1572 Ga0207667_10001651
1573 Ga0207667_10049107
1574 Ga0207667_10129158
1575 Ga0207651_10001009
1576 Ga0207651_10069470
1577 Ga0207651_10110736
1578 Ga0207651_10239377
1579 Ga0207712_10017241
1580 Ga0207712_10075415
1581 Ga0207640_10190473
1582 Ga0207640_10283987
1583 Ga0207658_10153500
1584 Ga0207677_10002324
1585 Ga0207677_10003785
1586 Ga0207677_10047610
1587 Ga0207677_10226804
1588 Ga0207703_10003131
1589 Ga0207703_10021976
1590 Ga0207703_10024701
1591 Ga0207703_10092993
1592 Ga0207639_10004276
1593 Ga0207678_10024830
1594 Ga0207678_10062383
1595 Ga0207702_10000305
1596 Ga0207702_10027017
1597 Ga0207702_10091496
1598 Ga0207702_10231198
1599 Ga0207641_10081706
1600 Ga0207641_10112043
1601 Ga0207648_10005380
1602 Ga0207648_10015510
1603 Ga0207648_10048878
1604 Ga0207648_10128026
1605 Ga0207648_10160550
1606 Ga0207648_10175499
1607 Ga0207648_10448174
1608 Ga0207676_10001457
1609 Ga0207676_10014960
1610 Ga0207676_10043123
1611 Ga0207674_10021674
1612 Ga0207674_10040752
1613 Ga0207674_10097874
1614 Ga0207674_10218345
1615 Ga0207674_10315926
1616 Ga0207674_10360743
1617 Ga0207675_100002976
1618 Ga0207675_100005040
1619 Ga0207675_100074722
1620 Ga0207675_100080010
1621 Ga0207675_100360220
1622 Ga0207683_10030578
1623 Ga0207683_10063818
1624 Ga0207683_10090581
1625 Ga0207683_10131412
1626 Ga0207683_10134438
1627 Ga0207698_10059078
1628 Ga0207698_10085339
1629 Ga0207698_10392828
1630 Ga0207698_10416644
1631 Ga0207698_10434480
1632 Ga0209281_1000259
1633 Ga0209389_1001550
1634 Ga0209371_1012540
1635 Ga0209282_1001433
1636 Ga0209813_10027106
1637 Ga0209813_10064218
1638 Ga0268266_10029102
1639 Ga0268266_10138127
1640 Ga0268265_10035450
1641 Ga0268265_10080194
1642 Ga0268265_10402325
1643 Ga0268264_10000991
1644 Ga0268264_10017985
1645 Ga0268264_10038937
1646 Ga0268264_10040703
1647 Ga0268264_10623235
1648 Ga0265334_10006510
1649 Ga0265336_10000013
1650 Ga0307517_10000131
1651 Ga0307515_10000011
1652 Ga0307515_10002251
1653 Ga0307515_10003079
1654 Ga0307515_10003449
1655 Ga0307515_10009653
1656 Ga0307515_10009817
1657 Ga0307515_10020437
1658 Ga0307515_10056041
1659 Ga0307515_10091473
1660 Ga0307515_10169786
1661 Ga0307515_10201434
1662 Ga0265324_10001846
1663 Ga0268256_1026534
1664 Ga0307511_10055559
1665 Ga0307512_10078314
1666 Ga0316176_1040348
1667 Ga0314311_1170456
1668 Ga0316179_1078834
1669 Ga0316183_1136313
1670 Ga0265329_10008613
1671 Ga0265331_10009176
1672 Ga0265327_10000012
1673 Ga0265327_10000056
1674 Ga0265327_10001807
1675 Ga0265316_10002321
1676 Ga0307513_10003077
1677 Ga0307513_10019900
1678 Ga0307513_10043735
1679 Ga0307513_10059994
1680 Ga0307513_10361519
1681 Ga0307509_10000871
1682 Ga0307509_10009460
1683 Ga0307509_10022255
1684 Ga0307509_10028400
1685 Ga0307509_10195687
1686 Ga0307509_10203426
1687 Ga0307509_10215244
1688 Ga0307509_10252867
1689 Ga0307408_100000037
1690 Ga0307408_100158050
1691 Ga0307408_100164324
1692 Ga0307408_100193482
1693 Ga0307508_10000123
1694 Ga0307508_10000349
1695 Ga0307508_10002230
1696 Ga0307508_10272356
1697 Ga0307514_10000355
1698 Ga0307514_10010918
1699 Ga0307514_10020837
1700 Ga0265314_10047625
1701 Ga0265342_10114117
1702 Ga0307516_10000303
1703 Ga0307516_10008217
1704 Ga0307516_10050751
1705 Ga0307516_10175736
1706 Ga0307405_10012268
1707 Ga0307405_10021412
1708 Ga0307405_10102759
1709 Ga0307405_10411825
1710 Ga0307413_10382363
1711 Ga0307406_10005195
1712 Ga0307406_10054939
1713 Ga0307406_10068104
1714 Ga0307406_10163773
1715 Ga0307412_10031153
1716 Ga0307412_10063769
1717 Ga0307412_10115767
1718 Ga0307412_10134175
1719 Ga0307409_100000926
1720 Ga0307409_100086215
1721 Ga0307409_100239027
1722 Ga0307416_100003028
1723 Ga0307416_100005442
1724 Ga0307416_100032643
1725 Ga0307416_100083294
1726 Ga0307416_100096192
1727 Ga0307414_10003263
1728 Ga0307414_10132690
1729 Ga0307414_10177876
1730 Ga0307414_10264358
1731 Ga0307411_10005122
1732 Ga0307411_10026791
1733 Ga0307411_10026968
1734 Ga0307411_10316605
1735 Ga0307415_100014487
1736 Ga0307415_100022072
1737 Ga0307507_10099711
1738 Ga0307510_10024879
1739 Ga0307510_10058456
1740 Ga0307510_10068523
1741 Ga0373948_0011730
1742 Ga0373950_0006113
1743 Ga0373940_0023282
1744 Ga0373932_0010384
1745 Ga0373932_0048541
1746 Ga0373955_0131767
1747 Ga0373924_0132353
1748 Ga0373931_0000480
1749 Ga0373931_0002140
1750 Ga0373931_0008075
1751 Ga0373931_0047189
1752 Ga0373931_0189316
1753 Ga0373935_0162930
1754 Ga0373947_0079558
1755 Ga0373937_0083884
1756 Ga0373937_0121014
1757 Ga0373925_0004190
1758 Ga0373925_0043282
1759 Ga0395899_0001142
1760 Ga0395898_0000283
1761 Ga0395898_0017273
1762 Ga0395898_0028719
1763 Ga0395898_0510687
1764 Ga0395905_0000117
1765 Ga0395905_0000474
1766 Ga0395905_0002201
1767 Ga0395905_0005150
1768 Ga0395905_0090405
1769 Ga0395905_0362289
1770 Ga0395901_0011124
1771 Ga0436365_1372925
1772 Ga0436361_0019641
1773 Ga0436361_0080882
1774 Ga0436361_0163583
1775 Ga0436361_0328630
1776 Ga0436361_0360217
1777 Ga0436361_0484071
1778 Ga0436361_0869713
1779 Ga0451853_2460991
1780 Ga0439431_0005707
1781 Ga0439437_000193
1782 Ga0439449_0001342
1783 Ga0450917_000061
1784 Ga0450919_000622
1785 Ga0450923_003185
1786 Ga0450923_014087
1787 Ga0450890_001292
1788 Ga0450890_001944
1789 Ga0450892_000146
1790 Ga0450898_009583
1791 Ga0450889_000033
1792 Ga0450906_013652
1793 Ga0439434_0000557
1794 Ga0439434_0054390
1795 Ga0439464_0008881
1796 Ga0439460_0010055
1797 Ga0450918_000307
1798 Ga0450918_000609
1799 Ga0451577_0001078
1800 Ga0451577_0036086
1801 Ga0451577_0069045
1802 Ga0466969_0000013
1803 Ga0466969_0005945
1804 Ga0466969_0056440
1805 Ga0466969_0062657
1806 Ga0466972_0012974
1807 Ga0466965_0001440
1808 Ga0466965_0047910
1809 Ga0466966_0009951
1810 Ga0466966_0021167
1811 Ga0466966_0066520
1812 Ga0466961_0013192
1813 Ga0466961_0017265
1814 Ga0466961_0045198
1815 Ga0466961_0051807
1816 Ga0466961_0191015
1817 Ga0466963_0018170
1818 Ga0466964_0002927
1819 Ga0453684_0020777
1820 Ga0453684_0212062
1821 Ga0453684_0253101
1822 Ga0453684_0299700
1823 Ga0466971_0012889
1824 Ga0466971_0044275
1825 Ga0466971_0045502
1826 Ga0466960_0077866
1827 Ga0466959_0013538
1828 Ga0466959_0079990
1829 Ga0466959_0320452
1830 Ga0451576_0015485
1831 Ga0451576_0056008
1832 Ga0451576_0073488
1833 Ga0451576_0183228
1834 Ga0466958_0046375
1835 Ga0466967_0013196
1836 Ga0495592_0004276
1837 Ga0495590_0029475
1838 Ga0495629_0036078
1839 Ga0495638_0108498
1840 Ga0495638_0202346
1841 Ga0495650_0006312
1842 Ga0495650_0020411
1843 Ga0495605_0039118
1844 Ga0495585_0059305
1845 Ga0495583_0000081
1846 Ga0495583_0045661
1847 Ga0495606_0001086
1848 Ga0495610_0042868
1849 Ga0495616_0000726
1850 Ga0495630_0098717
1851 Ga0495631_0070588
1852 Ga0495632_0017229
1853 Ga0495637_0077224
1854 Ga0495652_0335607
1855 Ga0495586_0038746
1856 Ga0495621_0004221
1857 Ga0495621_0021148
1858 Ga0495597_0007632
1859 Ga0495645_0324077
1860 Ga0495622_0081799
1861 Ga0495668_0059994
1862 Ga0495668_0068365
1863 Ga0495625_0001179
1864 Ga0495625_0004883
1865 Ga0495625_0006045
1866 Ga0495625_0068980
1867 Ga0495625_0120654
1868 Ga0495588_0054017
1869 Ga0495647_0090336
1870 Ga0495658_0047252
1871 Ga0495658_0058506
1872 Ga0495658_0074436
1873 Ga0495669_0037133
1874 Ga0495669_0059037
1875 Ga0495613_0323642
1876 Ga0495671_0018499
1877 Ga0495649_0000287
1878 Ga0495649_0009613
1879 Ga0495589_0002102
1880 Ga0495660_0043906
1881 Ga0495676_0007401
1882 Ga0495676_0038732
1883 Ga0495687_000582
1884 Ga0495687_003343
1885 Ga0495681_0024990
1886 Ga0495684_0108284
1887 Ga0495686_0062267
1888 Ga0495593_0002204
1889 Ga0495593_0025973
1890 Ga0495602_0220129
1891 Ga0495614_0154627
1892 Ga0496100_0034311
1893 Ga0496102_0052953
1894 Ga0496103_0102424
1895 Ga0496104_0067251
1896 Ga0496104_0214146
1897 Ga0496104_0226033
1898 Ga0496105_0046450
1899 Ga0496105_0062626
1900 Ga0496105_0159229
1901 Ga0496105_0210749
1902 Ga0496106_0004527
1903 Ga0496107_0006316
1904 Ga0496108_0137119
1905 Ga0496108_0228730
1906 Ga0496108_0252487
1907 Ga0496109_0010731
1908 Ga0496109_0075411
1909 Ga0496109_0123433
1910 Ga0496109_0176816
1911 Ga0496109_0256161
1912 Ga0496109_0455003
1913 Ga0496110_0007885
1914 Ga0496110_0041580
1915 Ga0496111_0334603
1916 Ga0496112_0011308
1917 Ga0496114_0038217
1918 Ga0496114_0051763
1919 Ga0496115_0018225
1920 Ga0496116_0095988
1921 Ga0496117_0045596
1922 Ga0496118_0006245
1923 Ga0496118_0017827
1924 Ga0496121_0023572
1925 Ga0496121_0143192
1926 Ga0496124_0001458
1927 Ga0496125_0005030
1928 Ga0496125_0124973
1929 Ga0496126_0199588
1930 Ga0496126_0229401
1931 Ga0495682_0049139
1932 Ga0501297_011568
1933 Ga0501298_010416
1934 Ga0501300_001415
1935 Ga0501034_0077062
1936 Ga0501034_0118662
1937 Ga0501047_0019851
1938 Ga0501198_000001
1939 Ga0501202_005882
1940 Ga0501206_001533
1941 Ga0501207_012428
1942 Ga0501211_000219
1943 Ga0501222_000004
1944 Ga0501222_000467
1945 Ga0501249_003842
1946 Ga0501253_005537
1947 Ga0501257_039065
1948 Ga0501258_000186
1949 Ga0501261_002913
1950 Ga0501221_002045
1951 Ga0501225_0004943
1952 Ga0501225_0016453
1953 Ga0501229_000371
1954 Ga0501080_0060974
1955 Ga0501262_001380
1956 Ga0501265_003561
1957 Ga0501271_002697
1958 Ga0501272_000700
1959 Ga0501035_0033229
1960 nmdc:mga03683_10973_c1
1961 nmdc:mga03683_22760_c1
1962 nmdc:mga03683_5023_c1
1963 nmdc:mga03n38_16306_c1
1964 nmdc:mga03n38_32716_c1
1965 nmdc:mga03n38_36024_c1
1966 nmdc:mga0k408_10183_c1
1967 nmdc:mga0k408_137371_c1
1968 nmdc:mga0k408_15567_c1
1969 nmdc:mga0k408_189618_c1
1970 nmdc:mga0k408_201803_c1
1971 nmdc:mga0k408_22319_c1
1972 nmdc:mga0k408_2564_c1
1973 nmdc:mga0k408_33438_c1
1974 nmdc:mga0k408_4053_c1
1975 nmdc:mga0k408_4958_c1
1976 nmdc:mga0k408_63664_c1
1977 nmdc:mga0k408_66089_c1
1978 nmdc:mga0k408_8218_c1
1979 nmdc:mga0k408_93998_c1
1980 nmdc:mga06z11_37401_c1
1981 nmdc:mga06z11_44644_c1
1982 nmdc:mga04h51_70934_c1
1983 nmdc:mga07m45_16377_c1
1984 nmdc:mga07m45_2094_c1
1985 nmdc:mga07m45_38799_c1
1986 nmdc:mga07m45_4892_c1
1987 nmdc:mga07m45_5767_c1
1988 nmdc:mga07m45_65014_c1
1989 nmdc:mga07m45_7026_c1
1990 nmdc:mga07m45_78799_c1
1991 nmdc:mga07m45_81_c1
1992 nmdc:mga07m45_89611_c1
1993 nmdc:mga07m45_9218_c1
1994 nmdc:mga09592_1146_c1
1995 nmdc:mga0qj67_116730_c1
1996 Ga0500610_0004460
1997 Ga0500610_0012136
1998 Ga0500635_0000011
1999 Ga0500643_022086
2000 Ga0500644_0001695
2001 Ga0500651_0000067
2002 Ga0500651_0010814
2003 Ga0500571_000088
2004 Ga0500594_0002317
2005 Ga0500594_0003170
2006 Ga0500607_003160
2007 Ga0500618_033455
2008 Ga0500658_0001848
2009 Ga0500658_0046863
2010 Ga0500559_0001207
2011 Ga0500568_0007294
2012 Ga0500573_0158255
2013 Ga0500619_005909
2014 Ga0500622_0009720
2015 Ga0500627_0001479
2016 Ga0500634_0030761
2017 Ga0500645_001523
2018 Ga0500596_008364
2019 Ga0500587_001369
2020 Ga0590071_005488
2021 Ga0466962_0001662
2022 2513228780
2023 2587759365
2024 2599620871
2025 2599674323
2026 2599678513
2027 2599690382
2028 2643743229
2029 2643932751
2030 2644161342
2031 2644218355
2032 2644243362
2033 2644260246
2034 2644303034
2035 2644314001
2036 2644324059
2037 2644340829
2038 2644400757
2039 2644465996
2040 2739056095
2041 2819601994
2042 2831269823
2043 2831869135
2044 2838055159
2045 2842680907
2046 2885196702
2047 2885201844
2048 2885215446
2049 2886849293
2050 2886853290
2051 2899927249
2052 2904453995
2053 2904459467
2054 2904546121
2055 2919465425
2056 2928042836
2057 2928048737
2058 2928055069
2059 2928068495
2060 2928073599
2061 2928089698
2062 2928117246
2063 2929161318
2064 2929521581
2065 2945949783
2066 2945973806
2067 2954770601

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03331

LpxC

UDP-3-O-acyl N-acetylglycosamine deacetylase

4

288

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cic-assembly2.cif.gz_B crystal structure of p.aeruginosa lpxc in complex with inhibitor 0.9111 1 289
7cic-assembly2.cif.gz_B crystal structure of p.aeruginosa lpxc in complex with inhibitor 0.908 1 289
7cie-assembly1.cif.gz_A crystal structure of p.aeruginosa lpxc in complex with inhibitor 0.9052 1 288
5u3b-assembly2.cif.gz_B pseudomonas aeruginosa lpxc in complex with nvs-lpxc-01 0.9041 1 295
4okg-assembly2.cif.gz_B lpxc from p.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid 0.9029 1 295
ID Description Score Start End Superfamily
3p3gA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 0.9043 1 123 3.30.230.20
af_Q10PS1_24_147_3.30.230.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 0.9027 2 117 3.30.230.20
2vesC02 Alpha Beta;2-Layer Sandwich;lpxc deacetylase, domain 1;lpxc deacetylase, domain 2 0.87 125 295 3.30.1700.10
3p3gA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 0.864 1 123 3.30.230.20
2vesC02 Alpha Beta;2-Layer Sandwich;lpxc deacetylase, domain 1;lpxc deacetylase, domain 2 0.8419 125 295 3.30.1700.10
ID Description Score Start End GO Terms
AF-A0A7X7AHK9-F1-model_v4 deleted 0.9406 1 149
AF-A0A536URK9-F1-model_v4 UDP-3-O-acyl-N-acetylglucosamine deacetylase (EC 3.5.1.108) 0.9223 1 274 GO:0009245
GO:0016020
GO:0046872
GO:0103117
AF-A0A2M8BRB9-F1-model_v4 UDP-3-O-acyl-N-acetylglucosamine deacetylase (EC 3.5.1.108) 0.9192 1 179 GO:0009245
GO:0016020
GO:0046872
GO:0103117
AF-A0A4Q2IZ69-F1-model_v4 UDP-3-O-acyl-N-acetylglucosamine deacetylase (UDP-3-O-acyl-GlcNAc deacetylase) (EC 3.5.1.108) (UDP-3-O-[R-3-hydroxymyristoyl]-N-acetylglucosamine deacetylase) 0.9179 1 301 GO:0009245
GO:0016020
GO:0046872
GO:0103117
AF-A0A257P8P2-F1-model_v4 UDP-3-O-acyl-N-acetylglucosamine deacetylase (EC 3.5.1.108) 0.9169 72 298 GO:0009245
GO:0016020
GO:0046872
GO:0103117

Map