F488664
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1033 | 467 | 2067 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300028786|Ga0307517_10115787|Ga0307517_101157871 |
| Length | 315 |
| Sequence | MLQQRTVKALTCAVGVGIHSGQKVELCLRPAPADTGIVFRRVDLPVPVDIPVNANSVSETRMASTISVNGEPRGPKVQTVEHLLSACSGLGLDNLYIDISGDEVPILDGSAASFVYLLQSAGIELQDAPKRFIKVLKTVEVRAGSAEDGARTLMWARLEPYHGYKLSFEIDFHHPAVDQTGQRVVFDMGSGSYKRDIARARTFGFTKDVEMARSRGLALGGSMDNAIVVDDYRVLNAEGLRYDDEFVKHKILDAIGDMYLAGKPLLAAYSAFRSGHALNNKLLRALLDDPSAYEIVSFDDEKQAPRGFADLAPAW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 100 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 101 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 220 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 227 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 230 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 231 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 232 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 233 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 234 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 235 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 241 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 242 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 243 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 244 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 245 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 246 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 247 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 248 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 249 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 250 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 252 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 253 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 254 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 255 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 256 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 257 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 258 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 259 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 263 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 264 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 271 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 275 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 276 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 277 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 278 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 279 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 280 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 281 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 282 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 283 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 284 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 285 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 286 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 287 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 288 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 289 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 290 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 291 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 292 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 293 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 294 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 295 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 296 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 297 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 298 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 299 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 300 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 301 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 302 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 303 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 304 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 305 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 306 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 348 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 352 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 353 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 356 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 357 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 360 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 361 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 362 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 363 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 364 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 365 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 366 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 367 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 369 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 370 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 374 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 375 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 376 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 377 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 378 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 379 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 380 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 381 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 382 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 383 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 384 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 385 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 386 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 387 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 389 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 390 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 391 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 392 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 394 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 395 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 396 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 398 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 399 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 403 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 404 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 406 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 408 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 409 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 412 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 413 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 414 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 415 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 416 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 418 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 419 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 420 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 421 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 422 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 423 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 424 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 425 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 426 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 427 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 428 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 429 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 430 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 431 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 432 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 433 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 434 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 435 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 436 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 437 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 438 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 439 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 440 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 441 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 442 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 443 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 444 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 445 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 446 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 447 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 448 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 449 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 450 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 451 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 452 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 453 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 454 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 455 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 456 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 457 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 458 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 459 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 460 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 461 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 462 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 463 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 464 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 465 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 466 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 467 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.55 |
| Metatranscriptomes | 0 |
| Isolates | 4.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.17 |
| Nodule | 0.77 |
| Rhizoplane | 3 |
| Rhizosphere | 67.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307517_10115787 | 3300028786 | Bacteria | 2010 |
| 2 | JGI24740J21852_10041842 | 3300001979 | Bacteria | 1377 |
| 3 | JGI25156J39149_1000380 | 3300002705 | Bacteria | 28086 |
| 4 | JGI25154J39366_1000915 | 3300002738 | Bacteria | 12421 |
| 5 | JGI25157J39369_1000290 | 3300002741 | Bacteria | 36531 |
| 6 | JGI25152J39213_1013435 | 3300002773 | Bacteria | 1708 |
| 7 | JGI25150J39212_1001384 | 3300002774 | Bacteria | 6869 |
| 8 | JGI25159J45721_1016485 | 3300002987 | Bacteria | 1572 |
| 9 | JGI25151J46595_10013260 | 3300003187 | Bacteria | 3716 |
| 10 | JGI25153J46596_10015977 | 3300003215 | Bacteria | 3031 |
| 11 | rootH1_10000486 | 3300003316 | Bacteria | 10789 |
| 12 | rootH1_10000486 | 3300003323 | Bacteria | 45870 |
| 13 | rootH2_10010441 | 3300003320 | Bacteria | 4029 |
| 14 | rootL2_10001240 | 3300003322 | Bacteria | 49675 |
| 15 | rootL2_10012906 | 3300003322 | Bacteria | 12232 |
| 16 | rootL2_10027680 | 3300003322 | Bacteria | 2563 |
| 17 | rootH1_10024176 | 3300003323 | Bacteria | 5218 |
| 18 | JGI25161J50226_1002180 | 3300003374 | Bacteria | 5216 |
| 19 | Ga0055539_1000222 | 3300003752 | Bacteria | 40292 |
| 20 | Ga0055539_1001236 | 3300003752 | Bacteria | 5136 |
| 21 | Ga0055533_1000016 | 3300003756 | Bacteria | 396179 |
| 22 | Ga0055532_1007900 | 3300003758 | Bacteria | 1348 |
| 23 | Ga0055525_1000031 | 3300003759 | Bacteria | 314909 |
| 24 | Ga0055525_1001027 | 3300003759 | Bacteria | 7316 |
| 25 | Ga0055535_1000546 | 3300003761 | Bacteria | 32302 |
| 26 | Ga0055535_1000934 | 3300003761 | Bacteria | 19510 |
| 27 | Ga0055542_1000051 | 3300003762 | Bacteria | 175242 |
| 28 | Ga0055529_1000333 | 3300003763 | Bacteria | 52783 |
| 29 | Ga0055526_1001991 | 3300003771 | Bacteria | 14078 |
| 30 | Ga0055537_1000847 | 3300003773 | Bacteria | 14872 |
| 31 | Ga0055537_1013336 | 3300003773 | Bacteria | 1549 |
| 32 | Ga0055524_1000052 | 3300003775 | Bacteria | 144959 |
| 33 | Ga0055524_1001208 | 3300003775 | Bacteria | 15319 |
| 34 | Ga0055536_1001039 | 3300003781 | Bacteria | 17571 |
| 35 | Ga0055534_1006014 | 3300003784 | Bacteria | 3135 |
| 36 | Ga0055534_1011734 | 3300003784 | Bacteria | 1765 |
| 37 | Ga0055528_1028315 | 3300003790 | Bacteria | 1549 |
| 38 | Ga0055528_1028978 | 3300003790 | Bacteria | 1512 |
| 39 | Ga0055530_10000774 | 3300003791 | Bacteria | 26678 |
| 40 | Ga0055530_10002673 | 3300003791 | Bacteria | 11115 |
| 41 | Ga0055540_1000019 | 3300003792 | Bacteria | 210593 |
| 42 | Ga0055540_1003484 | 3300003792 | Bacteria | 7593 |
| 43 | Ga0055540_1004637 | 3300003792 | Bacteria | 6100 |
| 44 | Ga0055540_1008483 | 3300003792 | Bacteria | 3695 |
| 45 | Ga0055540_1014026 | 3300003792 | Bacteria | 2413 |
| 46 | Ga0055531_10000001 | 3300003794 | Bacteria | 543586 |
| 47 | Ga0055531_10003590 | 3300003794 | Bacteria | 9824 |
| 48 | Ga0055543_1001268 | 3300004625 | Bacteria | 10404 |
| 49 | Ga0055543_1014652 | 3300004625 | Bacteria | 1525 |
| 50 | Ga0065165_1000080 | 3300005262 | Bacteria | 159638 |
| 51 | Ga0065165_1000101 | 3300005262 | Bacteria | 141486 |
| 52 | Ga0065165_1004873 | 3300005262 | Bacteria | 7950 |
| 53 | Ga0065704_10101350 | 3300005289 | Bacteria | 2240 |
| 54 | Ga0065707_10085820 | 3300005295 | Bacteria | 5869 |
| 55 | Ga0070658_10191316 | 3300005327 | Bacteria | 1724 |
| 56 | Ga0070676_10003063 | 3300005328 | Bacteria | 8634 |
| 57 | Ga0070676_10011288 | 3300005328 | Bacteria | 4855 |
| 58 | Ga0070676_10076365 | 3300005328 | Bacteria | 2022 |
| 59 | Ga0070676_10216878 | 3300005328 | Bacteria | 1262 |
| 60 | Ga0070683_100058877 | 3300005329 | Bacteria | 3568 |
| 61 | Ga0070683_100098711 | 3300005329 | Bacteria | 2748 |
| 62 | Ga0070670_100015187 | 3300005331 | Bacteria | 6610 |
| 63 | Ga0070670_100034680 | 3300005331 | Bacteria | 4343 |
| 64 | Ga0070670_100034757 | 3300005331 | Bacteria | 4338 |
| 65 | Ga0070670_100039540 | 3300005331 | Bacteria | 4056 |
| 66 | Ga0070670_100072428 | 3300005331 | Bacteria | 2959 |
| 67 | Ga0070677_10044568 | 3300005333 | Bacteria | 1765 |
| 68 | Ga0070677_10068212 | 3300005333 | Bacteria | 1488 |
| 69 | Ga0068869_100004719 | 3300005334 | Bacteria | 8504 |
| 70 | Ga0068869_100008964 | 3300005334 | Bacteria | 6476 |
| 71 | Ga0068869_100039750 | 3300005334 | Bacteria | 3360 |
| 72 | Ga0068869_100049512 | 3300005334 | Bacteria | 3042 |
| 73 | Ga0070666_10006633 | 3300005335 | Bacteria | 7120 |
| 74 | Ga0070666_10091903 | 3300005335 | Bacteria | 2086 |
| 75 | Ga0070666_10212196 | 3300005335 | Bacteria | 1364 |
| 76 | Ga0068868_100004253 | 3300005338 | Bacteria | 10018 |
| 77 | Ga0068868_100023907 | 3300005338 | Bacteria | 4630 |
| 78 | Ga0068868_100034210 | 3300005338 | Bacteria | 3922 |
| 79 | Ga0068868_100042672 | 3300005338 | Bacteria | 3541 |
| 80 | Ga0068868_100286998 | 3300005338 | Bacteria | 1394 |
| 81 | Ga0070660_100035703 | 3300005339 | Bacteria | 3763 |
| 82 | Ga0070689_100017233 | 3300005340 | Bacteria | 5301 |
| 83 | Ga0070687_100039015 | 3300005343 | Bacteria | 2384 |
| 84 | Ga0070661_100001817 | 3300005344 | Bacteria | 14798 |
| 85 | Ga0070661_100058647 | 3300005344 | Bacteria | 2821 |
| 86 | Ga0070661_100274770 | 3300005344 | Bacteria | 1306 |
| 87 | Ga0070661_100285772 | 3300005344 | Bacteria | 1281 |
| 88 | Ga0070669_100023109 | 3300005353 | Bacteria | 4450 |
| 89 | Ga0070669_100038738 | 3300005353 | Bacteria | 3461 |
| 90 | Ga0070669_100131496 | 3300005353 | Bacteria | 1920 |
| 91 | Ga0070675_100002826 | 3300005354 | Bacteria | 13094 |
| 92 | Ga0070675_100030113 | 3300005354 | Bacteria | 4379 |
| 93 | Ga0070675_100040918 | 3300005354 | Bacteria | 3785 |
| 94 | Ga0070675_100045557 | 3300005354 | Bacteria | 3589 |
| 95 | Ga0070675_100057952 | 3300005354 | Bacteria | 3194 |
| 96 | Ga0070675_100085309 | 3300005354 | Bacteria | 2638 |
| 97 | Ga0070675_100241704 | 3300005354 | Bacteria | 1578 |
| 98 | Ga0070671_100003012 | 3300005355 | Bacteria | 13118 |
| 99 | Ga0070671_100025005 | 3300005355 | Bacteria | 4895 |
| 100 | Ga0070671_100047724 | 3300005355 | Bacteria | 3560 |
| 101 | Ga0070671_100054104 | 3300005355 | Bacteria | 3337 |
| 102 | Ga0070671_100069858 | 3300005355 | Bacteria | 2929 |
| 103 | Ga0070671_100082020 | 3300005355 | Bacteria | 2696 |
| 104 | Ga0070671_100121894 | 3300005355 | Bacteria | 2194 |
| 105 | Ga0070671_100219877 | 3300005355 | Bacteria | 1611 |
| 106 | Ga0070674_100030949 | 3300005356 | Bacteria | 3541 |
| 107 | Ga0070674_100032975 | 3300005356 | Bacteria | 3443 |
| 108 | Ga0070674_100036248 | 3300005356 | Bacteria | 3309 |
| 109 | Ga0070673_100007588 | 3300005364 | Bacteria | 7174 |
| 110 | Ga0070673_100036683 | 3300005364 | Bacteria | 3729 |
| 111 | Ga0070673_100044973 | 3300005364 | Bacteria | 3421 |
| 112 | Ga0070673_100068030 | 3300005364 | Bacteria | 2850 |
| 113 | Ga0070673_100103568 | 3300005364 | Bacteria | 2349 |
| 114 | Ga0070673_100138713 | 3300005364 | Bacteria | 2049 |
| 115 | Ga0070673_100234969 | 3300005364 | Bacteria | 1591 |
| 116 | Ga0070688_100064028 | 3300005365 | Bacteria | 2332 |
| 117 | Ga0070688_100195163 | 3300005365 | Bacteria | 1413 |
| 118 | Ga0070659_100000579 | 3300005366 | Bacteria | 26725 |
| 119 | Ga0070659_100008674 | 3300005366 | Bacteria | 7435 |
| 120 | Ga0070659_100013962 | 3300005366 | Bacteria | 5995 |
| 121 | Ga0070659_100157803 | 3300005366 | Bacteria | 1854 |
| 122 | Ga0070659_100174294 | 3300005366 | Bacteria | 1763 |
| 123 | Ga0070667_100013082 | 3300005367 | Bacteria | 6857 |
| 124 | Ga0070667_100023040 | 3300005367 | Bacteria | 5165 |
| 125 | Ga0070667_100095226 | 3300005367 | Bacteria | 2567 |
| 126 | Ga0070667_100109279 | 3300005367 | Bacteria | 2396 |
| 127 | Ga0070667_100144436 | 3300005367 | Bacteria | 2086 |
| 128 | Ga0070701_10015321 | 3300005438 | Bacteria | 3538 |
| 129 | Ga0070700_100091315 | 3300005441 | Bacteria | 1988 |
| 130 | Ga0070708_100125922 | 3300005445 | Bacteria | 2368 |
| 131 | Ga0070663_100025098 | 3300005455 | Bacteria | 4021 |
| 132 | Ga0070678_100004941 | 3300005456 | Bacteria | 7629 |
| 133 | Ga0070678_100055164 | 3300005456 | Bacteria | 2900 |
| 134 | Ga0070678_100078809 | 3300005456 | Bacteria | 2490 |
| 135 | Ga0070678_100096289 | 3300005456 | Bacteria | 2283 |
| 136 | Ga0070678_100169634 | 3300005456 | Bacteria | 1776 |
| 137 | Ga0070662_100013426 | 3300005457 | Bacteria | 5451 |
| 138 | Ga0070662_100034456 | 3300005457 | Bacteria | 3570 |
| 139 | Ga0070662_100079499 | 3300005457 | Bacteria | 2439 |
| 140 | Ga0070662_100089545 | 3300005457 | Bacteria | 2308 |
| 141 | Ga0070662_100089693 | 3300005457 | Bacteria | 2306 |
| 142 | Ga0070662_100332517 | 3300005457 | Bacteria | 1241 |
| 143 | Ga0068867_100004120 | 3300005459 | Bacteria | 10210 |
| 144 | Ga0068867_100014291 | 3300005459 | Bacteria | 5624 |
| 145 | Ga0068867_100019883 | 3300005459 | Bacteria | 4786 |
| 146 | Ga0068867_100036670 | 3300005459 | Bacteria | 3561 |
| 147 | Ga0068867_100095169 | 3300005459 | Bacteria | 2266 |
| 148 | Ga0070685_10069079 | 3300005466 | Bacteria | 2089 |
| 149 | Ga0070685_10070274 | 3300005466 | Bacteria | 2072 |
| 150 | Ga0070706_100004451 | 3300005467 | Bacteria | 13531 |
| 151 | Ga0070707_100030017 | 3300005468 | Bacteria | 5173 |
| 152 | Ga0070679_100058210 | 3300005530 | Bacteria | 3850 |
| 153 | Ga0068853_100022515 | 3300005539 | Bacteria | 5263 |
| 154 | Ga0068853_100027195 | 3300005539 | Bacteria | 4806 |
| 155 | Ga0068853_100103909 | 3300005539 | Bacteria | 2515 |
| 156 | Ga0068853_100297298 | 3300005539 | Bacteria | 1491 |
| 157 | Ga0070672_100000539 | 3300005543 | Bacteria | 22233 |
| 158 | Ga0070672_100002829 | 3300005543 | Bacteria | 11117 |
| 159 | Ga0070672_100013763 | 3300005543 | Bacteria | 5720 |
| 160 | Ga0070672_100014204 | 3300005543 | Bacteria | 5636 |
| 161 | Ga0070672_100014890 | 3300005543 | Bacteria | 5522 |
| 162 | Ga0070672_100067627 | 3300005543 | Bacteria | 2831 |
| 163 | Ga0070695_100083628 | 3300005545 | Bacteria | 2115 |
| 164 | Ga0070693_100050798 | 3300005547 | Bacteria | 2371 |
| 165 | Ga0068855_100020802 | 3300005563 | Bacteria | 7867 |
| 166 | Ga0068855_100227926 | 3300005563 | Bacteria | 2087 |
| 167 | Ga0070664_100003888 | 3300005564 | Bacteria | 12054 |
| 168 | Ga0070664_100052052 | 3300005564 | Bacteria | 3467 |
| 169 | Ga0070664_100103488 | 3300005564 | Bacteria | 2478 |
| 170 | Ga0068857_100009913 | 3300005577 | Bacteria | 8268 |
| 171 | Ga0068857_100010130 | 3300005577 | Bacteria | 8191 |
| 172 | Ga0068857_100054535 | 3300005577 | Bacteria | 3547 |
| 173 | Ga0068857_100155452 | 3300005577 | Bacteria | 2074 |
| 174 | Ga0068854_100007402 | 3300005578 | Bacteria | 7012 |
| 175 | Ga0068854_100027971 | 3300005578 | Bacteria | 3891 |
| 176 | Ga0068854_100029629 | 3300005578 | Bacteria | 3790 |
| 177 | Ga0068854_100212437 | 3300005578 | Bacteria | 1527 |
| 178 | Ga0068854_100390870 | 3300005578 | Bacteria | 1148 |
| 179 | Ga0068856_100003701 | 3300005614 | Bacteria | 15340 |
| 180 | Ga0068856_100006672 | 3300005614 | Bacteria | 11312 |
| 181 | Ga0068856_100277956 | 3300005614 | Bacteria | 1691 |
| 182 | Ga0070702_100020783 | 3300005615 | Bacteria | 3444 |
| 183 | Ga0068852_100026590 | 3300005616 | Bacteria | 4706 |
| 184 | Ga0068852_100055928 | 3300005616 | Bacteria | 3407 |
| 185 | Ga0068852_100085967 | 3300005616 | Bacteria | 2802 |
| 186 | Ga0068852_100170013 | 3300005616 | Bacteria | 2042 |
| 187 | Ga0068852_100530206 | 3300005616 | Bacteria | 1176 |
| 188 | Ga0068859_100016999 | 3300005617 | Bacteria | 7302 |
| 189 | Ga0068859_100456499 | 3300005617 | Bacteria | 1374 |
| 190 | Ga0068859_100657771 | 3300005617 | Bacteria | 1140 |
| 191 | Ga0068864_100004486 | 3300005618 | Bacteria | 11478 |
| 192 | Ga0068864_100005423 | 3300005618 | Bacteria | 10455 |
| 193 | Ga0068864_100005655 | 3300005618 | Bacteria | 10250 |
| 194 | Ga0068866_10020191 | 3300005718 | Bacteria | 3048 |
| 195 | Ga0068866_10049310 | 3300005718 | Bacteria | 2133 |
| 196 | Ga0068861_100003800 | 3300005719 | Bacteria | 10082 |
| 197 | Ga0068861_100012185 | 3300005719 | Bacteria | 5994 |
| 198 | Ga0068861_100029406 | 3300005719 | Bacteria | 4020 |
| 199 | Ga0068861_100048410 | 3300005719 | Bacteria | 3213 |
| 200 | Ga0068861_100186709 | 3300005719 | Bacteria | 1729 |
| 201 | Ga0068861_100384732 | 3300005719 | Bacteria | 1241 |
| 202 | Ga0068851_10024607 | 3300005834 | Bacteria | 2949 |
| 203 | Ga0068851_10033506 | 3300005834 | Bacteria | 2560 |
| 204 | Ga0068851_10043285 | 3300005834 | Bacteria | 2269 |
| 205 | Ga0068851_10047676 | 3300005834 | Bacteria | 2170 |
| 206 | Ga0068870_10113740 | 3300005840 | Bacteria | 1549 |
| 207 | Ga0068870_10113987 | 3300005840 | Bacteria | 1548 |
| 208 | Ga0068863_100018169 | 3300005841 | Bacteria | 6733 |
| 209 | Ga0068863_100031313 | 3300005841 | Bacteria | 5077 |
| 210 | Ga0068858_100000947 | 3300005842 | Bacteria | 30015 |
| 211 | Ga0068858_100013934 | 3300005842 | Bacteria | 7584 |
| 212 | Ga0068858_100017782 | 3300005842 | Bacteria | 6657 |
| 213 | Ga0068860_100000590 | 3300005843 | Bacteria | 43453 |
| 214 | Ga0068860_100059239 | 3300005843 | Bacteria | 3641 |
| 215 | Ga0068860_100062776 | 3300005843 | Bacteria | 3530 |
| 216 | Ga0068862_100051041 | 3300005844 | Bacteria | 3537 |
| 217 | Ga0075365_10001679 | 3300006038 | Bacteria | 10232 |
| 218 | Ga0075363_100011463 | 3300006048 | Bacteria | 4245 |
| 219 | Ga0075362_10015037 | 3300006177 | Bacteria | 3139 |
| 220 | Ga0075362_10021544 | 3300006177 | Bacteria | 2706 |
| 221 | Ga0075362_10028745 | 3300006177 | Bacteria | 2390 |
| 222 | Ga0075362_10035990 | 3300006177 | Bacteria | 2163 |
| 223 | Ga0075367_10004085 | 3300006178 | Bacteria | 7066 |
| 224 | Ga0075367_10026150 | 3300006178 | Bacteria | 3307 |
| 225 | Ga0075366_10003992 | 3300006195 | Bacteria | 7882 |
| 226 | Ga0075366_10004014 | 3300006195 | Bacteria | 7866 |
| 227 | Ga0075366_10005103 | 3300006195 | Bacteria | 7099 |
| 228 | Ga0075366_10005573 | 3300006195 | Bacteria | 6825 |
| 229 | Ga0075366_10013306 | 3300006195 | Bacteria | 4680 |
| 230 | Ga0075366_10132149 | 3300006195 | Bacteria | 1506 |
| 231 | Ga0075366_10133536 | 3300006195 | Bacteria | 1498 |
| 232 | Ga0075366_10138842 | 3300006195 | Bacteria | 1469 |
| 233 | Ga0097621_100032503 | 3300006237 | Bacteria | 4148 |
| 234 | Ga0097621_100042765 | 3300006237 | Bacteria | 3650 |
| 235 | Ga0097621_100102269 | 3300006237 | Bacteria | 2412 |
| 236 | Ga0097621_100213414 | 3300006237 | Bacteria | 1679 |
| 237 | Ga0075370_10009645 | 3300006353 | Bacteria | 5023 |
| 238 | Ga0075370_10011106 | 3300006353 | Bacteria | 4722 |
| 239 | Ga0075370_10014544 | 3300006353 | Bacteria | 4201 |
| 240 | Ga0075370_10018864 | 3300006353 | Bacteria | 3746 |
| 241 | Ga0075370_10026377 | 3300006353 | Bacteria | 3219 |
| 242 | Ga0075370_10078789 | 3300006353 | Bacteria | 1892 |
| 243 | Ga0075370_10081059 | 3300006353 | Bacteria | 1865 |
| 244 | Ga0075430_100124636 | 3300006846 | Bacteria | 2147 |
| 245 | Ga0075429_100000199 | 3300006880 | Bacteria | 39995 |
| 246 | Ga0068865_100003764 | 3300006881 | Bacteria | 9103 |
| 247 | Ga0068865_100221809 | 3300006881 | Bacteria | 1478 |
| 248 | Ga0097620_100016998 | 3300006931 | Bacteria | 7302 |
| 249 | Ga0097620_100134814 | 3300006931 | Bacteria | 2541 |
| 250 | Ga0097620_100456497 | 3300006931 | Bacteria | 1374 |
| 251 | Ga0097620_100657750 | 3300006931 | Bacteria | 1140 |
| 252 | Ga0099823_1000108 | 3300006944 | Bacteria | 41193 |
| 253 | Ga0079104_1000206 | 3300006946 | Bacteria | 82424 |
| 254 | Ga0099826_10028336 | 3300006948 | Bacteria | 4098 |
| 255 | Ga0105244_10005962 | 3300009036 | Bacteria | 7987 |
| 256 | Ga0105240_10020056 | 3300009093 | Bacteria | 8924 |
| 257 | Ga0105240_10187212 | 3300009093 | Bacteria | 2437 |
| 258 | Ga0111539_10651212 | 3300009094 | Bacteria | 1227 |
| 259 | Ga0105245_10056203 | 3300009098 | Bacteria | 3536 |
| 260 | Ga0105245_10079449 | 3300009098 | Bacteria | 2995 |
| 261 | Ga0105245_10372533 | 3300009098 | Bacteria | 1420 |
| 262 | Ga0114129_10233635 | 3300009147 | Bacteria | 2475 |
| 263 | Ga0105243_10017850 | 3300009148 | Bacteria | 5368 |
| 264 | Ga0105243_10081131 | 3300009148 | Bacteria | 2647 |
| 265 | Ga0105243_10082103 | 3300009148 | Bacteria | 2633 |
| 266 | Ga0105242_10034430 | 3300009176 | Bacteria | 4060 |
| 267 | Ga0105242_10041874 | 3300009176 | Bacteria | 3696 |
| 268 | Ga0105242_10098902 | 3300009176 | Bacteria | 2468 |
| 269 | Ga0105242_10191525 | 3300009176 | Bacteria | 1811 |
| 270 | Ga0105242_10279628 | 3300009176 | Bacteria | 1515 |
| 271 | Ga0105248_10000507 | 3300009177 | Bacteria | 44310 |
| 272 | Ga0105248_10011351 | 3300009177 | Bacteria | 9817 |
| 273 | Ga0105248_10165534 | 3300009177 | Bacteria | 2493 |
| 274 | Ga0105248_10222679 | 3300009177 | Bacteria | 2124 |
| 275 | Ga0105248_10241477 | 3300009177 | Bacteria | 2034 |
| 276 | Ga0105248_10441834 | 3300009177 | Bacteria | 1465 |
| 277 | Ga0105237_10000407 | 3300009545 | Bacteria | 61234 |
| 278 | Ga0105237_10008587 | 3300009545 | Bacteria | 11047 |
| 279 | Ga0105237_10121001 | 3300009545 | Bacteria | 2612 |
| 280 | Ga0105237_10186286 | 3300009545 | Bacteria | 2075 |
| 281 | Ga0105238_10007219 | 3300009551 | Bacteria | 11120 |
| 282 | Ga0105238_10031941 | 3300009551 | Bacteria | 5357 |
| 283 | Ga0105238_10034210 | 3300009551 | Bacteria | 5171 |
| 284 | Ga0105238_10118970 | 3300009551 | Bacteria | 2622 |
| 285 | Ga0105249_10019636 | 3300009553 | Bacteria | 6032 |
| 286 | Ga0105249_10100427 | 3300009553 | Bacteria | 2720 |
| 287 | Ga0105239_10000335 | 3300010375 | Bacteria | 68810 |
| 288 | Ga0105239_10109818 | 3300010375 | Bacteria | 3057 |
| 289 | Ga0105239_10288572 | 3300010375 | Bacteria | 1848 |
| 290 | Ga0105246_10342205 | 3300011119 | Bacteria | 1223 |
| 291 | Ga0157319_1000008 | 3300012497 | Bacteria | 315600 |
| 292 | Ga0157373_10102499 | 3300013100 | Bacteria | 2014 |
| 293 | Ga0157371_10064216 | 3300013102 | Bacteria | 2601 |
| 294 | Ga0157370_10020513 | 3300013104 | Bacteria | 6599 |
| 295 | Ga0157370_10062708 | 3300013104 | Bacteria | 3525 |
| 296 | Ga0157369_10013318 | 3300013105 | Bacteria | 9299 |
| 297 | Ga0157369_10028976 | 3300013105 | Bacteria | 6122 |
| 298 | Ga0157369_10514526 | 3300013105 | Bacteria | 1238 |
| 299 | Ga0157369_10527566 | 3300013105 | Bacteria | 1221 |
| 300 | Ga0157374_10262529 | 3300013296 | Bacteria | 1701 |
| 301 | Ga0157378_10007768 | 3300013297 | Bacteria | 9364 |
| 302 | Ga0157378_10159676 | 3300013297 | Bacteria | 2107 |
| 303 | Ga0157378_10230325 | 3300013297 | Bacteria | 1765 |
| 304 | Ga0163162_10002118 | 3300013306 | Bacteria | 18641 |
| 305 | Ga0163162_10007695 | 3300013306 | Bacteria | 10495 |
| 306 | Ga0163162_10035098 | 3300013306 | Bacteria | 4994 |
| 307 | Ga0163162_10045884 | 3300013306 | Bacteria | 4379 |
| 308 | Ga0163162_10213321 | 3300013306 | Bacteria | 2060 |
| 309 | Ga0163162_10401651 | 3300013306 | Bacteria | 1503 |
| 310 | Ga0157372_10027045 | 3300013307 | Bacteria | 6244 |
| 311 | Ga0157372_10088825 | 3300013307 | Bacteria | 3510 |
| 312 | Ga0157375_10042105 | 3300013308 | Bacteria | 4417 |
| 313 | Ga0157375_10067294 | 3300013308 | Bacteria | 3579 |
| 314 | Ga0157375_10142267 | 3300013308 | Bacteria | 2527 |
| 315 | Ga0157375_10224572 | 3300013308 | Bacteria | 2037 |
| 316 | Ga0157375_10269509 | 3300013308 | Bacteria | 1864 |
| 317 | Ga0157375_10270675 | 3300013308 | Bacteria | 1861 |
| 318 | Ga0157375_10291569 | 3300013308 | Bacteria | 1795 |
| 319 | Ga0163163_10017791 | 3300014325 | Bacteria | 6635 |
| 320 | Ga0157380_10015082 | 3300014326 | Bacteria | 5670 |
| 321 | Ga0157380_10015978 | 3300014326 | Bacteria | 5526 |
| 322 | Ga0157380_10031940 | 3300014326 | Bacteria | 4045 |
| 323 | Ga0157380_10191358 | 3300014326 | Bacteria | 1806 |
| 324 | Ga0157380_10418226 | 3300014326 | Bacteria | 1278 |
| 325 | Ga0182008_10001528 | 3300014497 | Bacteria | 15392 |
| 326 | Ga0182008_10010178 | 3300014497 | Bacteria | 5041 |
| 327 | Ga0182008_10011139 | 3300014497 | Bacteria | 4797 |
| 328 | Ga0157377_10035813 | 3300014745 | Bacteria | 2726 |
| 329 | Ga0157379_10006779 | 3300014968 | Bacteria | 9902 |
| 330 | Ga0157379_10015200 | 3300014968 | Bacteria | 6752 |
| 331 | Ga0157379_10015438 | 3300014968 | Bacteria | 6701 |
| 332 | Ga0157379_10033209 | 3300014968 | Bacteria | 4602 |
| 333 | Ga0157379_10062810 | 3300014968 | Bacteria | 3321 |
| 334 | Ga0157379_10128357 | 3300014968 | Bacteria | 2282 |
| 335 | Ga0157379_10290705 | 3300014968 | Bacteria | 1488 |
| 336 | Ga0157376_10016718 | 3300014969 | Bacteria | 5578 |
| 337 | Ga0157376_10043442 | 3300014969 | Bacteria | 3689 |
| 338 | Ga0182006_1018146 | 3300015261 | Bacteria | 2978 |
| 339 | Ga0163161_10043326 | 3300017792 | Bacteria | 3240 |
| 340 | Ga0163161_10109278 | 3300017792 | Bacteria | 2065 |
| 341 | Ga0213872_10000006 | 3300021361 | Bacteria | 249845 |
| 342 | Ga0213872_10000007 | 3300021361 | Bacteria | 228206 |
| 343 | Ga0213872_10000085 | 3300021361 | Bacteria | 85496 |
| 344 | Ga0213872_10004397 | 3300021361 | Bacteria | 7491 |
| 345 | Ga0213872_10059740 | 3300021361 | Bacteria | 1725 |
| 346 | Ga0213872_10084726 | 3300021361 | Bacteria | 1421 |
| 347 | Ga0213876_10101126 | 3300021384 | Bacteria | 1528 |
| 348 | Ga0209436_108685 | 3300025208 | Bacteria | 1998 |
| 349 | Ga0209674_100041 | 3300025226 | Bacteria | 396231 |
| 350 | Ga0209672_100538 | 3300025228 | Bacteria | 20576 |
| 351 | Ga0209147_102376 | 3300025229 | Bacteria | 4751 |
| 352 | Ga0209563_100043 | 3300025230 | Bacteria | 397271 |
| 353 | Ga0209563_100044 | 3300025230 | Bacteria | 396812 |
| 354 | Ga0207427_101076 | 3300025231 | Bacteria | 11230 |
| 355 | Ga0209258_100132 | 3300025242 | Bacteria | 175292 |
| 356 | Ga0209258_100344 | 3300025242 | Bacteria | 68131 |
| 357 | Ga0209258_100888 | 3300025242 | Bacteria | 15609 |
| 358 | Ga0207425_1001109 | 3300025245 | Bacteria | 12168 |
| 359 | Ga0209646_1000069 | 3300025246 | Bacteria | 230340 |
| 360 | Ga0209026_1000006 | 3300025250 | Bacteria | 677225 |
| 361 | Ga0209677_100096 | 3300025253 | Bacteria | 99089 |
| 362 | Ga0209677_100412 | 3300025253 | Bacteria | 25554 |
| 363 | Ga0209677_102293 | 3300025253 | Bacteria | 7368 |
| 364 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 365 | Ga0209759_1000075 | 3300025256 | Bacteria | 176235 |
| 366 | Ga0209759_1002024 | 3300025256 | Bacteria | 9607 |
| 367 | Ga0209759_1002433 | 3300025256 | Bacteria | 8161 |
| 368 | Ga0209129_1000084 | 3300025258 | Bacteria | 182554 |
| 369 | Ga0209129_1008605 | 3300025258 | Bacteria | 2818 |
| 370 | Ga0209565_1000169 | 3300025263 | Bacteria | 84839 |
| 371 | Ga0209565_1000364 | 3300025263 | Bacteria | 38944 |
| 372 | Ga0209565_1000456 | 3300025263 | Bacteria | 31480 |
| 373 | Ga0209565_1009061 | 3300025263 | Bacteria | 2558 |
| 374 | Ga0209455_1000242 | 3300025272 | Bacteria | 68131 |
| 375 | Ga0209673_1000114 | 3300025273 | Bacteria | 178557 |
| 376 | Ga0209673_1000916 | 3300025273 | Bacteria | 37512 |
| 377 | Ga0209673_1001117 | 3300025273 | Bacteria | 29869 |
| 378 | Ga0209673_1004916 | 3300025273 | Bacteria | 6958 |
| 379 | Ga0209673_1007520 | 3300025273 | Bacteria | 4998 |
| 380 | Ga0209673_1038210 | 3300025273 | Bacteria | 1401 |
| 381 | Ga0209130_1000571 | 3300025284 | Bacteria | 36074 |
| 382 | Ga0209130_1000621 | 3300025284 | Bacteria | 33935 |
| 383 | Ga0209675_1000062 | 3300025291 | Bacteria | 178557 |
| 384 | Ga0209675_1000631 | 3300025291 | Bacteria | 25073 |
| 385 | Ga0209675_1003259 | 3300025291 | Bacteria | 7825 |
| 386 | Ga0209675_1007298 | 3300025291 | Bacteria | 4269 |
| 387 | Ga0209675_1012858 | 3300025291 | Bacteria | 2663 |
| 388 | Ga0209676_1000817 | 3300025292 | Bacteria | 40674 |
| 389 | Ga0209676_1000999 | 3300025292 | Bacteria | 33230 |
| 390 | Ga0209676_1001040 | 3300025292 | Bacteria | 32079 |
| 391 | Ga0209025_1000678 | 3300025294 | Bacteria | 58460 |
| 392 | Ga0209025_1000719 | 3300025294 | Bacteria | 56292 |
| 393 | Ga0209025_1000861 | 3300025294 | Bacteria | 47942 |
| 394 | Ga0209025_1026289 | 3300025294 | Bacteria | 2927 |
| 395 | Ga0209564_1000008 | 3300025295 | Bacteria | 953227 |
| 396 | Ga0209564_1001058 | 3300025295 | Bacteria | 33490 |
| 397 | Ga0209564_1001096 | 3300025295 | Bacteria | 32208 |
| 398 | Ga0209758_1000754 | 3300025297 | Bacteria | 46944 |
| 399 | Ga0209050_1000052 | 3300025298 | Bacteria | 351785 |
| 400 | Ga0209050_1000137 | 3300025298 | Bacteria | 178099 |
| 401 | Ga0209050_1001274 | 3300025298 | Bacteria | 28926 |
| 402 | Ga0209050_1007733 | 3300025298 | Bacteria | 5932 |
| 403 | Ga0209050_1009235 | 3300025298 | Bacteria | 5087 |
| 404 | Ga0209050_1011538 | 3300025298 | Bacteria | 4171 |
| 405 | Ga0209256_1000036 | 3300025299 | Bacteria | 386664 |
| 406 | Ga0209256_1000206 | 3300025299 | Bacteria | 111425 |
| 407 | Ga0209256_1000239 | 3300025299 | Bacteria | 97580 |
| 408 | Ga0209256_1000413 | 3300025299 | Bacteria | 67123 |
| 409 | Ga0207426_1000049 | 3300025302 | Bacteria | 401954 |
| 410 | Ga0207426_1000086 | 3300025302 | Bacteria | 292089 |
| 411 | Ga0207426_1000346 | 3300025302 | Bacteria | 85832 |
| 412 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 413 | Ga0209051_1000071 | 3300025303 | Bacteria | 210843 |
| 414 | Ga0209051_1000420 | 3300025303 | Bacteria | 58383 |
| 415 | Ga0209051_1000492 | 3300025303 | Bacteria | 51006 |
| 416 | Ga0209051_1000824 | 3300025303 | Bacteria | 32075 |
| 417 | Ga0209051_1001503 | 3300025303 | Bacteria | 19479 |
| 418 | Ga0209051_1002377 | 3300025303 | Bacteria | 13590 |
| 419 | Ga0209051_1004772 | 3300025303 | Bacteria | 8182 |
| 420 | Ga0209257_1000033 | 3300025304 | Bacteria | 671006 |
| 421 | Ga0209257_1000037 | 3300025304 | Bacteria | 612915 |
| 422 | Ga0209257_1000367 | 3300025304 | Bacteria | 91077 |
| 423 | Ga0209257_1002153 | 3300025304 | Bacteria | 20486 |
| 424 | Ga0209257_1003430 | 3300025304 | Bacteria | 13611 |
| 425 | Ga0209257_1004820 | 3300025304 | Bacteria | 10011 |
| 426 | Ga0209257_1013244 | 3300025304 | Bacteria | 3695 |
| 427 | Ga0207656_10045616 | 3300025321 | Bacteria | 1876 |
| 428 | Ga0207655_1000477 | 3300025728 | Bacteria | 51677 |
| 429 | Ga0207682_10006336 | 3300025893 | Bacteria | 4776 |
| 430 | Ga0207682_10008206 | 3300025893 | Bacteria | 4140 |
| 431 | Ga0207682_10025550 | 3300025893 | Bacteria | 2343 |
| 432 | Ga0207682_10053371 | 3300025893 | Bacteria | 1676 |
| 433 | Ga0207642_10052636 | 3300025899 | Bacteria | 1848 |
| 434 | Ga0207642_10186575 | 3300025899 | Bacteria | 1134 |
| 435 | Ga0207688_10024613 | 3300025901 | Bacteria | 3303 |
| 436 | Ga0207688_10075128 | 3300025901 | Bacteria | 1923 |
| 437 | Ga0207688_10092008 | 3300025901 | Bacteria | 1742 |
| 438 | Ga0207680_10028834 | 3300025903 | Bacteria | 3110 |
| 439 | Ga0207680_10069254 | 3300025903 | Bacteria | 2179 |
| 440 | Ga0207645_10004942 | 3300025907 | Bacteria | 9772 |
| 441 | Ga0207645_10015296 | 3300025907 | Bacteria | 5102 |
| 442 | Ga0207645_10024769 | 3300025907 | Bacteria | 3887 |
| 443 | Ga0207645_10221801 | 3300025907 | Bacteria | 1246 |
| 444 | Ga0207643_10068116 | 3300025908 | Bacteria | 2044 |
| 445 | Ga0207705_10133515 | 3300025909 | Bacteria | 1849 |
| 446 | Ga0207705_10259469 | 3300025909 | Bacteria | 1326 |
| 447 | Ga0207654_10108767 | 3300025911 | Bacteria | 1721 |
| 448 | Ga0207707_10075456 | 3300025912 | Bacteria | 2942 |
| 449 | Ga0207695_10007155 | 3300025913 | Bacteria | 14281 |
| 450 | Ga0207695_10027612 | 3300025913 | Bacteria | 6316 |
| 451 | Ga0207695_10038534 | 3300025913 | Bacteria | 5144 |
| 452 | Ga0207695_10145947 | 3300025913 | Bacteria | 2310 |
| 453 | Ga0207671_10001396 | 3300025914 | Bacteria | 28078 |
| 454 | Ga0207671_10138714 | 3300025914 | Bacteria | 1872 |
| 455 | Ga0207662_10023983 | 3300025918 | Bacteria | 3510 |
| 456 | Ga0207662_10067829 | 3300025918 | Bacteria | 2152 |
| 457 | Ga0207657_10012206 | 3300025919 | Bacteria | 8489 |
| 458 | Ga0207657_10018610 | 3300025919 | Bacteria | 6621 |
| 459 | Ga0207657_10054802 | 3300025919 | Bacteria | 3446 |
| 460 | Ga0207657_10133950 | 3300025919 | Bacteria | 2029 |
| 461 | Ga0207657_10157857 | 3300025919 | Bacteria | 1844 |
| 462 | Ga0207657_10210194 | 3300025919 | Bacteria | 1562 |
| 463 | Ga0207649_10001310 | 3300025920 | Bacteria | 14847 |
| 464 | Ga0207649_10002844 | 3300025920 | Bacteria | 9546 |
| 465 | Ga0207652_10146300 | 3300025921 | Bacteria | 2115 |
| 466 | Ga0207646_10044519 | 3300025922 | Bacteria | 3984 |
| 467 | Ga0207681_10022145 | 3300025923 | Bacteria | 4048 |
| 468 | Ga0207681_10025887 | 3300025923 | Bacteria | 3779 |
| 469 | Ga0207694_10016952 | 3300025924 | Bacteria | 5504 |
| 470 | Ga0207694_10114665 | 3300025924 | Bacteria | 2146 |
| 471 | Ga0207694_10119093 | 3300025924 | Bacteria | 2107 |
| 472 | Ga0207650_10001668 | 3300025925 | Bacteria | 15808 |
| 473 | Ga0207650_10044550 | 3300025925 | Bacteria | 3261 |
| 474 | Ga0207650_10097792 | 3300025925 | Bacteria | 2254 |
| 475 | Ga0207650_10101461 | 3300025925 | Bacteria | 2216 |
| 476 | Ga0207650_10104542 | 3300025925 | Bacteria | 2185 |
| 477 | Ga0207650_10136217 | 3300025925 | Bacteria | 1926 |
| 478 | Ga0207659_10010662 | 3300025926 | Bacteria | 5779 |
| 479 | Ga0207659_10041398 | 3300025926 | Bacteria | 3226 |
| 480 | Ga0207659_10074502 | 3300025926 | Bacteria | 2488 |
| 481 | Ga0207659_10079670 | 3300025926 | Bacteria | 2417 |
| 482 | Ga0207659_10105241 | 3300025926 | Bacteria | 2135 |
| 483 | Ga0207659_10125147 | 3300025926 | Bacteria | 1976 |
| 484 | Ga0207687_10015473 | 3300025927 | Bacteria | 5003 |
| 485 | Ga0207687_10075138 | 3300025927 | Bacteria | 2424 |
| 486 | Ga0207687_10080592 | 3300025927 | Bacteria | 2350 |
| 487 | Ga0207687_10093522 | 3300025927 | Bacteria | 2198 |
| 488 | Ga0207687_10358040 | 3300025927 | Bacteria | 1190 |
| 489 | Ga0207644_10001504 | 3300025931 | Bacteria | 15026 |
| 490 | Ga0207644_10019986 | 3300025931 | Bacteria | 4549 |
| 491 | Ga0207644_10022834 | 3300025931 | Bacteria | 4277 |
| 492 | Ga0207644_10038881 | 3300025931 | Bacteria | 3355 |
| 493 | Ga0207644_10053967 | 3300025931 | Bacteria | 2893 |
| 494 | Ga0207644_10111137 | 3300025931 | Bacteria | 2072 |
| 495 | Ga0207644_10264405 | 3300025931 | Bacteria | 1377 |
| 496 | Ga0207690_10000935 | 3300025932 | Bacteria | 18686 |
| 497 | Ga0207690_10058270 | 3300025932 | Bacteria | 2612 |
| 498 | Ga0207690_10201856 | 3300025932 | Bacteria | 1511 |
| 499 | Ga0207690_10208687 | 3300025932 | Bacteria | 1488 |
| 500 | Ga0207706_10001677 | 3300025933 | Bacteria | 21872 |
| 501 | Ga0207706_10015194 | 3300025933 | Bacteria | 6967 |
| 502 | Ga0207706_10023606 | 3300025933 | Bacteria | 5522 |
| 503 | Ga0207706_10024928 | 3300025933 | Bacteria | 5362 |
| 504 | Ga0207706_10074501 | 3300025933 | Bacteria | 2985 |
| 505 | Ga0207706_10096025 | 3300025933 | Bacteria | 2607 |
| 506 | Ga0207706_10250986 | 3300025933 | Bacteria | 1545 |
| 507 | Ga0207686_10063273 | 3300025934 | Bacteria | 2352 |
| 508 | Ga0207686_10101993 | 3300025934 | Bacteria | 1918 |
| 509 | Ga0207686_10175382 | 3300025934 | Bacteria | 1515 |
| 510 | Ga0207709_10003126 | 3300025935 | Bacteria | 9959 |
| 511 | Ga0207709_10026566 | 3300025935 | Bacteria | 3327 |
| 512 | Ga0207709_10041375 | 3300025935 | Bacteria | 2765 |
| 513 | Ga0207669_10019249 | 3300025937 | Bacteria | 3549 |
| 514 | Ga0207669_10088509 | 3300025937 | Bacteria | 2008 |
| 515 | Ga0207669_10223557 | 3300025937 | Bacteria | 1383 |
| 516 | Ga0207704_10001522 | 3300025938 | Bacteria | 10396 |
| 517 | Ga0207704_10063144 | 3300025938 | Bacteria | 2307 |
| 518 | Ga0207665_10147025 | 3300025939 | Bacteria | 1685 |
| 519 | Ga0207691_10002799 | 3300025940 | Bacteria | 17002 |
| 520 | Ga0207691_10013171 | 3300025940 | Bacteria | 7920 |
| 521 | Ga0207691_10013705 | 3300025940 | Bacteria | 7746 |
| 522 | Ga0207691_10017465 | 3300025940 | Bacteria | 6803 |
| 523 | Ga0207691_10023638 | 3300025940 | Bacteria | 5787 |
| 524 | Ga0207691_10063825 | 3300025940 | Bacteria | 3339 |
| 525 | Ga0207691_10076093 | 3300025940 | Bacteria | 3025 |
| 526 | Ga0207691_10079947 | 3300025940 | Bacteria | 2942 |
| 527 | Ga0207691_10143614 | 3300025940 | Bacteria | 2102 |
| 528 | Ga0207691_10200916 | 3300025940 | Bacteria | 1735 |
| 529 | Ga0207711_10010766 | 3300025941 | Bacteria | 7604 |
| 530 | Ga0207711_10060531 | 3300025941 | Bacteria | 3263 |
| 531 | Ga0207711_10088812 | 3300025941 | Bacteria | 2714 |
| 532 | Ga0207711_10105438 | 3300025941 | Bacteria | 2500 |
| 533 | Ga0207689_10002606 | 3300025942 | Bacteria | 16685 |
| 534 | Ga0207689_10031970 | 3300025942 | Bacteria | 4377 |
| 535 | Ga0207661_10123149 | 3300025944 | Bacteria | 2211 |
| 536 | Ga0207661_10173487 | 3300025944 | Bacteria | 1878 |
| 537 | Ga0207679_10000730 | 3300025945 | Bacteria | 21864 |
| 538 | Ga0207679_10062285 | 3300025945 | Bacteria | 2779 |
| 539 | Ga0207667_10001651 | 3300025949 | Bacteria | 28107 |
| 540 | Ga0207667_10049107 | 3300025949 | Bacteria | 4459 |
| 541 | Ga0207667_10129158 | 3300025949 | Bacteria | 2603 |
| 542 | Ga0207651_10001009 | 3300025960 | Bacteria | 12449 |
| 543 | Ga0207651_10069470 | 3300025960 | Bacteria | 2487 |
| 544 | Ga0207651_10110736 | 3300025960 | Bacteria | 2060 |
| 545 | Ga0207651_10239377 | 3300025960 | Bacteria | 1478 |
| 546 | Ga0207712_10017241 | 3300025961 | Bacteria | 4688 |
| 547 | Ga0207712_10075415 | 3300025961 | Bacteria | 2438 |
| 548 | Ga0207640_10190473 | 3300025981 | Bacteria | 1546 |
| 549 | Ga0207640_10283987 | 3300025981 | Bacteria | 1301 |
| 550 | Ga0207658_10153500 | 3300025986 | Bacteria | 1879 |
| 551 | Ga0207677_10002324 | 3300026023 | Bacteria | 9980 |
| 552 | Ga0207677_10003785 | 3300026023 | Bacteria | 8038 |
| 553 | Ga0207677_10047610 | 3300026023 | Bacteria | 2880 |
| 554 | Ga0207677_10226804 | 3300026023 | Bacteria | 1502 |
| 555 | Ga0207703_10003131 | 3300026035 | Bacteria | 13968 |
| 556 | Ga0207703_10021976 | 3300026035 | Bacteria | 4996 |
| 557 | Ga0207703_10024701 | 3300026035 | Bacteria | 4728 |
| 558 | Ga0207703_10092993 | 3300026035 | Bacteria | 2539 |
| 559 | Ga0207639_10004276 | 3300026041 | Bacteria | 9629 |
| 560 | Ga0207678_10024830 | 3300026067 | Bacteria | 5232 |
| 561 | Ga0207678_10062383 | 3300026067 | Bacteria | 3204 |
| 562 | Ga0207702_10000305 | 3300026078 | Bacteria | 56491 |
| 563 | Ga0207702_10027017 | 3300026078 | Bacteria | 4766 |
| 564 | Ga0207702_10091496 | 3300026078 | Bacteria | 2664 |
| 565 | Ga0207702_10231198 | 3300026078 | Bacteria | 1728 |
| 566 | Ga0207641_10081706 | 3300026088 | Bacteria | 2806 |
| 567 | Ga0207641_10112043 | 3300026088 | Bacteria | 2420 |
| 568 | Ga0207648_10005380 | 3300026089 | Bacteria | 12909 |
| 569 | Ga0207648_10015510 | 3300026089 | Bacteria | 7004 |
| 570 | Ga0207648_10048878 | 3300026089 | Bacteria | 3703 |
| 571 | Ga0207648_10128026 | 3300026089 | Bacteria | 2234 |
| 572 | Ga0207648_10160550 | 3300026089 | Bacteria | 1985 |
| 573 | Ga0207648_10175499 | 3300026089 | Bacteria | 1895 |
| 574 | Ga0207648_10448174 | 3300026089 | Bacteria | 1175 |
| 575 | Ga0207676_10001457 | 3300026095 | Bacteria | 17601 |
| 576 | Ga0207676_10014960 | 3300026095 | Bacteria | 5590 |
| 577 | Ga0207676_10043123 | 3300026095 | Bacteria | 3471 |
| 578 | Ga0207674_10021674 | 3300026116 | Bacteria | 6918 |
| 579 | Ga0207674_10040752 | 3300026116 | Bacteria | 4808 |
| 580 | Ga0207674_10097874 | 3300026116 | Bacteria | 2918 |
| 581 | Ga0207674_10218345 | 3300026116 | Bacteria | 1855 |
| 582 | Ga0207674_10315926 | 3300026116 | Bacteria | 1511 |
| 583 | Ga0207674_10360743 | 3300026116 | Bacteria | 1405 |
| 584 | Ga0207675_100002976 | 3300026118 | Bacteria | 16669 |
| 585 | Ga0207675_100005040 | 3300026118 | Bacteria | 12712 |
| 586 | Ga0207675_100074722 | 3300026118 | Bacteria | 3172 |
| 587 | Ga0207675_100080010 | 3300026118 | Bacteria | 3063 |
| 588 | Ga0207675_100360220 | 3300026118 | Bacteria | 1427 |
| 589 | Ga0207683_10030578 | 3300026121 | Bacteria | 4666 |
| 590 | Ga0207683_10063818 | 3300026121 | Bacteria | 3245 |
| 591 | Ga0207683_10090581 | 3300026121 | Bacteria | 2724 |
| 592 | Ga0207683_10131412 | 3300026121 | Bacteria | 2252 |
| 593 | Ga0207683_10134438 | 3300026121 | Bacteria | 2226 |
| 594 | Ga0207698_10059078 | 3300026142 | Bacteria | 2976 |
| 595 | Ga0207698_10085339 | 3300026142 | Bacteria | 2563 |
| 596 | Ga0207698_10392828 | 3300026142 | Bacteria | 1323 |
| 597 | Ga0207698_10416644 | 3300026142 | Bacteria | 1288 |
| 598 | Ga0207698_10434480 | 3300026142 | Bacteria | 1263 |
| 599 | Ga0209281_1000259 | 3300027111 | Bacteria | 101905 |
| 600 | Ga0209389_1001550 | 3300027296 | Bacteria | 16381 |
| 601 | Ga0209371_1012540 | 3300027312 | Bacteria | 2442 |
| 602 | Ga0209282_1001433 | 3300027666 | Bacteria | 13109 |
| 603 | Ga0209813_10027106 | 3300027866 | Bacteria | 1661 |
| 604 | Ga0209813_10064218 | 3300027866 | Bacteria | 1179 |
| 605 | Ga0268266_10029102 | 3300028379 | Bacteria | 4695 |
| 606 | Ga0268266_10138127 | 3300028379 | Bacteria | 2185 |
| 607 | Ga0268265_10035450 | 3300028380 | Bacteria | 3645 |
| 608 | Ga0268265_10080194 | 3300028380 | Bacteria | 2573 |
| 609 | Ga0268265_10402325 | 3300028380 | Bacteria | 1266 |
| 610 | Ga0268264_10000991 | 3300028381 | Bacteria | 28937 |
| 611 | Ga0268264_10017985 | 3300028381 | Bacteria | 5781 |
| 612 | Ga0268264_10038937 | 3300028381 | Bacteria | 3926 |
| 613 | Ga0268264_10040703 | 3300028381 | Bacteria | 3840 |
| 614 | Ga0268264_10623235 | 3300028381 | Bacteria | 1065 |
| 615 | Ga0265334_10006510 | 3300028573 | Bacteria | 5029 |
| 616 | Ga0265336_10000013 | 3300028666 | Bacteria | 252156 |
| 617 | Ga0307517_10000131 | 3300028786 | Bacteria | 113233 |
| 618 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 619 | Ga0307515_10002251 | 3300028794 | Bacteria | 42303 |
| 620 | Ga0307515_10003079 | 3300028794 | Bacteria | 35329 |
| 621 | Ga0307515_10003449 | 3300028794 | Bacteria | 33283 |
| 622 | Ga0307515_10009653 | 3300028794 | Bacteria | 18622 |
| 623 | Ga0307515_10009817 | 3300028794 | Bacteria | 18442 |
| 624 | Ga0307515_10020437 | 3300028794 | Bacteria | 11812 |
| 625 | Ga0307515_10056041 | 3300028794 | Bacteria | 5739 |
| 626 | Ga0307515_10091473 | 3300028794 | Bacteria | 3801 |
| 627 | Ga0307515_10169786 | 3300028794 | Bacteria | 2180 |
| 628 | Ga0307515_10201434 | 3300028794 | Bacteria | 1865 |
| 629 | Ga0265324_10001846 | 3300029957 | Bacteria | 11474 |
| 630 | Ga0268256_1026534 | 3300030500 | Bacteria | 1454 |
| 631 | Ga0307511_10055559 | 3300030521 | Bacteria | 3107 |
| 632 | Ga0307512_10078314 | 3300030522 | Bacteria | 2396 |
| 633 | Ga0316176_1040348 | 3300030732 | Bacteria | 1630 |
| 634 | Ga0314311_1170456 | 3300030733 | Bacteria | 1824 |
| 635 | Ga0316179_1078834 | 3300030734 | Bacteria | 5092 |
| 636 | Ga0316183_1136313 | 3300030742 | Bacteria | 4845 |
| 637 | Ga0265329_10008613 | 3300031242 | Bacteria | 3855 |
| 638 | Ga0265331_10009176 | 3300031250 | Bacteria | 5577 |
| 639 | Ga0265327_10000012 | 3300031251 | Bacteria | 530403 |
| 640 | Ga0265327_10000056 | 3300031251 | Bacteria | 243974 |
| 641 | Ga0265327_10001807 | 3300031251 | Bacteria | 25067 |
| 642 | Ga0265316_10002321 | 3300031344 | Bacteria | 19887 |
| 643 | Ga0307513_10003077 | 3300031456 | Bacteria | 22757 |
| 644 | Ga0307513_10019900 | 3300031456 | Bacteria | 7975 |
| 645 | Ga0307513_10043735 | 3300031456 | Bacteria | 4915 |
| 646 | Ga0307513_10059994 | 3300031456 | Bacteria | 4035 |
| 647 | Ga0307513_10361519 | 3300031456 | Bacteria | 1196 |
| 648 | Ga0307509_10000871 | 3300031507 | Bacteria | 52060 |
| 649 | Ga0307509_10009460 | 3300031507 | Bacteria | 12180 |
| 650 | Ga0307509_10022255 | 3300031507 | Bacteria | 7152 |
| 651 | Ga0307509_10028400 | 3300031507 | Bacteria | 6220 |
| 652 | Ga0307509_10195687 | 3300031507 | Bacteria | 1866 |
| 653 | Ga0307509_10203426 | 3300031507 | Bacteria | 1814 |
| 654 | Ga0307509_10215244 | 3300031507 | Bacteria | 1741 |
| 655 | Ga0307509_10252867 | 3300031507 | Bacteria | 1544 |
| 656 | Ga0307408_100000037 | 3300031548 | Bacteria | 187096 |
| 657 | Ga0307408_100158050 | 3300031548 | Bacteria | 1797 |
| 658 | Ga0307408_100164324 | 3300031548 | Bacteria | 1766 |
| 659 | Ga0307408_100193482 | 3300031548 | Bacteria | 1640 |
| 660 | Ga0307508_10000123 | 3300031616 | Bacteria | 92439 |
| 661 | Ga0307508_10000349 | 3300031616 | Bacteria | 56002 |
| 662 | Ga0307508_10002230 | 3300031616 | Bacteria | 20644 |
| 663 | Ga0307508_10272356 | 3300031616 | Bacteria | 1287 |
| 664 | Ga0307514_10000355 | 3300031649 | Bacteria | 106758 |
| 665 | Ga0307514_10010918 | 3300031649 | Bacteria | 7584 |
| 666 | Ga0307514_10020837 | 3300031649 | Bacteria | 5346 |
| 667 | Ga0265314_10047625 | 3300031711 | Bacteria | 3015 |
| 668 | Ga0265342_10114117 | 3300031712 | Bacteria | 1526 |
| 669 | Ga0307516_10000303 | 3300031730 | Bacteria | 63898 |
| 670 | Ga0307516_10008217 | 3300031730 | Bacteria | 11852 |
| 671 | Ga0307516_10050751 | 3300031730 | Bacteria | 4068 |
| 672 | Ga0307516_10175736 | 3300031730 | Bacteria | 1878 |
| 673 | Ga0307405_10012268 | 3300031731 | Bacteria | 4528 |
| 674 | Ga0307405_10021412 | 3300031731 | Bacteria | 3633 |
| 675 | Ga0307405_10102759 | 3300031731 | Bacteria | 1920 |
| 676 | Ga0307405_10411825 | 3300031731 | Bacteria | 1061 |
| 677 | Ga0307413_10382363 | 3300031824 | Bacteria | 1097 |
| 678 | Ga0307406_10005195 | 3300031901 | Bacteria | 7110 |
| 679 | Ga0307406_10054939 | 3300031901 | Bacteria | 2544 |
| 680 | Ga0307406_10068104 | 3300031901 | Bacteria | 2323 |
| 681 | Ga0307406_10163773 | 3300031901 | Bacteria | 1602 |
| 682 | Ga0307412_10031153 | 3300031911 | Bacteria | 3365 |
| 683 | Ga0307412_10063769 | 3300031911 | Bacteria | 2487 |
| 684 | Ga0307412_10115767 | 3300031911 | Bacteria | 1922 |
| 685 | Ga0307412_10134175 | 3300031911 | Bacteria | 1803 |
| 686 | Ga0307409_100000926 | 3300031995 | Bacteria | 13646 |
| 687 | Ga0307409_100086215 | 3300031995 | Bacteria | 2555 |
| 688 | Ga0307409_100239027 | 3300031995 | Bacteria | 1652 |
| 689 | Ga0307416_100003028 | 3300032002 | Bacteria | 9820 |
| 690 | Ga0307416_100005442 | 3300032002 | Bacteria | 7821 |
| 691 | Ga0307416_100032643 | 3300032002 | Bacteria | 3937 |
| 692 | Ga0307416_100083294 | 3300032002 | Bacteria | 2713 |
| 693 | Ga0307416_100096192 | 3300032002 | Bacteria | 2560 |
| 694 | Ga0307414_10003263 | 3300032004 | Bacteria | 8645 |
| 695 | Ga0307414_10132690 | 3300032004 | Bacteria | 1936 |
| 696 | Ga0307414_10177876 | 3300032004 | Bacteria | 1708 |
| 697 | Ga0307414_10264358 | 3300032004 | Bacteria | 1437 |
| 698 | Ga0307411_10005122 | 3300032005 | Bacteria | 6398 |
| 699 | Ga0307411_10026791 | 3300032005 | Bacteria | 3476 |
| 700 | Ga0307411_10026968 | 3300032005 | Bacteria | 3467 |
| 701 | Ga0307411_10316605 | 3300032005 | Bacteria | 1258 |
| 702 | Ga0307415_100014487 | 3300032126 | Bacteria | 4638 |
| 703 | Ga0307415_100022072 | 3300032126 | Bacteria | 3924 |
| 704 | Ga0307507_10099711 | 3300033179 | Bacteria | 2438 |
| 705 | Ga0307510_10024879 | 3300033180 | Bacteria | 6912 |
| 706 | Ga0307510_10058456 | 3300033180 | Bacteria | 3991 |
| 707 | Ga0307510_10068523 | 3300033180 | Bacteria | 3559 |
| 708 | Ga0373948_0011730 | 3300034817 | Bacteria | 1555 |
| 709 | Ga0373950_0006113 | 3300034818 | Bacteria | 1824 |
| 710 | Ga0373940_0023282 | 3300035088 | Bacteria | 1597 |
| 711 | Ga0373932_0010384 | 3300035112 | Bacteria | 2252 |
| 712 | Ga0373932_0048541 | 3300035112 | Bacteria | 1251 |
| 713 | Ga0373955_0131767 | 3300035172 | Bacteria | 1460 |
| 714 | Ga0373924_0132353 | 3300035410 | Bacteria | 1085 |
| 715 | Ga0373931_0000480 | 3300035691 | Bacteria | 16287 |
| 716 | Ga0373931_0002140 | 3300035691 | Bacteria | 8696 |
| 717 | Ga0373931_0008075 | 3300035691 | Bacteria | 4981 |
| 718 | Ga0373931_0047189 | 3300035691 | Bacteria | 2279 |
| 719 | Ga0373931_0189316 | 3300035691 | Bacteria | 1223 |
| 720 | Ga0373935_0162930 | 3300035692 | Bacteria | 1521 |
| 721 | Ga0373947_0079558 | 3300035725 | Bacteria | 2026 |
| 722 | Ga0373937_0083884 | 3300036401 | Bacteria | 2948 |
| 723 | Ga0373937_0121014 | 3300036401 | Bacteria | 2439 |
| 724 | Ga0373925_0004190 | 3300037068 | Bacteria | 10946 |
| 725 | Ga0373925_0043282 | 3300037068 | Bacteria | 3341 |
| 726 | Ga0395899_0001142 | 3300037312 | Bacteria | 23518 |
| 727 | Ga0395898_0000283 | 3300037466 | Bacteria | 122630 |
| 728 | Ga0395898_0017273 | 3300037466 | Bacteria | 7370 |
| 729 | Ga0395898_0028719 | 3300037466 | Bacteria | 5574 |
| 730 | Ga0395898_0510687 | 3300037466 | Bacteria | 1143 |
| 731 | Ga0395905_0000117 | 3300037471 | Bacteria | 133291 |
| 732 | Ga0395905_0000474 | 3300037471 | Bacteria | 55503 |
| 733 | Ga0395905_0002201 | 3300037471 | Bacteria | 22018 |
| 734 | Ga0395905_0005150 | 3300037471 | Bacteria | 13415 |
| 735 | Ga0395905_0090405 | 3300037471 | Bacteria | 2870 |
| 736 | Ga0395905_0362289 | 3300037471 | Bacteria | 1342 |
| 737 | Ga0395901_0011124 | 3300038443 | Bacteria | 9121 |
| 738 | Ga0436365_1372925 | 3300039437 | Bacteria | 1599 |
| 739 | Ga0436361_0019641 | 3300039447 | Bacteria | 127735 |
| 740 | Ga0436361_0080882 | 3300039447 | Bacteria | 1537 |
| 741 | Ga0436361_0163583 | 3300039447 | Bacteria | 173204 |
| 742 | Ga0436361_0328630 | 3300039447 | Bacteria | 6697 |
| 743 | Ga0436361_0360217 | 3300039447 | Bacteria | 9488 |
| 744 | Ga0436361_0484071 | 3300039447 | Bacteria | 47769 |
| 745 | Ga0436361_0869713 | 3300039447 | Bacteria | 3016 |
| 746 | Ga0451853_2460991 | 3300041512 | Bacteria | 2303 |
| 747 | Ga0439431_0005707 | 3300041997 | Bacteria | 2745 |
| 748 | Ga0439437_000193 | 3300042000 | Bacteria | 5272 |
| 749 | Ga0439449_0001342 | 3300042007 | Bacteria | 9637 |
| 750 | Ga0450917_000061 | 3300042120 | Bacteria | 5956 |
| 751 | Ga0450919_000622 | 3300042121 | Bacteria | 4483 |
| 752 | Ga0450923_003185 | 3300042125 | Bacteria | 2449 |
| 753 | Ga0450923_014087 | 3300042125 | Bacteria | 1479 |
| 754 | Ga0450890_001292 | 3300042127 | Bacteria | 3621 |
| 755 | Ga0450890_001944 | 3300042127 | Bacteria | 2919 |
| 756 | Ga0450892_000146 | 3300042130 | Bacteria | 8168 |
| 757 | Ga0450898_009583 | 3300042134 | Bacteria | 1552 |
| 758 | Ga0450889_000033 | 3300042144 | Bacteria | 11861 |
| 759 | Ga0450906_013652 | 3300042145 | Bacteria | 1495 |
| 760 | Ga0439434_0000557 | 3300042435 | Bacteria | 10724 |
| 761 | Ga0439434_0054390 | 3300042435 | Bacteria | 1245 |
| 762 | Ga0439464_0008881 | 3300042439 | Bacteria | 2635 |
| 763 | Ga0439460_0010055 | 3300042461 | Bacteria | 2413 |
| 764 | Ga0450918_000307 | 3300042531 | Bacteria | 10947 |
| 765 | Ga0450918_000609 | 3300042531 | Bacteria | 7669 |
| 766 | Ga0451577_0001078 | 3300042876 | Bacteria | 39114 |
| 767 | Ga0451577_0036086 | 3300042876 | Bacteria | 4452 |
| 768 | Ga0451577_0069045 | 3300042876 | Bacteria | 3151 |
| 769 | Ga0466969_0000013 | 3300044656 | Bacteria | 111537 |
| 770 | Ga0466969_0005945 | 3300044656 | Bacteria | 6492 |
| 771 | Ga0466969_0056440 | 3300044656 | Bacteria | 1917 |
| 772 | Ga0466969_0062657 | 3300044656 | Bacteria | 1803 |
| 773 | Ga0466972_0012974 | 3300044658 | Bacteria | 4187 |
| 774 | Ga0466965_0001440 | 3300044683 | Bacteria | 9598 |
| 775 | Ga0466965_0047910 | 3300044683 | Bacteria | 2116 |
| 776 | Ga0466966_0009951 | 3300044684 | Bacteria | 6302 |
| 777 | Ga0466966_0021167 | 3300044684 | Bacteria | 4270 |
| 778 | Ga0466966_0066520 | 3300044684 | Bacteria | 2264 |
| 779 | Ga0466961_0013192 | 3300044693 | Bacteria | 5286 |
| 780 | Ga0466961_0017265 | 3300044693 | Bacteria | 4634 |
| 781 | Ga0466961_0045198 | 3300044693 | Bacteria | 2817 |
| 782 | Ga0466961_0051807 | 3300044693 | Bacteria | 2620 |
| 783 | Ga0466961_0191015 | 3300044693 | Bacteria | 1269 |
| 784 | Ga0466963_0018170 | 3300044694 | Bacteria | 4392 |
| 785 | Ga0466964_0002927 | 3300044706 | Bacteria | 6163 |
| 786 | Ga0453684_0020777 | 3300044712 | Bacteria | 9869 |
| 787 | Ga0453684_0212062 | 3300044712 | Bacteria | 2250 |
| 788 | Ga0453684_0253101 | 3300044712 | Bacteria | 2022 |
| 789 | Ga0453684_0299700 | 3300044712 | Bacteria | 1827 |
| 790 | Ga0466971_0012889 | 3300044719 | Bacteria | 3666 |
| 791 | Ga0466971_0044275 | 3300044719 | Bacteria | 1998 |
| 792 | Ga0466971_0045502 | 3300044719 | Bacteria | 1971 |
| 793 | Ga0466960_0077866 | 3300044901 | Bacteria | 1664 |
| 794 | Ga0466959_0013538 | 3300045049 | Bacteria | 5912 |
| 795 | Ga0466959_0079990 | 3300045049 | Bacteria | 2356 |
| 796 | Ga0466959_0320452 | 3300045049 | Bacteria | 1060 |
| 797 | Ga0451576_0015485 | 3300045051 | Bacteria | 8445 |
| 798 | Ga0451576_0056008 | 3300045051 | Bacteria | 4124 |
| 799 | Ga0451576_0073488 | 3300045051 | Bacteria | 3558 |
| 800 | Ga0451576_0183228 | 3300045051 | Bacteria | 2186 |
| 801 | Ga0466958_0046375 | 3300045836 | Bacteria | 2622 |
| 802 | Ga0466967_0013196 | 3300045976 | Bacteria | 6371 |
| 803 | Ga0495592_0004276 | 3300046454 | Bacteria | 10439 |
| 804 | Ga0495590_0029475 | 3300046457 | Bacteria | 1924 |
| 805 | Ga0495629_0036078 | 3300046459 | Bacteria | 3493 |
| 806 | Ga0495638_0108498 | 3300046460 | Bacteria | 1651 |
| 807 | Ga0495638_0202346 | 3300046460 | Bacteria | 1120 |
| 808 | Ga0495650_0006312 | 3300046471 | Bacteria | 7413 |
| 809 | Ga0495650_0020411 | 3300046471 | Bacteria | 3232 |
| 810 | Ga0495605_0039118 | 3300046474 | Bacteria | 2377 |
| 811 | Ga0495585_0059305 | 3300046492 | Bacteria | 2109 |
| 812 | Ga0495583_0000081 | 3300046506 | Bacteria | 168304 |
| 813 | Ga0495583_0045661 | 3300046506 | Bacteria | 2025 |
| 814 | Ga0495606_0001086 | 3300046507 | Bacteria | 38950 |
| 815 | Ga0495610_0042868 | 3300046512 | Bacteria | 2259 |
| 816 | Ga0495616_0000726 | 3300046513 | Bacteria | 24323 |
| 817 | Ga0495630_0098717 | 3300046517 | Bacteria | 2209 |
| 818 | Ga0495631_0070588 | 3300046518 | Bacteria | 1510 |
| 819 | Ga0495632_0017229 | 3300046519 | Bacteria | 3994 |
| 820 | Ga0495637_0077224 | 3300046520 | Bacteria | 1333 |
| 821 | Ga0495652_0335607 | 3300046529 | Bacteria | 1088 |
| 822 | Ga0495586_0038746 | 3300046535 | Bacteria | 2561 |
| 823 | Ga0495621_0004221 | 3300046539 | Bacteria | 4015 |
| 824 | Ga0495621_0021148 | 3300046539 | Bacteria | 2142 |
| 825 | Ga0495597_0007632 | 3300046542 | Bacteria | 5474 |
| 826 | Ga0495645_0324077 | 3300046543 | Bacteria | 999 |
| 827 | Ga0495622_0081799 | 3300046557 | Bacteria | 1486 |
| 828 | Ga0495668_0059994 | 3300046616 | Bacteria | 2099 |
| 829 | Ga0495668_0068365 | 3300046616 | Bacteria | 1954 |
| 830 | Ga0495625_0001179 | 3300046660 | Bacteria | 33575 |
| 831 | Ga0495625_0004883 | 3300046660 | Bacteria | 12496 |
| 832 | Ga0495625_0006045 | 3300046660 | Bacteria | 10869 |
| 833 | Ga0495625_0068980 | 3300046660 | Bacteria | 2484 |
| 834 | Ga0495625_0120654 | 3300046660 | Bacteria | 1784 |
| 835 | Ga0495588_0054017 | 3300046674 | Bacteria | 2072 |
| 836 | Ga0495647_0090336 | 3300046681 | Bacteria | 1255 |
| 837 | Ga0495658_0047252 | 3300046683 | Bacteria | 2423 |
| 838 | Ga0495658_0058506 | 3300046683 | Bacteria | 2205 |
| 839 | Ga0495658_0074436 | 3300046683 | Bacteria | 1979 |
| 840 | Ga0495669_0037133 | 3300046684 | Bacteria | 2155 |
| 841 | Ga0495669_0059037 | 3300046684 | Bacteria | 1732 |
| 842 | Ga0495613_0323642 | 3300046689 | Bacteria | 1064 |
| 843 | Ga0495671_0018499 | 3300046692 | Bacteria | 3697 |
| 844 | Ga0495649_0000287 | 3300046694 | Bacteria | 44649 |
| 845 | Ga0495649_0009613 | 3300046694 | Bacteria | 5732 |
| 846 | Ga0495589_0002102 | 3300046794 | Bacteria | 11247 |
| 847 | Ga0495660_0043906 | 3300046810 | Bacteria | 2461 |
| 848 | Ga0495676_0007401 | 3300047321 | Bacteria | 10075 |
| 849 | Ga0495676_0038732 | 3300047321 | Bacteria | 3957 |
| 850 | Ga0495687_000582 | 3300047443 | Bacteria | 42863 |
| 851 | Ga0495687_003343 | 3300047443 | Bacteria | 11726 |
| 852 | Ga0495681_0024990 | 3300047470 | Bacteria | 3133 |
| 853 | Ga0495684_0108284 | 3300047471 | Bacteria | 2099 |
| 854 | Ga0495686_0062267 | 3300047472 | Bacteria | 2315 |
| 855 | Ga0495593_0002204 | 3300047673 | Bacteria | 11664 |
| 856 | Ga0495593_0025973 | 3300047673 | Bacteria | 3238 |
| 857 | Ga0495602_0220129 | 3300048088 | Bacteria | 1434 |
| 858 | Ga0495614_0154627 | 3300048089 | Bacteria | 1024 |
| 859 | Ga0496100_0034311 | 3300048903 | Bacteria | 3183 |
| 860 | Ga0496102_0052953 | 3300048905 | Bacteria | 3699 |
| 861 | Ga0496103_0102424 | 3300048906 | Bacteria | 1813 |
| 862 | Ga0496104_0067251 | 3300048907 | Bacteria | 3404 |
| 863 | Ga0496104_0214146 | 3300048907 | Bacteria | 1838 |
| 864 | Ga0496104_0226033 | 3300048907 | Bacteria | 1784 |
| 865 | Ga0496105_0046450 | 3300048908 | Bacteria | 3584 |
| 866 | Ga0496105_0062626 | 3300048908 | Bacteria | 3070 |
| 867 | Ga0496105_0159229 | 3300048908 | Bacteria | 1854 |
| 868 | Ga0496105_0210749 | 3300048908 | Bacteria | 1584 |
| 869 | Ga0496106_0004527 | 3300048909 | Bacteria | 10296 |
| 870 | Ga0496107_0006316 | 3300048910 | Bacteria | 8145 |
| 871 | Ga0496108_0137119 | 3300048911 | Bacteria | 2106 |
| 872 | Ga0496108_0228730 | 3300048911 | Bacteria | 1617 |
| 873 | Ga0496108_0252487 | 3300048911 | Bacteria | 1534 |
| 874 | Ga0496109_0010731 | 3300048912 | Bacteria | 7841 |
| 875 | Ga0496109_0075411 | 3300048912 | Bacteria | 3101 |
| 876 | Ga0496109_0123433 | 3300048912 | Bacteria | 2414 |
| 877 | Ga0496109_0176816 | 3300048912 | Bacteria | 2004 |
| 878 | Ga0496109_0256161 | 3300048912 | Bacteria | 1648 |
| 879 | Ga0496109_0455003 | 3300048912 | Bacteria | 1209 |
| 880 | Ga0496110_0007885 | 3300048913 | Bacteria | 8528 |
| 881 | Ga0496110_0041580 | 3300048913 | Bacteria | 4012 |
| 882 | Ga0496111_0334603 | 3300048914 | Bacteria | 1121 |
| 883 | Ga0496112_0011308 | 3300048915 | Bacteria | 8144 |
| 884 | Ga0496114_0038217 | 3300048917 | Bacteria | 3971 |
| 885 | Ga0496114_0051763 | 3300048917 | Bacteria | 3419 |
| 886 | Ga0496115_0018225 | 3300048918 | Bacteria | 5386 |
| 887 | Ga0496116_0095988 | 3300048919 | Bacteria | 1787 |
| 888 | Ga0496117_0045596 | 3300048920 | Bacteria | 3164 |
| 889 | Ga0496118_0006245 | 3300048921 | Bacteria | 13169 |
| 890 | Ga0496118_0017827 | 3300048921 | Bacteria | 6441 |
| 891 | Ga0496121_0023572 | 3300048924 | Bacteria | 5921 |
| 892 | Ga0496121_0143192 | 3300048924 | Bacteria | 1770 |
| 893 | Ga0496124_0001458 | 3300048927 | Bacteria | 34900 |
| 894 | Ga0496125_0005030 | 3300048928 | Bacteria | 14929 |
| 895 | Ga0496125_0124973 | 3300048928 | Bacteria | 1825 |
| 896 | Ga0496126_0199588 | 3300048929 | Bacteria | 1690 |
| 897 | Ga0496126_0229401 | 3300048929 | Bacteria | 1556 |
| 898 | Ga0495682_0049139 | 3300049460 | Bacteria | 1537 |
| 899 | Ga0501297_011568 | 3300049520 | Bacteria | 1014 |
| 900 | Ga0501298_010416 | 3300049521 | Bacteria | 1601 |
| 901 | Ga0501300_001415 | 3300049523 | Bacteria | 3595 |
| 902 | Ga0501034_0077062 | 3300049571 | Bacteria | 3340 |
| 903 | Ga0501034_0118662 | 3300049571 | Bacteria | 2632 |
| 904 | Ga0501047_0019851 | 3300049581 | Bacteria | 6450 |
| 905 | Ga0501198_000001 | 3300049649 | Bacteria | 234552 |
| 906 | Ga0501202_005882 | 3300049652 | Bacteria | 2181 |
| 907 | Ga0501206_001533 | 3300049653 | Bacteria | 2880 |
| 908 | Ga0501207_012428 | 3300049654 | Bacteria | 1280 |
| 909 | Ga0501211_000219 | 3300049658 | Bacteria | 4955 |
| 910 | Ga0501222_000004 | 3300049662 | Bacteria | 136139 |
| 911 | Ga0501222_000467 | 3300049662 | Bacteria | 6041 |
| 912 | Ga0501249_003842 | 3300049679 | Bacteria | 3032 |
| 913 | Ga0501253_005537 | 3300049683 | Bacteria | 1662 |
| 914 | Ga0501257_039065 | 3300049686 | Bacteria | 1162 |
| 915 | Ga0501258_000186 | 3300049687 | Bacteria | 3647 |
| 916 | Ga0501261_002913 | 3300049690 | Bacteria | 2102 |
| 917 | Ga0501221_002045 | 3300049704 | Bacteria | 3358 |
| 918 | Ga0501225_0004943 | 3300049705 | Bacteria | 3940 |
| 919 | Ga0501225_0016453 | 3300049705 | Bacteria | 2057 |
| 920 | Ga0501229_000371 | 3300049706 | Bacteria | 5068 |
| 921 | Ga0501080_0060974 | 3300049742 | Bacteria | 3512 |
| 922 | Ga0501262_001380 | 3300049759 | Bacteria | 2724 |
| 923 | Ga0501265_003561 | 3300049762 | Bacteria | 1768 |
| 924 | Ga0501271_002697 | 3300049768 | Bacteria | 1601 |
| 925 | Ga0501272_000700 | 3300049769 | Bacteria | 3024 |
| 926 | Ga0501035_0033229 | 3300049822 | Bacteria | 4691 |
| 927 | nmdc:mga03683_10973_c1 | 3300050489 | Bacteria | 3263 |
| 928 | nmdc:mga03683_22760_c1 | 3300050489 | Bacteria | 2432 |
| 929 | nmdc:mga03683_5023_c1 | 3300050489 | Bacteria | 4433 |
| 930 | nmdc:mga03n38_16306_c1 | 3300050490 | Bacteria | 2888 |
| 931 | nmdc:mga03n38_32716_c1 | 3300050490 | Bacteria | 2206 |
| 932 | nmdc:mga03n38_36024_c1 | 3300050490 | Bacteria | 2125 |
| 933 | nmdc:mga0k408_10183_c1 | 3300050493 | Bacteria | 5082 |
| 934 | nmdc:mga0k408_137371_c1 | 3300050493 | Bacteria | 1453 |
| 935 | nmdc:mga0k408_15567_c1 | 3300050493 | Bacteria | 4205 |
| 936 | nmdc:mga0k408_189618_c1 | 3300050493 | Bacteria | 1227 |
| 937 | nmdc:mga0k408_201803_c1 | 3300050493 | Bacteria | 1187 |
| 938 | nmdc:mga0k408_22319_c1 | 3300050493 | Bacteria | 3564 |
| 939 | nmdc:mga0k408_2564_c1 | 3300050493 | Bacteria | 8432 |
| 940 | nmdc:mga0k408_33438_c1 | 3300050493 | Bacteria | 2941 |
| 941 | nmdc:mga0k408_4053_c1 | 3300050493 | Bacteria | 7772 |
| 942 | nmdc:mga0k408_4958_c1 | 3300050493 | Bacteria | 7055 |
| 943 | nmdc:mga0k408_63664_c1 | 3300050493 | Bacteria | 2146 |
| 944 | nmdc:mga0k408_66089_c1 | 3300050493 | Bacteria | 2106 |
| 945 | nmdc:mga0k408_8218_c1 | 3300050493 | Bacteria | 5594 |
| 946 | nmdc:mga0k408_93998_c1 | 3300050493 | Bacteria | 1763 |
| 947 | nmdc:mga06z11_37401_c1 | 3300050494 | Bacteria | 2403 |
| 948 | nmdc:mga06z11_44644_c1 | 3300050494 | Bacteria | 2236 |
| 949 | nmdc:mga04h51_70934_c1 | 3300050495 | Bacteria | 1216 |
| 950 | nmdc:mga07m45_16377_c1 | 3300050496 | Bacteria | 3970 |
| 951 | nmdc:mga07m45_2094_c1 | 3300050496 | Bacteria | 9264 |
| 952 | nmdc:mga07m45_38799_c1 | 3300050496 | Bacteria | 2660 |
| 953 | nmdc:mga07m45_4892_c1 | 3300050496 | Bacteria | 6600 |
| 954 | nmdc:mga07m45_5767_c1 | 3300050496 | Bacteria | 6199 |
| 955 | nmdc:mga07m45_65014_c1 | 3300050496 | Bacteria | 2071 |
| 956 | nmdc:mga07m45_7026_c1 | 3300050496 | Bacteria | 5728 |
| 957 | nmdc:mga07m45_78799_c1 | 3300050496 | Bacteria | 1880 |
| 958 | nmdc:mga07m45_81_c1 | 3300050496 | Bacteria | 35778 |
| 959 | nmdc:mga07m45_89611_c1 | 3300050496 | Bacteria | 1762 |
| 960 | nmdc:mga07m45_9218_c1 | 3300050496 | Bacteria | 5108 |
| 961 | nmdc:mga09592_1146_c1 | 3300050508 | Bacteria | 21139 |
| 962 | nmdc:mga0qj67_116730_c1 | 3300050509 | Bacteria | 2157 |
| 963 | Ga0500610_0004460 | 3300053079 | Bacteria | 5566 |
| 964 | Ga0500610_0012136 | 3300053079 | Bacteria | 3955 |
| 965 | Ga0500635_0000011 | 3300053080 | Bacteria | 144219 |
| 966 | Ga0500643_022086 | 3300053087 | Bacteria | 2054 |
| 967 | Ga0500644_0001695 | 3300053088 | Bacteria | 5745 |
| 968 | Ga0500651_0000067 | 3300053093 | Bacteria | 67673 |
| 969 | Ga0500651_0010814 | 3300053093 | Bacteria | 5484 |
| 970 | Ga0500571_000088 | 3300053110 | Bacteria | 29136 |
| 971 | Ga0500594_0002317 | 3300053118 | Bacteria | 4130 |
| 972 | Ga0500594_0003170 | 3300053118 | Bacteria | 3601 |
| 973 | Ga0500607_003160 | 3300053121 | Bacteria | 12287 |
| 974 | Ga0500618_033455 | 3300053125 | Bacteria | 1199 |
| 975 | Ga0500658_0001848 | 3300053134 | Bacteria | 8325 |
| 976 | Ga0500658_0046863 | 3300053134 | Bacteria | 1752 |
| 977 | Ga0500559_0001207 | 3300053136 | Bacteria | 15383 |
| 978 | Ga0500568_0007294 | 3300053139 | Bacteria | 5437 |
| 979 | Ga0500573_0158255 | 3300053140 | Bacteria | 1235 |
| 980 | Ga0500619_005909 | 3300053154 | Bacteria | 2776 |
| 981 | Ga0500622_0009720 | 3300053156 | Bacteria | 5313 |
| 982 | Ga0500627_0001479 | 3300053158 | Bacteria | 6584 |
| 983 | Ga0500634_0030761 | 3300053161 | Bacteria | 2926 |
| 984 | Ga0500645_001523 | 3300053730 | Bacteria | 11600 |
| 985 | Ga0500596_008364 | 3300053735 | Bacteria | 1653 |
| 986 | Ga0500587_001369 | 3300053739 | Bacteria | 3437 |
| 987 | Ga0590071_005488 | 3300059421 | Bacteria | 3047 |
| 988 | Ga0466962_0001662 | 3300061719 | Bacteria | 10428 |
| 989 | 2513228780 | 2513020051 | Bacteria | 6053213 |
| 990 | 2587759365 | 2585428062 | Bacteria | 6842168 |
| 991 | 2599620871 | 2599185214 | Bacteria | 8209958 |
| 992 | 2599674323 | 2599185226 | Bacteria | 8233575 |
| 993 | 2599678513 | 2599185227 | Bacteria | 8246414 |
| 994 | 2599690382 | 2599185229 | Bacteria | 8216126 |
| 995 | 2643743229 | 2643221544 | Bacteria | 5886209 |
| 996 | 2643932751 | 2643221585 | Bacteria | 5812563 |
| 997 | 2644161342 | 2643221628 | Bacteria | 5745828 |
| 998 | 2644218355 | 2643221639 | Bacteria | 6649903 |
| 999 | 2644243362 | 2643221644 | Bacteria | 6865017 |
| 1000 | 2644260246 | 2643221646 | Bacteria | 6433402 |
| 1001 | 2644303034 | 2643221654 | Bacteria | 5273570 |
| 1002 | 2644314001 | 2643221656 | Bacteria | 5809961 |
| 1003 | 2644324059 | 2643221658 | Bacteria | 6064537 |
| 1004 | 2644340829 | 2643221660 | Bacteria | 4208257 |
| 1005 | 2644400757 | 2643221672 | Bacteria | 6322190 |
| 1006 | 2644465996 | 2643221683 | Bacteria | 5749203 |
| 1007 | 2739056095 | 2738541337 | Bacteria | 6183410 |
| 1008 | 2819601994 | 2818991446 | Bacteria | 7757362 |
| 1009 | 2831269823 | 2831265667 | Bacteria | 7184833 |
| 1010 | 2831869135 | 2831864461 | Bacteria | 6502356 |
| 1011 | 2838055159 | 2838054893 | Bacteria | 7451788 |
| 1012 | 2842680907 | 2842677519 | Bacteria | 5615038 |
| 1013 | 2885196702 | 2885192300 | Bacteria | 5882526 |
| 1014 | 2885201844 | 2885198086 | Bacteria | 7212419 |
| 1015 | 2885215446 | 2885211737 | Bacteria | 7212420 |
| 1016 | 2886849293 | 2886848708 | Bacteria | 5632523 |
| 1017 | 2886853290 | 2886848708 | Bacteria | 5632523 |
| 1018 | 2899927249 | 2899924645 | Bacteria | 7487985 |
| 1019 | 2904453995 | 2904449895 | Bacteria | 6927402 |
| 1020 | 2904459467 | 2904456579 | Bacteria | 6819253 |
| 1021 | 2904546121 | 2904541872 | Bacteria | 8915136 |
| 1022 | 2919465425 | 2919462493 | Bacteria | 5817112 |
| 1023 | 2928042836 | 2928037797 | Bacteria | 7273642 |
| 1024 | 2928048737 | 2928044640 | Bacteria | 7271509 |
| 1025 | 2928055069 | 2928051484 | Bacteria | 7773759 |
| 1026 | 2928068495 | 2928064002 | Bacteria | 7419480 |
| 1027 | 2928073599 | 2928070936 | Bacteria | 8062541 |
| 1028 | 2928089698 | 2928084124 | Bacteria | 7159212 |
| 1029 | 2928117246 | 2928115317 | Bacteria | 6477646 |
| 1030 | 2929161318 | 2929160207 | Bacteria | 9075316 |
| 1031 | 2929521581 | 2929520902 | Bacteria | 6765052 |
| 1032 | 2945949783 | 2945945610 | Bacteria | 5951079 |
| 1033 | 2945973806 | 2945972063 | Bacteria | 6086495 |
| 1034 | 2954770601 | 2954767861 | Bacteria | 5535784 |
| 1035 | Ga0307517_10115787 | |||
| 1036 | JGI24740J21852_10041842 | |||
| 1037 | JGI25156J39149_1000380 | |||
| 1038 | JGI25154J39366_1000915 | |||
| 1039 | JGI25157J39369_1000290 | |||
| 1040 | JGI25152J39213_1013435 | |||
| 1041 | JGI25150J39212_1001384 | |||
| 1042 | JGI25159J45721_1016485 | |||
| 1043 | JGI25151J46595_10013260 | |||
| 1044 | JGI25153J46596_10015977 | |||
| 1045 | rootH1_10000486 | |||
| 1046 | rootH2_10010441 | |||
| 1047 | rootL2_10001240 | |||
| 1048 | rootL2_10012906 | |||
| 1049 | rootL2_10027680 | |||
| 1050 | rootH1_10024176 | |||
| 1051 | JGI25161J50226_1002180 | |||
| 1052 | Ga0055539_1000222 | |||
| 1053 | Ga0055539_1001236 | |||
| 1054 | Ga0055533_1000016 | |||
| 1055 | Ga0055532_1007900 | |||
| 1056 | Ga0055525_1000031 | |||
| 1057 | Ga0055525_1001027 | |||
| 1058 | Ga0055535_1000546 | |||
| 1059 | Ga0055535_1000934 | |||
| 1060 | Ga0055542_1000051 | |||
| 1061 | Ga0055529_1000333 | |||
| 1062 | Ga0055526_1001991 | |||
| 1063 | Ga0055537_1000847 | |||
| 1064 | Ga0055537_1013336 | |||
| 1065 | Ga0055524_1000052 | |||
| 1066 | Ga0055524_1001208 | |||
| 1067 | Ga0055536_1001039 | |||
| 1068 | Ga0055534_1006014 | |||
| 1069 | Ga0055534_1011734 | |||
| 1070 | Ga0055528_1028315 | |||
| 1071 | Ga0055528_1028978 | |||
| 1072 | Ga0055530_10000774 | |||
| 1073 | Ga0055530_10002673 | |||
| 1074 | Ga0055540_1000019 | |||
| 1075 | Ga0055540_1003484 | |||
| 1076 | Ga0055540_1004637 | |||
| 1077 | Ga0055540_1008483 | |||
| 1078 | Ga0055540_1014026 | |||
| 1079 | Ga0055531_10000001 | |||
| 1080 | Ga0055531_10003590 | |||
| 1081 | Ga0055543_1001268 | |||
| 1082 | Ga0055543_1014652 | |||
| 1083 | Ga0065165_1000080 | |||
| 1084 | Ga0065165_1000101 | |||
| 1085 | Ga0065165_1004873 | |||
| 1086 | Ga0065704_10101350 | |||
| 1087 | Ga0065707_10085820 | |||
| 1088 | Ga0070658_10191316 | |||
| 1089 | Ga0070676_10003063 | |||
| 1090 | Ga0070676_10011288 | |||
| 1091 | Ga0070676_10076365 | |||
| 1092 | Ga0070676_10216878 | |||
| 1093 | Ga0070683_100058877 | |||
| 1094 | Ga0070683_100098711 | |||
| 1095 | Ga0070670_100015187 | |||
| 1096 | Ga0070670_100034680 | |||
| 1097 | Ga0070670_100034757 | |||
| 1098 | Ga0070670_100039540 | |||
| 1099 | Ga0070670_100072428 | |||
| 1100 | Ga0070677_10044568 | |||
| 1101 | Ga0070677_10068212 | |||
| 1102 | Ga0068869_100004719 | |||
| 1103 | Ga0068869_100008964 | |||
| 1104 | Ga0068869_100039750 | |||
| 1105 | Ga0068869_100049512 | |||
| 1106 | Ga0070666_10006633 | |||
| 1107 | Ga0070666_10091903 | |||
| 1108 | Ga0070666_10212196 | |||
| 1109 | Ga0068868_100004253 | |||
| 1110 | Ga0068868_100023907 | |||
| 1111 | Ga0068868_100034210 | |||
| 1112 | Ga0068868_100042672 | |||
| 1113 | Ga0068868_100286998 | |||
| 1114 | Ga0070660_100035703 | |||
| 1115 | Ga0070689_100017233 | |||
| 1116 | Ga0070687_100039015 | |||
| 1117 | Ga0070661_100001817 | |||
| 1118 | Ga0070661_100058647 | |||
| 1119 | Ga0070661_100274770 | |||
| 1120 | Ga0070661_100285772 | |||
| 1121 | Ga0070669_100023109 | |||
| 1122 | Ga0070669_100038738 | |||
| 1123 | Ga0070669_100131496 | |||
| 1124 | Ga0070675_100002826 | |||
| 1125 | Ga0070675_100030113 | |||
| 1126 | Ga0070675_100040918 | |||
| 1127 | Ga0070675_100045557 | |||
| 1128 | Ga0070675_100057952 | |||
| 1129 | Ga0070675_100085309 | |||
| 1130 | Ga0070675_100241704 | |||
| 1131 | Ga0070671_100003012 | |||
| 1132 | Ga0070671_100025005 | |||
| 1133 | Ga0070671_100047724 | |||
| 1134 | Ga0070671_100054104 | |||
| 1135 | Ga0070671_100069858 | |||
| 1136 | Ga0070671_100082020 | |||
| 1137 | Ga0070671_100121894 | |||
| 1138 | Ga0070671_100219877 | |||
| 1139 | Ga0070674_100030949 | |||
| 1140 | Ga0070674_100032975 | |||
| 1141 | Ga0070674_100036248 | |||
| 1142 | Ga0070673_100007588 | |||
| 1143 | Ga0070673_100036683 | |||
| 1144 | Ga0070673_100044973 | |||
| 1145 | Ga0070673_100068030 | |||
| 1146 | Ga0070673_100103568 | |||
| 1147 | Ga0070673_100138713 | |||
| 1148 | Ga0070673_100234969 | |||
| 1149 | Ga0070688_100064028 | |||
| 1150 | Ga0070688_100195163 | |||
| 1151 | Ga0070659_100000579 | |||
| 1152 | Ga0070659_100008674 | |||
| 1153 | Ga0070659_100013962 | |||
| 1154 | Ga0070659_100157803 | |||
| 1155 | Ga0070659_100174294 | |||
| 1156 | Ga0070667_100013082 | |||
| 1157 | Ga0070667_100023040 | |||
| 1158 | Ga0070667_100095226 | |||
| 1159 | Ga0070667_100109279 | |||
| 1160 | Ga0070667_100144436 | |||
| 1161 | Ga0070701_10015321 | |||
| 1162 | Ga0070700_100091315 | |||
| 1163 | Ga0070708_100125922 | |||
| 1164 | Ga0070663_100025098 | |||
| 1165 | Ga0070678_100004941 | |||
| 1166 | Ga0070678_100055164 | |||
| 1167 | Ga0070678_100078809 | |||
| 1168 | Ga0070678_100096289 | |||
| 1169 | Ga0070678_100169634 | |||
| 1170 | Ga0070662_100013426 | |||
| 1171 | Ga0070662_100034456 | |||
| 1172 | Ga0070662_100079499 | |||
| 1173 | Ga0070662_100089545 | |||
| 1174 | Ga0070662_100089693 | |||
| 1175 | Ga0070662_100332517 | |||
| 1176 | Ga0068867_100004120 | |||
| 1177 | Ga0068867_100014291 | |||
| 1178 | Ga0068867_100019883 | |||
| 1179 | Ga0068867_100036670 | |||
| 1180 | Ga0068867_100095169 | |||
| 1181 | Ga0070685_10069079 | |||
| 1182 | Ga0070685_10070274 | |||
| 1183 | Ga0070706_100004451 | |||
| 1184 | Ga0070707_100030017 | |||
| 1185 | Ga0070679_100058210 | |||
| 1186 | Ga0068853_100022515 | |||
| 1187 | Ga0068853_100027195 | |||
| 1188 | Ga0068853_100103909 | |||
| 1189 | Ga0068853_100297298 | |||
| 1190 | Ga0070672_100000539 | |||
| 1191 | Ga0070672_100002829 | |||
| 1192 | Ga0070672_100013763 | |||
| 1193 | Ga0070672_100014204 | |||
| 1194 | Ga0070672_100014890 | |||
| 1195 | Ga0070672_100067627 | |||
| 1196 | Ga0070695_100083628 | |||
| 1197 | Ga0070693_100050798 | |||
| 1198 | Ga0068855_100020802 | |||
| 1199 | Ga0068855_100227926 | |||
| 1200 | Ga0070664_100003888 | |||
| 1201 | Ga0070664_100052052 | |||
| 1202 | Ga0070664_100103488 | |||
| 1203 | Ga0068857_100009913 | |||
| 1204 | Ga0068857_100010130 | |||
| 1205 | Ga0068857_100054535 | |||
| 1206 | Ga0068857_100155452 | |||
| 1207 | Ga0068854_100007402 | |||
| 1208 | Ga0068854_100027971 | |||
| 1209 | Ga0068854_100029629 | |||
| 1210 | Ga0068854_100212437 | |||
| 1211 | Ga0068854_100390870 | |||
| 1212 | Ga0068856_100003701 | |||
| 1213 | Ga0068856_100006672 | |||
| 1214 | Ga0068856_100277956 | |||
| 1215 | Ga0070702_100020783 | |||
| 1216 | Ga0068852_100026590 | |||
| 1217 | Ga0068852_100055928 | |||
| 1218 | Ga0068852_100085967 | |||
| 1219 | Ga0068852_100170013 | |||
| 1220 | Ga0068852_100530206 | |||
| 1221 | Ga0068859_100016999 | |||
| 1222 | Ga0068859_100456499 | |||
| 1223 | Ga0068859_100657771 | |||
| 1224 | Ga0068864_100004486 | |||
| 1225 | Ga0068864_100005423 | |||
| 1226 | Ga0068864_100005655 | |||
| 1227 | Ga0068866_10020191 | |||
| 1228 | Ga0068866_10049310 | |||
| 1229 | Ga0068861_100003800 | |||
| 1230 | Ga0068861_100012185 | |||
| 1231 | Ga0068861_100029406 | |||
| 1232 | Ga0068861_100048410 | |||
| 1233 | Ga0068861_100186709 | |||
| 1234 | Ga0068861_100384732 | |||
| 1235 | Ga0068851_10024607 | |||
| 1236 | Ga0068851_10033506 | |||
| 1237 | Ga0068851_10043285 | |||
| 1238 | Ga0068851_10047676 | |||
| 1239 | Ga0068870_10113740 | |||
| 1240 | Ga0068870_10113987 | |||
| 1241 | Ga0068863_100018169 | |||
| 1242 | Ga0068863_100031313 | |||
| 1243 | Ga0068858_100000947 | |||
| 1244 | Ga0068858_100013934 | |||
| 1245 | Ga0068858_100017782 | |||
| 1246 | Ga0068860_100000590 | |||
| 1247 | Ga0068860_100059239 | |||
| 1248 | Ga0068860_100062776 | |||
| 1249 | Ga0068862_100051041 | |||
| 1250 | Ga0075365_10001679 | |||
| 1251 | Ga0075363_100011463 | |||
| 1252 | Ga0075362_10015037 | |||
| 1253 | Ga0075362_10021544 | |||
| 1254 | Ga0075362_10028745 | |||
| 1255 | Ga0075362_10035990 | |||
| 1256 | Ga0075367_10004085 | |||
| 1257 | Ga0075367_10026150 | |||
| 1258 | Ga0075366_10003992 | |||
| 1259 | Ga0075366_10004014 | |||
| 1260 | Ga0075366_10005103 | |||
| 1261 | Ga0075366_10005573 | |||
| 1262 | Ga0075366_10013306 | |||
| 1263 | Ga0075366_10132149 | |||
| 1264 | Ga0075366_10133536 | |||
| 1265 | Ga0075366_10138842 | |||
| 1266 | Ga0097621_100032503 | |||
| 1267 | Ga0097621_100042765 | |||
| 1268 | Ga0097621_100102269 | |||
| 1269 | Ga0097621_100213414 | |||
| 1270 | Ga0075370_10009645 | |||
| 1271 | Ga0075370_10011106 | |||
| 1272 | Ga0075370_10014544 | |||
| 1273 | Ga0075370_10018864 | |||
| 1274 | Ga0075370_10026377 | |||
| 1275 | Ga0075370_10078789 | |||
| 1276 | Ga0075370_10081059 | |||
| 1277 | Ga0075430_100124636 | |||
| 1278 | Ga0075429_100000199 | |||
| 1279 | Ga0068865_100003764 | |||
| 1280 | Ga0068865_100221809 | |||
| 1281 | Ga0097620_100016998 | |||
| 1282 | Ga0097620_100134814 | |||
| 1283 | Ga0097620_100456497 | |||
| 1284 | Ga0097620_100657750 | |||
| 1285 | Ga0099823_1000108 | |||
| 1286 | Ga0079104_1000206 | |||
| 1287 | Ga0099826_10028336 | |||
| 1288 | Ga0105244_10005962 | |||
| 1289 | Ga0105240_10020056 | |||
| 1290 | Ga0105240_10187212 | |||
| 1291 | Ga0111539_10651212 | |||
| 1292 | Ga0105245_10056203 | |||
| 1293 | Ga0105245_10079449 | |||
| 1294 | Ga0105245_10372533 | |||
| 1295 | Ga0114129_10233635 | |||
| 1296 | Ga0105243_10017850 | |||
| 1297 | Ga0105243_10081131 | |||
| 1298 | Ga0105243_10082103 | |||
| 1299 | Ga0105242_10034430 | |||
| 1300 | Ga0105242_10041874 | |||
| 1301 | Ga0105242_10098902 | |||
| 1302 | Ga0105242_10191525 | |||
| 1303 | Ga0105242_10279628 | |||
| 1304 | Ga0105248_10000507 | |||
| 1305 | Ga0105248_10011351 | |||
| 1306 | Ga0105248_10165534 | |||
| 1307 | Ga0105248_10222679 | |||
| 1308 | Ga0105248_10241477 | |||
| 1309 | Ga0105248_10441834 | |||
| 1310 | Ga0105237_10000407 | |||
| 1311 | Ga0105237_10008587 | |||
| 1312 | Ga0105237_10121001 | |||
| 1313 | Ga0105237_10186286 | |||
| 1314 | Ga0105238_10007219 | |||
| 1315 | Ga0105238_10031941 | |||
| 1316 | Ga0105238_10034210 | |||
| 1317 | Ga0105238_10118970 | |||
| 1318 | Ga0105249_10019636 | |||
| 1319 | Ga0105249_10100427 | |||
| 1320 | Ga0105239_10000335 | |||
| 1321 | Ga0105239_10109818 | |||
| 1322 | Ga0105239_10288572 | |||
| 1323 | Ga0105246_10342205 | |||
| 1324 | Ga0157319_1000008 | |||
| 1325 | Ga0157373_10102499 | |||
| 1326 | Ga0157371_10064216 | |||
| 1327 | Ga0157370_10020513 | |||
| 1328 | Ga0157370_10062708 | |||
| 1329 | Ga0157369_10013318 | |||
| 1330 | Ga0157369_10028976 | |||
| 1331 | Ga0157369_10514526 | |||
| 1332 | Ga0157369_10527566 | |||
| 1333 | Ga0157374_10262529 | |||
| 1334 | Ga0157378_10007768 | |||
| 1335 | Ga0157378_10159676 | |||
| 1336 | Ga0157378_10230325 | |||
| 1337 | Ga0163162_10002118 | |||
| 1338 | Ga0163162_10007695 | |||
| 1339 | Ga0163162_10035098 | |||
| 1340 | Ga0163162_10045884 | |||
| 1341 | Ga0163162_10213321 | |||
| 1342 | Ga0163162_10401651 | |||
| 1343 | Ga0157372_10027045 | |||
| 1344 | Ga0157372_10088825 | |||
| 1345 | Ga0157375_10042105 | |||
| 1346 | Ga0157375_10067294 | |||
| 1347 | Ga0157375_10142267 | |||
| 1348 | Ga0157375_10224572 | |||
| 1349 | Ga0157375_10269509 | |||
| 1350 | Ga0157375_10270675 | |||
| 1351 | Ga0157375_10291569 | |||
| 1352 | Ga0163163_10017791 | |||
| 1353 | Ga0157380_10015082 | |||
| 1354 | Ga0157380_10015978 | |||
| 1355 | Ga0157380_10031940 | |||
| 1356 | Ga0157380_10191358 | |||
| 1357 | Ga0157380_10418226 | |||
| 1358 | Ga0182008_10001528 | |||
| 1359 | Ga0182008_10010178 | |||
| 1360 | Ga0182008_10011139 | |||
| 1361 | Ga0157377_10035813 | |||
| 1362 | Ga0157379_10006779 | |||
| 1363 | Ga0157379_10015200 | |||
| 1364 | Ga0157379_10015438 | |||
| 1365 | Ga0157379_10033209 | |||
| 1366 | Ga0157379_10062810 | |||
| 1367 | Ga0157379_10128357 | |||
| 1368 | Ga0157379_10290705 | |||
| 1369 | Ga0157376_10016718 | |||
| 1370 | Ga0157376_10043442 | |||
| 1371 | Ga0182006_1018146 | |||
| 1372 | Ga0163161_10043326 | |||
| 1373 | Ga0163161_10109278 | |||
| 1374 | Ga0213872_10000006 | |||
| 1375 | Ga0213872_10000007 | |||
| 1376 | Ga0213872_10000085 | |||
| 1377 | Ga0213872_10004397 | |||
| 1378 | Ga0213872_10059740 | |||
| 1379 | Ga0213872_10084726 | |||
| 1380 | Ga0213876_10101126 | |||
| 1381 | Ga0209436_108685 | |||
| 1382 | Ga0209674_100041 | |||
| 1383 | Ga0209672_100538 | |||
| 1384 | Ga0209147_102376 | |||
| 1385 | Ga0209563_100043 | |||
| 1386 | Ga0209563_100044 | |||
| 1387 | Ga0207427_101076 | |||
| 1388 | Ga0209258_100132 | |||
| 1389 | Ga0209258_100344 | |||
| 1390 | Ga0209258_100888 | |||
| 1391 | Ga0207425_1001109 | |||
| 1392 | Ga0209646_1000069 | |||
| 1393 | Ga0209026_1000006 | |||
| 1394 | Ga0209677_100096 | |||
| 1395 | Ga0209677_100412 | |||
| 1396 | Ga0209677_102293 | |||
| 1397 | Ga0209148_1000007 | |||
| 1398 | Ga0209759_1000075 | |||
| 1399 | Ga0209759_1002024 | |||
| 1400 | Ga0209759_1002433 | |||
| 1401 | Ga0209129_1000084 | |||
| 1402 | Ga0209129_1008605 | |||
| 1403 | Ga0209565_1000169 | |||
| 1404 | Ga0209565_1000364 | |||
| 1405 | Ga0209565_1000456 | |||
| 1406 | Ga0209565_1009061 | |||
| 1407 | Ga0209455_1000242 | |||
| 1408 | Ga0209673_1000114 | |||
| 1409 | Ga0209673_1000916 | |||
| 1410 | Ga0209673_1001117 | |||
| 1411 | Ga0209673_1004916 | |||
| 1412 | Ga0209673_1007520 | |||
| 1413 | Ga0209673_1038210 | |||
| 1414 | Ga0209130_1000571 | |||
| 1415 | Ga0209130_1000621 | |||
| 1416 | Ga0209675_1000062 | |||
| 1417 | Ga0209675_1000631 | |||
| 1418 | Ga0209675_1003259 | |||
| 1419 | Ga0209675_1007298 | |||
| 1420 | Ga0209675_1012858 | |||
| 1421 | Ga0209676_1000817 | |||
| 1422 | Ga0209676_1000999 | |||
| 1423 | Ga0209676_1001040 | |||
| 1424 | Ga0209025_1000678 | |||
| 1425 | Ga0209025_1000719 | |||
| 1426 | Ga0209025_1000861 | |||
| 1427 | Ga0209025_1026289 | |||
| 1428 | Ga0209564_1000008 | |||
| 1429 | Ga0209564_1001058 | |||
| 1430 | Ga0209564_1001096 | |||
| 1431 | Ga0209758_1000754 | |||
| 1432 | Ga0209050_1000052 | |||
| 1433 | Ga0209050_1000137 | |||
| 1434 | Ga0209050_1001274 | |||
| 1435 | Ga0209050_1007733 | |||
| 1436 | Ga0209050_1009235 | |||
| 1437 | Ga0209050_1011538 | |||
| 1438 | Ga0209256_1000036 | |||
| 1439 | Ga0209256_1000206 | |||
| 1440 | Ga0209256_1000239 | |||
| 1441 | Ga0209256_1000413 | |||
| 1442 | Ga0207426_1000049 | |||
| 1443 | Ga0207426_1000086 | |||
| 1444 | Ga0207426_1000346 | |||
| 1445 | Ga0209051_1000015 | |||
| 1446 | Ga0209051_1000071 | |||
| 1447 | Ga0209051_1000420 | |||
| 1448 | Ga0209051_1000492 | |||
| 1449 | Ga0209051_1000824 | |||
| 1450 | Ga0209051_1001503 | |||
| 1451 | Ga0209051_1002377 | |||
| 1452 | Ga0209051_1004772 | |||
| 1453 | Ga0209257_1000033 | |||
| 1454 | Ga0209257_1000037 | |||
| 1455 | Ga0209257_1000367 | |||
| 1456 | Ga0209257_1002153 | |||
| 1457 | Ga0209257_1003430 | |||
| 1458 | Ga0209257_1004820 | |||
| 1459 | Ga0209257_1013244 | |||
| 1460 | Ga0207656_10045616 | |||
| 1461 | Ga0207655_1000477 | |||
| 1462 | Ga0207682_10006336 | |||
| 1463 | Ga0207682_10008206 | |||
| 1464 | Ga0207682_10025550 | |||
| 1465 | Ga0207682_10053371 | |||
| 1466 | Ga0207642_10052636 | |||
| 1467 | Ga0207642_10186575 | |||
| 1468 | Ga0207688_10024613 | |||
| 1469 | Ga0207688_10075128 | |||
| 1470 | Ga0207688_10092008 | |||
| 1471 | Ga0207680_10028834 | |||
| 1472 | Ga0207680_10069254 | |||
| 1473 | Ga0207645_10004942 | |||
| 1474 | Ga0207645_10015296 | |||
| 1475 | Ga0207645_10024769 | |||
| 1476 | Ga0207645_10221801 | |||
| 1477 | Ga0207643_10068116 | |||
| 1478 | Ga0207705_10133515 | |||
| 1479 | Ga0207705_10259469 | |||
| 1480 | Ga0207654_10108767 | |||
| 1481 | Ga0207707_10075456 | |||
| 1482 | Ga0207695_10007155 | |||
| 1483 | Ga0207695_10027612 | |||
| 1484 | Ga0207695_10038534 | |||
| 1485 | Ga0207695_10145947 | |||
| 1486 | Ga0207671_10001396 | |||
| 1487 | Ga0207671_10138714 | |||
| 1488 | Ga0207662_10023983 | |||
| 1489 | Ga0207662_10067829 | |||
| 1490 | Ga0207657_10012206 | |||
| 1491 | Ga0207657_10018610 | |||
| 1492 | Ga0207657_10054802 | |||
| 1493 | Ga0207657_10133950 | |||
| 1494 | Ga0207657_10157857 | |||
| 1495 | Ga0207657_10210194 | |||
| 1496 | Ga0207649_10001310 | |||
| 1497 | Ga0207649_10002844 | |||
| 1498 | Ga0207652_10146300 | |||
| 1499 | Ga0207646_10044519 | |||
| 1500 | Ga0207681_10022145 | |||
| 1501 | Ga0207681_10025887 | |||
| 1502 | Ga0207694_10016952 | |||
| 1503 | Ga0207694_10114665 | |||
| 1504 | Ga0207694_10119093 | |||
| 1505 | Ga0207650_10001668 | |||
| 1506 | Ga0207650_10044550 | |||
| 1507 | Ga0207650_10097792 | |||
| 1508 | Ga0207650_10101461 | |||
| 1509 | Ga0207650_10104542 | |||
| 1510 | Ga0207650_10136217 | |||
| 1511 | Ga0207659_10010662 | |||
| 1512 | Ga0207659_10041398 | |||
| 1513 | Ga0207659_10074502 | |||
| 1514 | Ga0207659_10079670 | |||
| 1515 | Ga0207659_10105241 | |||
| 1516 | Ga0207659_10125147 | |||
| 1517 | Ga0207687_10015473 | |||
| 1518 | Ga0207687_10075138 | |||
| 1519 | Ga0207687_10080592 | |||
| 1520 | Ga0207687_10093522 | |||
| 1521 | Ga0207687_10358040 | |||
| 1522 | Ga0207644_10001504 | |||
| 1523 | Ga0207644_10019986 | |||
| 1524 | Ga0207644_10022834 | |||
| 1525 | Ga0207644_10038881 | |||
| 1526 | Ga0207644_10053967 | |||
| 1527 | Ga0207644_10111137 | |||
| 1528 | Ga0207644_10264405 | |||
| 1529 | Ga0207690_10000935 | |||
| 1530 | Ga0207690_10058270 | |||
| 1531 | Ga0207690_10201856 | |||
| 1532 | Ga0207690_10208687 | |||
| 1533 | Ga0207706_10001677 | |||
| 1534 | Ga0207706_10015194 | |||
| 1535 | Ga0207706_10023606 | |||
| 1536 | Ga0207706_10024928 | |||
| 1537 | Ga0207706_10074501 | |||
| 1538 | Ga0207706_10096025 | |||
| 1539 | Ga0207706_10250986 | |||
| 1540 | Ga0207686_10063273 | |||
| 1541 | Ga0207686_10101993 | |||
| 1542 | Ga0207686_10175382 | |||
| 1543 | Ga0207709_10003126 | |||
| 1544 | Ga0207709_10026566 | |||
| 1545 | Ga0207709_10041375 | |||
| 1546 | Ga0207669_10019249 | |||
| 1547 | Ga0207669_10088509 | |||
| 1548 | Ga0207669_10223557 | |||
| 1549 | Ga0207704_10001522 | |||
| 1550 | Ga0207704_10063144 | |||
| 1551 | Ga0207665_10147025 | |||
| 1552 | Ga0207691_10002799 | |||
| 1553 | Ga0207691_10013171 | |||
| 1554 | Ga0207691_10013705 | |||
| 1555 | Ga0207691_10017465 | |||
| 1556 | Ga0207691_10023638 | |||
| 1557 | Ga0207691_10063825 | |||
| 1558 | Ga0207691_10076093 | |||
| 1559 | Ga0207691_10079947 | |||
| 1560 | Ga0207691_10143614 | |||
| 1561 | Ga0207691_10200916 | |||
| 1562 | Ga0207711_10010766 | |||
| 1563 | Ga0207711_10060531 | |||
| 1564 | Ga0207711_10088812 | |||
| 1565 | Ga0207711_10105438 | |||
| 1566 | Ga0207689_10002606 | |||
| 1567 | Ga0207689_10031970 | |||
| 1568 | Ga0207661_10123149 | |||
| 1569 | Ga0207661_10173487 | |||
| 1570 | Ga0207679_10000730 | |||
| 1571 | Ga0207679_10062285 | |||
| 1572 | Ga0207667_10001651 | |||
| 1573 | Ga0207667_10049107 | |||
| 1574 | Ga0207667_10129158 | |||
| 1575 | Ga0207651_10001009 | |||
| 1576 | Ga0207651_10069470 | |||
| 1577 | Ga0207651_10110736 | |||
| 1578 | Ga0207651_10239377 | |||
| 1579 | Ga0207712_10017241 | |||
| 1580 | Ga0207712_10075415 | |||
| 1581 | Ga0207640_10190473 | |||
| 1582 | Ga0207640_10283987 | |||
| 1583 | Ga0207658_10153500 | |||
| 1584 | Ga0207677_10002324 | |||
| 1585 | Ga0207677_10003785 | |||
| 1586 | Ga0207677_10047610 | |||
| 1587 | Ga0207677_10226804 | |||
| 1588 | Ga0207703_10003131 | |||
| 1589 | Ga0207703_10021976 | |||
| 1590 | Ga0207703_10024701 | |||
| 1591 | Ga0207703_10092993 | |||
| 1592 | Ga0207639_10004276 | |||
| 1593 | Ga0207678_10024830 | |||
| 1594 | Ga0207678_10062383 | |||
| 1595 | Ga0207702_10000305 | |||
| 1596 | Ga0207702_10027017 | |||
| 1597 | Ga0207702_10091496 | |||
| 1598 | Ga0207702_10231198 | |||
| 1599 | Ga0207641_10081706 | |||
| 1600 | Ga0207641_10112043 | |||
| 1601 | Ga0207648_10005380 | |||
| 1602 | Ga0207648_10015510 | |||
| 1603 | Ga0207648_10048878 | |||
| 1604 | Ga0207648_10128026 | |||
| 1605 | Ga0207648_10160550 | |||
| 1606 | Ga0207648_10175499 | |||
| 1607 | Ga0207648_10448174 | |||
| 1608 | Ga0207676_10001457 | |||
| 1609 | Ga0207676_10014960 | |||
| 1610 | Ga0207676_10043123 | |||
| 1611 | Ga0207674_10021674 | |||
| 1612 | Ga0207674_10040752 | |||
| 1613 | Ga0207674_10097874 | |||
| 1614 | Ga0207674_10218345 | |||
| 1615 | Ga0207674_10315926 | |||
| 1616 | Ga0207674_10360743 | |||
| 1617 | Ga0207675_100002976 | |||
| 1618 | Ga0207675_100005040 | |||
| 1619 | Ga0207675_100074722 | |||
| 1620 | Ga0207675_100080010 | |||
| 1621 | Ga0207675_100360220 | |||
| 1622 | Ga0207683_10030578 | |||
| 1623 | Ga0207683_10063818 | |||
| 1624 | Ga0207683_10090581 | |||
| 1625 | Ga0207683_10131412 | |||
| 1626 | Ga0207683_10134438 | |||
| 1627 | Ga0207698_10059078 | |||
| 1628 | Ga0207698_10085339 | |||
| 1629 | Ga0207698_10392828 | |||
| 1630 | Ga0207698_10416644 | |||
| 1631 | Ga0207698_10434480 | |||
| 1632 | Ga0209281_1000259 | |||
| 1633 | Ga0209389_1001550 | |||
| 1634 | Ga0209371_1012540 | |||
| 1635 | Ga0209282_1001433 | |||
| 1636 | Ga0209813_10027106 | |||
| 1637 | Ga0209813_10064218 | |||
| 1638 | Ga0268266_10029102 | |||
| 1639 | Ga0268266_10138127 | |||
| 1640 | Ga0268265_10035450 | |||
| 1641 | Ga0268265_10080194 | |||
| 1642 | Ga0268265_10402325 | |||
| 1643 | Ga0268264_10000991 | |||
| 1644 | Ga0268264_10017985 | |||
| 1645 | Ga0268264_10038937 | |||
| 1646 | Ga0268264_10040703 | |||
| 1647 | Ga0268264_10623235 | |||
| 1648 | Ga0265334_10006510 | |||
| 1649 | Ga0265336_10000013 | |||
| 1650 | Ga0307517_10000131 | |||
| 1651 | Ga0307515_10000011 | |||
| 1652 | Ga0307515_10002251 | |||
| 1653 | Ga0307515_10003079 | |||
| 1654 | Ga0307515_10003449 | |||
| 1655 | Ga0307515_10009653 | |||
| 1656 | Ga0307515_10009817 | |||
| 1657 | Ga0307515_10020437 | |||
| 1658 | Ga0307515_10056041 | |||
| 1659 | Ga0307515_10091473 | |||
| 1660 | Ga0307515_10169786 | |||
| 1661 | Ga0307515_10201434 | |||
| 1662 | Ga0265324_10001846 | |||
| 1663 | Ga0268256_1026534 | |||
| 1664 | Ga0307511_10055559 | |||
| 1665 | Ga0307512_10078314 | |||
| 1666 | Ga0316176_1040348 | |||
| 1667 | Ga0314311_1170456 | |||
| 1668 | Ga0316179_1078834 | |||
| 1669 | Ga0316183_1136313 | |||
| 1670 | Ga0265329_10008613 | |||
| 1671 | Ga0265331_10009176 | |||
| 1672 | Ga0265327_10000012 | |||
| 1673 | Ga0265327_10000056 | |||
| 1674 | Ga0265327_10001807 | |||
| 1675 | Ga0265316_10002321 | |||
| 1676 | Ga0307513_10003077 | |||
| 1677 | Ga0307513_10019900 | |||
| 1678 | Ga0307513_10043735 | |||
| 1679 | Ga0307513_10059994 | |||
| 1680 | Ga0307513_10361519 | |||
| 1681 | Ga0307509_10000871 | |||
| 1682 | Ga0307509_10009460 | |||
| 1683 | Ga0307509_10022255 | |||
| 1684 | Ga0307509_10028400 | |||
| 1685 | Ga0307509_10195687 | |||
| 1686 | Ga0307509_10203426 | |||
| 1687 | Ga0307509_10215244 | |||
| 1688 | Ga0307509_10252867 | |||
| 1689 | Ga0307408_100000037 | |||
| 1690 | Ga0307408_100158050 | |||
| 1691 | Ga0307408_100164324 | |||
| 1692 | Ga0307408_100193482 | |||
| 1693 | Ga0307508_10000123 | |||
| 1694 | Ga0307508_10000349 | |||
| 1695 | Ga0307508_10002230 | |||
| 1696 | Ga0307508_10272356 | |||
| 1697 | Ga0307514_10000355 | |||
| 1698 | Ga0307514_10010918 | |||
| 1699 | Ga0307514_10020837 | |||
| 1700 | Ga0265314_10047625 | |||
| 1701 | Ga0265342_10114117 | |||
| 1702 | Ga0307516_10000303 | |||
| 1703 | Ga0307516_10008217 | |||
| 1704 | Ga0307516_10050751 | |||
| 1705 | Ga0307516_10175736 | |||
| 1706 | Ga0307405_10012268 | |||
| 1707 | Ga0307405_10021412 | |||
| 1708 | Ga0307405_10102759 | |||
| 1709 | Ga0307405_10411825 | |||
| 1710 | Ga0307413_10382363 | |||
| 1711 | Ga0307406_10005195 | |||
| 1712 | Ga0307406_10054939 | |||
| 1713 | Ga0307406_10068104 | |||
| 1714 | Ga0307406_10163773 | |||
| 1715 | Ga0307412_10031153 | |||
| 1716 | Ga0307412_10063769 | |||
| 1717 | Ga0307412_10115767 | |||
| 1718 | Ga0307412_10134175 | |||
| 1719 | Ga0307409_100000926 | |||
| 1720 | Ga0307409_100086215 | |||
| 1721 | Ga0307409_100239027 | |||
| 1722 | Ga0307416_100003028 | |||
| 1723 | Ga0307416_100005442 | |||
| 1724 | Ga0307416_100032643 | |||
| 1725 | Ga0307416_100083294 | |||
| 1726 | Ga0307416_100096192 | |||
| 1727 | Ga0307414_10003263 | |||
| 1728 | Ga0307414_10132690 | |||
| 1729 | Ga0307414_10177876 | |||
| 1730 | Ga0307414_10264358 | |||
| 1731 | Ga0307411_10005122 | |||
| 1732 | Ga0307411_10026791 | |||
| 1733 | Ga0307411_10026968 | |||
| 1734 | Ga0307411_10316605 | |||
| 1735 | Ga0307415_100014487 | |||
| 1736 | Ga0307415_100022072 | |||
| 1737 | Ga0307507_10099711 | |||
| 1738 | Ga0307510_10024879 | |||
| 1739 | Ga0307510_10058456 | |||
| 1740 | Ga0307510_10068523 | |||
| 1741 | Ga0373948_0011730 | |||
| 1742 | Ga0373950_0006113 | |||
| 1743 | Ga0373940_0023282 | |||
| 1744 | Ga0373932_0010384 | |||
| 1745 | Ga0373932_0048541 | |||
| 1746 | Ga0373955_0131767 | |||
| 1747 | Ga0373924_0132353 | |||
| 1748 | Ga0373931_0000480 | |||
| 1749 | Ga0373931_0002140 | |||
| 1750 | Ga0373931_0008075 | |||
| 1751 | Ga0373931_0047189 | |||
| 1752 | Ga0373931_0189316 | |||
| 1753 | Ga0373935_0162930 | |||
| 1754 | Ga0373947_0079558 | |||
| 1755 | Ga0373937_0083884 | |||
| 1756 | Ga0373937_0121014 | |||
| 1757 | Ga0373925_0004190 | |||
| 1758 | Ga0373925_0043282 | |||
| 1759 | Ga0395899_0001142 | |||
| 1760 | Ga0395898_0000283 | |||
| 1761 | Ga0395898_0017273 | |||
| 1762 | Ga0395898_0028719 | |||
| 1763 | Ga0395898_0510687 | |||
| 1764 | Ga0395905_0000117 | |||
| 1765 | Ga0395905_0000474 | |||
| 1766 | Ga0395905_0002201 | |||
| 1767 | Ga0395905_0005150 | |||
| 1768 | Ga0395905_0090405 | |||
| 1769 | Ga0395905_0362289 | |||
| 1770 | Ga0395901_0011124 | |||
| 1771 | Ga0436365_1372925 | |||
| 1772 | Ga0436361_0019641 | |||
| 1773 | Ga0436361_0080882 | |||
| 1774 | Ga0436361_0163583 | |||
| 1775 | Ga0436361_0328630 | |||
| 1776 | Ga0436361_0360217 | |||
| 1777 | Ga0436361_0484071 | |||
| 1778 | Ga0436361_0869713 | |||
| 1779 | Ga0451853_2460991 | |||
| 1780 | Ga0439431_0005707 | |||
| 1781 | Ga0439437_000193 | |||
| 1782 | Ga0439449_0001342 | |||
| 1783 | Ga0450917_000061 | |||
| 1784 | Ga0450919_000622 | |||
| 1785 | Ga0450923_003185 | |||
| 1786 | Ga0450923_014087 | |||
| 1787 | Ga0450890_001292 | |||
| 1788 | Ga0450890_001944 | |||
| 1789 | Ga0450892_000146 | |||
| 1790 | Ga0450898_009583 | |||
| 1791 | Ga0450889_000033 | |||
| 1792 | Ga0450906_013652 | |||
| 1793 | Ga0439434_0000557 | |||
| 1794 | Ga0439434_0054390 | |||
| 1795 | Ga0439464_0008881 | |||
| 1796 | Ga0439460_0010055 | |||
| 1797 | Ga0450918_000307 | |||
| 1798 | Ga0450918_000609 | |||
| 1799 | Ga0451577_0001078 | |||
| 1800 | Ga0451577_0036086 | |||
| 1801 | Ga0451577_0069045 | |||
| 1802 | Ga0466969_0000013 | |||
| 1803 | Ga0466969_0005945 | |||
| 1804 | Ga0466969_0056440 | |||
| 1805 | Ga0466969_0062657 | |||
| 1806 | Ga0466972_0012974 | |||
| 1807 | Ga0466965_0001440 | |||
| 1808 | Ga0466965_0047910 | |||
| 1809 | Ga0466966_0009951 | |||
| 1810 | Ga0466966_0021167 | |||
| 1811 | Ga0466966_0066520 | |||
| 1812 | Ga0466961_0013192 | |||
| 1813 | Ga0466961_0017265 | |||
| 1814 | Ga0466961_0045198 | |||
| 1815 | Ga0466961_0051807 | |||
| 1816 | Ga0466961_0191015 | |||
| 1817 | Ga0466963_0018170 | |||
| 1818 | Ga0466964_0002927 | |||
| 1819 | Ga0453684_0020777 | |||
| 1820 | Ga0453684_0212062 | |||
| 1821 | Ga0453684_0253101 | |||
| 1822 | Ga0453684_0299700 | |||
| 1823 | Ga0466971_0012889 | |||
| 1824 | Ga0466971_0044275 | |||
| 1825 | Ga0466971_0045502 | |||
| 1826 | Ga0466960_0077866 | |||
| 1827 | Ga0466959_0013538 | |||
| 1828 | Ga0466959_0079990 | |||
| 1829 | Ga0466959_0320452 | |||
| 1830 | Ga0451576_0015485 | |||
| 1831 | Ga0451576_0056008 | |||
| 1832 | Ga0451576_0073488 | |||
| 1833 | Ga0451576_0183228 | |||
| 1834 | Ga0466958_0046375 | |||
| 1835 | Ga0466967_0013196 | |||
| 1836 | Ga0495592_0004276 | |||
| 1837 | Ga0495590_0029475 | |||
| 1838 | Ga0495629_0036078 | |||
| 1839 | Ga0495638_0108498 | |||
| 1840 | Ga0495638_0202346 | |||
| 1841 | Ga0495650_0006312 | |||
| 1842 | Ga0495650_0020411 | |||
| 1843 | Ga0495605_0039118 | |||
| 1844 | Ga0495585_0059305 | |||
| 1845 | Ga0495583_0000081 | |||
| 1846 | Ga0495583_0045661 | |||
| 1847 | Ga0495606_0001086 | |||
| 1848 | Ga0495610_0042868 | |||
| 1849 | Ga0495616_0000726 | |||
| 1850 | Ga0495630_0098717 | |||
| 1851 | Ga0495631_0070588 | |||
| 1852 | Ga0495632_0017229 | |||
| 1853 | Ga0495637_0077224 | |||
| 1854 | Ga0495652_0335607 | |||
| 1855 | Ga0495586_0038746 | |||
| 1856 | Ga0495621_0004221 | |||
| 1857 | Ga0495621_0021148 | |||
| 1858 | Ga0495597_0007632 | |||
| 1859 | Ga0495645_0324077 | |||
| 1860 | Ga0495622_0081799 | |||
| 1861 | Ga0495668_0059994 | |||
| 1862 | Ga0495668_0068365 | |||
| 1863 | Ga0495625_0001179 | |||
| 1864 | Ga0495625_0004883 | |||
| 1865 | Ga0495625_0006045 | |||
| 1866 | Ga0495625_0068980 | |||
| 1867 | Ga0495625_0120654 | |||
| 1868 | Ga0495588_0054017 | |||
| 1869 | Ga0495647_0090336 | |||
| 1870 | Ga0495658_0047252 | |||
| 1871 | Ga0495658_0058506 | |||
| 1872 | Ga0495658_0074436 | |||
| 1873 | Ga0495669_0037133 | |||
| 1874 | Ga0495669_0059037 | |||
| 1875 | Ga0495613_0323642 | |||
| 1876 | Ga0495671_0018499 | |||
| 1877 | Ga0495649_0000287 | |||
| 1878 | Ga0495649_0009613 | |||
| 1879 | Ga0495589_0002102 | |||
| 1880 | Ga0495660_0043906 | |||
| 1881 | Ga0495676_0007401 | |||
| 1882 | Ga0495676_0038732 | |||
| 1883 | Ga0495687_000582 | |||
| 1884 | Ga0495687_003343 | |||
| 1885 | Ga0495681_0024990 | |||
| 1886 | Ga0495684_0108284 | |||
| 1887 | Ga0495686_0062267 | |||
| 1888 | Ga0495593_0002204 | |||
| 1889 | Ga0495593_0025973 | |||
| 1890 | Ga0495602_0220129 | |||
| 1891 | Ga0495614_0154627 | |||
| 1892 | Ga0496100_0034311 | |||
| 1893 | Ga0496102_0052953 | |||
| 1894 | Ga0496103_0102424 | |||
| 1895 | Ga0496104_0067251 | |||
| 1896 | Ga0496104_0214146 | |||
| 1897 | Ga0496104_0226033 | |||
| 1898 | Ga0496105_0046450 | |||
| 1899 | Ga0496105_0062626 | |||
| 1900 | Ga0496105_0159229 | |||
| 1901 | Ga0496105_0210749 | |||
| 1902 | Ga0496106_0004527 | |||
| 1903 | Ga0496107_0006316 | |||
| 1904 | Ga0496108_0137119 | |||
| 1905 | Ga0496108_0228730 | |||
| 1906 | Ga0496108_0252487 | |||
| 1907 | Ga0496109_0010731 | |||
| 1908 | Ga0496109_0075411 | |||
| 1909 | Ga0496109_0123433 | |||
| 1910 | Ga0496109_0176816 | |||
| 1911 | Ga0496109_0256161 | |||
| 1912 | Ga0496109_0455003 | |||
| 1913 | Ga0496110_0007885 | |||
| 1914 | Ga0496110_0041580 | |||
| 1915 | Ga0496111_0334603 | |||
| 1916 | Ga0496112_0011308 | |||
| 1917 | Ga0496114_0038217 | |||
| 1918 | Ga0496114_0051763 | |||
| 1919 | Ga0496115_0018225 | |||
| 1920 | Ga0496116_0095988 | |||
| 1921 | Ga0496117_0045596 | |||
| 1922 | Ga0496118_0006245 | |||
| 1923 | Ga0496118_0017827 | |||
| 1924 | Ga0496121_0023572 | |||
| 1925 | Ga0496121_0143192 | |||
| 1926 | Ga0496124_0001458 | |||
| 1927 | Ga0496125_0005030 | |||
| 1928 | Ga0496125_0124973 | |||
| 1929 | Ga0496126_0199588 | |||
| 1930 | Ga0496126_0229401 | |||
| 1931 | Ga0495682_0049139 | |||
| 1932 | Ga0501297_011568 | |||
| 1933 | Ga0501298_010416 | |||
| 1934 | Ga0501300_001415 | |||
| 1935 | Ga0501034_0077062 | |||
| 1936 | Ga0501034_0118662 | |||
| 1937 | Ga0501047_0019851 | |||
| 1938 | Ga0501198_000001 | |||
| 1939 | Ga0501202_005882 | |||
| 1940 | Ga0501206_001533 | |||
| 1941 | Ga0501207_012428 | |||
| 1942 | Ga0501211_000219 | |||
| 1943 | Ga0501222_000004 | |||
| 1944 | Ga0501222_000467 | |||
| 1945 | Ga0501249_003842 | |||
| 1946 | Ga0501253_005537 | |||
| 1947 | Ga0501257_039065 | |||
| 1948 | Ga0501258_000186 | |||
| 1949 | Ga0501261_002913 | |||
| 1950 | Ga0501221_002045 | |||
| 1951 | Ga0501225_0004943 | |||
| 1952 | Ga0501225_0016453 | |||
| 1953 | Ga0501229_000371 | |||
| 1954 | Ga0501080_0060974 | |||
| 1955 | Ga0501262_001380 | |||
| 1956 | Ga0501265_003561 | |||
| 1957 | Ga0501271_002697 | |||
| 1958 | Ga0501272_000700 | |||
| 1959 | Ga0501035_0033229 | |||
| 1960 | nmdc:mga03683_10973_c1 | |||
| 1961 | nmdc:mga03683_22760_c1 | |||
| 1962 | nmdc:mga03683_5023_c1 | |||
| 1963 | nmdc:mga03n38_16306_c1 | |||
| 1964 | nmdc:mga03n38_32716_c1 | |||
| 1965 | nmdc:mga03n38_36024_c1 | |||
| 1966 | nmdc:mga0k408_10183_c1 | |||
| 1967 | nmdc:mga0k408_137371_c1 | |||
| 1968 | nmdc:mga0k408_15567_c1 | |||
| 1969 | nmdc:mga0k408_189618_c1 | |||
| 1970 | nmdc:mga0k408_201803_c1 | |||
| 1971 | nmdc:mga0k408_22319_c1 | |||
| 1972 | nmdc:mga0k408_2564_c1 | |||
| 1973 | nmdc:mga0k408_33438_c1 | |||
| 1974 | nmdc:mga0k408_4053_c1 | |||
| 1975 | nmdc:mga0k408_4958_c1 | |||
| 1976 | nmdc:mga0k408_63664_c1 | |||
| 1977 | nmdc:mga0k408_66089_c1 | |||
| 1978 | nmdc:mga0k408_8218_c1 | |||
| 1979 | nmdc:mga0k408_93998_c1 | |||
| 1980 | nmdc:mga06z11_37401_c1 | |||
| 1981 | nmdc:mga06z11_44644_c1 | |||
| 1982 | nmdc:mga04h51_70934_c1 | |||
| 1983 | nmdc:mga07m45_16377_c1 | |||
| 1984 | nmdc:mga07m45_2094_c1 | |||
| 1985 | nmdc:mga07m45_38799_c1 | |||
| 1986 | nmdc:mga07m45_4892_c1 | |||
| 1987 | nmdc:mga07m45_5767_c1 | |||
| 1988 | nmdc:mga07m45_65014_c1 | |||
| 1989 | nmdc:mga07m45_7026_c1 | |||
| 1990 | nmdc:mga07m45_78799_c1 | |||
| 1991 | nmdc:mga07m45_81_c1 | |||
| 1992 | nmdc:mga07m45_89611_c1 | |||
| 1993 | nmdc:mga07m45_9218_c1 | |||
| 1994 | nmdc:mga09592_1146_c1 | |||
| 1995 | nmdc:mga0qj67_116730_c1 | |||
| 1996 | Ga0500610_0004460 | |||
| 1997 | Ga0500610_0012136 | |||
| 1998 | Ga0500635_0000011 | |||
| 1999 | Ga0500643_022086 | |||
| 2000 | Ga0500644_0001695 | |||
| 2001 | Ga0500651_0000067 | |||
| 2002 | Ga0500651_0010814 | |||
| 2003 | Ga0500571_000088 | |||
| 2004 | Ga0500594_0002317 | |||
| 2005 | Ga0500594_0003170 | |||
| 2006 | Ga0500607_003160 | |||
| 2007 | Ga0500618_033455 | |||
| 2008 | Ga0500658_0001848 | |||
| 2009 | Ga0500658_0046863 | |||
| 2010 | Ga0500559_0001207 | |||
| 2011 | Ga0500568_0007294 | |||
| 2012 | Ga0500573_0158255 | |||
| 2013 | Ga0500619_005909 | |||
| 2014 | Ga0500622_0009720 | |||
| 2015 | Ga0500627_0001479 | |||
| 2016 | Ga0500634_0030761 | |||
| 2017 | Ga0500645_001523 | |||
| 2018 | Ga0500596_008364 | |||
| 2019 | Ga0500587_001369 | |||
| 2020 | Ga0590071_005488 | |||
| 2021 | Ga0466962_0001662 | |||
| 2022 | 2513228780 | |||
| 2023 | 2587759365 | |||
| 2024 | 2599620871 | |||
| 2025 | 2599674323 | |||
| 2026 | 2599678513 | |||
| 2027 | 2599690382 | |||
| 2028 | 2643743229 | |||
| 2029 | 2643932751 | |||
| 2030 | 2644161342 | |||
| 2031 | 2644218355 | |||
| 2032 | 2644243362 | |||
| 2033 | 2644260246 | |||
| 2034 | 2644303034 | |||
| 2035 | 2644314001 | |||
| 2036 | 2644324059 | |||
| 2037 | 2644340829 | |||
| 2038 | 2644400757 | |||
| 2039 | 2644465996 | |||
| 2040 | 2739056095 | |||
| 2041 | 2819601994 | |||
| 2042 | 2831269823 | |||
| 2043 | 2831869135 | |||
| 2044 | 2838055159 | |||
| 2045 | 2842680907 | |||
| 2046 | 2885196702 | |||
| 2047 | 2885201844 | |||
| 2048 | 2885215446 | |||
| 2049 | 2886849293 | |||
| 2050 | 2886853290 | |||
| 2051 | 2899927249 | |||
| 2052 | 2904453995 | |||
| 2053 | 2904459467 | |||
| 2054 | 2904546121 | |||
| 2055 | 2919465425 | |||
| 2056 | 2928042836 | |||
| 2057 | 2928048737 | |||
| 2058 | 2928055069 | |||
| 2059 | 2928068495 | |||
| 2060 | 2928073599 | |||
| 2061 | 2928089698 | |||
| 2062 | 2928117246 | |||
| 2063 | 2929161318 | |||
| 2064 | 2929521581 | |||
| 2065 | 2945949783 | |||
| 2066 | 2945973806 | |||
| 2067 | 2954770601 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cic-assembly2.cif.gz_B | crystal structure of p.aeruginosa lpxc in complex with inhibitor | 0.9111 | 1 | 289 |
| 7cic-assembly2.cif.gz_B | crystal structure of p.aeruginosa lpxc in complex with inhibitor | 0.908 | 1 | 289 |
| 7cie-assembly1.cif.gz_A | crystal structure of p.aeruginosa lpxc in complex with inhibitor | 0.9052 | 1 | 288 |
| 5u3b-assembly2.cif.gz_B | pseudomonas aeruginosa lpxc in complex with nvs-lpxc-01 | 0.9041 | 1 | 295 |
| 4okg-assembly2.cif.gz_B | lpxc from p.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid | 0.9029 | 1 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3p3gA01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 | 0.9043 | 1 | 123 | 3.30.230.20 |
| af_Q10PS1_24_147_3.30.230.20 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 | 0.9027 | 2 | 117 | 3.30.230.20 |
| 2vesC02 | Alpha Beta;2-Layer Sandwich;lpxc deacetylase, domain 1;lpxc deacetylase, domain 2 | 0.87 | 125 | 295 | 3.30.1700.10 |
| 3p3gA01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 | 0.864 | 1 | 123 | 3.30.230.20 |
| 2vesC02 | Alpha Beta;2-Layer Sandwich;lpxc deacetylase, domain 1;lpxc deacetylase, domain 2 | 0.8419 | 125 | 295 | 3.30.1700.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7AHK9-F1-model_v4 | deleted | 0.9406 | 1 | 149 |
|
| AF-A0A536URK9-F1-model_v4 | UDP-3-O-acyl-N-acetylglucosamine deacetylase (EC 3.5.1.108) | 0.9223 | 1 | 274 |
GO:0009245
GO:0016020 GO:0046872 GO:0103117 |
| AF-A0A2M8BRB9-F1-model_v4 | UDP-3-O-acyl-N-acetylglucosamine deacetylase (EC 3.5.1.108) | 0.9192 | 1 | 179 |
GO:0009245
GO:0016020 GO:0046872 GO:0103117 |
| AF-A0A4Q2IZ69-F1-model_v4 | UDP-3-O-acyl-N-acetylglucosamine deacetylase (UDP-3-O-acyl-GlcNAc deacetylase) (EC 3.5.1.108) (UDP-3-O-[R-3-hydroxymyristoyl]-N-acetylglucosamine deacetylase) | 0.9179 | 1 | 301 |
GO:0009245
GO:0016020 GO:0046872 GO:0103117 |
| AF-A0A257P8P2-F1-model_v4 | UDP-3-O-acyl-N-acetylglucosamine deacetylase (EC 3.5.1.108) | 0.9169 | 72 | 298 |
GO:0009245
GO:0016020 GO:0046872 GO:0103117 |