F488674

General Info

Members Datasets Scaffolds Average Seq Length
1034 396 2068 308

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000125|Ga0213875_1000012575
Length 345
Sequence MSQPDTPRRGKVAVIGAGFYGSTTAQRLAEYDIFEEVVLTDIIDGKPEGLALDMNQSRPIEGFETRVTGQTTGRSGDGYEAVAGSGIVVITAGLPRKPGMSRMDLIEVNAKIVRDVVENVVKHAPEAVLIVVSNPLDEMTALAAKVSGFPSSRVMGQAGMLDTARFSYFVAEKLGVPAGSVRTLTLGSHGDTMVPVPSACSVSGRPLGELLPAEEIDKLVTRTRNGGGEIVGLLKTGSAYYAPSAAAARMARAVAADSGDVMPVCAWVDGEYGISGVYLGVEAEIGSAGVRRVVQRDLSDTELAALREAAEAVRAKQASRSCASQGGAGPARRSPGPRPAGRRRA

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
101 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
165 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
194 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
197 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
227 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
236 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
237 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
241 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
242 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
243 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
244 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
245 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
246 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
247 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
248 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
249 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
250 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
251 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
252 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
258 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
259 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
266 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
267 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
292 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
293 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
294 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
295 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
296 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
297 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
298 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
359 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
360 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
361 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
362 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
363 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
364 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
365 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
366 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
369 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
370 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
371 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
372 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
373 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
374 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
377 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
378 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
379 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
380 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
381 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
382 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
383 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
384 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
385 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
386 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
387 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
388 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
389 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
390 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
391 2855683550 Micromonospora sp. RP3T Isolate Unclassified
392 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
393 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
394 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
395 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
396 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 1.06
Isolates 1.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 4.26
Rhizosphere 91.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000125 3300021388 Bacteria 85515
2 JGI25407J50210_10018873 3300003373 Bacteria 1792
3 Ga0070658_10000726 3300005327 Bacteria 28475
4 Ga0070658_10167961 3300005327 Bacteria 1843
5 Ga0070676_10043582 3300005328 Bacteria 2608
6 Ga0070683_100072950 3300005329 Bacteria 3205
7 Ga0070683_100173090 3300005329 Bacteria 2049
8 Ga0070683_100220782 3300005329 Bacteria 1801
9 Ga0068869_100006152 3300005334 Bacteria 7599
10 Ga0068869_100274442 3300005334 Bacteria 1354
11 Ga0070666_10106644 3300005335 Bacteria 1935
12 Ga0070680_100043236 3300005336 Bacteria 3659
13 Ga0070680_100056299 3300005336 Bacteria 3214
14 Ga0070680_100257496 3300005336 Bacteria 1476
15 Ga0068868_100044731 3300005338 Bacteria 3462
16 Ga0070660_100056267 3300005339 Bacteria 3042
17 Ga0070660_100085659 3300005339 Bacteria 2479
18 Ga0070687_100007727 3300005343 Bacteria 4507
19 Ga0070692_10003994 3300005345 Bacteria 6091
20 Ga0070675_100028479 3300005354 Bacteria 4495
21 Ga0070671_100044503 3300005355 Bacteria 3689
22 Ga0070673_100003932 3300005364 Bacteria 9334
23 Ga0070673_100038754 3300005364 Bacteria 3641
24 Ga0070659_100005916 3300005366 Bacteria 8815
25 Ga0070659_100010121 3300005366 Bacteria 6941
26 Ga0070659_100067507 3300005366 Bacteria 2836
27 Ga0070659_100176405 3300005366 Bacteria 1752
28 Ga0070659_100360254 3300005366 Bacteria 1222
29 Ga0070667_100211942 3300005367 Bacteria 1722
30 Ga0070709_10001361 3300005434 Bacteria 13346
31 Ga0070709_10012963 3300005434 Bacteria 4675
32 Ga0070709_10036675 3300005434 Bacteria 2989
33 Ga0070709_10088459 3300005434 Bacteria 2037
34 Ga0070709_10114686 3300005434 Bacteria 1816
35 Ga0070714_100000545 3300005435 Bacteria 27112
36 Ga0070714_100001325 3300005435 Bacteria 17871
37 Ga0070714_100025088 3300005435 Bacteria 4917
38 Ga0070714_100117982 3300005435 Bacteria 2357
39 Ga0070713_100000483 3300005436 Bacteria 25351
40 Ga0070713_100003097 3300005436 Bacteria 10939
41 Ga0070713_100008642 3300005436 Bacteria 7238
42 Ga0070713_100012555 3300005436 Bacteria 6218
43 Ga0070713_100021482 3300005436 Bacteria 4968
44 Ga0070713_100149652 3300005436 Bacteria 2075
45 Ga0070713_100165594 3300005436 Bacteria 1976
46 Ga0070710_10000539 3300005437 Bacteria 17930
47 Ga0070710_10000864 3300005437 Bacteria 14525
48 Ga0070710_10016620 3300005437 Bacteria 3748
49 Ga0070710_10063603 3300005437 Bacteria 2108
50 Ga0070710_10085268 3300005437 Bacteria 1852
51 Ga0070701_10085083 3300005438 Bacteria 1721
52 Ga0070711_100027416 3300005439 Bacteria 3739
53 Ga0070711_100056913 3300005439 Bacteria 2705
54 Ga0070711_100127218 3300005439 Bacteria 1893
55 Ga0070708_100001278 3300005445 Bacteria 19366
56 Ga0070708_100015039 3300005445 Bacteria 6383
57 Ga0070708_100198649 3300005445 Bacteria 1877
58 Ga0070708_100238464 3300005445 Bacteria 1707
59 Ga0070663_100026128 3300005455 Bacteria 3950
60 Ga0070663_100349091 3300005455 Bacteria 1197
61 Ga0070681_10087816 3300005458 Bacteria 3062
62 Ga0070681_10101000 3300005458 Bacteria 2830
63 Ga0070681_10174259 3300005458 Bacteria 2073
64 Ga0070681_10383872 3300005458 Bacteria 1315
65 Ga0070681_10390902 3300005458 Bacteria 1302
66 Ga0070681_10393953 3300005458 Bacteria 1296
67 Ga0070681_10537162 3300005458 Bacteria 1083
68 Ga0070685_10060058 3300005466 Bacteria 2222
69 Ga0070706_100000990 3300005467 Bacteria 30930
70 Ga0070706_100001894 3300005467 Bacteria 21601
71 Ga0070706_100004349 3300005467 Bacteria 13686
72 Ga0070706_100008020 3300005467 Bacteria 9852
73 Ga0070706_100024464 3300005467 Bacteria 5560
74 Ga0070706_100053956 3300005467 Bacteria 3711
75 Ga0070706_100057020 3300005467 Bacteria 3604
76 Ga0070706_100083098 3300005467 Bacteria 2966
77 Ga0070706_100096173 3300005467 Bacteria 2749
78 Ga0070707_100000256 3300005468 Bacteria 53538
79 Ga0070707_100004570 3300005468 Bacteria 12957
80 Ga0070707_100007016 3300005468 Bacteria 10448
81 Ga0070707_100026268 3300005468 Bacteria 5528
82 Ga0070707_100029674 3300005468 Bacteria 5205
83 Ga0070707_100168762 3300005468 Bacteria 2133
84 Ga0070707_100172512 3300005468 Bacteria 2107
85 Ga0070707_100180529 3300005468 Bacteria 2057
86 Ga0070707_100198649 3300005468 Bacteria 1954
87 Ga0070707_100233617 3300005468 Bacteria 1789
88 Ga0070707_100254561 3300005468 Bacteria 1709
89 Ga0070707_100305997 3300005468 Bacteria 1545
90 Ga0070698_100000292 3300005471 Bacteria 50989
91 Ga0070698_100000333 3300005471 Bacteria 48484
92 Ga0070698_100000898 3300005471 Bacteria 32677
93 Ga0070698_100002525 3300005471 Bacteria 20157
94 Ga0070698_100013017 3300005471 Bacteria 8806
95 Ga0070698_100017040 3300005471 Bacteria 7660
96 Ga0070698_100017971 3300005471 Bacteria 7447
97 Ga0070698_100051847 3300005471 Bacteria 4177
98 Ga0070698_100070857 3300005471 Bacteria 3497
99 Ga0070698_100086838 3300005471 Bacteria 3114
100 Ga0070698_100131717 3300005471 Bacteria 2455
101 Ga0070698_100228475 3300005471 Bacteria 1794
102 Ga0070699_100020685 3300005518 Bacteria 5677
103 Ga0070699_100028148 3300005518 Bacteria 4846
104 Ga0070699_100221012 3300005518 Bacteria 1688
105 Ga0070679_100034617 3300005530 Bacteria 5006
106 Ga0070679_100040543 3300005530 Bacteria 4632
107 Ga0070679_100053534 3300005530 Bacteria 4017
108 Ga0070679_100085114 3300005530 Bacteria 3149
109 Ga0070679_100173911 3300005530 Bacteria 2126
110 Ga0070679_100207892 3300005530 Bacteria 1922
111 Ga0070697_100108411 3300005536 Bacteria 2312
112 Ga0070697_100140261 3300005536 Bacteria 2032
113 Ga0068853_100227422 3300005539 Bacteria 1705
114 Ga0068853_100331322 3300005539 Bacteria 1413
115 Ga0070686_100004813 3300005544 Bacteria 7452
116 Ga0070696_100008315 3300005546 Bacteria 6942
117 Ga0070693_100003713 3300005547 Bacteria 7140
118 Ga0070693_100016084 3300005547 Bacteria 3865
119 Ga0070665_100006607 3300005548 Bacteria 11785
120 Ga0070665_100117827 3300005548 Bacteria 2658
121 Ga0070665_100147095 3300005548 Bacteria 2359
122 Ga0068855_100449672 3300005563 Bacteria 1406
123 Ga0070664_100016206 3300005564 Bacteria 6108
124 Ga0068854_100125742 3300005578 Bacteria 1952
125 Ga0068856_100115958 3300005614 Bacteria 2679
126 Ga0068856_100320759 3300005614 Bacteria 1566
127 Ga0068856_100380650 3300005614 Bacteria 1430
128 Ga0070702_100000031 3300005615 Bacteria 37489
129 Ga0070702_100030640 3300005615 Bacteria 2934
130 Ga0068852_100011289 3300005616 Bacteria 6719
131 Ga0068852_100295725 3300005616 Bacteria 1566
132 Ga0068859_100066935 3300005617 Bacteria 3627
133 Ga0068859_100443735 3300005617 Bacteria 1394
134 Ga0068864_100058887 3300005618 Bacteria 3321
135 Ga0068861_100014024 3300005719 Bacteria 5620
136 Ga0068861_100220936 3300005719 Bacteria 1601
137 Ga0068861_100264042 3300005719 Bacteria 1475
138 Ga0068851_10035674 3300005834 Bacteria 2487
139 Ga0068870_10000614 3300005840 Bacteria 13559
140 Ga0068863_100021114 3300005841 Bacteria 6220
141 Ga0068863_100111276 3300005841 Bacteria 2608
142 Ga0068863_100144648 3300005841 Bacteria 2273
143 Ga0068858_100180277 3300005842 Bacteria 1994
144 Ga0068858_100188374 3300005842 Bacteria 1949
145 Ga0068860_100043085 3300005843 Bacteria 4307
146 Ga0081455_10057618 3300005937 Bacteria 3292
147 Ga0081455_10156068 3300005937 Bacteria 1754
148 Ga0081538_10002786 3300005981 Bacteria 16746
149 Ga0081538_10008955 3300005981 Bacteria 8411
150 Ga0081538_10026674 3300005981 Bacteria 4031
151 Ga0081538_10034098 3300005981 Bacteria 3373
152 Ga0081538_10037427 3300005981 Bacteria 3148
153 Ga0081540_1000250 3300005983 Bacteria 56639
154 Ga0081540_1000330 3300005983 Bacteria 49099
155 Ga0081540_1005418 3300005983 Bacteria 9524
156 Ga0081540_1020749 3300005983 Bacteria 3938
157 Ga0081540_1032375 3300005983 Bacteria 2856
158 Ga0081539_10004919 3300005985 Bacteria 14234
159 Ga0081539_10018877 3300005985 Bacteria 4752
160 Ga0081539_10150970 3300005985 Bacteria 1118
161 Ga0070717_10001205 3300006028 Bacteria 17518
162 Ga0070717_10002725 3300006028 Bacteria 12478
163 Ga0070717_10011881 3300006028 Bacteria 6626
164 Ga0070717_10050812 3300006028 Bacteria 3409
165 Ga0070717_10076722 3300006028 Bacteria 2797
166 Ga0070717_10134834 3300006028 Bacteria 2125
167 Ga0070717_10263592 3300006028 Bacteria 1525
168 Ga0070717_10461944 3300006028 Bacteria 1145
169 Ga0075432_10026310 3300006058 Bacteria 1998
170 Ga0070715_10052548 3300006163 Bacteria 1758
171 Ga0070715_10057037 3300006163 Bacteria 1701
172 Ga0070716_100001415 3300006173 Bacteria 10653
173 Ga0070716_100026533 3300006173 Bacteria 3103
174 Ga0070716_100045435 3300006173 Bacteria 2466
175 Ga0070712_100002052 3300006175 Bacteria 12329
176 Ga0070712_100008902 3300006175 Bacteria 6323
177 Ga0070712_100014062 3300006175 Bacteria 5131
178 Ga0070712_100093705 3300006175 Bacteria 2205
179 Ga0070712_100398840 3300006175 Bacteria 1136
180 Ga0097621_100002544 3300006237 Bacteria 12495
181 Ga0097621_100037665 3300006237 Bacteria 3877
182 Ga0097621_100111339 3300006237 Bacteria 2314
183 Ga0068871_100047631 3300006358 Bacteria 3458
184 Ga0068871_100091961 3300006358 Bacteria 2529
185 Ga0068871_100129495 3300006358 Bacteria 2139
186 Ga0075428_100020125 3300006844 Bacteria 7389
187 Ga0075428_100062887 3300006844 Bacteria 4063
188 Ga0075428_100282093 3300006844 Bacteria 1787
189 Ga0075430_100000294 3300006846 Bacteria 35128
190 Ga0075430_100001663 3300006846 Bacteria 18174
191 Ga0075430_100006545 3300006846 Bacteria 9825
192 Ga0075430_100155213 3300006846 Bacteria 1906
193 Ga0075431_100046671 3300006847 Bacteria 4467
194 Ga0075431_100063910 3300006847 Bacteria 3799
195 Ga0075431_100272902 3300006847 Bacteria 1713
196 Ga0075433_10031211 3300006852 Bacteria 4553
197 Ga0075433_10049564 3300006852 Bacteria 3653
198 Ga0075433_10143574 3300006852 Bacteria 2122
199 Ga0075434_100009917 3300006871 Bacteria 8910
200 Ga0075434_100018423 3300006871 Bacteria 6746
201 Ga0075434_100044958 3300006871 Bacteria 4380
202 Ga0075434_100216438 3300006871 Bacteria 1936
203 Ga0075429_100002678 3300006880 Bacteria 14987
204 Ga0075429_100044119 3300006880 Bacteria 3878
205 Ga0075429_100116528 3300006880 Bacteria 2335
206 Ga0075436_100004879 3300006914 Bacteria 9217
207 Ga0075436_100074055 3300006914 Bacteria 2357
208 Ga0097620_100066940 3300006931 Bacteria 3627
209 Ga0097620_100443771 3300006931 Bacteria 1394
210 Ga0075435_100064936 3300007076 Bacteria 2966
211 Ga0075435_100232998 3300007076 Bacteria 1565
212 Ga0075435_100328524 3300007076 Bacteria 1309
213 Ga0105240_10251979 3300009093 Bacteria 2041
214 Ga0111539_10032226 3300009094 Bacteria 6366
215 Ga0111539_10047409 3300009094 Bacteria 5135
216 Ga0105245_10005437 3300009098 Bacteria 11189
217 Ga0105245_10056487 3300009098 Bacteria 3529
218 Ga0105247_10053503 3300009101 Bacteria 2490
219 Ga0114129_10006711 3300009147 Bacteria 16343
220 Ga0114129_10009018 3300009147 Bacteria 14220
221 Ga0114129_10047822 3300009147 Bacteria 6010
222 Ga0114129_10166468 3300009147 Bacteria 3008
223 Ga0114129_10184699 3300009147 Bacteria 2835
224 Ga0114129_10412805 3300009147 Bacteria 1777
225 Ga0105243_10365331 3300009148 Bacteria 1330
226 Ga0105241_10379178 3300009174 Bacteria 1235
227 Ga0105248_10152913 3300009177 Bacteria 2603
228 Ga0105248_10294461 3300009177 Bacteria 1827
229 Ga0105237_10033633 3300009545 Bacteria 5195
230 Ga0105238_10129275 3300009551 Bacteria 2504
231 Ga0105238_10290145 3300009551 Bacteria 1618
232 Ga0105249_10073392 3300009553 Bacteria 3166
233 Ga0099796_10050215 3300010159 Bacteria 1445
234 Ga0105239_10036023 3300010375 Bacteria 5432
235 Ga0157313_1001542 3300012503 Bacteria 1259
236 Ga0157371_10059306 3300013102 Bacteria 2713
237 Ga0157371_10137477 3300013102 Bacteria 1740
238 Ga0157370_10049599 3300013104 Bacteria 4017
239 Ga0157370_10057438 3300013104 Bacteria 3700
240 Ga0157370_10090646 3300013104 Bacteria 2870
241 Ga0157369_10011739 3300013105 Bacteria 9946
242 Ga0157369_10264471 3300013105 Bacteria 1793
243 Ga0157374_10020729 3300013296 Bacteria 5836
244 Ga0157374_10259101 3300013296 Bacteria 1713
245 Ga0163162_10013494 3300013306 Bacteria 7975
246 Ga0163162_10127754 3300013306 Bacteria 2649
247 Ga0157375_10193002 3300013308 Bacteria 2192
248 Ga0157375_10448831 3300013308 Bacteria 1455
249 Ga0163163_10001600 3300014325 Bacteria 19033
250 Ga0157379_10017361 3300014968 Bacteria 6340
251 Ga0157379_10146024 3300014968 Bacteria 2133
252 Ga0157379_10150130 3300014968 Bacteria 2102
253 Ga0157376_10103696 3300014969 Bacteria 2491
254 Ga0163161_10099487 3300017792 Bacteria 2163
255 Ga0206349_1541197 3300020075 Bacteria 1324
256 Ga0206351_10996409 3300020077 Bacteria 2111
257 Ga0206354_10500860 3300020081 Bacteria 2269
258 Ga0206354_10593962 3300020081 Bacteria 4033
259 Ga0213873_10019370 3300021358 Bacteria 1578
260 Ga0213875_10000250 3300021388 Bacteria 54123
261 Ga0213875_10016542 3300021388 Bacteria 3574
262 Ga0213875_10033159 3300021388 Bacteria 2438
263 Ga0213871_10050030 3300021441 Bacteria 1143
264 Ga0224712_10003353 3300022467 Bacteria 4150
265 Ga0224712_10012929 3300022467 Bacteria 2644
266 Ga0224712_10013796 3300022467 Bacteria 2584
267 Ga0224712_10017923 3300022467 Bacteria 2357
268 Ga0224712_10021524 3300022467 Bacteria 2208
269 Ga0224712_10021811 3300022467 Bacteria 2198
270 Ga0224712_10127430 3300022467 Bacteria 1108
271 Ga0224572_1000791 3300024225 Bacteria 4180
272 Ga0207656_10020636 3300025321 Bacteria 2621
273 Ga0207653_10008398 3300025885 Bacteria 3216
274 Ga0207692_10001094 3300025898 Bacteria 9936
275 Ga0207692_10001437 3300025898 Bacteria 8917
276 Ga0207692_10004739 3300025898 Bacteria 5402
277 Ga0207692_10025602 3300025898 Bacteria 2758
278 Ga0207692_10033061 3300025898 Bacteria 2491
279 Ga0207692_10138175 3300025898 Bacteria 1383
280 Ga0207692_10244113 3300025898 Bacteria 1074
281 Ga0207710_10028052 3300025900 Bacteria 2442
282 Ga0207688_10017900 3300025901 Bacteria 3856
283 Ga0207688_10106533 3300025901 Bacteria 1624
284 Ga0207680_10025579 3300025903 Bacteria 3258
285 Ga0207685_10022394 3300025905 Bacteria 2135
286 Ga0207685_10039962 3300025905 Bacteria 1745
287 Ga0207699_10001830 3300025906 Bacteria 10004
288 Ga0207699_10006266 3300025906 Bacteria 5746
289 Ga0207699_10011057 3300025906 Bacteria 4547
290 Ga0207699_10074359 3300025906 Bacteria 2087
291 Ga0207699_10154582 3300025906 Bacteria 1521
292 Ga0207643_10000204 3300025908 Bacteria 41257
293 Ga0207705_10001642 3300025909 Bacteria 17743
294 Ga0207684_10001419 3300025910 Bacteria 25953
295 Ga0207684_10002612 3300025910 Bacteria 18016
296 Ga0207684_10002799 3300025910 Bacteria 17340
297 Ga0207684_10015342 3300025910 Bacteria 6595
298 Ga0207684_10092354 3300025910 Bacteria 2579
299 Ga0207684_10186921 3300025910 Bacteria 1786
300 Ga0207654_10054753 3300025911 Bacteria 2306
301 Ga0207707_10035796 3300025912 Bacteria 4341
302 Ga0207707_10098332 3300025912 Bacteria 2558
303 Ga0207707_10109135 3300025912 Bacteria 2419
304 Ga0207695_10287073 3300025913 Bacteria 1538
305 Ga0207695_10361244 3300025913 Bacteria 1339
306 Ga0207671_10071968 3300025914 Bacteria 2579
307 Ga0207671_10151559 3300025914 Bacteria 1791
308 Ga0207693_10001078 3300025915 Bacteria 24478
309 Ga0207693_10005180 3300025915 Bacteria 10914
310 Ga0207693_10008773 3300025915 Bacteria 8262
311 Ga0207693_10013430 3300025915 Bacteria 6604
312 Ga0207693_10014990 3300025915 Bacteria 6223
313 Ga0207693_10085727 3300025915 Bacteria 2467
314 Ga0207693_10138270 3300025915 Bacteria 1915
315 Ga0207663_10010431 3300025916 Bacteria 4947
316 Ga0207663_10014695 3300025916 Bacteria 4296
317 Ga0207663_10039635 3300025916 Bacteria 2856
318 Ga0207663_10074280 3300025916 Bacteria 2203
319 Ga0207663_10084495 3300025916 Bacteria 2088
320 Ga0207660_10038844 3300025917 Bacteria 3325
321 Ga0207660_10254343 3300025917 Bacteria 1387
322 Ga0207662_10011478 3300025918 Bacteria 4917
323 Ga0207662_10052164 3300025918 Bacteria 2434
324 Ga0207657_10044561 3300025919 Bacteria 3899
325 Ga0207657_10089951 3300025919 Bacteria 2562
326 Ga0207657_10105478 3300025919 Bacteria 2333
327 Ga0207657_10165197 3300025919 Bacteria 1796
328 Ga0207649_10018450 3300025920 Bacteria 3969
329 Ga0207652_10124104 3300025921 Bacteria 2299
330 Ga0207652_10159071 3300025921 Bacteria 2024
331 Ga0207652_10219371 3300025921 Bacteria 1713
332 Ga0207652_10403798 3300025921 Bacteria 1233
333 Ga0207646_10000950 3300025922 Bacteria 37311
334 Ga0207646_10001124 3300025922 Bacteria 34128
335 Ga0207646_10031779 3300025922 Bacteria 4778
336 Ga0207646_10044143 3300025922 Bacteria 4001
337 Ga0207646_10072069 3300025922 Bacteria 3086
338 Ga0207646_10102009 3300025922 Bacteria 2572
339 Ga0207646_10184097 3300025922 Bacteria 1886
340 Ga0207646_10201908 3300025922 Bacteria 1796
341 Ga0207650_10002710 3300025925 Bacteria 12237
342 Ga0207659_10004400 3300025926 Bacteria 8514
343 Ga0207687_10006217 3300025927 Bacteria 7905
344 Ga0207687_10074652 3300025927 Bacteria 2431
345 Ga0207687_10075188 3300025927 Bacteria 2424
346 Ga0207700_10001672 3300025928 Bacteria 12587
347 Ga0207700_10002173 3300025928 Bacteria 11233
348 Ga0207700_10005055 3300025928 Bacteria 7845
349 Ga0207700_10020413 3300025928 Bacteria 4499
350 Ga0207700_10021329 3300025928 Bacteria 4421
351 Ga0207700_10022331 3300025928 Bacteria 4340
352 Ga0207700_10034120 3300025928 Bacteria 3649
353 Ga0207700_10057202 3300025928 Bacteria 2939
354 Ga0207700_10096005 3300025928 Bacteria 2352
355 Ga0207700_10301731 3300025928 Bacteria 1383
356 Ga0207664_10000427 3300025929 Bacteria 30029
357 Ga0207664_10000940 3300025929 Bacteria 19579
358 Ga0207664_10002584 3300025929 Bacteria 11979
359 Ga0207664_10007361 3300025929 Bacteria 7629
360 Ga0207664_10020499 3300025929 Bacteria 4901
361 Ga0207664_10021524 3300025929 Bacteria 4797
362 Ga0207664_10043770 3300025929 Bacteria 3504
363 Ga0207664_10052186 3300025929 Bacteria 3233
364 Ga0207664_10053493 3300025929 Bacteria 3196
365 Ga0207664_10080047 3300025929 Bacteria 2654
366 Ga0207664_10191859 3300025929 Bacteria 1759
367 Ga0207664_10304935 3300025929 Bacteria 1402
368 Ga0207644_10007562 3300025931 Bacteria 7084
369 Ga0207644_10044521 3300025931 Bacteria 3153
370 Ga0207690_10000219 3300025932 Bacteria 43461
371 Ga0207690_10030154 3300025932 Bacteria 3456
372 Ga0207690_10333355 3300025932 Bacteria 1196
373 Ga0207686_10114479 3300025934 Bacteria 1825
374 Ga0207670_10035613 3300025936 Bacteria 3229
375 Ga0207665_10001719 3300025939 Bacteria 14712
376 Ga0207665_10002491 3300025939 Bacteria 12398
377 Ga0207665_10017416 3300025939 Bacteria 4721
378 Ga0207665_10025411 3300025939 Bacteria 3908
379 Ga0207665_10056283 3300025939 Bacteria 2654
380 Ga0207665_10134613 3300025939 Bacteria 1757
381 Ga0207665_10141555 3300025939 Bacteria 1716
382 Ga0207691_10029944 3300025940 Bacteria 5090
383 Ga0207711_10178971 3300025941 Bacteria 1927
384 Ga0207689_10000223 3300025942 Bacteria 50338
385 Ga0207689_10017179 3300025942 Bacteria 6124
386 Ga0207661_10130930 3300025944 Bacteria 2148
387 Ga0207661_10510587 3300025944 Bacteria 1099
388 Ga0207679_10006307 3300025945 Bacteria 7488
389 Ga0207712_10023350 3300025961 Bacteria 4080
390 Ga0207712_10098587 3300025961 Bacteria 2168
391 Ga0207668_10127648 3300025972 Bacteria 1937
392 Ga0207640_10046715 3300025981 Bacteria 2788
393 Ga0207640_10270453 3300025981 Bacteria 1329
394 Ga0207677_10018630 3300026023 Bacteria 4170
395 Ga0207703_10040754 3300026035 Bacteria 3718
396 Ga0207639_10083405 3300026041 Bacteria 2537
397 Ga0207639_10328799 3300026041 Bacteria 1359
398 Ga0207678_10002516 3300026067 Bacteria 16688
399 Ga0207678_10006007 3300026067 Bacteria 10803
400 Ga0207708_10046904 3300026075 Bacteria 3290
401 Ga0207702_10043655 3300026078 Bacteria 3765
402 Ga0207702_10056949 3300026078 Bacteria 3320
403 Ga0207702_10070243 3300026078 Bacteria 3012
404 Ga0207702_10130343 3300026078 Bacteria 2262
405 Ga0207702_10370778 3300026078 Bacteria 1374
406 Ga0207702_10386642 3300026078 Bacteria 1346
407 Ga0207641_10009542 3300026088 Bacteria 7995
408 Ga0207676_10001541 3300026095 Bacteria 17016
409 Ga0207676_10156658 3300026095 Bacteria 1968
410 Ga0207674_10004964 3300026116 Bacteria 15897
411 Ga0207674_10123468 3300026116 Bacteria 2555
412 Ga0207675_100002250 3300026118 Bacteria 19196
413 Ga0207675_100037515 3300026118 Bacteria 4520
414 Ga0207675_100265546 3300026118 Bacteria 1664
415 Ga0207683_10000804 3300026121 Bacteria 28698
416 Ga0207683_10005606 3300026121 Bacteria 10764
417 Ga0207683_10024244 3300026121 Bacteria 5222
418 Ga0207698_10002366 3300026142 Bacteria 11182
419 Ga0207698_10317204 3300026142 Bacteria 1458
420 Ga0207428_10000537 3300027907 Bacteria 45252
421 Ga0207428_10009923 3300027907 Bacteria 8528
422 Ga0207428_10068605 3300027907 Bacteria 2789
423 Ga0268266_10023015 3300028379 Bacteria 5303
424 Ga0268266_10525110 3300028379 Bacteria 1132
425 Ga0265336_10004601 3300028666 Bacteria 5184
426 Ga0307517_10074469 3300028786 Bacteria 2994
427 Ga0307515_10001066 3300028794 Bacteria 62806
428 Ga0307515_10009042 3300028794 Bacteria 19333
429 Ga0307515_10170578 3300028794 Bacteria 2171
430 Ga0265338_10002247 3300028800 Bacteria 29390
431 Ga0265338_10014640 3300028800 Bacteria 8701
432 Ga0265338_10031380 3300028800 Bacteria 5211
433 Ga0307512_10003683 3300030522 Bacteria 17448
434 Ga0307512_10025517 3300030522 Bacteria 5234
435 Ga0316181_1149483 3300030744 Bacteria 2422
436 Ga0265330_10081434 3300031235 Bacteria 1395
437 Ga0265320_10022258 3300031240 Bacteria 3393
438 Ga0265325_10027015 3300031241 Bacteria 3105
439 Ga0265340_10008623 3300031247 Bacteria 5496
440 Ga0265340_10013418 3300031247 Bacteria 4302
441 Ga0265340_10034361 3300031247 Bacteria 2522
442 Ga0265316_10042524 3300031344 Bacteria 3631
443 Ga0307513_10000001 3300031456 Bacteria 1660464
444 Ga0307513_10036904 3300031456 Bacteria 5443
445 Ga0307509_10178452 3300031507 Bacteria 1993
446 Ga0307408_100018031 3300031548 Bacteria 4735
447 Ga0307408_100030377 3300031548 Bacteria 3752
448 Ga0307408_100206281 3300031548 Bacteria 1594
449 Ga0265313_10046513 3300031595 Bacteria 2106
450 Ga0307508_10033247 3300031616 Bacteria 4654
451 Ga0307508_10306467 3300031616 Bacteria 1181
452 Ga0316579_10011444 3300031691 Bacteria 3770
453 Ga0316579_10079237 3300031691 Bacteria 1563
454 Ga0265314_10022618 3300031711 Bacteria 4814
455 Ga0265314_10136154 3300031711 Bacteria 1525
456 Ga0265342_10094939 3300031712 Bacteria 1705
457 Ga0316576_10014040 3300031727 Bacteria 5341
458 Ga0316578_10020196 3300031728 Bacteria 3677
459 Ga0307516_10001792 3300031730 Bacteria 29478
460 Ga0307405_10016418 3300031731 Bacteria 4037
461 Ga0307405_10034777 3300031731 Bacteria 3002
462 Ga0307405_10071517 3300031731 Bacteria 2232
463 Ga0307413_10002297 3300031824 Bacteria 7739
464 Ga0307413_10028958 3300031824 Bacteria 3092
465 Ga0307413_10126857 3300031824 Bacteria 1739
466 Ga0307413_10174920 3300031824 Bacteria 1524
467 Ga0307410_10008218 3300031852 Bacteria 5775
468 Ga0307410_10012065 3300031852 Bacteria 4974
469 Ga0307410_10017362 3300031852 Bacteria 4320
470 Ga0307410_10151531 3300031852 Bacteria 1727
471 Ga0326468_10000905 3300031889 Bacteria 2896
472 Ga0307406_10005635 3300031901 Bacteria 6845
473 Ga0307406_10080903 3300031901 Bacteria 2158
474 Ga0307406_10140744 3300031901 Bacteria 1707
475 Ga0307407_10010091 3300031903 Bacteria 4436
476 Ga0307412_10037573 3300031911 Bacteria 3113
477 Ga0307412_10176155 3300031911 Bacteria 1604
478 Ga0307409_100042353 3300031995 Bacteria 3409
479 Ga0307409_100062244 3300031995 Bacteria 2920
480 Ga0307409_100074136 3300031995 Bacteria 2718
481 Ga0307409_100224732 3300031995 Bacteria 1697
482 Ga0307416_100005911 3300032002 Bacteria 7596
483 Ga0307416_100010416 3300032002 Bacteria 6138
484 Ga0307416_100014187 3300032002 Bacteria 5446
485 Ga0307416_100021209 3300032002 Bacteria 4658
486 Ga0307416_100022814 3300032002 Bacteria 4527
487 Ga0307416_100026645 3300032002 Bacteria 4263
488 Ga0307416_100051710 3300032002 Bacteria 3284
489 Ga0307416_100127411 3300032002 Bacteria 2283
490 Ga0307416_100190815 3300032002 Bacteria 1932
491 Ga0307414_10295094 3300032004 Bacteria 1368
492 Ga0307411_10003583 3300032005 Bacteria 7239
493 Ga0307411_10013764 3300032005 Bacteria 4478
494 Ga0307411_10067943 3300032005 Bacteria 2401
495 Ga0307415_100001464 3300032126 Bacteria 11306
496 Ga0307415_100005414 3300032126 Bacteria 6777
497 Ga0307415_100005543 3300032126 Bacteria 6715
498 Ga0307415_100048312 3300032126 Bacteria 2871
499 Ga0307415_100059169 3300032126 Bacteria 2641
500 Ga0307415_100115846 3300032126 Bacteria 1998
501 Ga0307415_100165772 3300032126 Bacteria 1717
502 Ga0307415_100231174 3300032126 Bacteria 1489
503 Ga0316583_10003287 3300032133 Bacteria 5682
504 Ga0316585_10024611 3300032137 Bacteria 1863
505 Ga0307510_10178321 3300033180 Bacteria 1692
506 Ga0373930_0011979 3300034816 Bacteria 1574
507 Ga0373948_0010418 3300034817 Bacteria 1623
508 Ga0373926_0009034 3300035083 Bacteria 3323
509 Ga0373926_0107581 3300035083 Bacteria 1046
510 Ga0373928_0007014 3300035084 Bacteria 2172
511 Ga0373934_0000070 3300035086 Bacteria 35142
512 Ga0373934_0002196 3300035086 Bacteria 7172
513 Ga0373934_0006637 3300035086 Bacteria 4297
514 Ga0373940_0020952 3300035088 Bacteria 1666
515 Ga0373940_0040831 3300035088 Bacteria 1274
516 Ga0373944_0002438 3300035089 Bacteria 4722
517 Ga0373949_0003325 3300035090 Bacteria 3861
518 Ga0373949_0023621 3300035090 Bacteria 1425
519 Ga0373923_0011010 3300035111 Bacteria 3307
520 Ga0373923_0056349 3300035111 Bacteria 1659
521 Ga0373923_0066202 3300035111 Bacteria 1544
522 Ga0373932_0016751 3300035112 Bacteria 1874
523 Ga0373936_0001293 3300035113 Bacteria 9062
524 Ga0373936_0004164 3300035113 Bacteria 5452
525 Ga0373936_0083543 3300035113 Bacteria 1331
526 Ga0373939_0060424 3300035114 Bacteria 1204
527 Ga0373945_0044491 3300035116 Bacteria 1614
528 Ga0373953_0000185 3300035117 Bacteria 16552
529 Ga0373953_0001732 3300035117 Bacteria 6429
530 Ga0373953_0010341 3300035117 Bacteria 3243
531 Ga0373953_0045019 3300035117 Bacteria 1766
532 Ga0373953_0068325 3300035117 Bacteria 1462
533 Ga0373954_0002192 3300035118 Bacteria 8115
534 Ga0373954_0040812 3300035118 Bacteria 2162
535 Ga0373954_0040873 3300035118 Bacteria 2161
536 Ga0373954_0061833 3300035118 Bacteria 1768
537 Ga0373956_0000007 3300035119 Bacteria 63448
538 Ga0373956_0020043 3300035119 Bacteria 2840
539 Ga0373956_0090125 3300035119 Bacteria 1414
540 Ga0373956_0126010 3300035119 Bacteria 1197
541 Ga0373957_0000024 3300035120 Bacteria 39141
542 Ga0373957_0002117 3300035120 Bacteria 5582
543 Ga0373957_0033521 3300035120 Bacteria 1897
544 Ga0373960_0004470 3300035121 Bacteria 3206
545 Ga0373943_0001340 3300035170 Bacteria 11093
546 Ga0373943_0001795 3300035170 Bacteria 9697
547 Ga0373946_0001065 3300035171 Bacteria 9448
548 Ga0373946_0017131 3300035171 Bacteria 2768
549 Ga0373955_0000368 3300035172 Bacteria 19027
550 Ga0373955_0017001 3300035172 Bacteria 3589
551 Ga0373955_0049962 3300035172 Bacteria 2272
552 Ga0373955_0058166 3300035172 Bacteria 2126
553 Ga0373955_0322137 3300035172 Bacteria 934
554 Ga0373942_0022330 3300035207 Bacteria 1604
555 Ga0316574_0001450 3300035398 Bacteria 11268
556 Ga0316574_0003741 3300035398 Bacteria 7883
557 Ga0316574_0150904 3300035398 Bacteria 1497
558 Ga0373924_0000372 3300035410 Bacteria 13775
559 Ga0373924_0011689 3300035410 Bacteria 3265
560 Ga0373924_0018862 3300035410 Bacteria 2665
561 Ga0373924_0029116 3300035410 Bacteria 2206
562 Ga0373924_0076608 3300035410 Bacteria 1417
563 Ga0373931_0027647 3300035691 Bacteria 2897
564 Ga0373935_0003744 3300035692 Bacteria 8878
565 Ga0373935_0005495 3300035692 Bacteria 7466
566 Ga0373935_0053505 3300035692 Bacteria 2568
567 Ga0373935_0073581 3300035692 Bacteria 2208
568 Ga0373935_0075094 3300035692 Bacteria 2186
569 Ga0373935_0332305 3300035692 Bacteria 1080
570 Ga0373927_0003060 3300035695 Bacteria 12127
571 Ga0373927_0070955 3300035695 Bacteria 2254
572 Ga0373933_0000002 3300035724 Bacteria 151785
573 Ga0373933_0001577 3300035724 Bacteria 13343
574 Ga0373933_0015191 3300035724 Bacteria 4291
575 Ga0373933_0019084 3300035724 Bacteria 3866
576 Ga0373933_0022077 3300035724 Bacteria 3622
577 Ga0373933_0037724 3300035724 Bacteria 2836
578 Ga0373933_0071489 3300035724 Bacteria 2112
579 Ga0373933_0142720 3300035724 Bacteria 1513
580 Ga0373947_0000007 3300035725 Bacteria 192259
581 Ga0373947_0003580 3300035725 Bacteria 9160
582 Ga0373937_0000014 3300036401 Bacteria 151785
583 Ga0373937_0000312 3300036401 Bacteria 45975
584 Ga0373937_0003119 3300036401 Bacteria 13861
585 Ga0373937_0007378 3300036401 Bacteria 9513
586 Ga0373937_0046082 3300036401 Bacteria 3986
587 Ga0373937_0074903 3300036401 Bacteria 3124
588 Ga0373937_0106572 3300036401 Bacteria 2605
589 Ga0373937_0117122 3300036401 Bacteria 2481
590 Ga0373937_0232432 3300036401 Bacteria 1736
591 Ga0373937_0236231 3300036401 Bacteria 1721
592 Ga0373937_0238112 3300036401 Bacteria 1714
593 Ga0373937_0373198 3300036401 Bacteria 1352
594 Ga0316582_0057528 3300036647 Bacteria 2484
595 Ga0316584_0018562 3300036712 Bacteria 5019
596 Ga0373925_0023473 3300037068 Bacteria 4500
597 Ga0373925_0062211 3300037068 Bacteria 2807
598 Ga0373925_0127897 3300037068 Bacteria 1978
599 Ga0373925_0221542 3300037068 Bacteria 1510
600 Ga0395899_0297566 3300037312 Bacteria 1093
601 Ga0395900_0025836 3300037418 Bacteria 6012
602 Ga0395900_0256887 3300037418 Bacteria 1746
603 Ga0395900_0357357 3300037418 Bacteria 1433
604 Ga0395898_0090208 3300037466 Bacteria 2950
605 Ga0395898_0154853 3300037466 Bacteria 2192
606 Ga0395898_0161474 3300037466 Bacteria 2143
607 Ga0395898_0361040 3300037466 Bacteria 1385
608 Ga0395905_0028781 3300037471 Bacteria 5235
609 Ga0395905_0149731 3300037471 Bacteria 2196
610 Ga0436364_0093921 3300037853 Bacteria 15238
611 Ga0436364_0118843 3300037853 Bacteria 1215
612 Ga0436364_0287407 3300037853 Bacteria 132611
613 Ga0436364_0639700 3300037853 Bacteria 1225
614 Ga0436364_0732570 3300037853 Bacteria 62691
615 Ga0436364_0786912 3300037853 Bacteria 2866
616 Ga0436364_0886432 3300037853 Bacteria 2692
617 Ga0436364_0935193 3300037853 Bacteria 1531
618 Ga0436364_1083867 3300037853 Bacteria 4252
619 Ga0436364_1537007 3300037853 Bacteria 5306
620 Ga0395901_0032412 3300038443 Bacteria 5391
621 Ga0395901_0044943 3300038443 Bacteria 4582
622 Ga0395901_0072361 3300038443 Bacteria 3594
623 Ga0395901_0231170 3300038443 Bacteria 1930
624 Ga0395901_0338218 3300038443 Bacteria 1555
625 Ga0395901_0441791 3300038443 Bacteria 1331
626 Ga0400485_02208 3300038735 Bacteria 45471
627 Ga0400486_25692 3300038742 Bacteria 36614
628 Ga0436360_0021783 3300039438 Bacteria 1375
629 Ga0436360_0455054 3300039438 Bacteria 2049
630 Ga0436361_0756449 3300039447 Bacteria 1580
631 Ga0436363_0045890 3300039450 Bacteria 1127
632 Ga0436363_0398535 3300039450 Bacteria 848
633 Ga0436363_0838504 3300039450 Bacteria 3983
634 Ga0439436_0003729 3300041404 Bacteria 4651
635 Ga0451853_3927494 3300041512 Bacteria 1778
636 Ga0439433_0009335 3300041999 Bacteria 2135
637 Ga0439442_011772 3300042002 Bacteria 1784
638 Ga0439448_0000572 3300042005 Bacteria 8631
639 Ga0439448_0051675 3300042005 Bacteria 1346
640 Ga0439449_0005338 3300042007 Bacteria 4921
641 Ga0439455_0026469 3300042012 Bacteria 1416
642 Ga0439463_003040 3300042016 Bacteria 4258
643 Ga0439458_0003964 3300042157 Bacteria 3420
644 Ga0439464_0010056 3300042439 Bacteria 2495
645 Ga0439464_0010767 3300042439 Bacteria 2417
646 Ga0439460_0012086 3300042461 Bacteria 2234
647 Ga0439460_0044508 3300042461 Bacteria 1314
648 Ga0450916_000764 3300042530 Bacteria 2970
649 Ga0466965_0142339 3300044683 Bacteria 1250
650 Ga0466966_0196157 3300044684 Bacteria 1222
651 Ga0466961_0017604 3300044693 Bacteria 4591
652 Ga0466961_0068036 3300044693 Bacteria 2262
653 Ga0466961_0233543 3300044693 Bacteria 1131
654 Ga0466963_0015064 3300044694 Bacteria 4780
655 Ga0466963_0038698 3300044694 Bacteria 3120
656 Ga0466963_0109300 3300044694 Bacteria 1897
657 Ga0466963_0267352 3300044694 Bacteria 1201
658 Ga0466964_0054574 3300044706 Bacteria 1647
659 Ga0466964_0063476 3300044706 Bacteria 1543
660 Ga0466971_0124060 3300044719 Bacteria 1196
661 Ga0466968_0000127 3300044735 Bacteria 22573
662 Ga0466970_0001582 3300044765 Bacteria 10998
663 Ga0466970_0032333 3300044765 Bacteria 2764
664 Ga0466970_0120894 3300044765 Bacteria 1434
665 Ga0466957_0002458 3300044842 Bacteria 9948
666 Ga0466957_0199478 3300044842 Bacteria 1314
667 Ga0466960_0014624 3300044901 Bacteria 3366
668 Ga0466960_0098437 3300044901 Bacteria 1502
669 Ga0466959_0163057 3300045049 Bacteria 1566
670 Ga0466959_0184133 3300045049 Bacteria 1460
671 Ga0466959_0285378 3300045049 Bacteria 1132
672 Ga0466958_0002125 3300045836 Bacteria 9848
673 Ga0466958_0025951 3300045836 Bacteria 3459
674 Ga0466967_0006236 3300045976 Bacteria 8408
675 Ga0466967_0097718 3300045976 Bacteria 2680
676 Ga0466967_0123286 3300045976 Bacteria 2397
677 Ga0466967_0141670 3300045976 Bacteria 2240
678 Ga0466967_0144241 3300045976 Bacteria 2220
679 Ga0466967_0168790 3300045976 Bacteria 2057
680 Ga0466967_0223140 3300045976 Bacteria 1792
681 Ga0495592_0000133 3300046454 Bacteria 66075
682 Ga0495592_0021245 3300046454 Bacteria 4935
683 Ga0495592_0027905 3300046454 Bacteria 4276
684 Ga0495592_0045713 3300046454 Bacteria 3266
685 Ga0495592_0145629 3300046454 Bacteria 1643
686 Ga0495629_0003615 3300046459 Bacteria 11686
687 Ga0495629_0120393 3300046459 Bacteria 1828
688 Ga0495641_0013730 3300046461 Bacteria 4427
689 Ga0495641_0026292 3300046461 Bacteria 2841
690 Ga0495651_0000019 3300046462 Bacteria 120970
691 Ga0495651_0001424 3300046462 Bacteria 18558
692 Ga0495651_0013797 3300046462 Bacteria 6249
693 Ga0495651_0030057 3300046462 Bacteria 4236
694 Ga0495651_0126446 3300046462 Bacteria 1871
695 Ga0495653_0003782 3300046463 Bacteria 12247
696 Ga0495653_0006300 3300046463 Bacteria 9733
697 Ga0495653_0010412 3300046463 Bacteria 7606
698 Ga0495653_0015651 3300046463 Bacteria 6182
699 Ga0495653_0017351 3300046463 Bacteria 5855
700 Ga0495653_0098404 3300046463 Bacteria 2124
701 Ga0495653_0151850 3300046463 Bacteria 1617
702 Ga0495582_0000493 3300046473 Bacteria 21575
703 Ga0495582_0015285 3300046473 Bacteria 4218
704 Ga0495582_0080091 3300046473 Bacteria 1813
705 Ga0495639_0005262 3300046475 Bacteria 5564
706 Ga0495639_0007891 3300046475 Bacteria 4575
707 Ga0495662_0020889 3300046476 Bacteria 3167
708 Ga0495662_0103426 3300046476 Bacteria 1393
709 Ga0495662_0160612 3300046476 Bacteria 1107
710 Ga0495664_0006872 3300046477 Bacteria 6297
711 Ga0495664_0009160 3300046477 Bacteria 5535
712 Ga0495664_0010930 3300046477 Bacteria 5105
713 Ga0495664_0017711 3300046477 Bacteria 4073
714 Ga0495664_0020928 3300046477 Bacteria 3776
715 Ga0495664_0062050 3300046477 Bacteria 2225
716 Ga0495664_0108657 3300046477 Bacteria 1673
717 Ga0495594_0097426 3300046499 Bacteria 1653
718 Ga0495596_0022225 3300046500 Bacteria 2583
719 Ga0495608_0000028 3300046511 Bacteria 151829
720 Ga0495608_0009390 3300046511 Bacteria 6838
721 Ga0495608_0014063 3300046511 Bacteria 5554
722 Ga0495608_0020716 3300046511 Bacteria 4517
723 Ga0495608_0044749 3300046511 Bacteria 2953
724 Ga0495608_0108063 3300046511 Bacteria 1789
725 Ga0495608_0236051 3300046511 Bacteria 1143
726 Ga0495608_0275611 3300046511 Bacteria 1045
727 Ga0495618_0052774 3300046514 Bacteria 2570
728 Ga0495618_0108712 3300046514 Bacteria 1775
729 Ga0495618_0130471 3300046514 Bacteria 1608
730 Ga0495628_0000337 3300046516 Bacteria 42541
731 Ga0495628_0010312 3300046516 Bacteria 7943
732 Ga0495628_0088817 3300046516 Bacteria 2394
733 Ga0495628_0254132 3300046516 Bacteria 1311
734 Ga0495630_0051465 3300046517 Bacteria 3082
735 Ga0495630_0078411 3300046517 Bacteria 2491
736 Ga0495630_0101646 3300046517 Bacteria 2175
737 Ga0495630_0156506 3300046517 Bacteria 1734
738 Ga0495632_0072168 3300046519 Bacteria 1657
739 Ga0495644_0072826 3300046523 Bacteria 1292
740 Ga0495666_0058276 3300046526 Bacteria 1848
741 Ga0495666_0078256 3300046526 Bacteria 1566
742 Ga0495652_0000031 3300046529 Bacteria 151765
743 Ga0495652_0019111 3300046529 Bacteria 6103
744 Ga0495652_0033547 3300046529 Bacteria 4481
745 Ga0495652_0071909 3300046529 Bacteria 2885
746 Ga0495652_0095275 3300046529 Bacteria 2425
747 Ga0495652_0103519 3300046529 Bacteria 2304
748 Ga0495652_0152813 3300046529 Bacteria 1801
749 Ga0495665_0012938 3300046531 Bacteria 4516
750 Ga0495665_0052706 3300046531 Bacteria 2153
751 Ga0495665_0111120 3300046531 Bacteria 1437
752 Ga0495640_0046881 3300046533 Bacteria 2992
753 Ga0495640_0056386 3300046533 Bacteria 2685
754 Ga0495640_0086003 3300046533 Bacteria 2083
755 Ga0495640_0223359 3300046533 Bacteria 1187
756 Ga0495586_0022724 3300046535 Bacteria 3347
757 Ga0495587_0000023 3300046536 Bacteria 151763
758 Ga0495587_0010018 3300046536 Bacteria 6052
759 Ga0495587_0017955 3300046536 Bacteria 4387
760 Ga0495587_0020164 3300046536 Bacteria 4118
761 Ga0495587_0104905 3300046536 Bacteria 1626
762 Ga0495645_0001100 3300046543 Bacteria 18313
763 Ga0495645_0008216 3300046543 Bacteria 7279
764 Ga0495645_0021367 3300046543 Bacteria 4678
765 Ga0495645_0028709 3300046543 Bacteria 4042
766 Ga0495645_0031746 3300046543 Bacteria 3849
767 Ga0495645_0055887 3300046543 Bacteria 2865
768 Ga0495645_0057243 3300046543 Bacteria 2830
769 Ga0495645_0132004 3300046543 Bacteria 1749
770 Ga0495667_0000054 3300046559 Bacteria 105009
771 Ga0495667_0001016 3300046559 Bacteria 18127
772 Ga0495667_0003509 3300046559 Bacteria 10519
773 Ga0495667_0005370 3300046559 Bacteria 8664
774 Ga0495667_0008650 3300046559 Bacteria 6912
775 Ga0495667_0008718 3300046559 Bacteria 6887
776 Ga0495667_0030351 3300046559 Bacteria 3633
777 Ga0495667_0065162 3300046559 Bacteria 2383
778 Ga0495634_0044036 3300046642 Bacteria 3022
779 Ga0495634_0057617 3300046642 Bacteria 2592
780 Ga0495634_0107121 3300046642 Bacteria 1800
781 Ga0495611_0067192 3300046648 Bacteria 1636
782 Ga0495635_0001264 3300046663 Bacteria 16898
783 Ga0495635_0003596 3300046663 Bacteria 10733
784 Ga0495635_0030032 3300046663 Bacteria 3778
785 Ga0495635_0030207 3300046663 Bacteria 3765
786 Ga0495635_0033733 3300046663 Bacteria 3551
787 Ga0495635_0038410 3300046663 Bacteria 3315
788 Ga0495659_0049178 3300046664 Bacteria 1530
789 Ga0495657_0000022 3300046675 Bacteria 151837
790 Ga0495657_0002053 3300046675 Bacteria 17157
791 Ga0495657_0025333 3300046675 Bacteria 4214
792 Ga0495657_0056185 3300046675 Bacteria 2622
793 Ga0495657_0091134 3300046675 Bacteria 1956
794 Ga0495657_0113762 3300046675 Bacteria 1711
795 Ga0495599_0000125 3300046678 Bacteria 50781
796 Ga0495599_0086416 3300046678 Bacteria 1958
797 Ga0495623_0000416 3300046679 Bacteria 28025
798 Ga0495623_0023167 3300046679 Bacteria 4007
799 Ga0495623_0033514 3300046679 Bacteria 3295
800 Ga0495623_0037893 3300046679 Bacteria 3083
801 Ga0495623_0058265 3300046679 Bacteria 2428
802 Ga0495623_0100795 3300046679 Bacteria 1759
803 Ga0495646_0017254 3300046680 Bacteria 4581
804 Ga0495646_0019999 3300046680 Bacteria 4233
805 Ga0495646_0076103 3300046680 Bacteria 1966
806 Ga0495646_0136431 3300046680 Bacteria 1376
807 Ga0495646_0150015 3300046680 Bacteria 1297
808 Ga0495647_0021475 3300046681 Bacteria 2324
809 Ga0495658_0076226 3300046683 Bacteria 1959
810 Ga0495658_0167186 3300046683 Bacteria 1359
811 Ga0495613_0031895 3300046689 Bacteria 3913
812 Ga0495624_0009088 3300046690 Bacteria 6894
813 Ga0495624_0013469 3300046690 Bacteria 5575
814 Ga0495624_0114947 3300046690 Bacteria 1654
815 Ga0495624_0128899 3300046690 Bacteria 1551
816 Ga0495670_0028797 3300046691 Bacteria 2754
817 Ga0495600_0008548 3300046809 Bacteria 6296
818 Ga0495600_0011991 3300046809 Bacteria 5411
819 Ga0495600_0052868 3300046809 Bacteria 2652
820 Ga0495600_0055207 3300046809 Bacteria 2594
821 Ga0495600_0134971 3300046809 Bacteria 1603
822 Ga0495600_0200203 3300046809 Bacteria 1283
823 Ga0495600_0219902 3300046809 Bacteria 1215
824 Ga0495581_0010470 3300047315 Bacteria 5361
825 Ga0495581_0015106 3300047315 Bacteria 4482
826 Ga0495581_0086599 3300047315 Bacteria 1816
827 Ga0495581_0147695 3300047315 Bacteria 1372
828 Ga0495604_0000022 3300047317 Bacteria 151744
829 Ga0495604_0030817 3300047317 Bacteria 4256
830 Ga0495604_0034218 3300047317 Bacteria 4021
831 Ga0495604_0136622 3300047317 Bacteria 1756
832 Ga0495604_0171420 3300047317 Bacteria 1525
833 Ga0495604_0184356 3300047317 Bacteria 1458
834 Ga0495674_0002831 3300047319 Bacteria 16861
835 Ga0495674_0008396 3300047319 Bacteria 9843
836 Ga0495674_0025284 3300047319 Bacteria 5446
837 Ga0495674_0027125 3300047319 Bacteria 5238
838 Ga0495674_0032708 3300047319 Bacteria 4715
839 Ga0495674_0186190 3300047319 Bacteria 1727
840 Ga0495676_0261425 3300047321 Bacteria 1177
841 Ga0495680_0000154 3300047322 Bacteria 69567
842 Ga0495680_0005823 3300047322 Bacteria 11532
843 Ga0495680_0011807 3300047322 Bacteria 7715
844 Ga0495680_0064853 3300047322 Bacteria 2799
845 Ga0495680_0203865 3300047322 Bacteria 1418
846 Ga0495680_0224846 3300047322 Bacteria 1338
847 Ga0495680_0338032 3300047322 Bacteria 1051
848 Ga0495675_0000843 3300047444 Bacteria 18757
849 Ga0495675_0013912 3300047444 Bacteria 5088
850 Ga0495675_0020526 3300047444 Bacteria 4203
851 Ga0495675_0031919 3300047444 Bacteria 3363
852 Ga0495675_0045040 3300047444 Bacteria 2809
853 Ga0495675_0081429 3300047444 Bacteria 2038
854 Ga0495675_0139513 3300047444 Bacteria 1503
855 Ga0495677_0062292 3300047445 Bacteria 1384
856 Ga0495684_0002351 3300047471 Bacteria 15113
857 Ga0495684_0020511 3300047471 Bacteria 5094
858 Ga0495684_0020760 3300047471 Bacteria 5060
859 Ga0495684_0029724 3300047471 Bacteria 4193
860 Ga0495684_0045475 3300047471 Bacteria 3360
861 Ga0495684_0051985 3300047471 Bacteria 3126
862 Ga0495684_0072458 3300047471 Bacteria 2617
863 Ga0495684_0144903 3300047471 Bacteria 1779
864 Ga0495593_0005889 3300047673 Bacteria 7222
865 Ga0495593_0025477 3300047673 Bacteria 3274
866 Ga0495602_0000195 3300048088 Bacteria 57149
867 Ga0495602_0000251 3300048088 Bacteria 50166
868 Ga0495602_0071257 3300048088 Bacteria 2968
869 Ga0495602_0129599 3300048088 Bacteria 2014
870 Ga0495602_0274928 3300048088 Bacteria 1243
871 Ga0495602_0328137 3300048088 Bacteria 1111
872 Ga0495614_0086759 3300048089 Bacteria 1359
873 Ga0496100_0054147 3300048903 Bacteria 2615
874 Ga0496101_0002786 3300048904 Bacteria 10718
875 Ga0496102_0006094 3300048905 Bacteria 10280
876 Ga0496102_0044150 3300048905 Bacteria 4044
877 Ga0496102_0061553 3300048905 Bacteria 3435
878 Ga0496103_0109747 3300048906 Bacteria 1752
879 Ga0496104_0000798 3300048907 Bacteria 27060
880 Ga0496104_0012341 3300048907 Bacteria 7680
881 Ga0496104_0068816 3300048907 Bacteria 3364
882 Ga0496104_0122788 3300048907 Bacteria 2493
883 Ga0496105_0012818 3300048908 Bacteria 6645
884 Ga0496105_0016937 3300048908 Bacteria 5831
885 Ga0496105_0018502 3300048908 Bacteria 5603
886 Ga0496105_0024086 3300048908 Bacteria 4944
887 Ga0496106_0034290 3300048909 Bacteria 3790
888 Ga0496106_0105687 3300048909 Bacteria 2187
889 Ga0496106_0287040 3300048909 Bacteria 1319
890 Ga0496107_0106800 3300048910 Bacteria 2056
891 Ga0496107_0146431 3300048910 Bacteria 1746
892 Ga0496107_0357290 3300048910 Bacteria 1087
893 Ga0496108_0073187 3300048911 Bacteria 2893
894 Ga0496108_0146718 3300048911 Bacteria 2034
895 Ga0496108_0300630 3300048911 Bacteria 1398
896 Ga0496109_0009817 3300048912 Bacteria 8171
897 Ga0496109_0208517 3300048912 Bacteria 1837
898 Ga0496110_0091221 3300048913 Bacteria 2725
899 Ga0496110_0177546 3300048913 Bacteria 1933
900 Ga0496110_0316810 3300048913 Bacteria 1421
901 Ga0496110_0346966 3300048913 Bacteria 1352
902 Ga0496111_0032415 3300048914 Bacteria 3725
903 Ga0496111_0051138 3300048914 Bacteria 2983
904 Ga0496112_0053238 3300048915 Bacteria 3974
905 Ga0496112_0104811 3300048915 Bacteria 2798
906 Ga0496112_0108323 3300048915 Bacteria 2748
907 Ga0496113_0016988 3300048916 Bacteria 5039
908 Ga0496113_0024157 3300048916 Bacteria 4316
909 Ga0496113_0051817 3300048916 Bacteria 3063
910 Ga0496113_0070327 3300048916 Bacteria 2660
911 Ga0496114_0100327 3300048917 Bacteria 2470
912 Ga0496114_0139974 3300048917 Bacteria 2094
913 Ga0496115_0015886 3300048918 Bacteria 5720
914 Ga0496115_0035994 3300048918 Bacteria 3918
915 Ga0496115_0069974 3300048918 Bacteria 2843
916 Ga0496115_0162714 3300048918 Bacteria 1845
917 Ga0496119_0003055 3300048922 Bacteria 17709
918 Ga0496121_0210719 3300048924 Bacteria 1377
919 Ga0496126_0078461 3300048929 Bacteria 2926
920 Ga0496126_0180939 3300048929 Bacteria 1791
921 Ga0501031_0174904 3300049568 Bacteria 1402
922 Ga0501032_0100248 3300049569 Bacteria 1919
923 Ga0501033_0149713 3300049570 Bacteria 1684
924 Ga0501036_0003648 3300049572 Bacteria 12312
925 Ga0501037_0120427 3300049573 Bacteria 1887
926 Ga0501038_0001572 3300049574 Bacteria 21145
927 Ga0501038_0109061 3300049574 Bacteria 2294
928 Ga0501039_0000354 3300049575 Bacteria 32857
929 Ga0501040_0000917 3300049576 Bacteria 18488
930 Ga0501041_0022606 3300049577 Bacteria 3765
931 Ga0501042_0017637 3300049578 Bacteria 4927
932 Ga0501042_0066361 3300049578 Bacteria 2579
933 Ga0501046_0071323 3300049580 Bacteria 2699
934 Ga0501047_0000141 3300049581 Bacteria 88104
935 Ga0501048_0011341 3300049582 Bacteria 6646
936 Ga0501068_0011701 3300049584 Bacteria 4960
937 Ga0501072_0001751 3300049588 Bacteria 16134
938 Ga0501072_0081895 3300049588 Bacteria 2559
939 Ga0501074_0001654 3300049590 Bacteria 15132
940 Ga0501074_0092134 3300049590 Bacteria 2170
941 Ga0501075_0000450 3300049591 Bacteria 24475
942 Ga0501076_0032057 3300049592 Bacteria 4101
943 Ga0501077_0010629 3300049593 Bacteria 5732
944 Ga0501079_0001334 3300049741 Bacteria 17363
945 Ga0501080_0217989 3300049742 Bacteria 1747
946 Ga0501081_0005425 3300049743 Bacteria 8231
947 Ga0501035_0295741 3300049822 Bacteria 1365
948 Ga0501045_0003401 3300049824 Bacteria 10897
949 Ga0501045_0021181 3300049824 Bacteria 4648
950 nmdc:mga05p37_1958_c1 3300050507 Bacteria 24006
951 nmdc:mga05p37_21880_c1 3300050507 Bacteria 7748
952 nmdc:mga05p37_220523_c1 3300050507 Bacteria 2289
953 nmdc:mga05p37_558250_c1 3300050507 Bacteria 1302
954 nmdc:mga05p37_61924_c1 3300050507 Bacteria 4606
955 nmdc:mga09592_112556_c1 3300050508 Bacteria 2335
956 nmdc:mga09592_368255_c1 3300050508 Bacteria 1243
957 nmdc:mga09592_4052_c1 3300050508 Bacteria 11826
958 nmdc:mga0qj67_10319_c1 3300050509 Bacteria 6976
959 nmdc:mga0qj67_314_c1 3300050509 Bacteria 33600
960 nmdc:mga0qj67_43141_c1 3300050509 Bacteria 3552
961 nmdc:mga06r32_21997_c1 3300050510 Bacteria 5890
962 nmdc:mga06r32_28294_c1 3300050510 Bacteria 5243
963 nmdc:mga06r32_629_c3 3300050510 Bacteria 4841
964 nmdc:mga08y16_11933_c1 3300050511 Bacteria 9125
965 nmdc:mga08y16_132702_c1 3300050511 Bacteria 2589
966 nmdc:mga08y16_136272_c1 3300050511 Bacteria 2552
967 nmdc:mga08y16_30087_c1 3300050511 Bacteria 5716
968 nmdc:mga0n895_10127_c1 3300050512 Bacteria 8299
969 nmdc:mga0n895_18120_c1 3300050512 Bacteria 6510
970 nmdc:mga0n895_262196_c1 3300050512 Bacteria 1754
971 nmdc:mga0n895_416606_c1 3300050512 Bacteria 1358
972 nmdc:mga0n895_75353_c1 3300050512 Bacteria 3354
973 nmdc:mga0rr50_223505_c1 3300050513 Bacteria 1555
974 nmdc:mga0rr50_234658_c1 3300050513 Bacteria 1519
975 nmdc:mga0rr50_59627_c1 3300050513 Bacteria 2867
976 nmdc:mga08x19_191754_c1 3300050514 Bacteria 1398
977 nmdc:mga08x19_31370_c1 3300050514 Bacteria 3342
978 nmdc:mga08x19_33680_c1 3300050514 Bacteria 3234
979 nmdc:mga0a205_101699_c1 3300050515 Bacteria 2773
980 nmdc:mga0a205_15293_c1 3300050515 Bacteria 7170
981 nmdc:mga0a205_34049_c1 3300050515 Bacteria 4887
982 nmdc:mga0a205_42659_c1 3300050515 Bacteria 4371
983 nmdc:mga0a205_99733_c1 3300050515 Bacteria 2803
984 Ga0495601_0046037 3300053077 Bacteria 2745
985 Ga0495601_0070273 3300053077 Bacteria 2235
986 Ga0495601_0077583 3300053077 Bacteria 2128
987 Ga0495601_0077975 3300053077 Bacteria 2122
988 Ga0495601_0098392 3300053077 Bacteria 1888
989 Ga0495601_0228448 3300053077 Bacteria 1215
990 Ga0495601_0249047 3300053077 Bacteria 1160
991 Ga0495612_0003726 3300053078 Bacteria 6333
992 Ga0495612_0004582 3300053078 Bacteria 5731
993 Ga0495612_0008163 3300053078 Bacteria 4256
994 Ga0495612_0019187 3300053078 Bacteria 2739
995 Ga0495612_0039241 3300053078 Bacteria 1925
996 Ga0495612_0087585 3300053078 Bacteria 1314
997 Ga0495595_0001056 3300053084 Bacteria 10645
998 Ga0495595_0013842 3300053084 Bacteria 3413
999 Ga0495595_0017836 3300053084 Bacteria 3058
1000 Ga0495595_0034282 3300053084 Bacteria 2295
1001 Ga0495595_0052060 3300053084 Bacteria 1899
1002 Ga0495595_0083694 3300053084 Bacteria 1523
1003 Ga0495619_0041514 3300053085 Bacteria 3009
1004 Ga0495619_0056829 3300053085 Bacteria 2595
1005 Ga0495619_0115459 3300053085 Bacteria 1837
1006 Ga0500644_0001435 3300053088 Bacteria 6304
1007 Ga0501084_0013673 3300054114 Bacteria 6718
1008 Ga0501084_0014695 3300054114 Bacteria 6492
1009 Ga0501084_0352786 3300054114 Bacteria 1243
1010 Ga0590075_005988 3300059424 Bacteria 2877
1011 Ga0590077_001146 3300059426 Bacteria 6467
1012 Ga0501082_0007058 3300060353 Bacteria 9697
1013 Ga0501082_0033886 3300060353 Bacteria 4405
1014 Ga0466962_0095767 3300061719 Bacteria 1423
1015 Ga0530510_0000669 3300061734 Bacteria 22218
1016 2515496569 2515154088 Bacteria 5526283
1017 2515718426 2515154129 Bacteria 5584369
1018 2515756807 2515154137 Bacteria 5711575
1019 2515855258 2515154155 Bacteria 7985436
1020 2516083418 2515154202 Bacteria 5471270
1021 2516089330 2515154203 Bacteria 5458536
1022 2676473578 2675903058 Bacteria 6822861
1023 2676480256 2675903059 Bacteria 8644972
1024 2686539196 2684623035 Bacteria 8032739
1025 2731909024 2731639228 Bacteria 4187555
1026 2799184882 2799112218 Bacteria 4315149
1027 2827632091 2827628540 Bacteria 6858585
1028 2832007879 2832004796 Bacteria 6538017
1029 2855685961 2855683550 Bacteria 7134265
1030 2861524772 2861520306 Bacteria 8348283
1031 2866068786 2866065130 Bacteria 6518152
1032 2895890449 2895880812 Bacteria 11255272
1033 8003858437 8003856774 Bacteria 7675274
1034 8056056906 8056054917 Bacteria 5736694
1035 Ga0213875_10000125
1036 JGI25407J50210_10018873
1037 Ga0070658_10000726
1038 Ga0070658_10167961
1039 Ga0070676_10043582
1040 Ga0070683_100072950
1041 Ga0070683_100173090
1042 Ga0070683_100220782
1043 Ga0068869_100006152
1044 Ga0068869_100274442
1045 Ga0070666_10106644
1046 Ga0070680_100043236
1047 Ga0070680_100056299
1048 Ga0070680_100257496
1049 Ga0068868_100044731
1050 Ga0070660_100056267
1051 Ga0070660_100085659
1052 Ga0070687_100007727
1053 Ga0070692_10003994
1054 Ga0070675_100028479
1055 Ga0070671_100044503
1056 Ga0070673_100003932
1057 Ga0070673_100038754
1058 Ga0070659_100005916
1059 Ga0070659_100010121
1060 Ga0070659_100067507
1061 Ga0070659_100176405
1062 Ga0070659_100360254
1063 Ga0070667_100211942
1064 Ga0070709_10001361
1065 Ga0070709_10012963
1066 Ga0070709_10036675
1067 Ga0070709_10088459
1068 Ga0070709_10114686
1069 Ga0070714_100000545
1070 Ga0070714_100001325
1071 Ga0070714_100025088
1072 Ga0070714_100117982
1073 Ga0070713_100000483
1074 Ga0070713_100003097
1075 Ga0070713_100008642
1076 Ga0070713_100012555
1077 Ga0070713_100021482
1078 Ga0070713_100149652
1079 Ga0070713_100165594
1080 Ga0070710_10000539
1081 Ga0070710_10000864
1082 Ga0070710_10016620
1083 Ga0070710_10063603
1084 Ga0070710_10085268
1085 Ga0070701_10085083
1086 Ga0070711_100027416
1087 Ga0070711_100056913
1088 Ga0070711_100127218
1089 Ga0070708_100001278
1090 Ga0070708_100015039
1091 Ga0070708_100198649
1092 Ga0070708_100238464
1093 Ga0070663_100026128
1094 Ga0070663_100349091
1095 Ga0070681_10087816
1096 Ga0070681_10101000
1097 Ga0070681_10174259
1098 Ga0070681_10383872
1099 Ga0070681_10390902
1100 Ga0070681_10393953
1101 Ga0070681_10537162
1102 Ga0070685_10060058
1103 Ga0070706_100000990
1104 Ga0070706_100001894
1105 Ga0070706_100004349
1106 Ga0070706_100008020
1107 Ga0070706_100024464
1108 Ga0070706_100053956
1109 Ga0070706_100057020
1110 Ga0070706_100083098
1111 Ga0070706_100096173
1112 Ga0070707_100000256
1113 Ga0070707_100004570
1114 Ga0070707_100007016
1115 Ga0070707_100026268
1116 Ga0070707_100029674
1117 Ga0070707_100168762
1118 Ga0070707_100172512
1119 Ga0070707_100180529
1120 Ga0070707_100198649
1121 Ga0070707_100233617
1122 Ga0070707_100254561
1123 Ga0070707_100305997
1124 Ga0070698_100000292
1125 Ga0070698_100000333
1126 Ga0070698_100000898
1127 Ga0070698_100002525
1128 Ga0070698_100013017
1129 Ga0070698_100017040
1130 Ga0070698_100017971
1131 Ga0070698_100051847
1132 Ga0070698_100070857
1133 Ga0070698_100086838
1134 Ga0070698_100131717
1135 Ga0070698_100228475
1136 Ga0070699_100020685
1137 Ga0070699_100028148
1138 Ga0070699_100221012
1139 Ga0070679_100034617
1140 Ga0070679_100040543
1141 Ga0070679_100053534
1142 Ga0070679_100085114
1143 Ga0070679_100173911
1144 Ga0070679_100207892
1145 Ga0070697_100108411
1146 Ga0070697_100140261
1147 Ga0068853_100227422
1148 Ga0068853_100331322
1149 Ga0070686_100004813
1150 Ga0070696_100008315
1151 Ga0070693_100003713
1152 Ga0070693_100016084
1153 Ga0070665_100006607
1154 Ga0070665_100117827
1155 Ga0070665_100147095
1156 Ga0068855_100449672
1157 Ga0070664_100016206
1158 Ga0068854_100125742
1159 Ga0068856_100115958
1160 Ga0068856_100320759
1161 Ga0068856_100380650
1162 Ga0070702_100000031
1163 Ga0070702_100030640
1164 Ga0068852_100011289
1165 Ga0068852_100295725
1166 Ga0068859_100066935
1167 Ga0068859_100443735
1168 Ga0068864_100058887
1169 Ga0068861_100014024
1170 Ga0068861_100220936
1171 Ga0068861_100264042
1172 Ga0068851_10035674
1173 Ga0068870_10000614
1174 Ga0068863_100021114
1175 Ga0068863_100111276
1176 Ga0068863_100144648
1177 Ga0068858_100180277
1178 Ga0068858_100188374
1179 Ga0068860_100043085
1180 Ga0081455_10057618
1181 Ga0081455_10156068
1182 Ga0081538_10002786
1183 Ga0081538_10008955
1184 Ga0081538_10026674
1185 Ga0081538_10034098
1186 Ga0081538_10037427
1187 Ga0081540_1000250
1188 Ga0081540_1000330
1189 Ga0081540_1005418
1190 Ga0081540_1020749
1191 Ga0081540_1032375
1192 Ga0081539_10004919
1193 Ga0081539_10018877
1194 Ga0081539_10150970
1195 Ga0070717_10001205
1196 Ga0070717_10002725
1197 Ga0070717_10011881
1198 Ga0070717_10050812
1199 Ga0070717_10076722
1200 Ga0070717_10134834
1201 Ga0070717_10263592
1202 Ga0070717_10461944
1203 Ga0075432_10026310
1204 Ga0070715_10052548
1205 Ga0070715_10057037
1206 Ga0070716_100001415
1207 Ga0070716_100026533
1208 Ga0070716_100045435
1209 Ga0070712_100002052
1210 Ga0070712_100008902
1211 Ga0070712_100014062
1212 Ga0070712_100093705
1213 Ga0070712_100398840
1214 Ga0097621_100002544
1215 Ga0097621_100037665
1216 Ga0097621_100111339
1217 Ga0068871_100047631
1218 Ga0068871_100091961
1219 Ga0068871_100129495
1220 Ga0075428_100020125
1221 Ga0075428_100062887
1222 Ga0075428_100282093
1223 Ga0075430_100000294
1224 Ga0075430_100001663
1225 Ga0075430_100006545
1226 Ga0075430_100155213
1227 Ga0075431_100046671
1228 Ga0075431_100063910
1229 Ga0075431_100272902
1230 Ga0075433_10031211
1231 Ga0075433_10049564
1232 Ga0075433_10143574
1233 Ga0075434_100009917
1234 Ga0075434_100018423
1235 Ga0075434_100044958
1236 Ga0075434_100216438
1237 Ga0075429_100002678
1238 Ga0075429_100044119
1239 Ga0075429_100116528
1240 Ga0075436_100004879
1241 Ga0075436_100074055
1242 Ga0097620_100066940
1243 Ga0097620_100443771
1244 Ga0075435_100064936
1245 Ga0075435_100232998
1246 Ga0075435_100328524
1247 Ga0105240_10251979
1248 Ga0111539_10032226
1249 Ga0111539_10047409
1250 Ga0105245_10005437
1251 Ga0105245_10056487
1252 Ga0105247_10053503
1253 Ga0114129_10006711
1254 Ga0114129_10009018
1255 Ga0114129_10047822
1256 Ga0114129_10166468
1257 Ga0114129_10184699
1258 Ga0114129_10412805
1259 Ga0105243_10365331
1260 Ga0105241_10379178
1261 Ga0105248_10152913
1262 Ga0105248_10294461
1263 Ga0105237_10033633
1264 Ga0105238_10129275
1265 Ga0105238_10290145
1266 Ga0105249_10073392
1267 Ga0099796_10050215
1268 Ga0105239_10036023
1269 Ga0157313_1001542
1270 Ga0157371_10059306
1271 Ga0157371_10137477
1272 Ga0157370_10049599
1273 Ga0157370_10057438
1274 Ga0157370_10090646
1275 Ga0157369_10011739
1276 Ga0157369_10264471
1277 Ga0157374_10020729
1278 Ga0157374_10259101
1279 Ga0163162_10013494
1280 Ga0163162_10127754
1281 Ga0157375_10193002
1282 Ga0157375_10448831
1283 Ga0163163_10001600
1284 Ga0157379_10017361
1285 Ga0157379_10146024
1286 Ga0157379_10150130
1287 Ga0157376_10103696
1288 Ga0163161_10099487
1289 Ga0206349_1541197
1290 Ga0206351_10996409
1291 Ga0206354_10500860
1292 Ga0206354_10593962
1293 Ga0213873_10019370
1294 Ga0213875_10000250
1295 Ga0213875_10016542
1296 Ga0213875_10033159
1297 Ga0213871_10050030
1298 Ga0224712_10003353
1299 Ga0224712_10012929
1300 Ga0224712_10013796
1301 Ga0224712_10017923
1302 Ga0224712_10021524
1303 Ga0224712_10021811
1304 Ga0224712_10127430
1305 Ga0224572_1000791
1306 Ga0207656_10020636
1307 Ga0207653_10008398
1308 Ga0207692_10001094
1309 Ga0207692_10001437
1310 Ga0207692_10004739
1311 Ga0207692_10025602
1312 Ga0207692_10033061
1313 Ga0207692_10138175
1314 Ga0207692_10244113
1315 Ga0207710_10028052
1316 Ga0207688_10017900
1317 Ga0207688_10106533
1318 Ga0207680_10025579
1319 Ga0207685_10022394
1320 Ga0207685_10039962
1321 Ga0207699_10001830
1322 Ga0207699_10006266
1323 Ga0207699_10011057
1324 Ga0207699_10074359
1325 Ga0207699_10154582
1326 Ga0207643_10000204
1327 Ga0207705_10001642
1328 Ga0207684_10001419
1329 Ga0207684_10002612
1330 Ga0207684_10002799
1331 Ga0207684_10015342
1332 Ga0207684_10092354
1333 Ga0207684_10186921
1334 Ga0207654_10054753
1335 Ga0207707_10035796
1336 Ga0207707_10098332
1337 Ga0207707_10109135
1338 Ga0207695_10287073
1339 Ga0207695_10361244
1340 Ga0207671_10071968
1341 Ga0207671_10151559
1342 Ga0207693_10001078
1343 Ga0207693_10005180
1344 Ga0207693_10008773
1345 Ga0207693_10013430
1346 Ga0207693_10014990
1347 Ga0207693_10085727
1348 Ga0207693_10138270
1349 Ga0207663_10010431
1350 Ga0207663_10014695
1351 Ga0207663_10039635
1352 Ga0207663_10074280
1353 Ga0207663_10084495
1354 Ga0207660_10038844
1355 Ga0207660_10254343
1356 Ga0207662_10011478
1357 Ga0207662_10052164
1358 Ga0207657_10044561
1359 Ga0207657_10089951
1360 Ga0207657_10105478
1361 Ga0207657_10165197
1362 Ga0207649_10018450
1363 Ga0207652_10124104
1364 Ga0207652_10159071
1365 Ga0207652_10219371
1366 Ga0207652_10403798
1367 Ga0207646_10000950
1368 Ga0207646_10001124
1369 Ga0207646_10031779
1370 Ga0207646_10044143
1371 Ga0207646_10072069
1372 Ga0207646_10102009
1373 Ga0207646_10184097
1374 Ga0207646_10201908
1375 Ga0207650_10002710
1376 Ga0207659_10004400
1377 Ga0207687_10006217
1378 Ga0207687_10074652
1379 Ga0207687_10075188
1380 Ga0207700_10001672
1381 Ga0207700_10002173
1382 Ga0207700_10005055
1383 Ga0207700_10020413
1384 Ga0207700_10021329
1385 Ga0207700_10022331
1386 Ga0207700_10034120
1387 Ga0207700_10057202
1388 Ga0207700_10096005
1389 Ga0207700_10301731
1390 Ga0207664_10000427
1391 Ga0207664_10000940
1392 Ga0207664_10002584
1393 Ga0207664_10007361
1394 Ga0207664_10020499
1395 Ga0207664_10021524
1396 Ga0207664_10043770
1397 Ga0207664_10052186
1398 Ga0207664_10053493
1399 Ga0207664_10080047
1400 Ga0207664_10191859
1401 Ga0207664_10304935
1402 Ga0207644_10007562
1403 Ga0207644_10044521
1404 Ga0207690_10000219
1405 Ga0207690_10030154
1406 Ga0207690_10333355
1407 Ga0207686_10114479
1408 Ga0207670_10035613
1409 Ga0207665_10001719
1410 Ga0207665_10002491
1411 Ga0207665_10017416
1412 Ga0207665_10025411
1413 Ga0207665_10056283
1414 Ga0207665_10134613
1415 Ga0207665_10141555
1416 Ga0207691_10029944
1417 Ga0207711_10178971
1418 Ga0207689_10000223
1419 Ga0207689_10017179
1420 Ga0207661_10130930
1421 Ga0207661_10510587
1422 Ga0207679_10006307
1423 Ga0207712_10023350
1424 Ga0207712_10098587
1425 Ga0207668_10127648
1426 Ga0207640_10046715
1427 Ga0207640_10270453
1428 Ga0207677_10018630
1429 Ga0207703_10040754
1430 Ga0207639_10083405
1431 Ga0207639_10328799
1432 Ga0207678_10002516
1433 Ga0207678_10006007
1434 Ga0207708_10046904
1435 Ga0207702_10043655
1436 Ga0207702_10056949
1437 Ga0207702_10070243
1438 Ga0207702_10130343
1439 Ga0207702_10370778
1440 Ga0207702_10386642
1441 Ga0207641_10009542
1442 Ga0207676_10001541
1443 Ga0207676_10156658
1444 Ga0207674_10004964
1445 Ga0207674_10123468
1446 Ga0207675_100002250
1447 Ga0207675_100037515
1448 Ga0207675_100265546
1449 Ga0207683_10000804
1450 Ga0207683_10005606
1451 Ga0207683_10024244
1452 Ga0207698_10002366
1453 Ga0207698_10317204
1454 Ga0207428_10000537
1455 Ga0207428_10009923
1456 Ga0207428_10068605
1457 Ga0268266_10023015
1458 Ga0268266_10525110
1459 Ga0265336_10004601
1460 Ga0307517_10074469
1461 Ga0307515_10001066
1462 Ga0307515_10009042
1463 Ga0307515_10170578
1464 Ga0265338_10002247
1465 Ga0265338_10014640
1466 Ga0265338_10031380
1467 Ga0307512_10003683
1468 Ga0307512_10025517
1469 Ga0316181_1149483
1470 Ga0265330_10081434
1471 Ga0265320_10022258
1472 Ga0265325_10027015
1473 Ga0265340_10008623
1474 Ga0265340_10013418
1475 Ga0265340_10034361
1476 Ga0265316_10042524
1477 Ga0307513_10000001
1478 Ga0307513_10036904
1479 Ga0307509_10178452
1480 Ga0307408_100018031
1481 Ga0307408_100030377
1482 Ga0307408_100206281
1483 Ga0265313_10046513
1484 Ga0307508_10033247
1485 Ga0307508_10306467
1486 Ga0316579_10011444
1487 Ga0316579_10079237
1488 Ga0265314_10022618
1489 Ga0265314_10136154
1490 Ga0265342_10094939
1491 Ga0316576_10014040
1492 Ga0316578_10020196
1493 Ga0307516_10001792
1494 Ga0307405_10016418
1495 Ga0307405_10034777
1496 Ga0307405_10071517
1497 Ga0307413_10002297
1498 Ga0307413_10028958
1499 Ga0307413_10126857
1500 Ga0307413_10174920
1501 Ga0307410_10008218
1502 Ga0307410_10012065
1503 Ga0307410_10017362
1504 Ga0307410_10151531
1505 Ga0326468_10000905
1506 Ga0307406_10005635
1507 Ga0307406_10080903
1508 Ga0307406_10140744
1509 Ga0307407_10010091
1510 Ga0307412_10037573
1511 Ga0307412_10176155
1512 Ga0307409_100042353
1513 Ga0307409_100062244
1514 Ga0307409_100074136
1515 Ga0307409_100224732
1516 Ga0307416_100005911
1517 Ga0307416_100010416
1518 Ga0307416_100014187
1519 Ga0307416_100021209
1520 Ga0307416_100022814
1521 Ga0307416_100026645
1522 Ga0307416_100051710
1523 Ga0307416_100127411
1524 Ga0307416_100190815
1525 Ga0307414_10295094
1526 Ga0307411_10003583
1527 Ga0307411_10013764
1528 Ga0307411_10067943
1529 Ga0307415_100001464
1530 Ga0307415_100005414
1531 Ga0307415_100005543
1532 Ga0307415_100048312
1533 Ga0307415_100059169
1534 Ga0307415_100115846
1535 Ga0307415_100165772
1536 Ga0307415_100231174
1537 Ga0316583_10003287
1538 Ga0316585_10024611
1539 Ga0307510_10178321
1540 Ga0373930_0011979
1541 Ga0373948_0010418
1542 Ga0373926_0009034
1543 Ga0373926_0107581
1544 Ga0373928_0007014
1545 Ga0373934_0000070
1546 Ga0373934_0002196
1547 Ga0373934_0006637
1548 Ga0373940_0020952
1549 Ga0373940_0040831
1550 Ga0373944_0002438
1551 Ga0373949_0003325
1552 Ga0373949_0023621
1553 Ga0373923_0011010
1554 Ga0373923_0056349
1555 Ga0373923_0066202
1556 Ga0373932_0016751
1557 Ga0373936_0001293
1558 Ga0373936_0004164
1559 Ga0373936_0083543
1560 Ga0373939_0060424
1561 Ga0373945_0044491
1562 Ga0373953_0000185
1563 Ga0373953_0001732
1564 Ga0373953_0010341
1565 Ga0373953_0045019
1566 Ga0373953_0068325
1567 Ga0373954_0002192
1568 Ga0373954_0040812
1569 Ga0373954_0040873
1570 Ga0373954_0061833
1571 Ga0373956_0000007
1572 Ga0373956_0020043
1573 Ga0373956_0090125
1574 Ga0373956_0126010
1575 Ga0373957_0000024
1576 Ga0373957_0002117
1577 Ga0373957_0033521
1578 Ga0373960_0004470
1579 Ga0373943_0001340
1580 Ga0373943_0001795
1581 Ga0373946_0001065
1582 Ga0373946_0017131
1583 Ga0373955_0000368
1584 Ga0373955_0017001
1585 Ga0373955_0049962
1586 Ga0373955_0058166
1587 Ga0373955_0322137
1588 Ga0373942_0022330
1589 Ga0316574_0001450
1590 Ga0316574_0003741
1591 Ga0316574_0150904
1592 Ga0373924_0000372
1593 Ga0373924_0011689
1594 Ga0373924_0018862
1595 Ga0373924_0029116
1596 Ga0373924_0076608
1597 Ga0373931_0027647
1598 Ga0373935_0003744
1599 Ga0373935_0005495
1600 Ga0373935_0053505
1601 Ga0373935_0073581
1602 Ga0373935_0075094
1603 Ga0373935_0332305
1604 Ga0373927_0003060
1605 Ga0373927_0070955
1606 Ga0373933_0000002
1607 Ga0373933_0001577
1608 Ga0373933_0015191
1609 Ga0373933_0019084
1610 Ga0373933_0022077
1611 Ga0373933_0037724
1612 Ga0373933_0071489
1613 Ga0373933_0142720
1614 Ga0373947_0000007
1615 Ga0373947_0003580
1616 Ga0373937_0000014
1617 Ga0373937_0000312
1618 Ga0373937_0003119
1619 Ga0373937_0007378
1620 Ga0373937_0046082
1621 Ga0373937_0074903
1622 Ga0373937_0106572
1623 Ga0373937_0117122
1624 Ga0373937_0232432
1625 Ga0373937_0236231
1626 Ga0373937_0238112
1627 Ga0373937_0373198
1628 Ga0316582_0057528
1629 Ga0316584_0018562
1630 Ga0373925_0023473
1631 Ga0373925_0062211
1632 Ga0373925_0127897
1633 Ga0373925_0221542
1634 Ga0395899_0297566
1635 Ga0395900_0025836
1636 Ga0395900_0256887
1637 Ga0395900_0357357
1638 Ga0395898_0090208
1639 Ga0395898_0154853
1640 Ga0395898_0161474
1641 Ga0395898_0361040
1642 Ga0395905_0028781
1643 Ga0395905_0149731
1644 Ga0436364_0093921
1645 Ga0436364_0118843
1646 Ga0436364_0287407
1647 Ga0436364_0639700
1648 Ga0436364_0732570
1649 Ga0436364_0786912
1650 Ga0436364_0886432
1651 Ga0436364_0935193
1652 Ga0436364_1083867
1653 Ga0436364_1537007
1654 Ga0395901_0032412
1655 Ga0395901_0044943
1656 Ga0395901_0072361
1657 Ga0395901_0231170
1658 Ga0395901_0338218
1659 Ga0395901_0441791
1660 Ga0400485_02208
1661 Ga0400486_25692
1662 Ga0436360_0021783
1663 Ga0436360_0455054
1664 Ga0436361_0756449
1665 Ga0436363_0045890
1666 Ga0436363_0398535
1667 Ga0436363_0838504
1668 Ga0439436_0003729
1669 Ga0451853_3927494
1670 Ga0439433_0009335
1671 Ga0439442_011772
1672 Ga0439448_0000572
1673 Ga0439448_0051675
1674 Ga0439449_0005338
1675 Ga0439455_0026469
1676 Ga0439463_003040
1677 Ga0439458_0003964
1678 Ga0439464_0010056
1679 Ga0439464_0010767
1680 Ga0439460_0012086
1681 Ga0439460_0044508
1682 Ga0450916_000764
1683 Ga0466965_0142339
1684 Ga0466966_0196157
1685 Ga0466961_0017604
1686 Ga0466961_0068036
1687 Ga0466961_0233543
1688 Ga0466963_0015064
1689 Ga0466963_0038698
1690 Ga0466963_0109300
1691 Ga0466963_0267352
1692 Ga0466964_0054574
1693 Ga0466964_0063476
1694 Ga0466971_0124060
1695 Ga0466968_0000127
1696 Ga0466970_0001582
1697 Ga0466970_0032333
1698 Ga0466970_0120894
1699 Ga0466957_0002458
1700 Ga0466957_0199478
1701 Ga0466960_0014624
1702 Ga0466960_0098437
1703 Ga0466959_0163057
1704 Ga0466959_0184133
1705 Ga0466959_0285378
1706 Ga0466958_0002125
1707 Ga0466958_0025951
1708 Ga0466967_0006236
1709 Ga0466967_0097718
1710 Ga0466967_0123286
1711 Ga0466967_0141670
1712 Ga0466967_0144241
1713 Ga0466967_0168790
1714 Ga0466967_0223140
1715 Ga0495592_0000133
1716 Ga0495592_0021245
1717 Ga0495592_0027905
1718 Ga0495592_0045713
1719 Ga0495592_0145629
1720 Ga0495629_0003615
1721 Ga0495629_0120393
1722 Ga0495641_0013730
1723 Ga0495641_0026292
1724 Ga0495651_0000019
1725 Ga0495651_0001424
1726 Ga0495651_0013797
1727 Ga0495651_0030057
1728 Ga0495651_0126446
1729 Ga0495653_0003782
1730 Ga0495653_0006300
1731 Ga0495653_0010412
1732 Ga0495653_0015651
1733 Ga0495653_0017351
1734 Ga0495653_0098404
1735 Ga0495653_0151850
1736 Ga0495582_0000493
1737 Ga0495582_0015285
1738 Ga0495582_0080091
1739 Ga0495639_0005262
1740 Ga0495639_0007891
1741 Ga0495662_0020889
1742 Ga0495662_0103426
1743 Ga0495662_0160612
1744 Ga0495664_0006872
1745 Ga0495664_0009160
1746 Ga0495664_0010930
1747 Ga0495664_0017711
1748 Ga0495664_0020928
1749 Ga0495664_0062050
1750 Ga0495664_0108657
1751 Ga0495594_0097426
1752 Ga0495596_0022225
1753 Ga0495608_0000028
1754 Ga0495608_0009390
1755 Ga0495608_0014063
1756 Ga0495608_0020716
1757 Ga0495608_0044749
1758 Ga0495608_0108063
1759 Ga0495608_0236051
1760 Ga0495608_0275611
1761 Ga0495618_0052774
1762 Ga0495618_0108712
1763 Ga0495618_0130471
1764 Ga0495628_0000337
1765 Ga0495628_0010312
1766 Ga0495628_0088817
1767 Ga0495628_0254132
1768 Ga0495630_0051465
1769 Ga0495630_0078411
1770 Ga0495630_0101646
1771 Ga0495630_0156506
1772 Ga0495632_0072168
1773 Ga0495644_0072826
1774 Ga0495666_0058276
1775 Ga0495666_0078256
1776 Ga0495652_0000031
1777 Ga0495652_0019111
1778 Ga0495652_0033547
1779 Ga0495652_0071909
1780 Ga0495652_0095275
1781 Ga0495652_0103519
1782 Ga0495652_0152813
1783 Ga0495665_0012938
1784 Ga0495665_0052706
1785 Ga0495665_0111120
1786 Ga0495640_0046881
1787 Ga0495640_0056386
1788 Ga0495640_0086003
1789 Ga0495640_0223359
1790 Ga0495586_0022724
1791 Ga0495587_0000023
1792 Ga0495587_0010018
1793 Ga0495587_0017955
1794 Ga0495587_0020164
1795 Ga0495587_0104905
1796 Ga0495645_0001100
1797 Ga0495645_0008216
1798 Ga0495645_0021367
1799 Ga0495645_0028709
1800 Ga0495645_0031746
1801 Ga0495645_0055887
1802 Ga0495645_0057243
1803 Ga0495645_0132004
1804 Ga0495667_0000054
1805 Ga0495667_0001016
1806 Ga0495667_0003509
1807 Ga0495667_0005370
1808 Ga0495667_0008650
1809 Ga0495667_0008718
1810 Ga0495667_0030351
1811 Ga0495667_0065162
1812 Ga0495634_0044036
1813 Ga0495634_0057617
1814 Ga0495634_0107121
1815 Ga0495611_0067192
1816 Ga0495635_0001264
1817 Ga0495635_0003596
1818 Ga0495635_0030032
1819 Ga0495635_0030207
1820 Ga0495635_0033733
1821 Ga0495635_0038410
1822 Ga0495659_0049178
1823 Ga0495657_0000022
1824 Ga0495657_0002053
1825 Ga0495657_0025333
1826 Ga0495657_0056185
1827 Ga0495657_0091134
1828 Ga0495657_0113762
1829 Ga0495599_0000125
1830 Ga0495599_0086416
1831 Ga0495623_0000416
1832 Ga0495623_0023167
1833 Ga0495623_0033514
1834 Ga0495623_0037893
1835 Ga0495623_0058265
1836 Ga0495623_0100795
1837 Ga0495646_0017254
1838 Ga0495646_0019999
1839 Ga0495646_0076103
1840 Ga0495646_0136431
1841 Ga0495646_0150015
1842 Ga0495647_0021475
1843 Ga0495658_0076226
1844 Ga0495658_0167186
1845 Ga0495613_0031895
1846 Ga0495624_0009088
1847 Ga0495624_0013469
1848 Ga0495624_0114947
1849 Ga0495624_0128899
1850 Ga0495670_0028797
1851 Ga0495600_0008548
1852 Ga0495600_0011991
1853 Ga0495600_0052868
1854 Ga0495600_0055207
1855 Ga0495600_0134971
1856 Ga0495600_0200203
1857 Ga0495600_0219902
1858 Ga0495581_0010470
1859 Ga0495581_0015106
1860 Ga0495581_0086599
1861 Ga0495581_0147695
1862 Ga0495604_0000022
1863 Ga0495604_0030817
1864 Ga0495604_0034218
1865 Ga0495604_0136622
1866 Ga0495604_0171420
1867 Ga0495604_0184356
1868 Ga0495674_0002831
1869 Ga0495674_0008396
1870 Ga0495674_0025284
1871 Ga0495674_0027125
1872 Ga0495674_0032708
1873 Ga0495674_0186190
1874 Ga0495676_0261425
1875 Ga0495680_0000154
1876 Ga0495680_0005823
1877 Ga0495680_0011807
1878 Ga0495680_0064853
1879 Ga0495680_0203865
1880 Ga0495680_0224846
1881 Ga0495680_0338032
1882 Ga0495675_0000843
1883 Ga0495675_0013912
1884 Ga0495675_0020526
1885 Ga0495675_0031919
1886 Ga0495675_0045040
1887 Ga0495675_0081429
1888 Ga0495675_0139513
1889 Ga0495677_0062292
1890 Ga0495684_0002351
1891 Ga0495684_0020511
1892 Ga0495684_0020760
1893 Ga0495684_0029724
1894 Ga0495684_0045475
1895 Ga0495684_0051985
1896 Ga0495684_0072458
1897 Ga0495684_0144903
1898 Ga0495593_0005889
1899 Ga0495593_0025477
1900 Ga0495602_0000195
1901 Ga0495602_0000251
1902 Ga0495602_0071257
1903 Ga0495602_0129599
1904 Ga0495602_0274928
1905 Ga0495602_0328137
1906 Ga0495614_0086759
1907 Ga0496100_0054147
1908 Ga0496101_0002786
1909 Ga0496102_0006094
1910 Ga0496102_0044150
1911 Ga0496102_0061553
1912 Ga0496103_0109747
1913 Ga0496104_0000798
1914 Ga0496104_0012341
1915 Ga0496104_0068816
1916 Ga0496104_0122788
1917 Ga0496105_0012818
1918 Ga0496105_0016937
1919 Ga0496105_0018502
1920 Ga0496105_0024086
1921 Ga0496106_0034290
1922 Ga0496106_0105687
1923 Ga0496106_0287040
1924 Ga0496107_0106800
1925 Ga0496107_0146431
1926 Ga0496107_0357290
1927 Ga0496108_0073187
1928 Ga0496108_0146718
1929 Ga0496108_0300630
1930 Ga0496109_0009817
1931 Ga0496109_0208517
1932 Ga0496110_0091221
1933 Ga0496110_0177546
1934 Ga0496110_0316810
1935 Ga0496110_0346966
1936 Ga0496111_0032415
1937 Ga0496111_0051138
1938 Ga0496112_0053238
1939 Ga0496112_0104811
1940 Ga0496112_0108323
1941 Ga0496113_0016988
1942 Ga0496113_0024157
1943 Ga0496113_0051817
1944 Ga0496113_0070327
1945 Ga0496114_0100327
1946 Ga0496114_0139974
1947 Ga0496115_0015886
1948 Ga0496115_0035994
1949 Ga0496115_0069974
1950 Ga0496115_0162714
1951 Ga0496119_0003055
1952 Ga0496121_0210719
1953 Ga0496126_0078461
1954 Ga0496126_0180939
1955 Ga0501031_0174904
1956 Ga0501032_0100248
1957 Ga0501033_0149713
1958 Ga0501036_0003648
1959 Ga0501037_0120427
1960 Ga0501038_0001572
1961 Ga0501038_0109061
1962 Ga0501039_0000354
1963 Ga0501040_0000917
1964 Ga0501041_0022606
1965 Ga0501042_0017637
1966 Ga0501042_0066361
1967 Ga0501046_0071323
1968 Ga0501047_0000141
1969 Ga0501048_0011341
1970 Ga0501068_0011701
1971 Ga0501072_0001751
1972 Ga0501072_0081895
1973 Ga0501074_0001654
1974 Ga0501074_0092134
1975 Ga0501075_0000450
1976 Ga0501076_0032057
1977 Ga0501077_0010629
1978 Ga0501079_0001334
1979 Ga0501080_0217989
1980 Ga0501081_0005425
1981 Ga0501035_0295741
1982 Ga0501045_0003401
1983 Ga0501045_0021181
1984 nmdc:mga05p37_1958_c1
1985 nmdc:mga05p37_21880_c1
1986 nmdc:mga05p37_220523_c1
1987 nmdc:mga05p37_558250_c1
1988 nmdc:mga05p37_61924_c1
1989 nmdc:mga09592_112556_c1
1990 nmdc:mga09592_368255_c1
1991 nmdc:mga09592_4052_c1
1992 nmdc:mga0qj67_10319_c1
1993 nmdc:mga0qj67_314_c1
1994 nmdc:mga0qj67_43141_c1
1995 nmdc:mga06r32_21997_c1
1996 nmdc:mga06r32_28294_c1
1997 nmdc:mga06r32_629_c3
1998 nmdc:mga08y16_11933_c1
1999 nmdc:mga08y16_132702_c1
2000 nmdc:mga08y16_136272_c1
2001 nmdc:mga08y16_30087_c1
2002 nmdc:mga0n895_10127_c1
2003 nmdc:mga0n895_18120_c1
2004 nmdc:mga0n895_262196_c1
2005 nmdc:mga0n895_416606_c1
2006 nmdc:mga0n895_75353_c1
2007 nmdc:mga0rr50_223505_c1
2008 nmdc:mga0rr50_234658_c1
2009 nmdc:mga0rr50_59627_c1
2010 nmdc:mga08x19_191754_c1
2011 nmdc:mga08x19_31370_c1
2012 nmdc:mga08x19_33680_c1
2013 nmdc:mga0a205_101699_c1
2014 nmdc:mga0a205_15293_c1
2015 nmdc:mga0a205_34049_c1
2016 nmdc:mga0a205_42659_c1
2017 nmdc:mga0a205_99733_c1
2018 Ga0495601_0046037
2019 Ga0495601_0070273
2020 Ga0495601_0077583
2021 Ga0495601_0077975
2022 Ga0495601_0098392
2023 Ga0495601_0228448
2024 Ga0495601_0249047
2025 Ga0495612_0003726
2026 Ga0495612_0004582
2027 Ga0495612_0008163
2028 Ga0495612_0019187
2029 Ga0495612_0039241
2030 Ga0495612_0087585
2031 Ga0495595_0001056
2032 Ga0495595_0013842
2033 Ga0495595_0017836
2034 Ga0495595_0034282
2035 Ga0495595_0052060
2036 Ga0495595_0083694
2037 Ga0495619_0041514
2038 Ga0495619_0056829
2039 Ga0495619_0115459
2040 Ga0500644_0001435
2041 Ga0501084_0013673
2042 Ga0501084_0014695
2043 Ga0501084_0352786
2044 Ga0590075_005988
2045 Ga0590077_001146
2046 Ga0501082_0007058
2047 Ga0501082_0033886
2048 Ga0466962_0095767
2049 Ga0530510_0000669
2050 2515496569
2051 2515718426
2052 2515756807
2053 2515855258
2054 2516083418
2055 2516089330
2056 2676473578
2057 2676480256
2058 2686539196
2059 2731909024
2060 2799184882
2061 2827632091
2062 2832007879
2063 2855685961
2064 2861524772
2065 2866068786
2066 2895890449
2067 8003858437
2068 8056056906

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02866

Ldh_1_C

lactate/malate dehydrogenase, alpha/beta C-terminal domain

159

320

0.95

PF00056

Ldh_1_N

lactate/malate dehydrogenase, NAD binding domain

10

156

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1guz-assembly1.cif.gz_C structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases 0.9586 3 288
1gv1-assembly1.cif.gz_C structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases 0.953 3 288
1uxi-assembly1.cif.gz_A large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface 0.9433 1 292
2hjr-assembly1.cif.gz_B crystal structure of cryptosporidium parvum malate dehydrogenase 0.9416 2 292
4ros-assembly1.cif.gz_A crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose 0.939 2 292
ID Description Score Start End Superfamily
4plhC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9778 2 142 3.40.50.720
1gv0A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9527 3 142 3.40.50.720
2d4aB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9451 4 142 3.40.50.720
4plhC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9425 2 142 3.40.50.720
6ihdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9413 2 134 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A838GIN4-F1-model_v4 Malate dehydrogenase 0.9907 1 61 GO:0016616
GO:0019752
AF-A0A357JJB3-F1-model_v4 Malate dehydrogenase 0.9885 3 63 GO:0016616
GO:0019752
AF-X0T3M2-F1-model_v4 Lactate/malate dehydrogenase N-terminal domain-containing protein 0.9829 2 204 GO:0004459
GO:0006089
GO:0006090
AF-A0A7V3PRZ4-F1-model_v4 Malate dehydrogenase (EC 1.1.1.37) 0.9762 3 193 GO:0004459
GO:0006089
GO:0006090
GO:0030060
AF-A0A7Y2UZ01-F1-model_v4 Malate dehydrogenase 0.9759 3 115 GO:0004459
GO:0006089
GO:0006090

Map