F488674
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1034 | 396 | 2068 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10000125|Ga0213875_1000012575 |
| Length | 345 |
| Sequence | MSQPDTPRRGKVAVIGAGFYGSTTAQRLAEYDIFEEVVLTDIIDGKPEGLALDMNQSRPIEGFETRVTGQTTGRSGDGYEAVAGSGIVVITAGLPRKPGMSRMDLIEVNAKIVRDVVENVVKHAPEAVLIVVSNPLDEMTALAAKVSGFPSSRVMGQAGMLDTARFSYFVAEKLGVPAGSVRTLTLGSHGDTMVPVPSACSVSGRPLGELLPAEEIDKLVTRTRNGGGEIVGLLKTGSAYYAPSAAAARMARAVAADSGDVMPVCAWVDGEYGISGVYLGVEAEIGSAGVRRVVQRDLSDTELAALREAAEAVRAKQASRSCASQGGAGPARRSPGPRPAGRRRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 101 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 102 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 164 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 165 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 171 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 175 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 179 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 194 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 195 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 196 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 197 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 199 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 211 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 212 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 213 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 227 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 236 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 237 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 240 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 241 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 242 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 243 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 244 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 245 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 246 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 247 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 248 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 249 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 250 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 251 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 252 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 257 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 258 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 259 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 332 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 333 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 334 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 372 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 374 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 375 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 377 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 378 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 379 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 380 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 381 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 382 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 383 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 384 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 385 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 386 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 387 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 388 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 389 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 390 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 391 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 392 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 393 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 394 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 395 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 396 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.1 |
| Metatranscriptomes | 1.06 |
| Isolates | 1.84 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.1 |
| Nodule | 0 |
| Rhizoplane | 4.26 |
| Rhizosphere | 91.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0213875_10000125 | 3300021388 | Bacteria | 85515 |
| 2 | JGI25407J50210_10018873 | 3300003373 | Bacteria | 1792 |
| 3 | Ga0070658_10000726 | 3300005327 | Bacteria | 28475 |
| 4 | Ga0070658_10167961 | 3300005327 | Bacteria | 1843 |
| 5 | Ga0070676_10043582 | 3300005328 | Bacteria | 2608 |
| 6 | Ga0070683_100072950 | 3300005329 | Bacteria | 3205 |
| 7 | Ga0070683_100173090 | 3300005329 | Bacteria | 2049 |
| 8 | Ga0070683_100220782 | 3300005329 | Bacteria | 1801 |
| 9 | Ga0068869_100006152 | 3300005334 | Bacteria | 7599 |
| 10 | Ga0068869_100274442 | 3300005334 | Bacteria | 1354 |
| 11 | Ga0070666_10106644 | 3300005335 | Bacteria | 1935 |
| 12 | Ga0070680_100043236 | 3300005336 | Bacteria | 3659 |
| 13 | Ga0070680_100056299 | 3300005336 | Bacteria | 3214 |
| 14 | Ga0070680_100257496 | 3300005336 | Bacteria | 1476 |
| 15 | Ga0068868_100044731 | 3300005338 | Bacteria | 3462 |
| 16 | Ga0070660_100056267 | 3300005339 | Bacteria | 3042 |
| 17 | Ga0070660_100085659 | 3300005339 | Bacteria | 2479 |
| 18 | Ga0070687_100007727 | 3300005343 | Bacteria | 4507 |
| 19 | Ga0070692_10003994 | 3300005345 | Bacteria | 6091 |
| 20 | Ga0070675_100028479 | 3300005354 | Bacteria | 4495 |
| 21 | Ga0070671_100044503 | 3300005355 | Bacteria | 3689 |
| 22 | Ga0070673_100003932 | 3300005364 | Bacteria | 9334 |
| 23 | Ga0070673_100038754 | 3300005364 | Bacteria | 3641 |
| 24 | Ga0070659_100005916 | 3300005366 | Bacteria | 8815 |
| 25 | Ga0070659_100010121 | 3300005366 | Bacteria | 6941 |
| 26 | Ga0070659_100067507 | 3300005366 | Bacteria | 2836 |
| 27 | Ga0070659_100176405 | 3300005366 | Bacteria | 1752 |
| 28 | Ga0070659_100360254 | 3300005366 | Bacteria | 1222 |
| 29 | Ga0070667_100211942 | 3300005367 | Bacteria | 1722 |
| 30 | Ga0070709_10001361 | 3300005434 | Bacteria | 13346 |
| 31 | Ga0070709_10012963 | 3300005434 | Bacteria | 4675 |
| 32 | Ga0070709_10036675 | 3300005434 | Bacteria | 2989 |
| 33 | Ga0070709_10088459 | 3300005434 | Bacteria | 2037 |
| 34 | Ga0070709_10114686 | 3300005434 | Bacteria | 1816 |
| 35 | Ga0070714_100000545 | 3300005435 | Bacteria | 27112 |
| 36 | Ga0070714_100001325 | 3300005435 | Bacteria | 17871 |
| 37 | Ga0070714_100025088 | 3300005435 | Bacteria | 4917 |
| 38 | Ga0070714_100117982 | 3300005435 | Bacteria | 2357 |
| 39 | Ga0070713_100000483 | 3300005436 | Bacteria | 25351 |
| 40 | Ga0070713_100003097 | 3300005436 | Bacteria | 10939 |
| 41 | Ga0070713_100008642 | 3300005436 | Bacteria | 7238 |
| 42 | Ga0070713_100012555 | 3300005436 | Bacteria | 6218 |
| 43 | Ga0070713_100021482 | 3300005436 | Bacteria | 4968 |
| 44 | Ga0070713_100149652 | 3300005436 | Bacteria | 2075 |
| 45 | Ga0070713_100165594 | 3300005436 | Bacteria | 1976 |
| 46 | Ga0070710_10000539 | 3300005437 | Bacteria | 17930 |
| 47 | Ga0070710_10000864 | 3300005437 | Bacteria | 14525 |
| 48 | Ga0070710_10016620 | 3300005437 | Bacteria | 3748 |
| 49 | Ga0070710_10063603 | 3300005437 | Bacteria | 2108 |
| 50 | Ga0070710_10085268 | 3300005437 | Bacteria | 1852 |
| 51 | Ga0070701_10085083 | 3300005438 | Bacteria | 1721 |
| 52 | Ga0070711_100027416 | 3300005439 | Bacteria | 3739 |
| 53 | Ga0070711_100056913 | 3300005439 | Bacteria | 2705 |
| 54 | Ga0070711_100127218 | 3300005439 | Bacteria | 1893 |
| 55 | Ga0070708_100001278 | 3300005445 | Bacteria | 19366 |
| 56 | Ga0070708_100015039 | 3300005445 | Bacteria | 6383 |
| 57 | Ga0070708_100198649 | 3300005445 | Bacteria | 1877 |
| 58 | Ga0070708_100238464 | 3300005445 | Bacteria | 1707 |
| 59 | Ga0070663_100026128 | 3300005455 | Bacteria | 3950 |
| 60 | Ga0070663_100349091 | 3300005455 | Bacteria | 1197 |
| 61 | Ga0070681_10087816 | 3300005458 | Bacteria | 3062 |
| 62 | Ga0070681_10101000 | 3300005458 | Bacteria | 2830 |
| 63 | Ga0070681_10174259 | 3300005458 | Bacteria | 2073 |
| 64 | Ga0070681_10383872 | 3300005458 | Bacteria | 1315 |
| 65 | Ga0070681_10390902 | 3300005458 | Bacteria | 1302 |
| 66 | Ga0070681_10393953 | 3300005458 | Bacteria | 1296 |
| 67 | Ga0070681_10537162 | 3300005458 | Bacteria | 1083 |
| 68 | Ga0070685_10060058 | 3300005466 | Bacteria | 2222 |
| 69 | Ga0070706_100000990 | 3300005467 | Bacteria | 30930 |
| 70 | Ga0070706_100001894 | 3300005467 | Bacteria | 21601 |
| 71 | Ga0070706_100004349 | 3300005467 | Bacteria | 13686 |
| 72 | Ga0070706_100008020 | 3300005467 | Bacteria | 9852 |
| 73 | Ga0070706_100024464 | 3300005467 | Bacteria | 5560 |
| 74 | Ga0070706_100053956 | 3300005467 | Bacteria | 3711 |
| 75 | Ga0070706_100057020 | 3300005467 | Bacteria | 3604 |
| 76 | Ga0070706_100083098 | 3300005467 | Bacteria | 2966 |
| 77 | Ga0070706_100096173 | 3300005467 | Bacteria | 2749 |
| 78 | Ga0070707_100000256 | 3300005468 | Bacteria | 53538 |
| 79 | Ga0070707_100004570 | 3300005468 | Bacteria | 12957 |
| 80 | Ga0070707_100007016 | 3300005468 | Bacteria | 10448 |
| 81 | Ga0070707_100026268 | 3300005468 | Bacteria | 5528 |
| 82 | Ga0070707_100029674 | 3300005468 | Bacteria | 5205 |
| 83 | Ga0070707_100168762 | 3300005468 | Bacteria | 2133 |
| 84 | Ga0070707_100172512 | 3300005468 | Bacteria | 2107 |
| 85 | Ga0070707_100180529 | 3300005468 | Bacteria | 2057 |
| 86 | Ga0070707_100198649 | 3300005468 | Bacteria | 1954 |
| 87 | Ga0070707_100233617 | 3300005468 | Bacteria | 1789 |
| 88 | Ga0070707_100254561 | 3300005468 | Bacteria | 1709 |
| 89 | Ga0070707_100305997 | 3300005468 | Bacteria | 1545 |
| 90 | Ga0070698_100000292 | 3300005471 | Bacteria | 50989 |
| 91 | Ga0070698_100000333 | 3300005471 | Bacteria | 48484 |
| 92 | Ga0070698_100000898 | 3300005471 | Bacteria | 32677 |
| 93 | Ga0070698_100002525 | 3300005471 | Bacteria | 20157 |
| 94 | Ga0070698_100013017 | 3300005471 | Bacteria | 8806 |
| 95 | Ga0070698_100017040 | 3300005471 | Bacteria | 7660 |
| 96 | Ga0070698_100017971 | 3300005471 | Bacteria | 7447 |
| 97 | Ga0070698_100051847 | 3300005471 | Bacteria | 4177 |
| 98 | Ga0070698_100070857 | 3300005471 | Bacteria | 3497 |
| 99 | Ga0070698_100086838 | 3300005471 | Bacteria | 3114 |
| 100 | Ga0070698_100131717 | 3300005471 | Bacteria | 2455 |
| 101 | Ga0070698_100228475 | 3300005471 | Bacteria | 1794 |
| 102 | Ga0070699_100020685 | 3300005518 | Bacteria | 5677 |
| 103 | Ga0070699_100028148 | 3300005518 | Bacteria | 4846 |
| 104 | Ga0070699_100221012 | 3300005518 | Bacteria | 1688 |
| 105 | Ga0070679_100034617 | 3300005530 | Bacteria | 5006 |
| 106 | Ga0070679_100040543 | 3300005530 | Bacteria | 4632 |
| 107 | Ga0070679_100053534 | 3300005530 | Bacteria | 4017 |
| 108 | Ga0070679_100085114 | 3300005530 | Bacteria | 3149 |
| 109 | Ga0070679_100173911 | 3300005530 | Bacteria | 2126 |
| 110 | Ga0070679_100207892 | 3300005530 | Bacteria | 1922 |
| 111 | Ga0070697_100108411 | 3300005536 | Bacteria | 2312 |
| 112 | Ga0070697_100140261 | 3300005536 | Bacteria | 2032 |
| 113 | Ga0068853_100227422 | 3300005539 | Bacteria | 1705 |
| 114 | Ga0068853_100331322 | 3300005539 | Bacteria | 1413 |
| 115 | Ga0070686_100004813 | 3300005544 | Bacteria | 7452 |
| 116 | Ga0070696_100008315 | 3300005546 | Bacteria | 6942 |
| 117 | Ga0070693_100003713 | 3300005547 | Bacteria | 7140 |
| 118 | Ga0070693_100016084 | 3300005547 | Bacteria | 3865 |
| 119 | Ga0070665_100006607 | 3300005548 | Bacteria | 11785 |
| 120 | Ga0070665_100117827 | 3300005548 | Bacteria | 2658 |
| 121 | Ga0070665_100147095 | 3300005548 | Bacteria | 2359 |
| 122 | Ga0068855_100449672 | 3300005563 | Bacteria | 1406 |
| 123 | Ga0070664_100016206 | 3300005564 | Bacteria | 6108 |
| 124 | Ga0068854_100125742 | 3300005578 | Bacteria | 1952 |
| 125 | Ga0068856_100115958 | 3300005614 | Bacteria | 2679 |
| 126 | Ga0068856_100320759 | 3300005614 | Bacteria | 1566 |
| 127 | Ga0068856_100380650 | 3300005614 | Bacteria | 1430 |
| 128 | Ga0070702_100000031 | 3300005615 | Bacteria | 37489 |
| 129 | Ga0070702_100030640 | 3300005615 | Bacteria | 2934 |
| 130 | Ga0068852_100011289 | 3300005616 | Bacteria | 6719 |
| 131 | Ga0068852_100295725 | 3300005616 | Bacteria | 1566 |
| 132 | Ga0068859_100066935 | 3300005617 | Bacteria | 3627 |
| 133 | Ga0068859_100443735 | 3300005617 | Bacteria | 1394 |
| 134 | Ga0068864_100058887 | 3300005618 | Bacteria | 3321 |
| 135 | Ga0068861_100014024 | 3300005719 | Bacteria | 5620 |
| 136 | Ga0068861_100220936 | 3300005719 | Bacteria | 1601 |
| 137 | Ga0068861_100264042 | 3300005719 | Bacteria | 1475 |
| 138 | Ga0068851_10035674 | 3300005834 | Bacteria | 2487 |
| 139 | Ga0068870_10000614 | 3300005840 | Bacteria | 13559 |
| 140 | Ga0068863_100021114 | 3300005841 | Bacteria | 6220 |
| 141 | Ga0068863_100111276 | 3300005841 | Bacteria | 2608 |
| 142 | Ga0068863_100144648 | 3300005841 | Bacteria | 2273 |
| 143 | Ga0068858_100180277 | 3300005842 | Bacteria | 1994 |
| 144 | Ga0068858_100188374 | 3300005842 | Bacteria | 1949 |
| 145 | Ga0068860_100043085 | 3300005843 | Bacteria | 4307 |
| 146 | Ga0081455_10057618 | 3300005937 | Bacteria | 3292 |
| 147 | Ga0081455_10156068 | 3300005937 | Bacteria | 1754 |
| 148 | Ga0081538_10002786 | 3300005981 | Bacteria | 16746 |
| 149 | Ga0081538_10008955 | 3300005981 | Bacteria | 8411 |
| 150 | Ga0081538_10026674 | 3300005981 | Bacteria | 4031 |
| 151 | Ga0081538_10034098 | 3300005981 | Bacteria | 3373 |
| 152 | Ga0081538_10037427 | 3300005981 | Bacteria | 3148 |
| 153 | Ga0081540_1000250 | 3300005983 | Bacteria | 56639 |
| 154 | Ga0081540_1000330 | 3300005983 | Bacteria | 49099 |
| 155 | Ga0081540_1005418 | 3300005983 | Bacteria | 9524 |
| 156 | Ga0081540_1020749 | 3300005983 | Bacteria | 3938 |
| 157 | Ga0081540_1032375 | 3300005983 | Bacteria | 2856 |
| 158 | Ga0081539_10004919 | 3300005985 | Bacteria | 14234 |
| 159 | Ga0081539_10018877 | 3300005985 | Bacteria | 4752 |
| 160 | Ga0081539_10150970 | 3300005985 | Bacteria | 1118 |
| 161 | Ga0070717_10001205 | 3300006028 | Bacteria | 17518 |
| 162 | Ga0070717_10002725 | 3300006028 | Bacteria | 12478 |
| 163 | Ga0070717_10011881 | 3300006028 | Bacteria | 6626 |
| 164 | Ga0070717_10050812 | 3300006028 | Bacteria | 3409 |
| 165 | Ga0070717_10076722 | 3300006028 | Bacteria | 2797 |
| 166 | Ga0070717_10134834 | 3300006028 | Bacteria | 2125 |
| 167 | Ga0070717_10263592 | 3300006028 | Bacteria | 1525 |
| 168 | Ga0070717_10461944 | 3300006028 | Bacteria | 1145 |
| 169 | Ga0075432_10026310 | 3300006058 | Bacteria | 1998 |
| 170 | Ga0070715_10052548 | 3300006163 | Bacteria | 1758 |
| 171 | Ga0070715_10057037 | 3300006163 | Bacteria | 1701 |
| 172 | Ga0070716_100001415 | 3300006173 | Bacteria | 10653 |
| 173 | Ga0070716_100026533 | 3300006173 | Bacteria | 3103 |
| 174 | Ga0070716_100045435 | 3300006173 | Bacteria | 2466 |
| 175 | Ga0070712_100002052 | 3300006175 | Bacteria | 12329 |
| 176 | Ga0070712_100008902 | 3300006175 | Bacteria | 6323 |
| 177 | Ga0070712_100014062 | 3300006175 | Bacteria | 5131 |
| 178 | Ga0070712_100093705 | 3300006175 | Bacteria | 2205 |
| 179 | Ga0070712_100398840 | 3300006175 | Bacteria | 1136 |
| 180 | Ga0097621_100002544 | 3300006237 | Bacteria | 12495 |
| 181 | Ga0097621_100037665 | 3300006237 | Bacteria | 3877 |
| 182 | Ga0097621_100111339 | 3300006237 | Bacteria | 2314 |
| 183 | Ga0068871_100047631 | 3300006358 | Bacteria | 3458 |
| 184 | Ga0068871_100091961 | 3300006358 | Bacteria | 2529 |
| 185 | Ga0068871_100129495 | 3300006358 | Bacteria | 2139 |
| 186 | Ga0075428_100020125 | 3300006844 | Bacteria | 7389 |
| 187 | Ga0075428_100062887 | 3300006844 | Bacteria | 4063 |
| 188 | Ga0075428_100282093 | 3300006844 | Bacteria | 1787 |
| 189 | Ga0075430_100000294 | 3300006846 | Bacteria | 35128 |
| 190 | Ga0075430_100001663 | 3300006846 | Bacteria | 18174 |
| 191 | Ga0075430_100006545 | 3300006846 | Bacteria | 9825 |
| 192 | Ga0075430_100155213 | 3300006846 | Bacteria | 1906 |
| 193 | Ga0075431_100046671 | 3300006847 | Bacteria | 4467 |
| 194 | Ga0075431_100063910 | 3300006847 | Bacteria | 3799 |
| 195 | Ga0075431_100272902 | 3300006847 | Bacteria | 1713 |
| 196 | Ga0075433_10031211 | 3300006852 | Bacteria | 4553 |
| 197 | Ga0075433_10049564 | 3300006852 | Bacteria | 3653 |
| 198 | Ga0075433_10143574 | 3300006852 | Bacteria | 2122 |
| 199 | Ga0075434_100009917 | 3300006871 | Bacteria | 8910 |
| 200 | Ga0075434_100018423 | 3300006871 | Bacteria | 6746 |
| 201 | Ga0075434_100044958 | 3300006871 | Bacteria | 4380 |
| 202 | Ga0075434_100216438 | 3300006871 | Bacteria | 1936 |
| 203 | Ga0075429_100002678 | 3300006880 | Bacteria | 14987 |
| 204 | Ga0075429_100044119 | 3300006880 | Bacteria | 3878 |
| 205 | Ga0075429_100116528 | 3300006880 | Bacteria | 2335 |
| 206 | Ga0075436_100004879 | 3300006914 | Bacteria | 9217 |
| 207 | Ga0075436_100074055 | 3300006914 | Bacteria | 2357 |
| 208 | Ga0097620_100066940 | 3300006931 | Bacteria | 3627 |
| 209 | Ga0097620_100443771 | 3300006931 | Bacteria | 1394 |
| 210 | Ga0075435_100064936 | 3300007076 | Bacteria | 2966 |
| 211 | Ga0075435_100232998 | 3300007076 | Bacteria | 1565 |
| 212 | Ga0075435_100328524 | 3300007076 | Bacteria | 1309 |
| 213 | Ga0105240_10251979 | 3300009093 | Bacteria | 2041 |
| 214 | Ga0111539_10032226 | 3300009094 | Bacteria | 6366 |
| 215 | Ga0111539_10047409 | 3300009094 | Bacteria | 5135 |
| 216 | Ga0105245_10005437 | 3300009098 | Bacteria | 11189 |
| 217 | Ga0105245_10056487 | 3300009098 | Bacteria | 3529 |
| 218 | Ga0105247_10053503 | 3300009101 | Bacteria | 2490 |
| 219 | Ga0114129_10006711 | 3300009147 | Bacteria | 16343 |
| 220 | Ga0114129_10009018 | 3300009147 | Bacteria | 14220 |
| 221 | Ga0114129_10047822 | 3300009147 | Bacteria | 6010 |
| 222 | Ga0114129_10166468 | 3300009147 | Bacteria | 3008 |
| 223 | Ga0114129_10184699 | 3300009147 | Bacteria | 2835 |
| 224 | Ga0114129_10412805 | 3300009147 | Bacteria | 1777 |
| 225 | Ga0105243_10365331 | 3300009148 | Bacteria | 1330 |
| 226 | Ga0105241_10379178 | 3300009174 | Bacteria | 1235 |
| 227 | Ga0105248_10152913 | 3300009177 | Bacteria | 2603 |
| 228 | Ga0105248_10294461 | 3300009177 | Bacteria | 1827 |
| 229 | Ga0105237_10033633 | 3300009545 | Bacteria | 5195 |
| 230 | Ga0105238_10129275 | 3300009551 | Bacteria | 2504 |
| 231 | Ga0105238_10290145 | 3300009551 | Bacteria | 1618 |
| 232 | Ga0105249_10073392 | 3300009553 | Bacteria | 3166 |
| 233 | Ga0099796_10050215 | 3300010159 | Bacteria | 1445 |
| 234 | Ga0105239_10036023 | 3300010375 | Bacteria | 5432 |
| 235 | Ga0157313_1001542 | 3300012503 | Bacteria | 1259 |
| 236 | Ga0157371_10059306 | 3300013102 | Bacteria | 2713 |
| 237 | Ga0157371_10137477 | 3300013102 | Bacteria | 1740 |
| 238 | Ga0157370_10049599 | 3300013104 | Bacteria | 4017 |
| 239 | Ga0157370_10057438 | 3300013104 | Bacteria | 3700 |
| 240 | Ga0157370_10090646 | 3300013104 | Bacteria | 2870 |
| 241 | Ga0157369_10011739 | 3300013105 | Bacteria | 9946 |
| 242 | Ga0157369_10264471 | 3300013105 | Bacteria | 1793 |
| 243 | Ga0157374_10020729 | 3300013296 | Bacteria | 5836 |
| 244 | Ga0157374_10259101 | 3300013296 | Bacteria | 1713 |
| 245 | Ga0163162_10013494 | 3300013306 | Bacteria | 7975 |
| 246 | Ga0163162_10127754 | 3300013306 | Bacteria | 2649 |
| 247 | Ga0157375_10193002 | 3300013308 | Bacteria | 2192 |
| 248 | Ga0157375_10448831 | 3300013308 | Bacteria | 1455 |
| 249 | Ga0163163_10001600 | 3300014325 | Bacteria | 19033 |
| 250 | Ga0157379_10017361 | 3300014968 | Bacteria | 6340 |
| 251 | Ga0157379_10146024 | 3300014968 | Bacteria | 2133 |
| 252 | Ga0157379_10150130 | 3300014968 | Bacteria | 2102 |
| 253 | Ga0157376_10103696 | 3300014969 | Bacteria | 2491 |
| 254 | Ga0163161_10099487 | 3300017792 | Bacteria | 2163 |
| 255 | Ga0206349_1541197 | 3300020075 | Bacteria | 1324 |
| 256 | Ga0206351_10996409 | 3300020077 | Bacteria | 2111 |
| 257 | Ga0206354_10500860 | 3300020081 | Bacteria | 2269 |
| 258 | Ga0206354_10593962 | 3300020081 | Bacteria | 4033 |
| 259 | Ga0213873_10019370 | 3300021358 | Bacteria | 1578 |
| 260 | Ga0213875_10000250 | 3300021388 | Bacteria | 54123 |
| 261 | Ga0213875_10016542 | 3300021388 | Bacteria | 3574 |
| 262 | Ga0213875_10033159 | 3300021388 | Bacteria | 2438 |
| 263 | Ga0213871_10050030 | 3300021441 | Bacteria | 1143 |
| 264 | Ga0224712_10003353 | 3300022467 | Bacteria | 4150 |
| 265 | Ga0224712_10012929 | 3300022467 | Bacteria | 2644 |
| 266 | Ga0224712_10013796 | 3300022467 | Bacteria | 2584 |
| 267 | Ga0224712_10017923 | 3300022467 | Bacteria | 2357 |
| 268 | Ga0224712_10021524 | 3300022467 | Bacteria | 2208 |
| 269 | Ga0224712_10021811 | 3300022467 | Bacteria | 2198 |
| 270 | Ga0224712_10127430 | 3300022467 | Bacteria | 1108 |
| 271 | Ga0224572_1000791 | 3300024225 | Bacteria | 4180 |
| 272 | Ga0207656_10020636 | 3300025321 | Bacteria | 2621 |
| 273 | Ga0207653_10008398 | 3300025885 | Bacteria | 3216 |
| 274 | Ga0207692_10001094 | 3300025898 | Bacteria | 9936 |
| 275 | Ga0207692_10001437 | 3300025898 | Bacteria | 8917 |
| 276 | Ga0207692_10004739 | 3300025898 | Bacteria | 5402 |
| 277 | Ga0207692_10025602 | 3300025898 | Bacteria | 2758 |
| 278 | Ga0207692_10033061 | 3300025898 | Bacteria | 2491 |
| 279 | Ga0207692_10138175 | 3300025898 | Bacteria | 1383 |
| 280 | Ga0207692_10244113 | 3300025898 | Bacteria | 1074 |
| 281 | Ga0207710_10028052 | 3300025900 | Bacteria | 2442 |
| 282 | Ga0207688_10017900 | 3300025901 | Bacteria | 3856 |
| 283 | Ga0207688_10106533 | 3300025901 | Bacteria | 1624 |
| 284 | Ga0207680_10025579 | 3300025903 | Bacteria | 3258 |
| 285 | Ga0207685_10022394 | 3300025905 | Bacteria | 2135 |
| 286 | Ga0207685_10039962 | 3300025905 | Bacteria | 1745 |
| 287 | Ga0207699_10001830 | 3300025906 | Bacteria | 10004 |
| 288 | Ga0207699_10006266 | 3300025906 | Bacteria | 5746 |
| 289 | Ga0207699_10011057 | 3300025906 | Bacteria | 4547 |
| 290 | Ga0207699_10074359 | 3300025906 | Bacteria | 2087 |
| 291 | Ga0207699_10154582 | 3300025906 | Bacteria | 1521 |
| 292 | Ga0207643_10000204 | 3300025908 | Bacteria | 41257 |
| 293 | Ga0207705_10001642 | 3300025909 | Bacteria | 17743 |
| 294 | Ga0207684_10001419 | 3300025910 | Bacteria | 25953 |
| 295 | Ga0207684_10002612 | 3300025910 | Bacteria | 18016 |
| 296 | Ga0207684_10002799 | 3300025910 | Bacteria | 17340 |
| 297 | Ga0207684_10015342 | 3300025910 | Bacteria | 6595 |
| 298 | Ga0207684_10092354 | 3300025910 | Bacteria | 2579 |
| 299 | Ga0207684_10186921 | 3300025910 | Bacteria | 1786 |
| 300 | Ga0207654_10054753 | 3300025911 | Bacteria | 2306 |
| 301 | Ga0207707_10035796 | 3300025912 | Bacteria | 4341 |
| 302 | Ga0207707_10098332 | 3300025912 | Bacteria | 2558 |
| 303 | Ga0207707_10109135 | 3300025912 | Bacteria | 2419 |
| 304 | Ga0207695_10287073 | 3300025913 | Bacteria | 1538 |
| 305 | Ga0207695_10361244 | 3300025913 | Bacteria | 1339 |
| 306 | Ga0207671_10071968 | 3300025914 | Bacteria | 2579 |
| 307 | Ga0207671_10151559 | 3300025914 | Bacteria | 1791 |
| 308 | Ga0207693_10001078 | 3300025915 | Bacteria | 24478 |
| 309 | Ga0207693_10005180 | 3300025915 | Bacteria | 10914 |
| 310 | Ga0207693_10008773 | 3300025915 | Bacteria | 8262 |
| 311 | Ga0207693_10013430 | 3300025915 | Bacteria | 6604 |
| 312 | Ga0207693_10014990 | 3300025915 | Bacteria | 6223 |
| 313 | Ga0207693_10085727 | 3300025915 | Bacteria | 2467 |
| 314 | Ga0207693_10138270 | 3300025915 | Bacteria | 1915 |
| 315 | Ga0207663_10010431 | 3300025916 | Bacteria | 4947 |
| 316 | Ga0207663_10014695 | 3300025916 | Bacteria | 4296 |
| 317 | Ga0207663_10039635 | 3300025916 | Bacteria | 2856 |
| 318 | Ga0207663_10074280 | 3300025916 | Bacteria | 2203 |
| 319 | Ga0207663_10084495 | 3300025916 | Bacteria | 2088 |
| 320 | Ga0207660_10038844 | 3300025917 | Bacteria | 3325 |
| 321 | Ga0207660_10254343 | 3300025917 | Bacteria | 1387 |
| 322 | Ga0207662_10011478 | 3300025918 | Bacteria | 4917 |
| 323 | Ga0207662_10052164 | 3300025918 | Bacteria | 2434 |
| 324 | Ga0207657_10044561 | 3300025919 | Bacteria | 3899 |
| 325 | Ga0207657_10089951 | 3300025919 | Bacteria | 2562 |
| 326 | Ga0207657_10105478 | 3300025919 | Bacteria | 2333 |
| 327 | Ga0207657_10165197 | 3300025919 | Bacteria | 1796 |
| 328 | Ga0207649_10018450 | 3300025920 | Bacteria | 3969 |
| 329 | Ga0207652_10124104 | 3300025921 | Bacteria | 2299 |
| 330 | Ga0207652_10159071 | 3300025921 | Bacteria | 2024 |
| 331 | Ga0207652_10219371 | 3300025921 | Bacteria | 1713 |
| 332 | Ga0207652_10403798 | 3300025921 | Bacteria | 1233 |
| 333 | Ga0207646_10000950 | 3300025922 | Bacteria | 37311 |
| 334 | Ga0207646_10001124 | 3300025922 | Bacteria | 34128 |
| 335 | Ga0207646_10031779 | 3300025922 | Bacteria | 4778 |
| 336 | Ga0207646_10044143 | 3300025922 | Bacteria | 4001 |
| 337 | Ga0207646_10072069 | 3300025922 | Bacteria | 3086 |
| 338 | Ga0207646_10102009 | 3300025922 | Bacteria | 2572 |
| 339 | Ga0207646_10184097 | 3300025922 | Bacteria | 1886 |
| 340 | Ga0207646_10201908 | 3300025922 | Bacteria | 1796 |
| 341 | Ga0207650_10002710 | 3300025925 | Bacteria | 12237 |
| 342 | Ga0207659_10004400 | 3300025926 | Bacteria | 8514 |
| 343 | Ga0207687_10006217 | 3300025927 | Bacteria | 7905 |
| 344 | Ga0207687_10074652 | 3300025927 | Bacteria | 2431 |
| 345 | Ga0207687_10075188 | 3300025927 | Bacteria | 2424 |
| 346 | Ga0207700_10001672 | 3300025928 | Bacteria | 12587 |
| 347 | Ga0207700_10002173 | 3300025928 | Bacteria | 11233 |
| 348 | Ga0207700_10005055 | 3300025928 | Bacteria | 7845 |
| 349 | Ga0207700_10020413 | 3300025928 | Bacteria | 4499 |
| 350 | Ga0207700_10021329 | 3300025928 | Bacteria | 4421 |
| 351 | Ga0207700_10022331 | 3300025928 | Bacteria | 4340 |
| 352 | Ga0207700_10034120 | 3300025928 | Bacteria | 3649 |
| 353 | Ga0207700_10057202 | 3300025928 | Bacteria | 2939 |
| 354 | Ga0207700_10096005 | 3300025928 | Bacteria | 2352 |
| 355 | Ga0207700_10301731 | 3300025928 | Bacteria | 1383 |
| 356 | Ga0207664_10000427 | 3300025929 | Bacteria | 30029 |
| 357 | Ga0207664_10000940 | 3300025929 | Bacteria | 19579 |
| 358 | Ga0207664_10002584 | 3300025929 | Bacteria | 11979 |
| 359 | Ga0207664_10007361 | 3300025929 | Bacteria | 7629 |
| 360 | Ga0207664_10020499 | 3300025929 | Bacteria | 4901 |
| 361 | Ga0207664_10021524 | 3300025929 | Bacteria | 4797 |
| 362 | Ga0207664_10043770 | 3300025929 | Bacteria | 3504 |
| 363 | Ga0207664_10052186 | 3300025929 | Bacteria | 3233 |
| 364 | Ga0207664_10053493 | 3300025929 | Bacteria | 3196 |
| 365 | Ga0207664_10080047 | 3300025929 | Bacteria | 2654 |
| 366 | Ga0207664_10191859 | 3300025929 | Bacteria | 1759 |
| 367 | Ga0207664_10304935 | 3300025929 | Bacteria | 1402 |
| 368 | Ga0207644_10007562 | 3300025931 | Bacteria | 7084 |
| 369 | Ga0207644_10044521 | 3300025931 | Bacteria | 3153 |
| 370 | Ga0207690_10000219 | 3300025932 | Bacteria | 43461 |
| 371 | Ga0207690_10030154 | 3300025932 | Bacteria | 3456 |
| 372 | Ga0207690_10333355 | 3300025932 | Bacteria | 1196 |
| 373 | Ga0207686_10114479 | 3300025934 | Bacteria | 1825 |
| 374 | Ga0207670_10035613 | 3300025936 | Bacteria | 3229 |
| 375 | Ga0207665_10001719 | 3300025939 | Bacteria | 14712 |
| 376 | Ga0207665_10002491 | 3300025939 | Bacteria | 12398 |
| 377 | Ga0207665_10017416 | 3300025939 | Bacteria | 4721 |
| 378 | Ga0207665_10025411 | 3300025939 | Bacteria | 3908 |
| 379 | Ga0207665_10056283 | 3300025939 | Bacteria | 2654 |
| 380 | Ga0207665_10134613 | 3300025939 | Bacteria | 1757 |
| 381 | Ga0207665_10141555 | 3300025939 | Bacteria | 1716 |
| 382 | Ga0207691_10029944 | 3300025940 | Bacteria | 5090 |
| 383 | Ga0207711_10178971 | 3300025941 | Bacteria | 1927 |
| 384 | Ga0207689_10000223 | 3300025942 | Bacteria | 50338 |
| 385 | Ga0207689_10017179 | 3300025942 | Bacteria | 6124 |
| 386 | Ga0207661_10130930 | 3300025944 | Bacteria | 2148 |
| 387 | Ga0207661_10510587 | 3300025944 | Bacteria | 1099 |
| 388 | Ga0207679_10006307 | 3300025945 | Bacteria | 7488 |
| 389 | Ga0207712_10023350 | 3300025961 | Bacteria | 4080 |
| 390 | Ga0207712_10098587 | 3300025961 | Bacteria | 2168 |
| 391 | Ga0207668_10127648 | 3300025972 | Bacteria | 1937 |
| 392 | Ga0207640_10046715 | 3300025981 | Bacteria | 2788 |
| 393 | Ga0207640_10270453 | 3300025981 | Bacteria | 1329 |
| 394 | Ga0207677_10018630 | 3300026023 | Bacteria | 4170 |
| 395 | Ga0207703_10040754 | 3300026035 | Bacteria | 3718 |
| 396 | Ga0207639_10083405 | 3300026041 | Bacteria | 2537 |
| 397 | Ga0207639_10328799 | 3300026041 | Bacteria | 1359 |
| 398 | Ga0207678_10002516 | 3300026067 | Bacteria | 16688 |
| 399 | Ga0207678_10006007 | 3300026067 | Bacteria | 10803 |
| 400 | Ga0207708_10046904 | 3300026075 | Bacteria | 3290 |
| 401 | Ga0207702_10043655 | 3300026078 | Bacteria | 3765 |
| 402 | Ga0207702_10056949 | 3300026078 | Bacteria | 3320 |
| 403 | Ga0207702_10070243 | 3300026078 | Bacteria | 3012 |
| 404 | Ga0207702_10130343 | 3300026078 | Bacteria | 2262 |
| 405 | Ga0207702_10370778 | 3300026078 | Bacteria | 1374 |
| 406 | Ga0207702_10386642 | 3300026078 | Bacteria | 1346 |
| 407 | Ga0207641_10009542 | 3300026088 | Bacteria | 7995 |
| 408 | Ga0207676_10001541 | 3300026095 | Bacteria | 17016 |
| 409 | Ga0207676_10156658 | 3300026095 | Bacteria | 1968 |
| 410 | Ga0207674_10004964 | 3300026116 | Bacteria | 15897 |
| 411 | Ga0207674_10123468 | 3300026116 | Bacteria | 2555 |
| 412 | Ga0207675_100002250 | 3300026118 | Bacteria | 19196 |
| 413 | Ga0207675_100037515 | 3300026118 | Bacteria | 4520 |
| 414 | Ga0207675_100265546 | 3300026118 | Bacteria | 1664 |
| 415 | Ga0207683_10000804 | 3300026121 | Bacteria | 28698 |
| 416 | Ga0207683_10005606 | 3300026121 | Bacteria | 10764 |
| 417 | Ga0207683_10024244 | 3300026121 | Bacteria | 5222 |
| 418 | Ga0207698_10002366 | 3300026142 | Bacteria | 11182 |
| 419 | Ga0207698_10317204 | 3300026142 | Bacteria | 1458 |
| 420 | Ga0207428_10000537 | 3300027907 | Bacteria | 45252 |
| 421 | Ga0207428_10009923 | 3300027907 | Bacteria | 8528 |
| 422 | Ga0207428_10068605 | 3300027907 | Bacteria | 2789 |
| 423 | Ga0268266_10023015 | 3300028379 | Bacteria | 5303 |
| 424 | Ga0268266_10525110 | 3300028379 | Bacteria | 1132 |
| 425 | Ga0265336_10004601 | 3300028666 | Bacteria | 5184 |
| 426 | Ga0307517_10074469 | 3300028786 | Bacteria | 2994 |
| 427 | Ga0307515_10001066 | 3300028794 | Bacteria | 62806 |
| 428 | Ga0307515_10009042 | 3300028794 | Bacteria | 19333 |
| 429 | Ga0307515_10170578 | 3300028794 | Bacteria | 2171 |
| 430 | Ga0265338_10002247 | 3300028800 | Bacteria | 29390 |
| 431 | Ga0265338_10014640 | 3300028800 | Bacteria | 8701 |
| 432 | Ga0265338_10031380 | 3300028800 | Bacteria | 5211 |
| 433 | Ga0307512_10003683 | 3300030522 | Bacteria | 17448 |
| 434 | Ga0307512_10025517 | 3300030522 | Bacteria | 5234 |
| 435 | Ga0316181_1149483 | 3300030744 | Bacteria | 2422 |
| 436 | Ga0265330_10081434 | 3300031235 | Bacteria | 1395 |
| 437 | Ga0265320_10022258 | 3300031240 | Bacteria | 3393 |
| 438 | Ga0265325_10027015 | 3300031241 | Bacteria | 3105 |
| 439 | Ga0265340_10008623 | 3300031247 | Bacteria | 5496 |
| 440 | Ga0265340_10013418 | 3300031247 | Bacteria | 4302 |
| 441 | Ga0265340_10034361 | 3300031247 | Bacteria | 2522 |
| 442 | Ga0265316_10042524 | 3300031344 | Bacteria | 3631 |
| 443 | Ga0307513_10000001 | 3300031456 | Bacteria | 1660464 |
| 444 | Ga0307513_10036904 | 3300031456 | Bacteria | 5443 |
| 445 | Ga0307509_10178452 | 3300031507 | Bacteria | 1993 |
| 446 | Ga0307408_100018031 | 3300031548 | Bacteria | 4735 |
| 447 | Ga0307408_100030377 | 3300031548 | Bacteria | 3752 |
| 448 | Ga0307408_100206281 | 3300031548 | Bacteria | 1594 |
| 449 | Ga0265313_10046513 | 3300031595 | Bacteria | 2106 |
| 450 | Ga0307508_10033247 | 3300031616 | Bacteria | 4654 |
| 451 | Ga0307508_10306467 | 3300031616 | Bacteria | 1181 |
| 452 | Ga0316579_10011444 | 3300031691 | Bacteria | 3770 |
| 453 | Ga0316579_10079237 | 3300031691 | Bacteria | 1563 |
| 454 | Ga0265314_10022618 | 3300031711 | Bacteria | 4814 |
| 455 | Ga0265314_10136154 | 3300031711 | Bacteria | 1525 |
| 456 | Ga0265342_10094939 | 3300031712 | Bacteria | 1705 |
| 457 | Ga0316576_10014040 | 3300031727 | Bacteria | 5341 |
| 458 | Ga0316578_10020196 | 3300031728 | Bacteria | 3677 |
| 459 | Ga0307516_10001792 | 3300031730 | Bacteria | 29478 |
| 460 | Ga0307405_10016418 | 3300031731 | Bacteria | 4037 |
| 461 | Ga0307405_10034777 | 3300031731 | Bacteria | 3002 |
| 462 | Ga0307405_10071517 | 3300031731 | Bacteria | 2232 |
| 463 | Ga0307413_10002297 | 3300031824 | Bacteria | 7739 |
| 464 | Ga0307413_10028958 | 3300031824 | Bacteria | 3092 |
| 465 | Ga0307413_10126857 | 3300031824 | Bacteria | 1739 |
| 466 | Ga0307413_10174920 | 3300031824 | Bacteria | 1524 |
| 467 | Ga0307410_10008218 | 3300031852 | Bacteria | 5775 |
| 468 | Ga0307410_10012065 | 3300031852 | Bacteria | 4974 |
| 469 | Ga0307410_10017362 | 3300031852 | Bacteria | 4320 |
| 470 | Ga0307410_10151531 | 3300031852 | Bacteria | 1727 |
| 471 | Ga0326468_10000905 | 3300031889 | Bacteria | 2896 |
| 472 | Ga0307406_10005635 | 3300031901 | Bacteria | 6845 |
| 473 | Ga0307406_10080903 | 3300031901 | Bacteria | 2158 |
| 474 | Ga0307406_10140744 | 3300031901 | Bacteria | 1707 |
| 475 | Ga0307407_10010091 | 3300031903 | Bacteria | 4436 |
| 476 | Ga0307412_10037573 | 3300031911 | Bacteria | 3113 |
| 477 | Ga0307412_10176155 | 3300031911 | Bacteria | 1604 |
| 478 | Ga0307409_100042353 | 3300031995 | Bacteria | 3409 |
| 479 | Ga0307409_100062244 | 3300031995 | Bacteria | 2920 |
| 480 | Ga0307409_100074136 | 3300031995 | Bacteria | 2718 |
| 481 | Ga0307409_100224732 | 3300031995 | Bacteria | 1697 |
| 482 | Ga0307416_100005911 | 3300032002 | Bacteria | 7596 |
| 483 | Ga0307416_100010416 | 3300032002 | Bacteria | 6138 |
| 484 | Ga0307416_100014187 | 3300032002 | Bacteria | 5446 |
| 485 | Ga0307416_100021209 | 3300032002 | Bacteria | 4658 |
| 486 | Ga0307416_100022814 | 3300032002 | Bacteria | 4527 |
| 487 | Ga0307416_100026645 | 3300032002 | Bacteria | 4263 |
| 488 | Ga0307416_100051710 | 3300032002 | Bacteria | 3284 |
| 489 | Ga0307416_100127411 | 3300032002 | Bacteria | 2283 |
| 490 | Ga0307416_100190815 | 3300032002 | Bacteria | 1932 |
| 491 | Ga0307414_10295094 | 3300032004 | Bacteria | 1368 |
| 492 | Ga0307411_10003583 | 3300032005 | Bacteria | 7239 |
| 493 | Ga0307411_10013764 | 3300032005 | Bacteria | 4478 |
| 494 | Ga0307411_10067943 | 3300032005 | Bacteria | 2401 |
| 495 | Ga0307415_100001464 | 3300032126 | Bacteria | 11306 |
| 496 | Ga0307415_100005414 | 3300032126 | Bacteria | 6777 |
| 497 | Ga0307415_100005543 | 3300032126 | Bacteria | 6715 |
| 498 | Ga0307415_100048312 | 3300032126 | Bacteria | 2871 |
| 499 | Ga0307415_100059169 | 3300032126 | Bacteria | 2641 |
| 500 | Ga0307415_100115846 | 3300032126 | Bacteria | 1998 |
| 501 | Ga0307415_100165772 | 3300032126 | Bacteria | 1717 |
| 502 | Ga0307415_100231174 | 3300032126 | Bacteria | 1489 |
| 503 | Ga0316583_10003287 | 3300032133 | Bacteria | 5682 |
| 504 | Ga0316585_10024611 | 3300032137 | Bacteria | 1863 |
| 505 | Ga0307510_10178321 | 3300033180 | Bacteria | 1692 |
| 506 | Ga0373930_0011979 | 3300034816 | Bacteria | 1574 |
| 507 | Ga0373948_0010418 | 3300034817 | Bacteria | 1623 |
| 508 | Ga0373926_0009034 | 3300035083 | Bacteria | 3323 |
| 509 | Ga0373926_0107581 | 3300035083 | Bacteria | 1046 |
| 510 | Ga0373928_0007014 | 3300035084 | Bacteria | 2172 |
| 511 | Ga0373934_0000070 | 3300035086 | Bacteria | 35142 |
| 512 | Ga0373934_0002196 | 3300035086 | Bacteria | 7172 |
| 513 | Ga0373934_0006637 | 3300035086 | Bacteria | 4297 |
| 514 | Ga0373940_0020952 | 3300035088 | Bacteria | 1666 |
| 515 | Ga0373940_0040831 | 3300035088 | Bacteria | 1274 |
| 516 | Ga0373944_0002438 | 3300035089 | Bacteria | 4722 |
| 517 | Ga0373949_0003325 | 3300035090 | Bacteria | 3861 |
| 518 | Ga0373949_0023621 | 3300035090 | Bacteria | 1425 |
| 519 | Ga0373923_0011010 | 3300035111 | Bacteria | 3307 |
| 520 | Ga0373923_0056349 | 3300035111 | Bacteria | 1659 |
| 521 | Ga0373923_0066202 | 3300035111 | Bacteria | 1544 |
| 522 | Ga0373932_0016751 | 3300035112 | Bacteria | 1874 |
| 523 | Ga0373936_0001293 | 3300035113 | Bacteria | 9062 |
| 524 | Ga0373936_0004164 | 3300035113 | Bacteria | 5452 |
| 525 | Ga0373936_0083543 | 3300035113 | Bacteria | 1331 |
| 526 | Ga0373939_0060424 | 3300035114 | Bacteria | 1204 |
| 527 | Ga0373945_0044491 | 3300035116 | Bacteria | 1614 |
| 528 | Ga0373953_0000185 | 3300035117 | Bacteria | 16552 |
| 529 | Ga0373953_0001732 | 3300035117 | Bacteria | 6429 |
| 530 | Ga0373953_0010341 | 3300035117 | Bacteria | 3243 |
| 531 | Ga0373953_0045019 | 3300035117 | Bacteria | 1766 |
| 532 | Ga0373953_0068325 | 3300035117 | Bacteria | 1462 |
| 533 | Ga0373954_0002192 | 3300035118 | Bacteria | 8115 |
| 534 | Ga0373954_0040812 | 3300035118 | Bacteria | 2162 |
| 535 | Ga0373954_0040873 | 3300035118 | Bacteria | 2161 |
| 536 | Ga0373954_0061833 | 3300035118 | Bacteria | 1768 |
| 537 | Ga0373956_0000007 | 3300035119 | Bacteria | 63448 |
| 538 | Ga0373956_0020043 | 3300035119 | Bacteria | 2840 |
| 539 | Ga0373956_0090125 | 3300035119 | Bacteria | 1414 |
| 540 | Ga0373956_0126010 | 3300035119 | Bacteria | 1197 |
| 541 | Ga0373957_0000024 | 3300035120 | Bacteria | 39141 |
| 542 | Ga0373957_0002117 | 3300035120 | Bacteria | 5582 |
| 543 | Ga0373957_0033521 | 3300035120 | Bacteria | 1897 |
| 544 | Ga0373960_0004470 | 3300035121 | Bacteria | 3206 |
| 545 | Ga0373943_0001340 | 3300035170 | Bacteria | 11093 |
| 546 | Ga0373943_0001795 | 3300035170 | Bacteria | 9697 |
| 547 | Ga0373946_0001065 | 3300035171 | Bacteria | 9448 |
| 548 | Ga0373946_0017131 | 3300035171 | Bacteria | 2768 |
| 549 | Ga0373955_0000368 | 3300035172 | Bacteria | 19027 |
| 550 | Ga0373955_0017001 | 3300035172 | Bacteria | 3589 |
| 551 | Ga0373955_0049962 | 3300035172 | Bacteria | 2272 |
| 552 | Ga0373955_0058166 | 3300035172 | Bacteria | 2126 |
| 553 | Ga0373955_0322137 | 3300035172 | Bacteria | 934 |
| 554 | Ga0373942_0022330 | 3300035207 | Bacteria | 1604 |
| 555 | Ga0316574_0001450 | 3300035398 | Bacteria | 11268 |
| 556 | Ga0316574_0003741 | 3300035398 | Bacteria | 7883 |
| 557 | Ga0316574_0150904 | 3300035398 | Bacteria | 1497 |
| 558 | Ga0373924_0000372 | 3300035410 | Bacteria | 13775 |
| 559 | Ga0373924_0011689 | 3300035410 | Bacteria | 3265 |
| 560 | Ga0373924_0018862 | 3300035410 | Bacteria | 2665 |
| 561 | Ga0373924_0029116 | 3300035410 | Bacteria | 2206 |
| 562 | Ga0373924_0076608 | 3300035410 | Bacteria | 1417 |
| 563 | Ga0373931_0027647 | 3300035691 | Bacteria | 2897 |
| 564 | Ga0373935_0003744 | 3300035692 | Bacteria | 8878 |
| 565 | Ga0373935_0005495 | 3300035692 | Bacteria | 7466 |
| 566 | Ga0373935_0053505 | 3300035692 | Bacteria | 2568 |
| 567 | Ga0373935_0073581 | 3300035692 | Bacteria | 2208 |
| 568 | Ga0373935_0075094 | 3300035692 | Bacteria | 2186 |
| 569 | Ga0373935_0332305 | 3300035692 | Bacteria | 1080 |
| 570 | Ga0373927_0003060 | 3300035695 | Bacteria | 12127 |
| 571 | Ga0373927_0070955 | 3300035695 | Bacteria | 2254 |
| 572 | Ga0373933_0000002 | 3300035724 | Bacteria | 151785 |
| 573 | Ga0373933_0001577 | 3300035724 | Bacteria | 13343 |
| 574 | Ga0373933_0015191 | 3300035724 | Bacteria | 4291 |
| 575 | Ga0373933_0019084 | 3300035724 | Bacteria | 3866 |
| 576 | Ga0373933_0022077 | 3300035724 | Bacteria | 3622 |
| 577 | Ga0373933_0037724 | 3300035724 | Bacteria | 2836 |
| 578 | Ga0373933_0071489 | 3300035724 | Bacteria | 2112 |
| 579 | Ga0373933_0142720 | 3300035724 | Bacteria | 1513 |
| 580 | Ga0373947_0000007 | 3300035725 | Bacteria | 192259 |
| 581 | Ga0373947_0003580 | 3300035725 | Bacteria | 9160 |
| 582 | Ga0373937_0000014 | 3300036401 | Bacteria | 151785 |
| 583 | Ga0373937_0000312 | 3300036401 | Bacteria | 45975 |
| 584 | Ga0373937_0003119 | 3300036401 | Bacteria | 13861 |
| 585 | Ga0373937_0007378 | 3300036401 | Bacteria | 9513 |
| 586 | Ga0373937_0046082 | 3300036401 | Bacteria | 3986 |
| 587 | Ga0373937_0074903 | 3300036401 | Bacteria | 3124 |
| 588 | Ga0373937_0106572 | 3300036401 | Bacteria | 2605 |
| 589 | Ga0373937_0117122 | 3300036401 | Bacteria | 2481 |
| 590 | Ga0373937_0232432 | 3300036401 | Bacteria | 1736 |
| 591 | Ga0373937_0236231 | 3300036401 | Bacteria | 1721 |
| 592 | Ga0373937_0238112 | 3300036401 | Bacteria | 1714 |
| 593 | Ga0373937_0373198 | 3300036401 | Bacteria | 1352 |
| 594 | Ga0316582_0057528 | 3300036647 | Bacteria | 2484 |
| 595 | Ga0316584_0018562 | 3300036712 | Bacteria | 5019 |
| 596 | Ga0373925_0023473 | 3300037068 | Bacteria | 4500 |
| 597 | Ga0373925_0062211 | 3300037068 | Bacteria | 2807 |
| 598 | Ga0373925_0127897 | 3300037068 | Bacteria | 1978 |
| 599 | Ga0373925_0221542 | 3300037068 | Bacteria | 1510 |
| 600 | Ga0395899_0297566 | 3300037312 | Bacteria | 1093 |
| 601 | Ga0395900_0025836 | 3300037418 | Bacteria | 6012 |
| 602 | Ga0395900_0256887 | 3300037418 | Bacteria | 1746 |
| 603 | Ga0395900_0357357 | 3300037418 | Bacteria | 1433 |
| 604 | Ga0395898_0090208 | 3300037466 | Bacteria | 2950 |
| 605 | Ga0395898_0154853 | 3300037466 | Bacteria | 2192 |
| 606 | Ga0395898_0161474 | 3300037466 | Bacteria | 2143 |
| 607 | Ga0395898_0361040 | 3300037466 | Bacteria | 1385 |
| 608 | Ga0395905_0028781 | 3300037471 | Bacteria | 5235 |
| 609 | Ga0395905_0149731 | 3300037471 | Bacteria | 2196 |
| 610 | Ga0436364_0093921 | 3300037853 | Bacteria | 15238 |
| 611 | Ga0436364_0118843 | 3300037853 | Bacteria | 1215 |
| 612 | Ga0436364_0287407 | 3300037853 | Bacteria | 132611 |
| 613 | Ga0436364_0639700 | 3300037853 | Bacteria | 1225 |
| 614 | Ga0436364_0732570 | 3300037853 | Bacteria | 62691 |
| 615 | Ga0436364_0786912 | 3300037853 | Bacteria | 2866 |
| 616 | Ga0436364_0886432 | 3300037853 | Bacteria | 2692 |
| 617 | Ga0436364_0935193 | 3300037853 | Bacteria | 1531 |
| 618 | Ga0436364_1083867 | 3300037853 | Bacteria | 4252 |
| 619 | Ga0436364_1537007 | 3300037853 | Bacteria | 5306 |
| 620 | Ga0395901_0032412 | 3300038443 | Bacteria | 5391 |
| 621 | Ga0395901_0044943 | 3300038443 | Bacteria | 4582 |
| 622 | Ga0395901_0072361 | 3300038443 | Bacteria | 3594 |
| 623 | Ga0395901_0231170 | 3300038443 | Bacteria | 1930 |
| 624 | Ga0395901_0338218 | 3300038443 | Bacteria | 1555 |
| 625 | Ga0395901_0441791 | 3300038443 | Bacteria | 1331 |
| 626 | Ga0400485_02208 | 3300038735 | Bacteria | 45471 |
| 627 | Ga0400486_25692 | 3300038742 | Bacteria | 36614 |
| 628 | Ga0436360_0021783 | 3300039438 | Bacteria | 1375 |
| 629 | Ga0436360_0455054 | 3300039438 | Bacteria | 2049 |
| 630 | Ga0436361_0756449 | 3300039447 | Bacteria | 1580 |
| 631 | Ga0436363_0045890 | 3300039450 | Bacteria | 1127 |
| 632 | Ga0436363_0398535 | 3300039450 | Bacteria | 848 |
| 633 | Ga0436363_0838504 | 3300039450 | Bacteria | 3983 |
| 634 | Ga0439436_0003729 | 3300041404 | Bacteria | 4651 |
| 635 | Ga0451853_3927494 | 3300041512 | Bacteria | 1778 |
| 636 | Ga0439433_0009335 | 3300041999 | Bacteria | 2135 |
| 637 | Ga0439442_011772 | 3300042002 | Bacteria | 1784 |
| 638 | Ga0439448_0000572 | 3300042005 | Bacteria | 8631 |
| 639 | Ga0439448_0051675 | 3300042005 | Bacteria | 1346 |
| 640 | Ga0439449_0005338 | 3300042007 | Bacteria | 4921 |
| 641 | Ga0439455_0026469 | 3300042012 | Bacteria | 1416 |
| 642 | Ga0439463_003040 | 3300042016 | Bacteria | 4258 |
| 643 | Ga0439458_0003964 | 3300042157 | Bacteria | 3420 |
| 644 | Ga0439464_0010056 | 3300042439 | Bacteria | 2495 |
| 645 | Ga0439464_0010767 | 3300042439 | Bacteria | 2417 |
| 646 | Ga0439460_0012086 | 3300042461 | Bacteria | 2234 |
| 647 | Ga0439460_0044508 | 3300042461 | Bacteria | 1314 |
| 648 | Ga0450916_000764 | 3300042530 | Bacteria | 2970 |
| 649 | Ga0466965_0142339 | 3300044683 | Bacteria | 1250 |
| 650 | Ga0466966_0196157 | 3300044684 | Bacteria | 1222 |
| 651 | Ga0466961_0017604 | 3300044693 | Bacteria | 4591 |
| 652 | Ga0466961_0068036 | 3300044693 | Bacteria | 2262 |
| 653 | Ga0466961_0233543 | 3300044693 | Bacteria | 1131 |
| 654 | Ga0466963_0015064 | 3300044694 | Bacteria | 4780 |
| 655 | Ga0466963_0038698 | 3300044694 | Bacteria | 3120 |
| 656 | Ga0466963_0109300 | 3300044694 | Bacteria | 1897 |
| 657 | Ga0466963_0267352 | 3300044694 | Bacteria | 1201 |
| 658 | Ga0466964_0054574 | 3300044706 | Bacteria | 1647 |
| 659 | Ga0466964_0063476 | 3300044706 | Bacteria | 1543 |
| 660 | Ga0466971_0124060 | 3300044719 | Bacteria | 1196 |
| 661 | Ga0466968_0000127 | 3300044735 | Bacteria | 22573 |
| 662 | Ga0466970_0001582 | 3300044765 | Bacteria | 10998 |
| 663 | Ga0466970_0032333 | 3300044765 | Bacteria | 2764 |
| 664 | Ga0466970_0120894 | 3300044765 | Bacteria | 1434 |
| 665 | Ga0466957_0002458 | 3300044842 | Bacteria | 9948 |
| 666 | Ga0466957_0199478 | 3300044842 | Bacteria | 1314 |
| 667 | Ga0466960_0014624 | 3300044901 | Bacteria | 3366 |
| 668 | Ga0466960_0098437 | 3300044901 | Bacteria | 1502 |
| 669 | Ga0466959_0163057 | 3300045049 | Bacteria | 1566 |
| 670 | Ga0466959_0184133 | 3300045049 | Bacteria | 1460 |
| 671 | Ga0466959_0285378 | 3300045049 | Bacteria | 1132 |
| 672 | Ga0466958_0002125 | 3300045836 | Bacteria | 9848 |
| 673 | Ga0466958_0025951 | 3300045836 | Bacteria | 3459 |
| 674 | Ga0466967_0006236 | 3300045976 | Bacteria | 8408 |
| 675 | Ga0466967_0097718 | 3300045976 | Bacteria | 2680 |
| 676 | Ga0466967_0123286 | 3300045976 | Bacteria | 2397 |
| 677 | Ga0466967_0141670 | 3300045976 | Bacteria | 2240 |
| 678 | Ga0466967_0144241 | 3300045976 | Bacteria | 2220 |
| 679 | Ga0466967_0168790 | 3300045976 | Bacteria | 2057 |
| 680 | Ga0466967_0223140 | 3300045976 | Bacteria | 1792 |
| 681 | Ga0495592_0000133 | 3300046454 | Bacteria | 66075 |
| 682 | Ga0495592_0021245 | 3300046454 | Bacteria | 4935 |
| 683 | Ga0495592_0027905 | 3300046454 | Bacteria | 4276 |
| 684 | Ga0495592_0045713 | 3300046454 | Bacteria | 3266 |
| 685 | Ga0495592_0145629 | 3300046454 | Bacteria | 1643 |
| 686 | Ga0495629_0003615 | 3300046459 | Bacteria | 11686 |
| 687 | Ga0495629_0120393 | 3300046459 | Bacteria | 1828 |
| 688 | Ga0495641_0013730 | 3300046461 | Bacteria | 4427 |
| 689 | Ga0495641_0026292 | 3300046461 | Bacteria | 2841 |
| 690 | Ga0495651_0000019 | 3300046462 | Bacteria | 120970 |
| 691 | Ga0495651_0001424 | 3300046462 | Bacteria | 18558 |
| 692 | Ga0495651_0013797 | 3300046462 | Bacteria | 6249 |
| 693 | Ga0495651_0030057 | 3300046462 | Bacteria | 4236 |
| 694 | Ga0495651_0126446 | 3300046462 | Bacteria | 1871 |
| 695 | Ga0495653_0003782 | 3300046463 | Bacteria | 12247 |
| 696 | Ga0495653_0006300 | 3300046463 | Bacteria | 9733 |
| 697 | Ga0495653_0010412 | 3300046463 | Bacteria | 7606 |
| 698 | Ga0495653_0015651 | 3300046463 | Bacteria | 6182 |
| 699 | Ga0495653_0017351 | 3300046463 | Bacteria | 5855 |
| 700 | Ga0495653_0098404 | 3300046463 | Bacteria | 2124 |
| 701 | Ga0495653_0151850 | 3300046463 | Bacteria | 1617 |
| 702 | Ga0495582_0000493 | 3300046473 | Bacteria | 21575 |
| 703 | Ga0495582_0015285 | 3300046473 | Bacteria | 4218 |
| 704 | Ga0495582_0080091 | 3300046473 | Bacteria | 1813 |
| 705 | Ga0495639_0005262 | 3300046475 | Bacteria | 5564 |
| 706 | Ga0495639_0007891 | 3300046475 | Bacteria | 4575 |
| 707 | Ga0495662_0020889 | 3300046476 | Bacteria | 3167 |
| 708 | Ga0495662_0103426 | 3300046476 | Bacteria | 1393 |
| 709 | Ga0495662_0160612 | 3300046476 | Bacteria | 1107 |
| 710 | Ga0495664_0006872 | 3300046477 | Bacteria | 6297 |
| 711 | Ga0495664_0009160 | 3300046477 | Bacteria | 5535 |
| 712 | Ga0495664_0010930 | 3300046477 | Bacteria | 5105 |
| 713 | Ga0495664_0017711 | 3300046477 | Bacteria | 4073 |
| 714 | Ga0495664_0020928 | 3300046477 | Bacteria | 3776 |
| 715 | Ga0495664_0062050 | 3300046477 | Bacteria | 2225 |
| 716 | Ga0495664_0108657 | 3300046477 | Bacteria | 1673 |
| 717 | Ga0495594_0097426 | 3300046499 | Bacteria | 1653 |
| 718 | Ga0495596_0022225 | 3300046500 | Bacteria | 2583 |
| 719 | Ga0495608_0000028 | 3300046511 | Bacteria | 151829 |
| 720 | Ga0495608_0009390 | 3300046511 | Bacteria | 6838 |
| 721 | Ga0495608_0014063 | 3300046511 | Bacteria | 5554 |
| 722 | Ga0495608_0020716 | 3300046511 | Bacteria | 4517 |
| 723 | Ga0495608_0044749 | 3300046511 | Bacteria | 2953 |
| 724 | Ga0495608_0108063 | 3300046511 | Bacteria | 1789 |
| 725 | Ga0495608_0236051 | 3300046511 | Bacteria | 1143 |
| 726 | Ga0495608_0275611 | 3300046511 | Bacteria | 1045 |
| 727 | Ga0495618_0052774 | 3300046514 | Bacteria | 2570 |
| 728 | Ga0495618_0108712 | 3300046514 | Bacteria | 1775 |
| 729 | Ga0495618_0130471 | 3300046514 | Bacteria | 1608 |
| 730 | Ga0495628_0000337 | 3300046516 | Bacteria | 42541 |
| 731 | Ga0495628_0010312 | 3300046516 | Bacteria | 7943 |
| 732 | Ga0495628_0088817 | 3300046516 | Bacteria | 2394 |
| 733 | Ga0495628_0254132 | 3300046516 | Bacteria | 1311 |
| 734 | Ga0495630_0051465 | 3300046517 | Bacteria | 3082 |
| 735 | Ga0495630_0078411 | 3300046517 | Bacteria | 2491 |
| 736 | Ga0495630_0101646 | 3300046517 | Bacteria | 2175 |
| 737 | Ga0495630_0156506 | 3300046517 | Bacteria | 1734 |
| 738 | Ga0495632_0072168 | 3300046519 | Bacteria | 1657 |
| 739 | Ga0495644_0072826 | 3300046523 | Bacteria | 1292 |
| 740 | Ga0495666_0058276 | 3300046526 | Bacteria | 1848 |
| 741 | Ga0495666_0078256 | 3300046526 | Bacteria | 1566 |
| 742 | Ga0495652_0000031 | 3300046529 | Bacteria | 151765 |
| 743 | Ga0495652_0019111 | 3300046529 | Bacteria | 6103 |
| 744 | Ga0495652_0033547 | 3300046529 | Bacteria | 4481 |
| 745 | Ga0495652_0071909 | 3300046529 | Bacteria | 2885 |
| 746 | Ga0495652_0095275 | 3300046529 | Bacteria | 2425 |
| 747 | Ga0495652_0103519 | 3300046529 | Bacteria | 2304 |
| 748 | Ga0495652_0152813 | 3300046529 | Bacteria | 1801 |
| 749 | Ga0495665_0012938 | 3300046531 | Bacteria | 4516 |
| 750 | Ga0495665_0052706 | 3300046531 | Bacteria | 2153 |
| 751 | Ga0495665_0111120 | 3300046531 | Bacteria | 1437 |
| 752 | Ga0495640_0046881 | 3300046533 | Bacteria | 2992 |
| 753 | Ga0495640_0056386 | 3300046533 | Bacteria | 2685 |
| 754 | Ga0495640_0086003 | 3300046533 | Bacteria | 2083 |
| 755 | Ga0495640_0223359 | 3300046533 | Bacteria | 1187 |
| 756 | Ga0495586_0022724 | 3300046535 | Bacteria | 3347 |
| 757 | Ga0495587_0000023 | 3300046536 | Bacteria | 151763 |
| 758 | Ga0495587_0010018 | 3300046536 | Bacteria | 6052 |
| 759 | Ga0495587_0017955 | 3300046536 | Bacteria | 4387 |
| 760 | Ga0495587_0020164 | 3300046536 | Bacteria | 4118 |
| 761 | Ga0495587_0104905 | 3300046536 | Bacteria | 1626 |
| 762 | Ga0495645_0001100 | 3300046543 | Bacteria | 18313 |
| 763 | Ga0495645_0008216 | 3300046543 | Bacteria | 7279 |
| 764 | Ga0495645_0021367 | 3300046543 | Bacteria | 4678 |
| 765 | Ga0495645_0028709 | 3300046543 | Bacteria | 4042 |
| 766 | Ga0495645_0031746 | 3300046543 | Bacteria | 3849 |
| 767 | Ga0495645_0055887 | 3300046543 | Bacteria | 2865 |
| 768 | Ga0495645_0057243 | 3300046543 | Bacteria | 2830 |
| 769 | Ga0495645_0132004 | 3300046543 | Bacteria | 1749 |
| 770 | Ga0495667_0000054 | 3300046559 | Bacteria | 105009 |
| 771 | Ga0495667_0001016 | 3300046559 | Bacteria | 18127 |
| 772 | Ga0495667_0003509 | 3300046559 | Bacteria | 10519 |
| 773 | Ga0495667_0005370 | 3300046559 | Bacteria | 8664 |
| 774 | Ga0495667_0008650 | 3300046559 | Bacteria | 6912 |
| 775 | Ga0495667_0008718 | 3300046559 | Bacteria | 6887 |
| 776 | Ga0495667_0030351 | 3300046559 | Bacteria | 3633 |
| 777 | Ga0495667_0065162 | 3300046559 | Bacteria | 2383 |
| 778 | Ga0495634_0044036 | 3300046642 | Bacteria | 3022 |
| 779 | Ga0495634_0057617 | 3300046642 | Bacteria | 2592 |
| 780 | Ga0495634_0107121 | 3300046642 | Bacteria | 1800 |
| 781 | Ga0495611_0067192 | 3300046648 | Bacteria | 1636 |
| 782 | Ga0495635_0001264 | 3300046663 | Bacteria | 16898 |
| 783 | Ga0495635_0003596 | 3300046663 | Bacteria | 10733 |
| 784 | Ga0495635_0030032 | 3300046663 | Bacteria | 3778 |
| 785 | Ga0495635_0030207 | 3300046663 | Bacteria | 3765 |
| 786 | Ga0495635_0033733 | 3300046663 | Bacteria | 3551 |
| 787 | Ga0495635_0038410 | 3300046663 | Bacteria | 3315 |
| 788 | Ga0495659_0049178 | 3300046664 | Bacteria | 1530 |
| 789 | Ga0495657_0000022 | 3300046675 | Bacteria | 151837 |
| 790 | Ga0495657_0002053 | 3300046675 | Bacteria | 17157 |
| 791 | Ga0495657_0025333 | 3300046675 | Bacteria | 4214 |
| 792 | Ga0495657_0056185 | 3300046675 | Bacteria | 2622 |
| 793 | Ga0495657_0091134 | 3300046675 | Bacteria | 1956 |
| 794 | Ga0495657_0113762 | 3300046675 | Bacteria | 1711 |
| 795 | Ga0495599_0000125 | 3300046678 | Bacteria | 50781 |
| 796 | Ga0495599_0086416 | 3300046678 | Bacteria | 1958 |
| 797 | Ga0495623_0000416 | 3300046679 | Bacteria | 28025 |
| 798 | Ga0495623_0023167 | 3300046679 | Bacteria | 4007 |
| 799 | Ga0495623_0033514 | 3300046679 | Bacteria | 3295 |
| 800 | Ga0495623_0037893 | 3300046679 | Bacteria | 3083 |
| 801 | Ga0495623_0058265 | 3300046679 | Bacteria | 2428 |
| 802 | Ga0495623_0100795 | 3300046679 | Bacteria | 1759 |
| 803 | Ga0495646_0017254 | 3300046680 | Bacteria | 4581 |
| 804 | Ga0495646_0019999 | 3300046680 | Bacteria | 4233 |
| 805 | Ga0495646_0076103 | 3300046680 | Bacteria | 1966 |
| 806 | Ga0495646_0136431 | 3300046680 | Bacteria | 1376 |
| 807 | Ga0495646_0150015 | 3300046680 | Bacteria | 1297 |
| 808 | Ga0495647_0021475 | 3300046681 | Bacteria | 2324 |
| 809 | Ga0495658_0076226 | 3300046683 | Bacteria | 1959 |
| 810 | Ga0495658_0167186 | 3300046683 | Bacteria | 1359 |
| 811 | Ga0495613_0031895 | 3300046689 | Bacteria | 3913 |
| 812 | Ga0495624_0009088 | 3300046690 | Bacteria | 6894 |
| 813 | Ga0495624_0013469 | 3300046690 | Bacteria | 5575 |
| 814 | Ga0495624_0114947 | 3300046690 | Bacteria | 1654 |
| 815 | Ga0495624_0128899 | 3300046690 | Bacteria | 1551 |
| 816 | Ga0495670_0028797 | 3300046691 | Bacteria | 2754 |
| 817 | Ga0495600_0008548 | 3300046809 | Bacteria | 6296 |
| 818 | Ga0495600_0011991 | 3300046809 | Bacteria | 5411 |
| 819 | Ga0495600_0052868 | 3300046809 | Bacteria | 2652 |
| 820 | Ga0495600_0055207 | 3300046809 | Bacteria | 2594 |
| 821 | Ga0495600_0134971 | 3300046809 | Bacteria | 1603 |
| 822 | Ga0495600_0200203 | 3300046809 | Bacteria | 1283 |
| 823 | Ga0495600_0219902 | 3300046809 | Bacteria | 1215 |
| 824 | Ga0495581_0010470 | 3300047315 | Bacteria | 5361 |
| 825 | Ga0495581_0015106 | 3300047315 | Bacteria | 4482 |
| 826 | Ga0495581_0086599 | 3300047315 | Bacteria | 1816 |
| 827 | Ga0495581_0147695 | 3300047315 | Bacteria | 1372 |
| 828 | Ga0495604_0000022 | 3300047317 | Bacteria | 151744 |
| 829 | Ga0495604_0030817 | 3300047317 | Bacteria | 4256 |
| 830 | Ga0495604_0034218 | 3300047317 | Bacteria | 4021 |
| 831 | Ga0495604_0136622 | 3300047317 | Bacteria | 1756 |
| 832 | Ga0495604_0171420 | 3300047317 | Bacteria | 1525 |
| 833 | Ga0495604_0184356 | 3300047317 | Bacteria | 1458 |
| 834 | Ga0495674_0002831 | 3300047319 | Bacteria | 16861 |
| 835 | Ga0495674_0008396 | 3300047319 | Bacteria | 9843 |
| 836 | Ga0495674_0025284 | 3300047319 | Bacteria | 5446 |
| 837 | Ga0495674_0027125 | 3300047319 | Bacteria | 5238 |
| 838 | Ga0495674_0032708 | 3300047319 | Bacteria | 4715 |
| 839 | Ga0495674_0186190 | 3300047319 | Bacteria | 1727 |
| 840 | Ga0495676_0261425 | 3300047321 | Bacteria | 1177 |
| 841 | Ga0495680_0000154 | 3300047322 | Bacteria | 69567 |
| 842 | Ga0495680_0005823 | 3300047322 | Bacteria | 11532 |
| 843 | Ga0495680_0011807 | 3300047322 | Bacteria | 7715 |
| 844 | Ga0495680_0064853 | 3300047322 | Bacteria | 2799 |
| 845 | Ga0495680_0203865 | 3300047322 | Bacteria | 1418 |
| 846 | Ga0495680_0224846 | 3300047322 | Bacteria | 1338 |
| 847 | Ga0495680_0338032 | 3300047322 | Bacteria | 1051 |
| 848 | Ga0495675_0000843 | 3300047444 | Bacteria | 18757 |
| 849 | Ga0495675_0013912 | 3300047444 | Bacteria | 5088 |
| 850 | Ga0495675_0020526 | 3300047444 | Bacteria | 4203 |
| 851 | Ga0495675_0031919 | 3300047444 | Bacteria | 3363 |
| 852 | Ga0495675_0045040 | 3300047444 | Bacteria | 2809 |
| 853 | Ga0495675_0081429 | 3300047444 | Bacteria | 2038 |
| 854 | Ga0495675_0139513 | 3300047444 | Bacteria | 1503 |
| 855 | Ga0495677_0062292 | 3300047445 | Bacteria | 1384 |
| 856 | Ga0495684_0002351 | 3300047471 | Bacteria | 15113 |
| 857 | Ga0495684_0020511 | 3300047471 | Bacteria | 5094 |
| 858 | Ga0495684_0020760 | 3300047471 | Bacteria | 5060 |
| 859 | Ga0495684_0029724 | 3300047471 | Bacteria | 4193 |
| 860 | Ga0495684_0045475 | 3300047471 | Bacteria | 3360 |
| 861 | Ga0495684_0051985 | 3300047471 | Bacteria | 3126 |
| 862 | Ga0495684_0072458 | 3300047471 | Bacteria | 2617 |
| 863 | Ga0495684_0144903 | 3300047471 | Bacteria | 1779 |
| 864 | Ga0495593_0005889 | 3300047673 | Bacteria | 7222 |
| 865 | Ga0495593_0025477 | 3300047673 | Bacteria | 3274 |
| 866 | Ga0495602_0000195 | 3300048088 | Bacteria | 57149 |
| 867 | Ga0495602_0000251 | 3300048088 | Bacteria | 50166 |
| 868 | Ga0495602_0071257 | 3300048088 | Bacteria | 2968 |
| 869 | Ga0495602_0129599 | 3300048088 | Bacteria | 2014 |
| 870 | Ga0495602_0274928 | 3300048088 | Bacteria | 1243 |
| 871 | Ga0495602_0328137 | 3300048088 | Bacteria | 1111 |
| 872 | Ga0495614_0086759 | 3300048089 | Bacteria | 1359 |
| 873 | Ga0496100_0054147 | 3300048903 | Bacteria | 2615 |
| 874 | Ga0496101_0002786 | 3300048904 | Bacteria | 10718 |
| 875 | Ga0496102_0006094 | 3300048905 | Bacteria | 10280 |
| 876 | Ga0496102_0044150 | 3300048905 | Bacteria | 4044 |
| 877 | Ga0496102_0061553 | 3300048905 | Bacteria | 3435 |
| 878 | Ga0496103_0109747 | 3300048906 | Bacteria | 1752 |
| 879 | Ga0496104_0000798 | 3300048907 | Bacteria | 27060 |
| 880 | Ga0496104_0012341 | 3300048907 | Bacteria | 7680 |
| 881 | Ga0496104_0068816 | 3300048907 | Bacteria | 3364 |
| 882 | Ga0496104_0122788 | 3300048907 | Bacteria | 2493 |
| 883 | Ga0496105_0012818 | 3300048908 | Bacteria | 6645 |
| 884 | Ga0496105_0016937 | 3300048908 | Bacteria | 5831 |
| 885 | Ga0496105_0018502 | 3300048908 | Bacteria | 5603 |
| 886 | Ga0496105_0024086 | 3300048908 | Bacteria | 4944 |
| 887 | Ga0496106_0034290 | 3300048909 | Bacteria | 3790 |
| 888 | Ga0496106_0105687 | 3300048909 | Bacteria | 2187 |
| 889 | Ga0496106_0287040 | 3300048909 | Bacteria | 1319 |
| 890 | Ga0496107_0106800 | 3300048910 | Bacteria | 2056 |
| 891 | Ga0496107_0146431 | 3300048910 | Bacteria | 1746 |
| 892 | Ga0496107_0357290 | 3300048910 | Bacteria | 1087 |
| 893 | Ga0496108_0073187 | 3300048911 | Bacteria | 2893 |
| 894 | Ga0496108_0146718 | 3300048911 | Bacteria | 2034 |
| 895 | Ga0496108_0300630 | 3300048911 | Bacteria | 1398 |
| 896 | Ga0496109_0009817 | 3300048912 | Bacteria | 8171 |
| 897 | Ga0496109_0208517 | 3300048912 | Bacteria | 1837 |
| 898 | Ga0496110_0091221 | 3300048913 | Bacteria | 2725 |
| 899 | Ga0496110_0177546 | 3300048913 | Bacteria | 1933 |
| 900 | Ga0496110_0316810 | 3300048913 | Bacteria | 1421 |
| 901 | Ga0496110_0346966 | 3300048913 | Bacteria | 1352 |
| 902 | Ga0496111_0032415 | 3300048914 | Bacteria | 3725 |
| 903 | Ga0496111_0051138 | 3300048914 | Bacteria | 2983 |
| 904 | Ga0496112_0053238 | 3300048915 | Bacteria | 3974 |
| 905 | Ga0496112_0104811 | 3300048915 | Bacteria | 2798 |
| 906 | Ga0496112_0108323 | 3300048915 | Bacteria | 2748 |
| 907 | Ga0496113_0016988 | 3300048916 | Bacteria | 5039 |
| 908 | Ga0496113_0024157 | 3300048916 | Bacteria | 4316 |
| 909 | Ga0496113_0051817 | 3300048916 | Bacteria | 3063 |
| 910 | Ga0496113_0070327 | 3300048916 | Bacteria | 2660 |
| 911 | Ga0496114_0100327 | 3300048917 | Bacteria | 2470 |
| 912 | Ga0496114_0139974 | 3300048917 | Bacteria | 2094 |
| 913 | Ga0496115_0015886 | 3300048918 | Bacteria | 5720 |
| 914 | Ga0496115_0035994 | 3300048918 | Bacteria | 3918 |
| 915 | Ga0496115_0069974 | 3300048918 | Bacteria | 2843 |
| 916 | Ga0496115_0162714 | 3300048918 | Bacteria | 1845 |
| 917 | Ga0496119_0003055 | 3300048922 | Bacteria | 17709 |
| 918 | Ga0496121_0210719 | 3300048924 | Bacteria | 1377 |
| 919 | Ga0496126_0078461 | 3300048929 | Bacteria | 2926 |
| 920 | Ga0496126_0180939 | 3300048929 | Bacteria | 1791 |
| 921 | Ga0501031_0174904 | 3300049568 | Bacteria | 1402 |
| 922 | Ga0501032_0100248 | 3300049569 | Bacteria | 1919 |
| 923 | Ga0501033_0149713 | 3300049570 | Bacteria | 1684 |
| 924 | Ga0501036_0003648 | 3300049572 | Bacteria | 12312 |
| 925 | Ga0501037_0120427 | 3300049573 | Bacteria | 1887 |
| 926 | Ga0501038_0001572 | 3300049574 | Bacteria | 21145 |
| 927 | Ga0501038_0109061 | 3300049574 | Bacteria | 2294 |
| 928 | Ga0501039_0000354 | 3300049575 | Bacteria | 32857 |
| 929 | Ga0501040_0000917 | 3300049576 | Bacteria | 18488 |
| 930 | Ga0501041_0022606 | 3300049577 | Bacteria | 3765 |
| 931 | Ga0501042_0017637 | 3300049578 | Bacteria | 4927 |
| 932 | Ga0501042_0066361 | 3300049578 | Bacteria | 2579 |
| 933 | Ga0501046_0071323 | 3300049580 | Bacteria | 2699 |
| 934 | Ga0501047_0000141 | 3300049581 | Bacteria | 88104 |
| 935 | Ga0501048_0011341 | 3300049582 | Bacteria | 6646 |
| 936 | Ga0501068_0011701 | 3300049584 | Bacteria | 4960 |
| 937 | Ga0501072_0001751 | 3300049588 | Bacteria | 16134 |
| 938 | Ga0501072_0081895 | 3300049588 | Bacteria | 2559 |
| 939 | Ga0501074_0001654 | 3300049590 | Bacteria | 15132 |
| 940 | Ga0501074_0092134 | 3300049590 | Bacteria | 2170 |
| 941 | Ga0501075_0000450 | 3300049591 | Bacteria | 24475 |
| 942 | Ga0501076_0032057 | 3300049592 | Bacteria | 4101 |
| 943 | Ga0501077_0010629 | 3300049593 | Bacteria | 5732 |
| 944 | Ga0501079_0001334 | 3300049741 | Bacteria | 17363 |
| 945 | Ga0501080_0217989 | 3300049742 | Bacteria | 1747 |
| 946 | Ga0501081_0005425 | 3300049743 | Bacteria | 8231 |
| 947 | Ga0501035_0295741 | 3300049822 | Bacteria | 1365 |
| 948 | Ga0501045_0003401 | 3300049824 | Bacteria | 10897 |
| 949 | Ga0501045_0021181 | 3300049824 | Bacteria | 4648 |
| 950 | nmdc:mga05p37_1958_c1 | 3300050507 | Bacteria | 24006 |
| 951 | nmdc:mga05p37_21880_c1 | 3300050507 | Bacteria | 7748 |
| 952 | nmdc:mga05p37_220523_c1 | 3300050507 | Bacteria | 2289 |
| 953 | nmdc:mga05p37_558250_c1 | 3300050507 | Bacteria | 1302 |
| 954 | nmdc:mga05p37_61924_c1 | 3300050507 | Bacteria | 4606 |
| 955 | nmdc:mga09592_112556_c1 | 3300050508 | Bacteria | 2335 |
| 956 | nmdc:mga09592_368255_c1 | 3300050508 | Bacteria | 1243 |
| 957 | nmdc:mga09592_4052_c1 | 3300050508 | Bacteria | 11826 |
| 958 | nmdc:mga0qj67_10319_c1 | 3300050509 | Bacteria | 6976 |
| 959 | nmdc:mga0qj67_314_c1 | 3300050509 | Bacteria | 33600 |
| 960 | nmdc:mga0qj67_43141_c1 | 3300050509 | Bacteria | 3552 |
| 961 | nmdc:mga06r32_21997_c1 | 3300050510 | Bacteria | 5890 |
| 962 | nmdc:mga06r32_28294_c1 | 3300050510 | Bacteria | 5243 |
| 963 | nmdc:mga06r32_629_c3 | 3300050510 | Bacteria | 4841 |
| 964 | nmdc:mga08y16_11933_c1 | 3300050511 | Bacteria | 9125 |
| 965 | nmdc:mga08y16_132702_c1 | 3300050511 | Bacteria | 2589 |
| 966 | nmdc:mga08y16_136272_c1 | 3300050511 | Bacteria | 2552 |
| 967 | nmdc:mga08y16_30087_c1 | 3300050511 | Bacteria | 5716 |
| 968 | nmdc:mga0n895_10127_c1 | 3300050512 | Bacteria | 8299 |
| 969 | nmdc:mga0n895_18120_c1 | 3300050512 | Bacteria | 6510 |
| 970 | nmdc:mga0n895_262196_c1 | 3300050512 | Bacteria | 1754 |
| 971 | nmdc:mga0n895_416606_c1 | 3300050512 | Bacteria | 1358 |
| 972 | nmdc:mga0n895_75353_c1 | 3300050512 | Bacteria | 3354 |
| 973 | nmdc:mga0rr50_223505_c1 | 3300050513 | Bacteria | 1555 |
| 974 | nmdc:mga0rr50_234658_c1 | 3300050513 | Bacteria | 1519 |
| 975 | nmdc:mga0rr50_59627_c1 | 3300050513 | Bacteria | 2867 |
| 976 | nmdc:mga08x19_191754_c1 | 3300050514 | Bacteria | 1398 |
| 977 | nmdc:mga08x19_31370_c1 | 3300050514 | Bacteria | 3342 |
| 978 | nmdc:mga08x19_33680_c1 | 3300050514 | Bacteria | 3234 |
| 979 | nmdc:mga0a205_101699_c1 | 3300050515 | Bacteria | 2773 |
| 980 | nmdc:mga0a205_15293_c1 | 3300050515 | Bacteria | 7170 |
| 981 | nmdc:mga0a205_34049_c1 | 3300050515 | Bacteria | 4887 |
| 982 | nmdc:mga0a205_42659_c1 | 3300050515 | Bacteria | 4371 |
| 983 | nmdc:mga0a205_99733_c1 | 3300050515 | Bacteria | 2803 |
| 984 | Ga0495601_0046037 | 3300053077 | Bacteria | 2745 |
| 985 | Ga0495601_0070273 | 3300053077 | Bacteria | 2235 |
| 986 | Ga0495601_0077583 | 3300053077 | Bacteria | 2128 |
| 987 | Ga0495601_0077975 | 3300053077 | Bacteria | 2122 |
| 988 | Ga0495601_0098392 | 3300053077 | Bacteria | 1888 |
| 989 | Ga0495601_0228448 | 3300053077 | Bacteria | 1215 |
| 990 | Ga0495601_0249047 | 3300053077 | Bacteria | 1160 |
| 991 | Ga0495612_0003726 | 3300053078 | Bacteria | 6333 |
| 992 | Ga0495612_0004582 | 3300053078 | Bacteria | 5731 |
| 993 | Ga0495612_0008163 | 3300053078 | Bacteria | 4256 |
| 994 | Ga0495612_0019187 | 3300053078 | Bacteria | 2739 |
| 995 | Ga0495612_0039241 | 3300053078 | Bacteria | 1925 |
| 996 | Ga0495612_0087585 | 3300053078 | Bacteria | 1314 |
| 997 | Ga0495595_0001056 | 3300053084 | Bacteria | 10645 |
| 998 | Ga0495595_0013842 | 3300053084 | Bacteria | 3413 |
| 999 | Ga0495595_0017836 | 3300053084 | Bacteria | 3058 |
| 1000 | Ga0495595_0034282 | 3300053084 | Bacteria | 2295 |
| 1001 | Ga0495595_0052060 | 3300053084 | Bacteria | 1899 |
| 1002 | Ga0495595_0083694 | 3300053084 | Bacteria | 1523 |
| 1003 | Ga0495619_0041514 | 3300053085 | Bacteria | 3009 |
| 1004 | Ga0495619_0056829 | 3300053085 | Bacteria | 2595 |
| 1005 | Ga0495619_0115459 | 3300053085 | Bacteria | 1837 |
| 1006 | Ga0500644_0001435 | 3300053088 | Bacteria | 6304 |
| 1007 | Ga0501084_0013673 | 3300054114 | Bacteria | 6718 |
| 1008 | Ga0501084_0014695 | 3300054114 | Bacteria | 6492 |
| 1009 | Ga0501084_0352786 | 3300054114 | Bacteria | 1243 |
| 1010 | Ga0590075_005988 | 3300059424 | Bacteria | 2877 |
| 1011 | Ga0590077_001146 | 3300059426 | Bacteria | 6467 |
| 1012 | Ga0501082_0007058 | 3300060353 | Bacteria | 9697 |
| 1013 | Ga0501082_0033886 | 3300060353 | Bacteria | 4405 |
| 1014 | Ga0466962_0095767 | 3300061719 | Bacteria | 1423 |
| 1015 | Ga0530510_0000669 | 3300061734 | Bacteria | 22218 |
| 1016 | 2515496569 | 2515154088 | Bacteria | 5526283 |
| 1017 | 2515718426 | 2515154129 | Bacteria | 5584369 |
| 1018 | 2515756807 | 2515154137 | Bacteria | 5711575 |
| 1019 | 2515855258 | 2515154155 | Bacteria | 7985436 |
| 1020 | 2516083418 | 2515154202 | Bacteria | 5471270 |
| 1021 | 2516089330 | 2515154203 | Bacteria | 5458536 |
| 1022 | 2676473578 | 2675903058 | Bacteria | 6822861 |
| 1023 | 2676480256 | 2675903059 | Bacteria | 8644972 |
| 1024 | 2686539196 | 2684623035 | Bacteria | 8032739 |
| 1025 | 2731909024 | 2731639228 | Bacteria | 4187555 |
| 1026 | 2799184882 | 2799112218 | Bacteria | 4315149 |
| 1027 | 2827632091 | 2827628540 | Bacteria | 6858585 |
| 1028 | 2832007879 | 2832004796 | Bacteria | 6538017 |
| 1029 | 2855685961 | 2855683550 | Bacteria | 7134265 |
| 1030 | 2861524772 | 2861520306 | Bacteria | 8348283 |
| 1031 | 2866068786 | 2866065130 | Bacteria | 6518152 |
| 1032 | 2895890449 | 2895880812 | Bacteria | 11255272 |
| 1033 | 8003858437 | 8003856774 | Bacteria | 7675274 |
| 1034 | 8056056906 | 8056054917 | Bacteria | 5736694 |
| 1035 | Ga0213875_10000125 | |||
| 1036 | JGI25407J50210_10018873 | |||
| 1037 | Ga0070658_10000726 | |||
| 1038 | Ga0070658_10167961 | |||
| 1039 | Ga0070676_10043582 | |||
| 1040 | Ga0070683_100072950 | |||
| 1041 | Ga0070683_100173090 | |||
| 1042 | Ga0070683_100220782 | |||
| 1043 | Ga0068869_100006152 | |||
| 1044 | Ga0068869_100274442 | |||
| 1045 | Ga0070666_10106644 | |||
| 1046 | Ga0070680_100043236 | |||
| 1047 | Ga0070680_100056299 | |||
| 1048 | Ga0070680_100257496 | |||
| 1049 | Ga0068868_100044731 | |||
| 1050 | Ga0070660_100056267 | |||
| 1051 | Ga0070660_100085659 | |||
| 1052 | Ga0070687_100007727 | |||
| 1053 | Ga0070692_10003994 | |||
| 1054 | Ga0070675_100028479 | |||
| 1055 | Ga0070671_100044503 | |||
| 1056 | Ga0070673_100003932 | |||
| 1057 | Ga0070673_100038754 | |||
| 1058 | Ga0070659_100005916 | |||
| 1059 | Ga0070659_100010121 | |||
| 1060 | Ga0070659_100067507 | |||
| 1061 | Ga0070659_100176405 | |||
| 1062 | Ga0070659_100360254 | |||
| 1063 | Ga0070667_100211942 | |||
| 1064 | Ga0070709_10001361 | |||
| 1065 | Ga0070709_10012963 | |||
| 1066 | Ga0070709_10036675 | |||
| 1067 | Ga0070709_10088459 | |||
| 1068 | Ga0070709_10114686 | |||
| 1069 | Ga0070714_100000545 | |||
| 1070 | Ga0070714_100001325 | |||
| 1071 | Ga0070714_100025088 | |||
| 1072 | Ga0070714_100117982 | |||
| 1073 | Ga0070713_100000483 | |||
| 1074 | Ga0070713_100003097 | |||
| 1075 | Ga0070713_100008642 | |||
| 1076 | Ga0070713_100012555 | |||
| 1077 | Ga0070713_100021482 | |||
| 1078 | Ga0070713_100149652 | |||
| 1079 | Ga0070713_100165594 | |||
| 1080 | Ga0070710_10000539 | |||
| 1081 | Ga0070710_10000864 | |||
| 1082 | Ga0070710_10016620 | |||
| 1083 | Ga0070710_10063603 | |||
| 1084 | Ga0070710_10085268 | |||
| 1085 | Ga0070701_10085083 | |||
| 1086 | Ga0070711_100027416 | |||
| 1087 | Ga0070711_100056913 | |||
| 1088 | Ga0070711_100127218 | |||
| 1089 | Ga0070708_100001278 | |||
| 1090 | Ga0070708_100015039 | |||
| 1091 | Ga0070708_100198649 | |||
| 1092 | Ga0070708_100238464 | |||
| 1093 | Ga0070663_100026128 | |||
| 1094 | Ga0070663_100349091 | |||
| 1095 | Ga0070681_10087816 | |||
| 1096 | Ga0070681_10101000 | |||
| 1097 | Ga0070681_10174259 | |||
| 1098 | Ga0070681_10383872 | |||
| 1099 | Ga0070681_10390902 | |||
| 1100 | Ga0070681_10393953 | |||
| 1101 | Ga0070681_10537162 | |||
| 1102 | Ga0070685_10060058 | |||
| 1103 | Ga0070706_100000990 | |||
| 1104 | Ga0070706_100001894 | |||
| 1105 | Ga0070706_100004349 | |||
| 1106 | Ga0070706_100008020 | |||
| 1107 | Ga0070706_100024464 | |||
| 1108 | Ga0070706_100053956 | |||
| 1109 | Ga0070706_100057020 | |||
| 1110 | Ga0070706_100083098 | |||
| 1111 | Ga0070706_100096173 | |||
| 1112 | Ga0070707_100000256 | |||
| 1113 | Ga0070707_100004570 | |||
| 1114 | Ga0070707_100007016 | |||
| 1115 | Ga0070707_100026268 | |||
| 1116 | Ga0070707_100029674 | |||
| 1117 | Ga0070707_100168762 | |||
| 1118 | Ga0070707_100172512 | |||
| 1119 | Ga0070707_100180529 | |||
| 1120 | Ga0070707_100198649 | |||
| 1121 | Ga0070707_100233617 | |||
| 1122 | Ga0070707_100254561 | |||
| 1123 | Ga0070707_100305997 | |||
| 1124 | Ga0070698_100000292 | |||
| 1125 | Ga0070698_100000333 | |||
| 1126 | Ga0070698_100000898 | |||
| 1127 | Ga0070698_100002525 | |||
| 1128 | Ga0070698_100013017 | |||
| 1129 | Ga0070698_100017040 | |||
| 1130 | Ga0070698_100017971 | |||
| 1131 | Ga0070698_100051847 | |||
| 1132 | Ga0070698_100070857 | |||
| 1133 | Ga0070698_100086838 | |||
| 1134 | Ga0070698_100131717 | |||
| 1135 | Ga0070698_100228475 | |||
| 1136 | Ga0070699_100020685 | |||
| 1137 | Ga0070699_100028148 | |||
| 1138 | Ga0070699_100221012 | |||
| 1139 | Ga0070679_100034617 | |||
| 1140 | Ga0070679_100040543 | |||
| 1141 | Ga0070679_100053534 | |||
| 1142 | Ga0070679_100085114 | |||
| 1143 | Ga0070679_100173911 | |||
| 1144 | Ga0070679_100207892 | |||
| 1145 | Ga0070697_100108411 | |||
| 1146 | Ga0070697_100140261 | |||
| 1147 | Ga0068853_100227422 | |||
| 1148 | Ga0068853_100331322 | |||
| 1149 | Ga0070686_100004813 | |||
| 1150 | Ga0070696_100008315 | |||
| 1151 | Ga0070693_100003713 | |||
| 1152 | Ga0070693_100016084 | |||
| 1153 | Ga0070665_100006607 | |||
| 1154 | Ga0070665_100117827 | |||
| 1155 | Ga0070665_100147095 | |||
| 1156 | Ga0068855_100449672 | |||
| 1157 | Ga0070664_100016206 | |||
| 1158 | Ga0068854_100125742 | |||
| 1159 | Ga0068856_100115958 | |||
| 1160 | Ga0068856_100320759 | |||
| 1161 | Ga0068856_100380650 | |||
| 1162 | Ga0070702_100000031 | |||
| 1163 | Ga0070702_100030640 | |||
| 1164 | Ga0068852_100011289 | |||
| 1165 | Ga0068852_100295725 | |||
| 1166 | Ga0068859_100066935 | |||
| 1167 | Ga0068859_100443735 | |||
| 1168 | Ga0068864_100058887 | |||
| 1169 | Ga0068861_100014024 | |||
| 1170 | Ga0068861_100220936 | |||
| 1171 | Ga0068861_100264042 | |||
| 1172 | Ga0068851_10035674 | |||
| 1173 | Ga0068870_10000614 | |||
| 1174 | Ga0068863_100021114 | |||
| 1175 | Ga0068863_100111276 | |||
| 1176 | Ga0068863_100144648 | |||
| 1177 | Ga0068858_100180277 | |||
| 1178 | Ga0068858_100188374 | |||
| 1179 | Ga0068860_100043085 | |||
| 1180 | Ga0081455_10057618 | |||
| 1181 | Ga0081455_10156068 | |||
| 1182 | Ga0081538_10002786 | |||
| 1183 | Ga0081538_10008955 | |||
| 1184 | Ga0081538_10026674 | |||
| 1185 | Ga0081538_10034098 | |||
| 1186 | Ga0081538_10037427 | |||
| 1187 | Ga0081540_1000250 | |||
| 1188 | Ga0081540_1000330 | |||
| 1189 | Ga0081540_1005418 | |||
| 1190 | Ga0081540_1020749 | |||
| 1191 | Ga0081540_1032375 | |||
| 1192 | Ga0081539_10004919 | |||
| 1193 | Ga0081539_10018877 | |||
| 1194 | Ga0081539_10150970 | |||
| 1195 | Ga0070717_10001205 | |||
| 1196 | Ga0070717_10002725 | |||
| 1197 | Ga0070717_10011881 | |||
| 1198 | Ga0070717_10050812 | |||
| 1199 | Ga0070717_10076722 | |||
| 1200 | Ga0070717_10134834 | |||
| 1201 | Ga0070717_10263592 | |||
| 1202 | Ga0070717_10461944 | |||
| 1203 | Ga0075432_10026310 | |||
| 1204 | Ga0070715_10052548 | |||
| 1205 | Ga0070715_10057037 | |||
| 1206 | Ga0070716_100001415 | |||
| 1207 | Ga0070716_100026533 | |||
| 1208 | Ga0070716_100045435 | |||
| 1209 | Ga0070712_100002052 | |||
| 1210 | Ga0070712_100008902 | |||
| 1211 | Ga0070712_100014062 | |||
| 1212 | Ga0070712_100093705 | |||
| 1213 | Ga0070712_100398840 | |||
| 1214 | Ga0097621_100002544 | |||
| 1215 | Ga0097621_100037665 | |||
| 1216 | Ga0097621_100111339 | |||
| 1217 | Ga0068871_100047631 | |||
| 1218 | Ga0068871_100091961 | |||
| 1219 | Ga0068871_100129495 | |||
| 1220 | Ga0075428_100020125 | |||
| 1221 | Ga0075428_100062887 | |||
| 1222 | Ga0075428_100282093 | |||
| 1223 | Ga0075430_100000294 | |||
| 1224 | Ga0075430_100001663 | |||
| 1225 | Ga0075430_100006545 | |||
| 1226 | Ga0075430_100155213 | |||
| 1227 | Ga0075431_100046671 | |||
| 1228 | Ga0075431_100063910 | |||
| 1229 | Ga0075431_100272902 | |||
| 1230 | Ga0075433_10031211 | |||
| 1231 | Ga0075433_10049564 | |||
| 1232 | Ga0075433_10143574 | |||
| 1233 | Ga0075434_100009917 | |||
| 1234 | Ga0075434_100018423 | |||
| 1235 | Ga0075434_100044958 | |||
| 1236 | Ga0075434_100216438 | |||
| 1237 | Ga0075429_100002678 | |||
| 1238 | Ga0075429_100044119 | |||
| 1239 | Ga0075429_100116528 | |||
| 1240 | Ga0075436_100004879 | |||
| 1241 | Ga0075436_100074055 | |||
| 1242 | Ga0097620_100066940 | |||
| 1243 | Ga0097620_100443771 | |||
| 1244 | Ga0075435_100064936 | |||
| 1245 | Ga0075435_100232998 | |||
| 1246 | Ga0075435_100328524 | |||
| 1247 | Ga0105240_10251979 | |||
| 1248 | Ga0111539_10032226 | |||
| 1249 | Ga0111539_10047409 | |||
| 1250 | Ga0105245_10005437 | |||
| 1251 | Ga0105245_10056487 | |||
| 1252 | Ga0105247_10053503 | |||
| 1253 | Ga0114129_10006711 | |||
| 1254 | Ga0114129_10009018 | |||
| 1255 | Ga0114129_10047822 | |||
| 1256 | Ga0114129_10166468 | |||
| 1257 | Ga0114129_10184699 | |||
| 1258 | Ga0114129_10412805 | |||
| 1259 | Ga0105243_10365331 | |||
| 1260 | Ga0105241_10379178 | |||
| 1261 | Ga0105248_10152913 | |||
| 1262 | Ga0105248_10294461 | |||
| 1263 | Ga0105237_10033633 | |||
| 1264 | Ga0105238_10129275 | |||
| 1265 | Ga0105238_10290145 | |||
| 1266 | Ga0105249_10073392 | |||
| 1267 | Ga0099796_10050215 | |||
| 1268 | Ga0105239_10036023 | |||
| 1269 | Ga0157313_1001542 | |||
| 1270 | Ga0157371_10059306 | |||
| 1271 | Ga0157371_10137477 | |||
| 1272 | Ga0157370_10049599 | |||
| 1273 | Ga0157370_10057438 | |||
| 1274 | Ga0157370_10090646 | |||
| 1275 | Ga0157369_10011739 | |||
| 1276 | Ga0157369_10264471 | |||
| 1277 | Ga0157374_10020729 | |||
| 1278 | Ga0157374_10259101 | |||
| 1279 | Ga0163162_10013494 | |||
| 1280 | Ga0163162_10127754 | |||
| 1281 | Ga0157375_10193002 | |||
| 1282 | Ga0157375_10448831 | |||
| 1283 | Ga0163163_10001600 | |||
| 1284 | Ga0157379_10017361 | |||
| 1285 | Ga0157379_10146024 | |||
| 1286 | Ga0157379_10150130 | |||
| 1287 | Ga0157376_10103696 | |||
| 1288 | Ga0163161_10099487 | |||
| 1289 | Ga0206349_1541197 | |||
| 1290 | Ga0206351_10996409 | |||
| 1291 | Ga0206354_10500860 | |||
| 1292 | Ga0206354_10593962 | |||
| 1293 | Ga0213873_10019370 | |||
| 1294 | Ga0213875_10000250 | |||
| 1295 | Ga0213875_10016542 | |||
| 1296 | Ga0213875_10033159 | |||
| 1297 | Ga0213871_10050030 | |||
| 1298 | Ga0224712_10003353 | |||
| 1299 | Ga0224712_10012929 | |||
| 1300 | Ga0224712_10013796 | |||
| 1301 | Ga0224712_10017923 | |||
| 1302 | Ga0224712_10021524 | |||
| 1303 | Ga0224712_10021811 | |||
| 1304 | Ga0224712_10127430 | |||
| 1305 | Ga0224572_1000791 | |||
| 1306 | Ga0207656_10020636 | |||
| 1307 | Ga0207653_10008398 | |||
| 1308 | Ga0207692_10001094 | |||
| 1309 | Ga0207692_10001437 | |||
| 1310 | Ga0207692_10004739 | |||
| 1311 | Ga0207692_10025602 | |||
| 1312 | Ga0207692_10033061 | |||
| 1313 | Ga0207692_10138175 | |||
| 1314 | Ga0207692_10244113 | |||
| 1315 | Ga0207710_10028052 | |||
| 1316 | Ga0207688_10017900 | |||
| 1317 | Ga0207688_10106533 | |||
| 1318 | Ga0207680_10025579 | |||
| 1319 | Ga0207685_10022394 | |||
| 1320 | Ga0207685_10039962 | |||
| 1321 | Ga0207699_10001830 | |||
| 1322 | Ga0207699_10006266 | |||
| 1323 | Ga0207699_10011057 | |||
| 1324 | Ga0207699_10074359 | |||
| 1325 | Ga0207699_10154582 | |||
| 1326 | Ga0207643_10000204 | |||
| 1327 | Ga0207705_10001642 | |||
| 1328 | Ga0207684_10001419 | |||
| 1329 | Ga0207684_10002612 | |||
| 1330 | Ga0207684_10002799 | |||
| 1331 | Ga0207684_10015342 | |||
| 1332 | Ga0207684_10092354 | |||
| 1333 | Ga0207684_10186921 | |||
| 1334 | Ga0207654_10054753 | |||
| 1335 | Ga0207707_10035796 | |||
| 1336 | Ga0207707_10098332 | |||
| 1337 | Ga0207707_10109135 | |||
| 1338 | Ga0207695_10287073 | |||
| 1339 | Ga0207695_10361244 | |||
| 1340 | Ga0207671_10071968 | |||
| 1341 | Ga0207671_10151559 | |||
| 1342 | Ga0207693_10001078 | |||
| 1343 | Ga0207693_10005180 | |||
| 1344 | Ga0207693_10008773 | |||
| 1345 | Ga0207693_10013430 | |||
| 1346 | Ga0207693_10014990 | |||
| 1347 | Ga0207693_10085727 | |||
| 1348 | Ga0207693_10138270 | |||
| 1349 | Ga0207663_10010431 | |||
| 1350 | Ga0207663_10014695 | |||
| 1351 | Ga0207663_10039635 | |||
| 1352 | Ga0207663_10074280 | |||
| 1353 | Ga0207663_10084495 | |||
| 1354 | Ga0207660_10038844 | |||
| 1355 | Ga0207660_10254343 | |||
| 1356 | Ga0207662_10011478 | |||
| 1357 | Ga0207662_10052164 | |||
| 1358 | Ga0207657_10044561 | |||
| 1359 | Ga0207657_10089951 | |||
| 1360 | Ga0207657_10105478 | |||
| 1361 | Ga0207657_10165197 | |||
| 1362 | Ga0207649_10018450 | |||
| 1363 | Ga0207652_10124104 | |||
| 1364 | Ga0207652_10159071 | |||
| 1365 | Ga0207652_10219371 | |||
| 1366 | Ga0207652_10403798 | |||
| 1367 | Ga0207646_10000950 | |||
| 1368 | Ga0207646_10001124 | |||
| 1369 | Ga0207646_10031779 | |||
| 1370 | Ga0207646_10044143 | |||
| 1371 | Ga0207646_10072069 | |||
| 1372 | Ga0207646_10102009 | |||
| 1373 | Ga0207646_10184097 | |||
| 1374 | Ga0207646_10201908 | |||
| 1375 | Ga0207650_10002710 | |||
| 1376 | Ga0207659_10004400 | |||
| 1377 | Ga0207687_10006217 | |||
| 1378 | Ga0207687_10074652 | |||
| 1379 | Ga0207687_10075188 | |||
| 1380 | Ga0207700_10001672 | |||
| 1381 | Ga0207700_10002173 | |||
| 1382 | Ga0207700_10005055 | |||
| 1383 | Ga0207700_10020413 | |||
| 1384 | Ga0207700_10021329 | |||
| 1385 | Ga0207700_10022331 | |||
| 1386 | Ga0207700_10034120 | |||
| 1387 | Ga0207700_10057202 | |||
| 1388 | Ga0207700_10096005 | |||
| 1389 | Ga0207700_10301731 | |||
| 1390 | Ga0207664_10000427 | |||
| 1391 | Ga0207664_10000940 | |||
| 1392 | Ga0207664_10002584 | |||
| 1393 | Ga0207664_10007361 | |||
| 1394 | Ga0207664_10020499 | |||
| 1395 | Ga0207664_10021524 | |||
| 1396 | Ga0207664_10043770 | |||
| 1397 | Ga0207664_10052186 | |||
| 1398 | Ga0207664_10053493 | |||
| 1399 | Ga0207664_10080047 | |||
| 1400 | Ga0207664_10191859 | |||
| 1401 | Ga0207664_10304935 | |||
| 1402 | Ga0207644_10007562 | |||
| 1403 | Ga0207644_10044521 | |||
| 1404 | Ga0207690_10000219 | |||
| 1405 | Ga0207690_10030154 | |||
| 1406 | Ga0207690_10333355 | |||
| 1407 | Ga0207686_10114479 | |||
| 1408 | Ga0207670_10035613 | |||
| 1409 | Ga0207665_10001719 | |||
| 1410 | Ga0207665_10002491 | |||
| 1411 | Ga0207665_10017416 | |||
| 1412 | Ga0207665_10025411 | |||
| 1413 | Ga0207665_10056283 | |||
| 1414 | Ga0207665_10134613 | |||
| 1415 | Ga0207665_10141555 | |||
| 1416 | Ga0207691_10029944 | |||
| 1417 | Ga0207711_10178971 | |||
| 1418 | Ga0207689_10000223 | |||
| 1419 | Ga0207689_10017179 | |||
| 1420 | Ga0207661_10130930 | |||
| 1421 | Ga0207661_10510587 | |||
| 1422 | Ga0207679_10006307 | |||
| 1423 | Ga0207712_10023350 | |||
| 1424 | Ga0207712_10098587 | |||
| 1425 | Ga0207668_10127648 | |||
| 1426 | Ga0207640_10046715 | |||
| 1427 | Ga0207640_10270453 | |||
| 1428 | Ga0207677_10018630 | |||
| 1429 | Ga0207703_10040754 | |||
| 1430 | Ga0207639_10083405 | |||
| 1431 | Ga0207639_10328799 | |||
| 1432 | Ga0207678_10002516 | |||
| 1433 | Ga0207678_10006007 | |||
| 1434 | Ga0207708_10046904 | |||
| 1435 | Ga0207702_10043655 | |||
| 1436 | Ga0207702_10056949 | |||
| 1437 | Ga0207702_10070243 | |||
| 1438 | Ga0207702_10130343 | |||
| 1439 | Ga0207702_10370778 | |||
| 1440 | Ga0207702_10386642 | |||
| 1441 | Ga0207641_10009542 | |||
| 1442 | Ga0207676_10001541 | |||
| 1443 | Ga0207676_10156658 | |||
| 1444 | Ga0207674_10004964 | |||
| 1445 | Ga0207674_10123468 | |||
| 1446 | Ga0207675_100002250 | |||
| 1447 | Ga0207675_100037515 | |||
| 1448 | Ga0207675_100265546 | |||
| 1449 | Ga0207683_10000804 | |||
| 1450 | Ga0207683_10005606 | |||
| 1451 | Ga0207683_10024244 | |||
| 1452 | Ga0207698_10002366 | |||
| 1453 | Ga0207698_10317204 | |||
| 1454 | Ga0207428_10000537 | |||
| 1455 | Ga0207428_10009923 | |||
| 1456 | Ga0207428_10068605 | |||
| 1457 | Ga0268266_10023015 | |||
| 1458 | Ga0268266_10525110 | |||
| 1459 | Ga0265336_10004601 | |||
| 1460 | Ga0307517_10074469 | |||
| 1461 | Ga0307515_10001066 | |||
| 1462 | Ga0307515_10009042 | |||
| 1463 | Ga0307515_10170578 | |||
| 1464 | Ga0265338_10002247 | |||
| 1465 | Ga0265338_10014640 | |||
| 1466 | Ga0265338_10031380 | |||
| 1467 | Ga0307512_10003683 | |||
| 1468 | Ga0307512_10025517 | |||
| 1469 | Ga0316181_1149483 | |||
| 1470 | Ga0265330_10081434 | |||
| 1471 | Ga0265320_10022258 | |||
| 1472 | Ga0265325_10027015 | |||
| 1473 | Ga0265340_10008623 | |||
| 1474 | Ga0265340_10013418 | |||
| 1475 | Ga0265340_10034361 | |||
| 1476 | Ga0265316_10042524 | |||
| 1477 | Ga0307513_10000001 | |||
| 1478 | Ga0307513_10036904 | |||
| 1479 | Ga0307509_10178452 | |||
| 1480 | Ga0307408_100018031 | |||
| 1481 | Ga0307408_100030377 | |||
| 1482 | Ga0307408_100206281 | |||
| 1483 | Ga0265313_10046513 | |||
| 1484 | Ga0307508_10033247 | |||
| 1485 | Ga0307508_10306467 | |||
| 1486 | Ga0316579_10011444 | |||
| 1487 | Ga0316579_10079237 | |||
| 1488 | Ga0265314_10022618 | |||
| 1489 | Ga0265314_10136154 | |||
| 1490 | Ga0265342_10094939 | |||
| 1491 | Ga0316576_10014040 | |||
| 1492 | Ga0316578_10020196 | |||
| 1493 | Ga0307516_10001792 | |||
| 1494 | Ga0307405_10016418 | |||
| 1495 | Ga0307405_10034777 | |||
| 1496 | Ga0307405_10071517 | |||
| 1497 | Ga0307413_10002297 | |||
| 1498 | Ga0307413_10028958 | |||
| 1499 | Ga0307413_10126857 | |||
| 1500 | Ga0307413_10174920 | |||
| 1501 | Ga0307410_10008218 | |||
| 1502 | Ga0307410_10012065 | |||
| 1503 | Ga0307410_10017362 | |||
| 1504 | Ga0307410_10151531 | |||
| 1505 | Ga0326468_10000905 | |||
| 1506 | Ga0307406_10005635 | |||
| 1507 | Ga0307406_10080903 | |||
| 1508 | Ga0307406_10140744 | |||
| 1509 | Ga0307407_10010091 | |||
| 1510 | Ga0307412_10037573 | |||
| 1511 | Ga0307412_10176155 | |||
| 1512 | Ga0307409_100042353 | |||
| 1513 | Ga0307409_100062244 | |||
| 1514 | Ga0307409_100074136 | |||
| 1515 | Ga0307409_100224732 | |||
| 1516 | Ga0307416_100005911 | |||
| 1517 | Ga0307416_100010416 | |||
| 1518 | Ga0307416_100014187 | |||
| 1519 | Ga0307416_100021209 | |||
| 1520 | Ga0307416_100022814 | |||
| 1521 | Ga0307416_100026645 | |||
| 1522 | Ga0307416_100051710 | |||
| 1523 | Ga0307416_100127411 | |||
| 1524 | Ga0307416_100190815 | |||
| 1525 | Ga0307414_10295094 | |||
| 1526 | Ga0307411_10003583 | |||
| 1527 | Ga0307411_10013764 | |||
| 1528 | Ga0307411_10067943 | |||
| 1529 | Ga0307415_100001464 | |||
| 1530 | Ga0307415_100005414 | |||
| 1531 | Ga0307415_100005543 | |||
| 1532 | Ga0307415_100048312 | |||
| 1533 | Ga0307415_100059169 | |||
| 1534 | Ga0307415_100115846 | |||
| 1535 | Ga0307415_100165772 | |||
| 1536 | Ga0307415_100231174 | |||
| 1537 | Ga0316583_10003287 | |||
| 1538 | Ga0316585_10024611 | |||
| 1539 | Ga0307510_10178321 | |||
| 1540 | Ga0373930_0011979 | |||
| 1541 | Ga0373948_0010418 | |||
| 1542 | Ga0373926_0009034 | |||
| 1543 | Ga0373926_0107581 | |||
| 1544 | Ga0373928_0007014 | |||
| 1545 | Ga0373934_0000070 | |||
| 1546 | Ga0373934_0002196 | |||
| 1547 | Ga0373934_0006637 | |||
| 1548 | Ga0373940_0020952 | |||
| 1549 | Ga0373940_0040831 | |||
| 1550 | Ga0373944_0002438 | |||
| 1551 | Ga0373949_0003325 | |||
| 1552 | Ga0373949_0023621 | |||
| 1553 | Ga0373923_0011010 | |||
| 1554 | Ga0373923_0056349 | |||
| 1555 | Ga0373923_0066202 | |||
| 1556 | Ga0373932_0016751 | |||
| 1557 | Ga0373936_0001293 | |||
| 1558 | Ga0373936_0004164 | |||
| 1559 | Ga0373936_0083543 | |||
| 1560 | Ga0373939_0060424 | |||
| 1561 | Ga0373945_0044491 | |||
| 1562 | Ga0373953_0000185 | |||
| 1563 | Ga0373953_0001732 | |||
| 1564 | Ga0373953_0010341 | |||
| 1565 | Ga0373953_0045019 | |||
| 1566 | Ga0373953_0068325 | |||
| 1567 | Ga0373954_0002192 | |||
| 1568 | Ga0373954_0040812 | |||
| 1569 | Ga0373954_0040873 | |||
| 1570 | Ga0373954_0061833 | |||
| 1571 | Ga0373956_0000007 | |||
| 1572 | Ga0373956_0020043 | |||
| 1573 | Ga0373956_0090125 | |||
| 1574 | Ga0373956_0126010 | |||
| 1575 | Ga0373957_0000024 | |||
| 1576 | Ga0373957_0002117 | |||
| 1577 | Ga0373957_0033521 | |||
| 1578 | Ga0373960_0004470 | |||
| 1579 | Ga0373943_0001340 | |||
| 1580 | Ga0373943_0001795 | |||
| 1581 | Ga0373946_0001065 | |||
| 1582 | Ga0373946_0017131 | |||
| 1583 | Ga0373955_0000368 | |||
| 1584 | Ga0373955_0017001 | |||
| 1585 | Ga0373955_0049962 | |||
| 1586 | Ga0373955_0058166 | |||
| 1587 | Ga0373955_0322137 | |||
| 1588 | Ga0373942_0022330 | |||
| 1589 | Ga0316574_0001450 | |||
| 1590 | Ga0316574_0003741 | |||
| 1591 | Ga0316574_0150904 | |||
| 1592 | Ga0373924_0000372 | |||
| 1593 | Ga0373924_0011689 | |||
| 1594 | Ga0373924_0018862 | |||
| 1595 | Ga0373924_0029116 | |||
| 1596 | Ga0373924_0076608 | |||
| 1597 | Ga0373931_0027647 | |||
| 1598 | Ga0373935_0003744 | |||
| 1599 | Ga0373935_0005495 | |||
| 1600 | Ga0373935_0053505 | |||
| 1601 | Ga0373935_0073581 | |||
| 1602 | Ga0373935_0075094 | |||
| 1603 | Ga0373935_0332305 | |||
| 1604 | Ga0373927_0003060 | |||
| 1605 | Ga0373927_0070955 | |||
| 1606 | Ga0373933_0000002 | |||
| 1607 | Ga0373933_0001577 | |||
| 1608 | Ga0373933_0015191 | |||
| 1609 | Ga0373933_0019084 | |||
| 1610 | Ga0373933_0022077 | |||
| 1611 | Ga0373933_0037724 | |||
| 1612 | Ga0373933_0071489 | |||
| 1613 | Ga0373933_0142720 | |||
| 1614 | Ga0373947_0000007 | |||
| 1615 | Ga0373947_0003580 | |||
| 1616 | Ga0373937_0000014 | |||
| 1617 | Ga0373937_0000312 | |||
| 1618 | Ga0373937_0003119 | |||
| 1619 | Ga0373937_0007378 | |||
| 1620 | Ga0373937_0046082 | |||
| 1621 | Ga0373937_0074903 | |||
| 1622 | Ga0373937_0106572 | |||
| 1623 | Ga0373937_0117122 | |||
| 1624 | Ga0373937_0232432 | |||
| 1625 | Ga0373937_0236231 | |||
| 1626 | Ga0373937_0238112 | |||
| 1627 | Ga0373937_0373198 | |||
| 1628 | Ga0316582_0057528 | |||
| 1629 | Ga0316584_0018562 | |||
| 1630 | Ga0373925_0023473 | |||
| 1631 | Ga0373925_0062211 | |||
| 1632 | Ga0373925_0127897 | |||
| 1633 | Ga0373925_0221542 | |||
| 1634 | Ga0395899_0297566 | |||
| 1635 | Ga0395900_0025836 | |||
| 1636 | Ga0395900_0256887 | |||
| 1637 | Ga0395900_0357357 | |||
| 1638 | Ga0395898_0090208 | |||
| 1639 | Ga0395898_0154853 | |||
| 1640 | Ga0395898_0161474 | |||
| 1641 | Ga0395898_0361040 | |||
| 1642 | Ga0395905_0028781 | |||
| 1643 | Ga0395905_0149731 | |||
| 1644 | Ga0436364_0093921 | |||
| 1645 | Ga0436364_0118843 | |||
| 1646 | Ga0436364_0287407 | |||
| 1647 | Ga0436364_0639700 | |||
| 1648 | Ga0436364_0732570 | |||
| 1649 | Ga0436364_0786912 | |||
| 1650 | Ga0436364_0886432 | |||
| 1651 | Ga0436364_0935193 | |||
| 1652 | Ga0436364_1083867 | |||
| 1653 | Ga0436364_1537007 | |||
| 1654 | Ga0395901_0032412 | |||
| 1655 | Ga0395901_0044943 | |||
| 1656 | Ga0395901_0072361 | |||
| 1657 | Ga0395901_0231170 | |||
| 1658 | Ga0395901_0338218 | |||
| 1659 | Ga0395901_0441791 | |||
| 1660 | Ga0400485_02208 | |||
| 1661 | Ga0400486_25692 | |||
| 1662 | Ga0436360_0021783 | |||
| 1663 | Ga0436360_0455054 | |||
| 1664 | Ga0436361_0756449 | |||
| 1665 | Ga0436363_0045890 | |||
| 1666 | Ga0436363_0398535 | |||
| 1667 | Ga0436363_0838504 | |||
| 1668 | Ga0439436_0003729 | |||
| 1669 | Ga0451853_3927494 | |||
| 1670 | Ga0439433_0009335 | |||
| 1671 | Ga0439442_011772 | |||
| 1672 | Ga0439448_0000572 | |||
| 1673 | Ga0439448_0051675 | |||
| 1674 | Ga0439449_0005338 | |||
| 1675 | Ga0439455_0026469 | |||
| 1676 | Ga0439463_003040 | |||
| 1677 | Ga0439458_0003964 | |||
| 1678 | Ga0439464_0010056 | |||
| 1679 | Ga0439464_0010767 | |||
| 1680 | Ga0439460_0012086 | |||
| 1681 | Ga0439460_0044508 | |||
| 1682 | Ga0450916_000764 | |||
| 1683 | Ga0466965_0142339 | |||
| 1684 | Ga0466966_0196157 | |||
| 1685 | Ga0466961_0017604 | |||
| 1686 | Ga0466961_0068036 | |||
| 1687 | Ga0466961_0233543 | |||
| 1688 | Ga0466963_0015064 | |||
| 1689 | Ga0466963_0038698 | |||
| 1690 | Ga0466963_0109300 | |||
| 1691 | Ga0466963_0267352 | |||
| 1692 | Ga0466964_0054574 | |||
| 1693 | Ga0466964_0063476 | |||
| 1694 | Ga0466971_0124060 | |||
| 1695 | Ga0466968_0000127 | |||
| 1696 | Ga0466970_0001582 | |||
| 1697 | Ga0466970_0032333 | |||
| 1698 | Ga0466970_0120894 | |||
| 1699 | Ga0466957_0002458 | |||
| 1700 | Ga0466957_0199478 | |||
| 1701 | Ga0466960_0014624 | |||
| 1702 | Ga0466960_0098437 | |||
| 1703 | Ga0466959_0163057 | |||
| 1704 | Ga0466959_0184133 | |||
| 1705 | Ga0466959_0285378 | |||
| 1706 | Ga0466958_0002125 | |||
| 1707 | Ga0466958_0025951 | |||
| 1708 | Ga0466967_0006236 | |||
| 1709 | Ga0466967_0097718 | |||
| 1710 | Ga0466967_0123286 | |||
| 1711 | Ga0466967_0141670 | |||
| 1712 | Ga0466967_0144241 | |||
| 1713 | Ga0466967_0168790 | |||
| 1714 | Ga0466967_0223140 | |||
| 1715 | Ga0495592_0000133 | |||
| 1716 | Ga0495592_0021245 | |||
| 1717 | Ga0495592_0027905 | |||
| 1718 | Ga0495592_0045713 | |||
| 1719 | Ga0495592_0145629 | |||
| 1720 | Ga0495629_0003615 | |||
| 1721 | Ga0495629_0120393 | |||
| 1722 | Ga0495641_0013730 | |||
| 1723 | Ga0495641_0026292 | |||
| 1724 | Ga0495651_0000019 | |||
| 1725 | Ga0495651_0001424 | |||
| 1726 | Ga0495651_0013797 | |||
| 1727 | Ga0495651_0030057 | |||
| 1728 | Ga0495651_0126446 | |||
| 1729 | Ga0495653_0003782 | |||
| 1730 | Ga0495653_0006300 | |||
| 1731 | Ga0495653_0010412 | |||
| 1732 | Ga0495653_0015651 | |||
| 1733 | Ga0495653_0017351 | |||
| 1734 | Ga0495653_0098404 | |||
| 1735 | Ga0495653_0151850 | |||
| 1736 | Ga0495582_0000493 | |||
| 1737 | Ga0495582_0015285 | |||
| 1738 | Ga0495582_0080091 | |||
| 1739 | Ga0495639_0005262 | |||
| 1740 | Ga0495639_0007891 | |||
| 1741 | Ga0495662_0020889 | |||
| 1742 | Ga0495662_0103426 | |||
| 1743 | Ga0495662_0160612 | |||
| 1744 | Ga0495664_0006872 | |||
| 1745 | Ga0495664_0009160 | |||
| 1746 | Ga0495664_0010930 | |||
| 1747 | Ga0495664_0017711 | |||
| 1748 | Ga0495664_0020928 | |||
| 1749 | Ga0495664_0062050 | |||
| 1750 | Ga0495664_0108657 | |||
| 1751 | Ga0495594_0097426 | |||
| 1752 | Ga0495596_0022225 | |||
| 1753 | Ga0495608_0000028 | |||
| 1754 | Ga0495608_0009390 | |||
| 1755 | Ga0495608_0014063 | |||
| 1756 | Ga0495608_0020716 | |||
| 1757 | Ga0495608_0044749 | |||
| 1758 | Ga0495608_0108063 | |||
| 1759 | Ga0495608_0236051 | |||
| 1760 | Ga0495608_0275611 | |||
| 1761 | Ga0495618_0052774 | |||
| 1762 | Ga0495618_0108712 | |||
| 1763 | Ga0495618_0130471 | |||
| 1764 | Ga0495628_0000337 | |||
| 1765 | Ga0495628_0010312 | |||
| 1766 | Ga0495628_0088817 | |||
| 1767 | Ga0495628_0254132 | |||
| 1768 | Ga0495630_0051465 | |||
| 1769 | Ga0495630_0078411 | |||
| 1770 | Ga0495630_0101646 | |||
| 1771 | Ga0495630_0156506 | |||
| 1772 | Ga0495632_0072168 | |||
| 1773 | Ga0495644_0072826 | |||
| 1774 | Ga0495666_0058276 | |||
| 1775 | Ga0495666_0078256 | |||
| 1776 | Ga0495652_0000031 | |||
| 1777 | Ga0495652_0019111 | |||
| 1778 | Ga0495652_0033547 | |||
| 1779 | Ga0495652_0071909 | |||
| 1780 | Ga0495652_0095275 | |||
| 1781 | Ga0495652_0103519 | |||
| 1782 | Ga0495652_0152813 | |||
| 1783 | Ga0495665_0012938 | |||
| 1784 | Ga0495665_0052706 | |||
| 1785 | Ga0495665_0111120 | |||
| 1786 | Ga0495640_0046881 | |||
| 1787 | Ga0495640_0056386 | |||
| 1788 | Ga0495640_0086003 | |||
| 1789 | Ga0495640_0223359 | |||
| 1790 | Ga0495586_0022724 | |||
| 1791 | Ga0495587_0000023 | |||
| 1792 | Ga0495587_0010018 | |||
| 1793 | Ga0495587_0017955 | |||
| 1794 | Ga0495587_0020164 | |||
| 1795 | Ga0495587_0104905 | |||
| 1796 | Ga0495645_0001100 | |||
| 1797 | Ga0495645_0008216 | |||
| 1798 | Ga0495645_0021367 | |||
| 1799 | Ga0495645_0028709 | |||
| 1800 | Ga0495645_0031746 | |||
| 1801 | Ga0495645_0055887 | |||
| 1802 | Ga0495645_0057243 | |||
| 1803 | Ga0495645_0132004 | |||
| 1804 | Ga0495667_0000054 | |||
| 1805 | Ga0495667_0001016 | |||
| 1806 | Ga0495667_0003509 | |||
| 1807 | Ga0495667_0005370 | |||
| 1808 | Ga0495667_0008650 | |||
| 1809 | Ga0495667_0008718 | |||
| 1810 | Ga0495667_0030351 | |||
| 1811 | Ga0495667_0065162 | |||
| 1812 | Ga0495634_0044036 | |||
| 1813 | Ga0495634_0057617 | |||
| 1814 | Ga0495634_0107121 | |||
| 1815 | Ga0495611_0067192 | |||
| 1816 | Ga0495635_0001264 | |||
| 1817 | Ga0495635_0003596 | |||
| 1818 | Ga0495635_0030032 | |||
| 1819 | Ga0495635_0030207 | |||
| 1820 | Ga0495635_0033733 | |||
| 1821 | Ga0495635_0038410 | |||
| 1822 | Ga0495659_0049178 | |||
| 1823 | Ga0495657_0000022 | |||
| 1824 | Ga0495657_0002053 | |||
| 1825 | Ga0495657_0025333 | |||
| 1826 | Ga0495657_0056185 | |||
| 1827 | Ga0495657_0091134 | |||
| 1828 | Ga0495657_0113762 | |||
| 1829 | Ga0495599_0000125 | |||
| 1830 | Ga0495599_0086416 | |||
| 1831 | Ga0495623_0000416 | |||
| 1832 | Ga0495623_0023167 | |||
| 1833 | Ga0495623_0033514 | |||
| 1834 | Ga0495623_0037893 | |||
| 1835 | Ga0495623_0058265 | |||
| 1836 | Ga0495623_0100795 | |||
| 1837 | Ga0495646_0017254 | |||
| 1838 | Ga0495646_0019999 | |||
| 1839 | Ga0495646_0076103 | |||
| 1840 | Ga0495646_0136431 | |||
| 1841 | Ga0495646_0150015 | |||
| 1842 | Ga0495647_0021475 | |||
| 1843 | Ga0495658_0076226 | |||
| 1844 | Ga0495658_0167186 | |||
| 1845 | Ga0495613_0031895 | |||
| 1846 | Ga0495624_0009088 | |||
| 1847 | Ga0495624_0013469 | |||
| 1848 | Ga0495624_0114947 | |||
| 1849 | Ga0495624_0128899 | |||
| 1850 | Ga0495670_0028797 | |||
| 1851 | Ga0495600_0008548 | |||
| 1852 | Ga0495600_0011991 | |||
| 1853 | Ga0495600_0052868 | |||
| 1854 | Ga0495600_0055207 | |||
| 1855 | Ga0495600_0134971 | |||
| 1856 | Ga0495600_0200203 | |||
| 1857 | Ga0495600_0219902 | |||
| 1858 | Ga0495581_0010470 | |||
| 1859 | Ga0495581_0015106 | |||
| 1860 | Ga0495581_0086599 | |||
| 1861 | Ga0495581_0147695 | |||
| 1862 | Ga0495604_0000022 | |||
| 1863 | Ga0495604_0030817 | |||
| 1864 | Ga0495604_0034218 | |||
| 1865 | Ga0495604_0136622 | |||
| 1866 | Ga0495604_0171420 | |||
| 1867 | Ga0495604_0184356 | |||
| 1868 | Ga0495674_0002831 | |||
| 1869 | Ga0495674_0008396 | |||
| 1870 | Ga0495674_0025284 | |||
| 1871 | Ga0495674_0027125 | |||
| 1872 | Ga0495674_0032708 | |||
| 1873 | Ga0495674_0186190 | |||
| 1874 | Ga0495676_0261425 | |||
| 1875 | Ga0495680_0000154 | |||
| 1876 | Ga0495680_0005823 | |||
| 1877 | Ga0495680_0011807 | |||
| 1878 | Ga0495680_0064853 | |||
| 1879 | Ga0495680_0203865 | |||
| 1880 | Ga0495680_0224846 | |||
| 1881 | Ga0495680_0338032 | |||
| 1882 | Ga0495675_0000843 | |||
| 1883 | Ga0495675_0013912 | |||
| 1884 | Ga0495675_0020526 | |||
| 1885 | Ga0495675_0031919 | |||
| 1886 | Ga0495675_0045040 | |||
| 1887 | Ga0495675_0081429 | |||
| 1888 | Ga0495675_0139513 | |||
| 1889 | Ga0495677_0062292 | |||
| 1890 | Ga0495684_0002351 | |||
| 1891 | Ga0495684_0020511 | |||
| 1892 | Ga0495684_0020760 | |||
| 1893 | Ga0495684_0029724 | |||
| 1894 | Ga0495684_0045475 | |||
| 1895 | Ga0495684_0051985 | |||
| 1896 | Ga0495684_0072458 | |||
| 1897 | Ga0495684_0144903 | |||
| 1898 | Ga0495593_0005889 | |||
| 1899 | Ga0495593_0025477 | |||
| 1900 | Ga0495602_0000195 | |||
| 1901 | Ga0495602_0000251 | |||
| 1902 | Ga0495602_0071257 | |||
| 1903 | Ga0495602_0129599 | |||
| 1904 | Ga0495602_0274928 | |||
| 1905 | Ga0495602_0328137 | |||
| 1906 | Ga0495614_0086759 | |||
| 1907 | Ga0496100_0054147 | |||
| 1908 | Ga0496101_0002786 | |||
| 1909 | Ga0496102_0006094 | |||
| 1910 | Ga0496102_0044150 | |||
| 1911 | Ga0496102_0061553 | |||
| 1912 | Ga0496103_0109747 | |||
| 1913 | Ga0496104_0000798 | |||
| 1914 | Ga0496104_0012341 | |||
| 1915 | Ga0496104_0068816 | |||
| 1916 | Ga0496104_0122788 | |||
| 1917 | Ga0496105_0012818 | |||
| 1918 | Ga0496105_0016937 | |||
| 1919 | Ga0496105_0018502 | |||
| 1920 | Ga0496105_0024086 | |||
| 1921 | Ga0496106_0034290 | |||
| 1922 | Ga0496106_0105687 | |||
| 1923 | Ga0496106_0287040 | |||
| 1924 | Ga0496107_0106800 | |||
| 1925 | Ga0496107_0146431 | |||
| 1926 | Ga0496107_0357290 | |||
| 1927 | Ga0496108_0073187 | |||
| 1928 | Ga0496108_0146718 | |||
| 1929 | Ga0496108_0300630 | |||
| 1930 | Ga0496109_0009817 | |||
| 1931 | Ga0496109_0208517 | |||
| 1932 | Ga0496110_0091221 | |||
| 1933 | Ga0496110_0177546 | |||
| 1934 | Ga0496110_0316810 | |||
| 1935 | Ga0496110_0346966 | |||
| 1936 | Ga0496111_0032415 | |||
| 1937 | Ga0496111_0051138 | |||
| 1938 | Ga0496112_0053238 | |||
| 1939 | Ga0496112_0104811 | |||
| 1940 | Ga0496112_0108323 | |||
| 1941 | Ga0496113_0016988 | |||
| 1942 | Ga0496113_0024157 | |||
| 1943 | Ga0496113_0051817 | |||
| 1944 | Ga0496113_0070327 | |||
| 1945 | Ga0496114_0100327 | |||
| 1946 | Ga0496114_0139974 | |||
| 1947 | Ga0496115_0015886 | |||
| 1948 | Ga0496115_0035994 | |||
| 1949 | Ga0496115_0069974 | |||
| 1950 | Ga0496115_0162714 | |||
| 1951 | Ga0496119_0003055 | |||
| 1952 | Ga0496121_0210719 | |||
| 1953 | Ga0496126_0078461 | |||
| 1954 | Ga0496126_0180939 | |||
| 1955 | Ga0501031_0174904 | |||
| 1956 | Ga0501032_0100248 | |||
| 1957 | Ga0501033_0149713 | |||
| 1958 | Ga0501036_0003648 | |||
| 1959 | Ga0501037_0120427 | |||
| 1960 | Ga0501038_0001572 | |||
| 1961 | Ga0501038_0109061 | |||
| 1962 | Ga0501039_0000354 | |||
| 1963 | Ga0501040_0000917 | |||
| 1964 | Ga0501041_0022606 | |||
| 1965 | Ga0501042_0017637 | |||
| 1966 | Ga0501042_0066361 | |||
| 1967 | Ga0501046_0071323 | |||
| 1968 | Ga0501047_0000141 | |||
| 1969 | Ga0501048_0011341 | |||
| 1970 | Ga0501068_0011701 | |||
| 1971 | Ga0501072_0001751 | |||
| 1972 | Ga0501072_0081895 | |||
| 1973 | Ga0501074_0001654 | |||
| 1974 | Ga0501074_0092134 | |||
| 1975 | Ga0501075_0000450 | |||
| 1976 | Ga0501076_0032057 | |||
| 1977 | Ga0501077_0010629 | |||
| 1978 | Ga0501079_0001334 | |||
| 1979 | Ga0501080_0217989 | |||
| 1980 | Ga0501081_0005425 | |||
| 1981 | Ga0501035_0295741 | |||
| 1982 | Ga0501045_0003401 | |||
| 1983 | Ga0501045_0021181 | |||
| 1984 | nmdc:mga05p37_1958_c1 | |||
| 1985 | nmdc:mga05p37_21880_c1 | |||
| 1986 | nmdc:mga05p37_220523_c1 | |||
| 1987 | nmdc:mga05p37_558250_c1 | |||
| 1988 | nmdc:mga05p37_61924_c1 | |||
| 1989 | nmdc:mga09592_112556_c1 | |||
| 1990 | nmdc:mga09592_368255_c1 | |||
| 1991 | nmdc:mga09592_4052_c1 | |||
| 1992 | nmdc:mga0qj67_10319_c1 | |||
| 1993 | nmdc:mga0qj67_314_c1 | |||
| 1994 | nmdc:mga0qj67_43141_c1 | |||
| 1995 | nmdc:mga06r32_21997_c1 | |||
| 1996 | nmdc:mga06r32_28294_c1 | |||
| 1997 | nmdc:mga06r32_629_c3 | |||
| 1998 | nmdc:mga08y16_11933_c1 | |||
| 1999 | nmdc:mga08y16_132702_c1 | |||
| 2000 | nmdc:mga08y16_136272_c1 | |||
| 2001 | nmdc:mga08y16_30087_c1 | |||
| 2002 | nmdc:mga0n895_10127_c1 | |||
| 2003 | nmdc:mga0n895_18120_c1 | |||
| 2004 | nmdc:mga0n895_262196_c1 | |||
| 2005 | nmdc:mga0n895_416606_c1 | |||
| 2006 | nmdc:mga0n895_75353_c1 | |||
| 2007 | nmdc:mga0rr50_223505_c1 | |||
| 2008 | nmdc:mga0rr50_234658_c1 | |||
| 2009 | nmdc:mga0rr50_59627_c1 | |||
| 2010 | nmdc:mga08x19_191754_c1 | |||
| 2011 | nmdc:mga08x19_31370_c1 | |||
| 2012 | nmdc:mga08x19_33680_c1 | |||
| 2013 | nmdc:mga0a205_101699_c1 | |||
| 2014 | nmdc:mga0a205_15293_c1 | |||
| 2015 | nmdc:mga0a205_34049_c1 | |||
| 2016 | nmdc:mga0a205_42659_c1 | |||
| 2017 | nmdc:mga0a205_99733_c1 | |||
| 2018 | Ga0495601_0046037 | |||
| 2019 | Ga0495601_0070273 | |||
| 2020 | Ga0495601_0077583 | |||
| 2021 | Ga0495601_0077975 | |||
| 2022 | Ga0495601_0098392 | |||
| 2023 | Ga0495601_0228448 | |||
| 2024 | Ga0495601_0249047 | |||
| 2025 | Ga0495612_0003726 | |||
| 2026 | Ga0495612_0004582 | |||
| 2027 | Ga0495612_0008163 | |||
| 2028 | Ga0495612_0019187 | |||
| 2029 | Ga0495612_0039241 | |||
| 2030 | Ga0495612_0087585 | |||
| 2031 | Ga0495595_0001056 | |||
| 2032 | Ga0495595_0013842 | |||
| 2033 | Ga0495595_0017836 | |||
| 2034 | Ga0495595_0034282 | |||
| 2035 | Ga0495595_0052060 | |||
| 2036 | Ga0495595_0083694 | |||
| 2037 | Ga0495619_0041514 | |||
| 2038 | Ga0495619_0056829 | |||
| 2039 | Ga0495619_0115459 | |||
| 2040 | Ga0500644_0001435 | |||
| 2041 | Ga0501084_0013673 | |||
| 2042 | Ga0501084_0014695 | |||
| 2043 | Ga0501084_0352786 | |||
| 2044 | Ga0590075_005988 | |||
| 2045 | Ga0590077_001146 | |||
| 2046 | Ga0501082_0007058 | |||
| 2047 | Ga0501082_0033886 | |||
| 2048 | Ga0466962_0095767 | |||
| 2049 | Ga0530510_0000669 | |||
| 2050 | 2515496569 | |||
| 2051 | 2515718426 | |||
| 2052 | 2515756807 | |||
| 2053 | 2515855258 | |||
| 2054 | 2516083418 | |||
| 2055 | 2516089330 | |||
| 2056 | 2676473578 | |||
| 2057 | 2676480256 | |||
| 2058 | 2686539196 | |||
| 2059 | 2731909024 | |||
| 2060 | 2799184882 | |||
| 2061 | 2827632091 | |||
| 2062 | 2832007879 | |||
| 2063 | 2855685961 | |||
| 2064 | 2861524772 | |||
| 2065 | 2866068786 | |||
| 2066 | 2895890449 | |||
| 2067 | 8003858437 | |||
| 2068 | 8056056906 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1guz-assembly1.cif.gz_C | structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases | 0.9586 | 3 | 288 |
| 1gv1-assembly1.cif.gz_C | structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases | 0.953 | 3 | 288 |
| 1uxi-assembly1.cif.gz_A | large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface | 0.9433 | 1 | 292 |
| 2hjr-assembly1.cif.gz_B | crystal structure of cryptosporidium parvum malate dehydrogenase | 0.9416 | 2 | 292 |
| 4ros-assembly1.cif.gz_A | crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose | 0.939 | 2 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4plhC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9778 | 2 | 142 | 3.40.50.720 |
| 1gv0A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9527 | 3 | 142 | 3.40.50.720 |
| 2d4aB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9451 | 4 | 142 | 3.40.50.720 |
| 4plhC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9425 | 2 | 142 | 3.40.50.720 |
| 6ihdA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9413 | 2 | 134 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838GIN4-F1-model_v4 | Malate dehydrogenase | 0.9907 | 1 | 61 |
GO:0016616
GO:0019752 |
| AF-A0A357JJB3-F1-model_v4 | Malate dehydrogenase | 0.9885 | 3 | 63 |
GO:0016616
GO:0019752 |
| AF-X0T3M2-F1-model_v4 | Lactate/malate dehydrogenase N-terminal domain-containing protein | 0.9829 | 2 | 204 |
GO:0004459
GO:0006089 GO:0006090 |
| AF-A0A7V3PRZ4-F1-model_v4 | Malate dehydrogenase (EC 1.1.1.37) | 0.9762 | 3 | 193 |
GO:0004459
GO:0006089 GO:0006090 GO:0030060 |
| AF-A0A7Y2UZ01-F1-model_v4 | Malate dehydrogenase | 0.9759 | 3 | 115 |
GO:0004459
GO:0006089 GO:0006090 |