F488675

General Info

Members Datasets Scaffolds Average Seq Length
1034 595 800 548

Family's Representative Sequence

Representative Sequence 3300025735|Ga0207713_1033608|Ga0207713_10336082
Length 510
Sequence VNDGPLIVQSDKTILAFAELERAPEHVHSYRLTPLGLWNARAAGLDAEKVLDTLLTYSRFPVPHSLLIDVEETMSRYGRLRLEKDPQHGLVMRTSDYPVLEEVSRAKKIAPLLGPRIDGETVVVHSSQRGQLKQLLLKLGWPAEDLAGYVDGTPHPIVLNESGWKLRPYQQLAAENFWAGGSGVVVLPCGAGKTLVGQWKDELLKRTSLTEEEIGEYSGSVKEVRPVTIATYQVLTTKRGGLYPHLELVDGNDWGLIIYDEVHLLPAPIFRMTADLQARRRLGLTATLVREDGREGEVFSLIGPKRYDAPWKDIEAQGYIAPADCVEVRVDLPRDERVAYAMAEDADKYRLCATSETKTRVVEELVAEHAGEQLLVIGQYIDQLDEIGERLGAPVIKGDTSVKERQRLFDAFRTGEVQTLVVSKVANFSIDLPEASVAIQVSGSFGSRQEEAQRLGRLLRPKKDGRSARFYSLVARDTLDQDFAAKRQRFLAEQGYAYRIMDAKDVGTAG

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
4 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
5 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
6 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
7 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
8 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
9 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
10 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
11 2643221546 Microbacterium sp. Root53 Isolate Unclassified
12 2643221548 Streptomyces sp. Root55 Isolate Unclassified
13 2643221549 Agromyces sp. Root1464 Isolate Unclassified
14 2643221553 Microbacterium sp. Root553 Isolate Unclassified
15 2643221561 Nocardioides sp. Root151 Isolate Unclassified
16 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
17 2643221572 Leifsonia sp. Root60 Isolate Unclassified
18 2643221576 Nocardioides sp. Root614 Isolate Unclassified
19 2643221578 Streptomyces sp. Root63 Isolate Unclassified
20 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
21 2643221590 Nocardioides sp. Root682 Isolate Unclassified
22 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
23 2643221604 Nocardioides sp. Root190 Isolate Unclassified
24 2643221615 Nocardioides sp. Root224 Isolate Unclassified
25 2643221617 Nocardioides sp. Root79 Isolate Unclassified
26 2643221620 Nocardioides sp. Root240 Isolate Unclassified
27 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
28 2643221630 Microbacterium sp. Root322 Isolate Unclassified
29 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
30 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
31 2643221641 Nocardioides sp. Root122 Isolate Unclassified
32 2643221647 Streptomyces sp. Root369 Isolate Unclassified
33 2643221649 Leifsonia sp. Root4 Isolate Unclassified
34 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
35 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
36 2643221670 Streptomyces sp. Root431 Isolate Unclassified
37 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
38 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
39 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
40 2643221679 Angustibacter sp. Root456 Isolate Unclassified
41 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
42 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
43 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
44 2643221696 Nocardioides sp. Root140 Isolate Unclassified
45 2643221711 Terrabacter sp. Root85 Isolate Unclassified
46 2643221714 Streptomyces sp. Root264 Isolate Unclassified
47 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
48 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
49 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
50 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
51 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
52 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
53 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
54 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
55 2739367898 Nocardioides sp. CF479 Isolate Unclassified
56 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
57 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
58 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
59 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
60 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
61 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
62 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
63 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
64 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
65 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
66 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
67 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
68 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
69 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
70 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
71 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
72 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
73 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
74 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
75 2808606372 Agromyces sp. 23-23 Isolate Unclassified
76 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
77 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
78 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
79 2808606448 Streptomyces sp. 193411 Isolate Unclassified
80 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
81 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
82 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
83 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
84 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
85 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
86 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
87 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
88 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
89 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
90 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
91 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
92 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
93 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
94 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
95 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
96 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
97 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
98 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
99 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
100 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
101 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
102 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
103 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
104 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
105 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
106 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
107 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
108 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
109 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
110 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
111 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
112 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
113 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
114 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
115 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
116 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
117 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
118 2867369537 Streptomyces sp. Z26 Isolate Unclassified
119 2867428634 Streptomyces sp. RP5T Isolate Unclassified
120 2867475112 Streptomyces sp. TM32 Isolate Unclassified
121 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
122 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
123 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
124 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
125 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
126 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
127 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
128 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
129 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
130 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
131 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
132 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
133 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
134 2891562705 Microbispora tritici MT50 Isolate Unclassified
135 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
136 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
137 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
138 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
139 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
140 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
141 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
142 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
143 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
144 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
145 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
146 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
147 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
148 2919069694 Microbacterium sp. 1154 Isolate Unclassified
149 2919395869 Microbacterium resistens 2980 Isolate Unclassified
150 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
151 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
152 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
153 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
154 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
155 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
156 2928153084 Leifsonia sp. 563 Isolate Unclassified
157 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
158 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
159 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
160 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
161 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
162 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
163 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
164 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
165 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
166 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
167 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
168 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
169 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
170 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
171 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
172 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
173 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
174 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
175 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
176 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
177 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
178 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
179 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
180 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
181 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
182 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
183 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
184 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
185 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
186 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
187 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
188 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
189 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
190 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
191 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
192 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
193 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
194 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
195 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
196 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
197 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
198 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
199 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
200 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
201 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
202 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
203 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
204 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
205 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
206 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
207 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
208 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
209 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
210 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
211 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
212 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
213 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
214 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
215 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
216 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
217 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
218 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
219 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
220 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
221 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
222 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
223 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
224 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
225 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
226 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
227 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
228 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
229 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
230 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
231 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
232 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
233 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
234 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
235 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
236 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
237 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
238 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
239 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
240 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
241 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
242 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
243 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
244 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
245 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
246 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
247 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
248 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
249 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
250 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
251 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
252 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
253 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
254 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
255 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
256 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
257 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
258 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
259 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
260 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
261 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
262 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
263 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
264 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
265 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
266 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
267 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
268 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
269 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
270 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
271 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
272 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
273 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
274 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
275 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
276 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
277 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
278 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
279 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
280 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
281 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
287 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
288 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
291 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
292 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
294 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
295 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
296 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
334 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
335 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
336 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
338 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
339 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
340 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
341 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
342 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
343 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
344 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
345 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
346 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
347 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
348 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
349 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
350 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
351 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
352 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
353 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
354 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
355 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
356 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
357 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
358 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
359 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
360 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
361 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
362 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
363 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
364 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
365 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
366 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
367 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
368 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
369 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
370 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
371 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
372 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
373 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
374 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
375 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
376 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
377 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
378 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
379 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
380 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
381 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
382 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
383 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
384 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
385 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
386 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
387 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
388 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
389 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
390 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
391 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
392 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
393 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
394 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
395 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
396 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
397 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
398 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
399 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
400 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
401 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
402 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
403 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
404 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
405 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
406 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
407 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
408 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
409 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
410 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
411 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
412 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
413 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
414 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
415 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
416 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
417 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
418 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
419 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
420 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
421 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
422 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
423 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
424 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
425 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
426 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
427 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
428 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
429 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
430 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
431 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
432 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
433 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
434 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
435 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
436 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
437 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
438 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
439 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
440 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
441 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
442 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
443 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
444 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
445 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
446 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
447 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
448 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
449 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
450 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
451 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
452 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
453 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
454 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
455 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
456 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
457 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
458 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
459 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
460 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
461 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
462 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
463 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
464 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
465 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
466 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
467 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
468 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
469 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
470 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
471 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
472 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
473 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
474 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
475 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
476 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
477 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
478 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
479 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
480 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
481 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
482 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
483 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
484 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
485 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
486 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
487 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
488 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
489 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
490 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
491 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
492 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
493 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
494 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
495 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
496 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
499 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
501 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
502 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
503 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
504 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
505 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
506 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
507 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
508 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
512 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
513 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
514 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
515 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
516 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
517 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
518 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
519 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
520 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
521 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
522 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
523 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
524 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
525 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
526 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
527 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
528 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
530 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
531 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
532 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
533 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
534 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
535 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
536 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
537 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
538 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
539 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
540 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
541 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
542 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
543 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
544 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
545 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
546 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
547 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
548 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
549 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
550 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
551 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
552 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
553 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
554 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
555 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
556 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
557 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
558 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
559 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
560 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
561 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
562 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
563 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
564 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
565 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
566 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
567 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
568 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
569 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
570 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
571 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
572 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
573 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
574 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
575 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
576 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
577 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
578 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
579 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
580 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
581 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
582 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
583 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
584 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
585 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
586 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
587 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
588 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
589 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
590 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
591 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
592 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
593 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
594 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
595 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.5
Metatranscriptomes 0.87
Isolates 22.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 7.16
Nodule 0.29
Rhizoplane 3.68
Rhizosphere 71.28
Stem 0
Stem Tuber 0.1
Unclassified 17.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007688 3300001979 Bacteria 4361
2 JGI24739J22299_10013586 3300001989 Bacteria 2970
3 JGI24739J22299_10016409 3300001989 Bacteria 2681
4 JGI25164J39214_1000508 3300002772 Bacteria 18811
5 JGI25152J39213_1000323 3300002773 Bacteria 30643
6 JGI25406J46586_10002789 3300003203 Bacteria 8214
7 JGI25165J46597_1000004 3300003214 Bacteria 667510
8 JGI25165J46597_1000174 3300003214 Bacteria 100372
9 Ga0007423J48922_100648 3300003285 Bacteria 2265
10 JGI25160J50197_1007167 3300003354 Bacteria 4395
11 Ga0006562J51391_1021328 3300003578 Bacteria 11190
12 Ga0006562J51391_1021330 3300003578 Bacteria 7080
13 Ga0006562J51391_1037344 3300003578 Bacteria 7210
14 Ga0006562J51391_1071059 3300003578 Bacteria 3520
15 Ga0055539_1000005 3300003752 Bacteria 609598
16 Ga0055533_1000001 3300003756 Bacteria 1863437
17 Ga0055525_1000150 3300003759 Bacteria 94263
18 Ga0055542_1000023 3300003762 Bacteria 292964
19 Ga0055529_1000050 3300003763 Bacteria 206297
20 Ga0070658_10047967 3300005327 Bacteria 3457
21 Ga0070658_10084451 3300005327 Bacteria 2611
22 Ga0070683_100011149 3300005329 Bacteria 7755
23 Ga0070692_10003408 3300005345 Bacteria 6445
24 Ga0070674_100011905 3300005356 Bacteria 5317
25 Ga0070659_100016472 3300005366 Bacteria 5549
26 Ga0070659_100022773 3300005366 Bacteria 4786
27 Ga0070714_100018329 3300005435 Bacteria 5685
28 Ga0070710_10014843 3300005437 Bacteria 3927
29 Ga0070700_100009817 3300005441 Bacteria 5264
30 Ga0070662_100061364 3300005457 Bacteria 2744
31 Ga0070707_100154579 3300005468 Bacteria 2235
32 Ga0070698_100003436 3300005471 Bacteria 17413
33 Ga0070679_100025454 3300005530 Bacteria 5807
34 Ga0070684_100012629 3300005535 Bacteria 6774
35 Ga0070684_100047463 3300005535 Bacteria 3721
36 Ga0068853_100063338 3300005539 Bacteria 3203
37 Ga0070672_100012648 3300005543 Bacteria 5936
38 Ga0070665_100006294 3300005548 Bacteria 12125
39 Ga0070665_100027096 3300005548 Bacteria 5772
40 Ga0070665_100072414 3300005548 Bacteria 3454
41 Ga0070665_100119368 3300005548 Bacteria 2639
42 Ga0068855_100011791 3300005563 Bacteria 10569
43 Ga0068855_100022280 3300005563 Bacteria 7591
44 Ga0068855_100052075 3300005563 Bacteria 4820
45 Ga0068854_100053247 3300005578 Bacteria 2905
46 Ga0068854_100119775 3300005578 Bacteria 1996
47 Ga0068852_100016871 3300005616 Bacteria 5711
48 Ga0068863_100125131 3300005841 Bacteria 2452
49 Ga0068858_100022773 3300005842 Bacteria 5842
50 Ga0081455_10004253 3300005937 Bacteria 16138
51 Ga0081455_10006608 3300005937 Bacteria 12407
52 Ga0081455_10031375 3300005937 Bacteria 4809
53 Ga0081538_10005537 3300005981 Bacteria 11337
54 Ga0081540_1001898 3300005983 Bacteria 17502
55 Ga0081540_1013976 3300005983 Bacteria 5180
56 Ga0081539_10001419 3300005985 Bacteria 41210
57 Ga0081539_10001811 3300005985 Bacteria 33775
58 Ga0075365_10001344 3300006038 Bacteria 11023
59 Ga0075365_10023077 3300006038 Bacteria 3908
60 Ga0075365_10041369 3300006038 Bacteria 3010
61 Ga0075368_10000990 3300006042 Bacteria 8887
62 Ga0075368_10017943 3300006042 Bacteria 2654
63 Ga0075363_100001385 3300006048 Bacteria 9139
64 Ga0075363_100010888 3300006048 Bacteria 4339
65 Ga0075364_10001480 3300006051 Bacteria 12798
66 Ga0075432_10000054 3300006058 Bacteria 22459
67 Ga0075367_10003044 3300006178 Bacteria 7855
68 Ga0075367_10003546 3300006178 Bacteria 7465
69 Ga0075367_10079245 3300006178 Bacteria 1985
70 Ga0075428_100005149 3300006844 Bacteria 14538
71 Ga0075433_10001879 3300006852 Bacteria 15781
72 Ga0075433_10008214 3300006852 Bacteria 8316
73 Ga0075434_100001494 3300006871 Bacteria 19738
74 Ga0075434_100010605 3300006871 Bacteria 8645
75 Ga0075436_100000397 3300006914 Bacteria 28015
76 Ga0075435_100009820 3300007076 Bacteria 6963
77 Ga0075435_100045473 3300007076 Bacteria 3520
78 Ga0105251_10013865 3300009011 Bacteria 4484
79 Ga0105240_10004795 3300009093 Bacteria 20387
80 Ga0105240_10008261 3300009093 Bacteria 14900
81 Ga0111539_10001116 3300009094 Bacteria 35481
82 Ga0111539_10001701 3300009094 Bacteria 29310
83 Ga0111539_10051875 3300009094 Bacteria 4884
84 Ga0105245_10008900 3300009098 Bacteria 8763
85 Ga0105245_10017794 3300009098 Bacteria 6203
86 Ga0114129_10009337 3300009147 Bacteria 13990
87 Ga0105243_10004589 3300009148 Bacteria 10892
88 Ga0105243_10018609 3300009148 Bacteria 5263
89 Ga0105241_10000495 3300009174 Bacteria 29802
90 Ga0105242_10010498 3300009176 Bacteria 7108
91 Ga0105248_10130643 3300009177 Bacteria 2834
92 Ga0105248_10140826 3300009177 Bacteria 2721
93 Ga0105237_10101399 3300009545 Bacteria 2871
94 Ga0105238_10001585 3300009551 Bacteria 22764
95 Ga0105249_10024119 3300009553 Bacteria 5464
96 Ga0105249_10042998 3300009553 Bacteria 4109
97 Ga0105239_10002867 3300010375 Bacteria 21561
98 Ga0105246_10001000 3300011119 Bacteria 16237
99 Ga0157370_10019952 3300013104 Bacteria 6705
100 Ga0157369_10000422 3300013105 Bacteria 56065
101 Ga0157369_10006480 3300013105 Bacteria 13565
102 Ga0157369_10049710 3300013105 Bacteria 4544
103 Ga0157369_10077141 3300013105 Bacteria 3571
104 Ga0157372_10168159 3300013307 Bacteria 2536
105 Ga0163163_10004192 3300014325 Bacteria 12283
106 Ga0157380_10022443 3300014326 Bacteria 4752
107 Ga0157377_10015698 3300014745 Bacteria 3881
108 Ga0182007_10002608 3300015262 Bacteria 8881
109 Ga0183367_1005 3300015688 Bacteria 652063
110 Ga0206356_10246010 3300020070 Bacteria 3356
111 Ga0206354_10550714 3300020081 Bacteria 4638
112 Ga0206353_11057787 3300020082 Bacteria 12106
113 Ga0209566_100053 3300025225 Bacteria 224436
114 Ga0209674_100001 3300025226 Bacteria 4013750
115 Ga0209672_100064 3300025228 Bacteria 204609
116 Ga0209147_100956 3300025229 Bacteria 12686
117 Ga0209563_100001 3300025230 Bacteria 4013775
118 Ga0209563_100349 3300025230 Bacteria 17553
119 Ga0207427_100010 3300025231 Bacteria 648610
120 Ga0209437_100290 3300025233 Bacteria 72971
121 Ga0209677_100001 3300025253 Bacteria 4013787
122 Ga0209677_101255 3300025253 Bacteria 11412
123 Ga0209148_1000108 3300025254 Bacteria 204609
124 Ga0209129_1000109 3300025258 Bacteria 153068
125 Ga0209233_1000001 3300025261 Bacteria 2992747
126 Ga0209455_1000102 3300025272 Bacteria 204609
127 Ga0209025_1000984 3300025294 Bacteria 42427
128 Ga0209758_1005903 3300025297 Bacteria 9116
129 Ga0207426_1001574 3300025302 Bacteria 18395
130 Ga0207426_1002948 3300025302 Bacteria 9992
131 Ga0207426_1009898 3300025302 Bacteria 3737
132 Ga0207655_1004694 3300025728 Bacteria 9569
133 Ga0207713_1030611 3300025735 Bacteria 2394
134 Ga0207713_1033608 3300025735 Bacteria 2238
135 Ga0207688_10005132 3300025901 Bacteria 7115
136 Ga0207647_10005104 3300025904 Bacteria 9672
137 Ga0207645_10000233 3300025907 Bacteria 46095
138 Ga0207643_10002591 3300025908 Bacteria 9772
139 Ga0207705_10034687 3300025909 Bacteria 3608
140 Ga0207705_10048422 3300025909 Bacteria 3057
141 Ga0207654_10006689 3300025911 Bacteria 5801
142 Ga0207707_10171067 3300025912 Bacteria 1898
143 Ga0207695_10000324 3300025913 Bacteria 114066
144 Ga0207695_10020753 3300025913 Bacteria 7516
145 Ga0207671_10000133 3300025914 Bacteria 114011
146 Ga0207671_10062856 3300025914 Bacteria 2758
147 Ga0207657_10023495 3300025919 Bacteria 5740
148 Ga0207652_10016360 3300025921 Bacteria 6055
149 Ga0207646_10143064 3300025922 Bacteria 2154
150 Ga0207694_10013035 3300025924 Bacteria 6258
151 Ga0207650_10096742 3300025925 Bacteria 2265
152 Ga0207690_10028850 3300025932 Bacteria 3520
153 Ga0207690_10029058 3300025932 Bacteria 3511
154 Ga0207706_10012759 3300025933 Bacteria 7648
155 Ga0207686_10041797 3300025934 Bacteria 2798
156 Ga0207709_10012912 3300025935 Bacteria 4606
157 Ga0207709_10019826 3300025935 Bacteria 3785
158 Ga0207709_10026849 3300025935 Bacteria 3311
159 Ga0207709_10041797 3300025935 Bacteria 2753
160 Ga0207669_10014430 3300025937 Bacteria 3959
161 Ga0207691_10010786 3300025940 Bacteria 8772
162 Ga0207711_10103018 3300025941 Bacteria 2527
163 Ga0207661_10032798 3300025944 Bacteria 4027
164 Ga0207661_10090194 3300025944 Bacteria 2552
165 Ga0207667_10026184 3300025949 Bacteria 6376
166 Ga0207667_10028691 3300025949 Bacteria 6042
167 Ga0207667_10035689 3300025949 Bacteria 5334
168 Ga0207712_10031419 3300025961 Bacteria 3577
169 Ga0207712_10039735 3300025961 Bacteria 3225
170 Ga0207668_10012275 3300025972 Bacteria 5238
171 Ga0207668_10053874 3300025972 Bacteria 2790
172 Ga0207640_10010107 3300025981 Bacteria 5305
173 Ga0207658_10028254 3300025986 Bacteria 3949
174 Ga0207639_10018528 3300026041 Bacteria 4949
175 Ga0207708_10000420 3300026075 Bacteria 33209
176 Ga0207708_10067613 3300026075 Bacteria 2733
177 Ga0207702_10045834 3300026078 Bacteria 3679
178 Ga0207702_10109043 3300026078 Bacteria 2457
179 Ga0207641_10029831 3300026088 Bacteria 4511
180 Ga0207641_10142569 3300026088 Bacteria 2164
181 Ga0207648_10000985 3300026089 Bacteria 32132
182 Ga0207674_10023094 3300026116 Bacteria 6670
183 Ga0207674_10035403 3300026116 Bacteria 5209
184 Ga0207674_10061655 3300026116 Bacteria 3789
185 Ga0207674_10107618 3300026116 Bacteria 2765
186 Ga0207675_100002855 3300026118 Bacteria 16992
187 Ga0207683_10003907 3300026121 Bacteria 12917
188 Ga0209371_1009379 3300027312 Bacteria 3117
189 Ga0209813_10002898 3300027866 Bacteria 3971
190 Ga0207428_10000732 3300027907 Bacteria 37790
191 Ga0207428_10008028 3300027907 Bacteria 9578
192 Ga0207428_10037470 3300027907 Bacteria 3944
193 Ga0268266_10001692 3300028379 Bacteria 25320
194 Ga0307517_10013607 3300028786 Bacteria 11026
195 Ga0307517_10037929 3300028786 Bacteria 5359
196 Ga0307515_10000732 3300028794 Bacteria 75720
197 Ga0307515_10094610 3300028794 Bacteria 3688
198 Ga0268256_1015470 3300030500 Bacteria 2225
199 Ga0307511_10001033 3300030521 Bacteria 29558
200 Ga0307512_10002037 3300030522 Bacteria 26685
201 Ga0307512_10046544 3300030522 Bacteria 3536
202 Ga0265340_10001671 3300031247 Bacteria 12760
203 Ga0307513_10016986 3300031456 Bacteria 8742
204 Ga0307513_10075096 3300031456 Bacteria 3512
205 Ga0307509_10013840 3300031507 Bacteria 9516
206 Ga0307408_100004432 3300031548 Bacteria 9530
207 Ga0307408_100007289 3300031548 Bacteria 7317
208 Ga0307508_10003106 3300031616 Bacteria 17036
209 Ga0307508_10035283 3300031616 Bacteria 4507
210 Ga0307514_10001479 3300031649 Bacteria 28450
211 Ga0307514_10079343 3300031649 Bacteria 2434
212 Ga0316579_10003809 3300031691 Bacteria 5939
213 Ga0316576_10000275 3300031727 Bacteria 22518
214 Ga0316576_10004042 3300031727 Bacteria 8731
215 Ga0316576_10038342 3300031727 Bacteria 3436
216 Ga0316578_10013053 3300031728 Bacteria 4393
217 Ga0316578_10026161 3300031728 Bacteria 3288
218 Ga0316578_10066381 3300031728 Bacteria 2131
219 Ga0307516_10017407 3300031730 Bacteria 7494
220 Ga0307405_10017059 3300031731 Bacteria 3976
221 Ga0307413_10001475 3300031824 Bacteria 8948
222 Ga0307413_10002149 3300031824 Bacteria 7916
223 Ga0307413_10005023 3300031824 Bacteria 5842
224 Ga0307413_10005655 3300031824 Bacteria 5608
225 Ga0307413_10035772 3300031824 Bacteria 2852
226 Ga0307410_10000556 3300031852 Bacteria 15312
227 Ga0307410_10003801 3300031852 Bacteria 7663
228 Ga0307410_10004130 3300031852 Bacteria 7442
229 Ga0307410_10006902 3300031852 Bacteria 6169
230 Ga0307410_10045170 3300031852 Bacteria 2931
231 Ga0307410_10122649 3300031852 Bacteria 1897
232 Ga0307406_10000155 3300031901 Bacteria 40861
233 Ga0307406_10006506 3300031901 Bacteria 6455
234 Ga0307406_10063448 3300031901 Bacteria 2393
235 Ga0307406_10063908 3300031901 Bacteria 2386
236 Ga0307407_10008027 3300031903 Bacteria 4816
237 Ga0307407_10008074 3300031903 Bacteria 4807
238 Ga0307407_10036110 3300031903 Bacteria 2720
239 Ga0307412_10023926 3300031911 Bacteria 3765
240 Ga0307412_10049198 3300031911 Bacteria 2776
241 Ga0307412_10109300 3300031911 Bacteria 1971
242 Ga0307409_100012442 3300031995 Bacteria 5423
243 Ga0307409_100013785 3300031995 Bacteria 5223
244 Ga0307409_100055061 3300031995 Bacteria 3068
245 Ga0307409_100101957 3300031995 Bacteria 2383
246 Ga0307409_100123006 3300031995 Bacteria 2201
247 Ga0307409_100215234 3300031995 Bacteria 1730
248 Ga0307416_100014102 3300032002 Bacteria 5458
249 Ga0307416_100025102 3300032002 Bacteria 4363
250 Ga0307416_100053610 3300032002 Bacteria 3237
251 Ga0307416_100067367 3300032002 Bacteria 2952
252 Ga0307414_10001749 3300032004 Bacteria 11266
253 Ga0307414_10022367 3300032004 Bacteria 3986
254 Ga0307414_10028782 3300032004 Bacteria 3607
255 Ga0307414_10074716 3300032004 Bacteria 2457
256 Ga0307414_10090288 3300032004 Bacteria 2273
257 Ga0307414_10104274 3300032004 Bacteria 2141
258 Ga0307411_10005549 3300032005 Bacteria 6209
259 Ga0307411_10014304 3300032005 Bacteria 4410
260 Ga0307411_10047673 3300032005 Bacteria 2771
261 Ga0307415_100008469 3300032126 Bacteria 5702
262 Ga0307415_100048632 3300032126 Bacteria 2863
263 Ga0307415_100068610 3300032126 Bacteria 2482
264 Ga0316585_10006278 3300032137 Bacteria 3391
265 Ga0316585_10012441 3300032137 Bacteria 2522
266 Ga0307510_10036910 3300033180 Bacteria 5432
267 Ga0307510_10037066 3300033180 Bacteria 5417
268 Ga0307510_10063878 3300033180 Bacteria 3744
269 Ga0316574_0000641 3300035398 Bacteria 14669
270 Ga0316574_0103777 3300035398 Bacteria 1820
271 Ga0316582_0035873 3300036647 Bacteria 3065
272 Ga0316582_0069879 3300036647 Bacteria 2271
273 Ga0316584_0001293 3300036712 Bacteria 14772
274 Ga0316584_0035559 3300036712 Bacteria 3696
275 Ga0395899_0008826 3300037312 Bacteria 7759
276 Ga0395899_0015433 3300037312 Bacteria 5823
277 Ga0395900_0008453 3300037418 Bacteria 10584
278 Ga0395900_0205433 3300037418 Bacteria 1991
279 Ga0395898_0000256 3300037466 Bacteria 130878
280 Ga0395898_0005536 3300037466 Bacteria 13627
281 Ga0395898_0007727 3300037466 Bacteria 11416
282 Ga0395898_0025008 3300037466 Bacteria 6020
283 Ga0395898_0035997 3300037466 Bacteria 4919
284 Ga0436364_0121658 3300037853 Bacteria 3655
285 Ga0436364_0258391 3300037853 Bacteria 19221
286 Ga0395901_0007406 3300038443 Bacteria 11074
287 Ga0395901_0037134 3300038443 Bacteria 5039
288 Ga0395901_0049733 3300038443 Bacteria 4356
289 Ga0395901_0057386 3300038443 Bacteria 4049
290 Ga0400485_14478 3300038735 Bacteria 11567
291 Ga0400486_12313 3300038742 Bacteria 11748
292 Ga0439436_0001355 3300041404 Bacteria 7049
293 Ga0451837_0835599 3300041494 Bacteria 3047
294 Ga0451841_0533336 3300041498 Bacteria 2225
295 Ga0451853_2772043 3300041512 Bacteria 2096
296 Ga0439431_0001742 3300041997 Bacteria 4796
297 Ga0439445_0013224 3300042004 Bacteria 1996
298 Ga0439448_0005088 3300042005 Bacteria 3738
299 Ga0439449_0001993 3300042007 Bacteria 8026
300 Ga0439455_0000218 3300042012 Bacteria 6811
301 Ga0439457_000372 3300042014 Bacteria 12620
302 Ga0439457_001355 3300042014 Bacteria 7367
303 Ga0439462_0011765 3300042015 Bacteria 2231
304 Ga0450898_000187 3300042134 Bacteria 6553
305 Ga0450903_000107 3300042138 Bacteria 17718
306 Ga0450906_000549 3300042145 Bacteria 7931
307 Ga0439458_0000589 3300042157 Bacteria 9359
308 Ga0439434_0014581 3300042435 Bacteria 2338
309 Ga0439440_0001905 3300042993 Bacteria 3875
310 Ga0439440_0006571 3300042993 Bacteria 2346
311 Ga0466969_0002205 3300044656 Bacteria 10413
312 Ga0466969_0003997 3300044656 Bacteria 7821
313 Ga0466969_0045608 3300044656 Bacteria 2176
314 Ga0466972_0007384 3300044658 Bacteria 5522
315 Ga0466972_0011623 3300044658 Bacteria 4420
316 Ga0466972_0032132 3300044658 Bacteria 2578
317 Ga0466972_0070420 3300044658 Bacteria 1669
318 Ga0466965_0011800 3300044683 Bacteria 4102
319 Ga0466965_0068253 3300044683 Bacteria 1785
320 Ga0466966_0002663 3300044684 Bacteria 11700
321 Ga0466966_0004330 3300044684 Bacteria 9355
322 Ga0466961_0002231 3300044693 Bacteria 12066
323 Ga0466961_0002683 3300044693 Bacteria 11048
324 Ga0466961_0005498 3300044693 Bacteria 7991
325 Ga0466961_0007410 3300044693 Bacteria 6984
326 Ga0466961_0050602 3300044693 Bacteria 2653
327 Ga0466963_0006524 3300044694 Bacteria 6912
328 Ga0466964_0000503 3300044706 Bacteria 12155
329 Ga0466971_0017204 3300044719 Bacteria 3196
330 Ga0466971_0046236 3300044719 Bacteria 1956
331 Ga0466968_0011444 3300044735 Bacteria 3455
332 Ga0466970_0000301 3300044765 Bacteria 24129
333 Ga0466970_0002452 3300044765 Bacteria 8965
334 Ga0466970_0003859 3300044765 Bacteria 7336
335 Ga0466970_0041423 3300044765 Bacteria 2447
336 Ga0466957_0002626 3300044842 Bacteria 9697
337 Ga0466957_0005920 3300044842 Bacteria 6890
338 Ga0466960_0007762 3300044901 Bacteria 4372
339 Ga0466960_0010191 3300044901 Bacteria 3899
340 Ga0466959_0000404 3300045049 Bacteria 25274
341 Ga0466959_0032776 3300045049 Bacteria 3845
342 Ga0466959_0047606 3300045049 Bacteria 3153
343 Ga0466958_0006615 3300045836 Bacteria 6320
344 Ga0466958_0008928 3300045836 Bacteria 5569
345 Ga0466958_0033825 3300045836 Bacteria 3047
346 Ga0466958_0062441 3300045836 Bacteria 2271
347 Ga0466958_0067998 3300045836 Bacteria 2177
348 Ga0466967_0019690 3300045976 Bacteria 5434
349 Ga0466967_0037388 3300045976 Bacteria 4154
350 Ga0466967_0091223 3300045976 Bacteria 2768
351 Ga0466967_0127237 3300045976 Bacteria 2361
352 Ga0466967_0152474 3300045976 Bacteria 2161
353 Ga0466967_0199728 3300045976 Bacteria 1893
354 Ga0495627_001243 3300046453 Bacteria 15864
355 Ga0495627_009577 3300046453 Bacteria 3558
356 Ga0495592_0001633 3300046454 Bacteria 15715
357 Ga0495592_0013615 3300046454 Bacteria 6185
358 Ga0495603_0000568 3300046455 Bacteria 20742
359 Ga0495603_0000900 3300046455 Bacteria 17124
360 Ga0495603_0001369 3300046455 Bacteria 14159
361 Ga0495603_0002351 3300046455 Bacteria 11095
362 Ga0495603_0005879 3300046455 Bacteria 7332
363 Ga0495629_0002068 3300046459 Bacteria 15572
364 Ga0495629_0004829 3300046459 Bacteria 10107
365 Ga0495629_0012678 3300046459 Bacteria 6105
366 Ga0495629_0047846 3300046459 Bacteria 2999
367 Ga0495629_0054622 3300046459 Bacteria 2793
368 Ga0495638_0049126 3300046460 Bacteria 2638
369 Ga0495638_0084537 3300046460 Bacteria 1920
370 Ga0495651_0049344 3300046462 Bacteria 3248
371 Ga0495651_0080573 3300046462 Bacteria 2459
372 Ga0495651_0082590 3300046462 Bacteria 2424
373 Ga0495580_0077511 3300046472 Bacteria 2318
374 Ga0495605_0002215 3300046474 Bacteria 12139
375 Ga0495662_0000587 3300046476 Bacteria 16777
376 Ga0495662_0001163 3300046476 Bacteria 12964
377 Ga0495662_0034463 3300046476 Bacteria 2443
378 Ga0495584_0027505 3300046491 Bacteria 2882
379 Ga0495585_0015186 3300046492 Bacteria 4475
380 Ga0495585_0044475 3300046492 Bacteria 2481
381 Ga0495594_0004425 3300046499 Bacteria 7227
382 Ga0495594_0025469 3300046499 Bacteria 3180
383 Ga0495594_0048816 3300046499 Bacteria 2325
384 Ga0495607_0026057 3300046501 Bacteria 3630
385 Ga0495608_0022842 3300046511 Bacteria 4291
386 Ga0495616_0008761 3300046513 Bacteria 5962
387 Ga0495618_0053599 3300046514 Bacteria 2550
388 Ga0495620_0003173 3300046515 Bacteria 9431
389 Ga0495628_0008126 3300046516 Bacteria 9030
390 Ga0495628_0010249 3300046516 Bacteria 7972
391 Ga0495631_0005774 3300046518 Bacteria 6456
392 Ga0495637_0033247 3300046520 Bacteria 2266
393 Ga0495643_0002929 3300046522 Bacteria 12936
394 Ga0495643_0007450 3300046522 Bacteria 7050
395 Ga0495663_0022457 3300046525 Bacteria 1823
396 Ga0495666_0001372 3300046526 Bacteria 11800
397 Ga0495666_0018950 3300046526 Bacteria 3418
398 Ga0495652_0016537 3300046529 Bacteria 6598
399 Ga0495652_0032037 3300046529 Bacteria 4599
400 Ga0495652_0035283 3300046529 Bacteria 4354
401 Ga0495654_0010771 3300046530 Bacteria 4969
402 Ga0495665_0019191 3300046531 Bacteria 3675
403 Ga0495640_0029284 3300046533 Bacteria 3955
404 Ga0495640_0053506 3300046533 Bacteria 2767
405 Ga0495586_0021797 3300046535 Bacteria 3419
406 Ga0495587_0002070 3300046536 Bacteria 13400
407 Ga0495587_0013224 3300046536 Bacteria 5187
408 Ga0495597_0006873 3300046542 Bacteria 5839
409 Ga0495645_0004013 3300046543 Bacteria 10050
410 Ga0495645_0004306 3300046543 Bacteria 9722
411 Ga0495622_0003939 3300046557 Bacteria 6935
412 Ga0495633_0016083 3300046558 Bacteria 3868
413 Ga0495667_0022051 3300046559 Bacteria 4292
414 Ga0495667_0054837 3300046559 Bacteria 2622
415 Ga0495656_0032577 3300046615 Bacteria 2122
416 Ga0495668_0006268 3300046616 Bacteria 7838
417 Ga0495634_0000538 3300046642 Bacteria 37243
418 Ga0495634_0012422 3300046642 Bacteria 6164
419 Ga0495634_0101559 3300046642 Bacteria 1857
420 Ga0495611_0031831 3300046648 Bacteria 2323
421 Ga0495625_0007428 3300046660 Bacteria 9536
422 Ga0495625_0020111 3300046660 Bacteria 5160
423 Ga0495635_0027825 3300046663 Bacteria 3931
424 Ga0495661_0014582 3300046665 Bacteria 5264
425 Ga0495588_0006246 3300046674 Bacteria 5354
426 Ga0495657_0002584 3300046675 Bacteria 15156
427 Ga0495657_0003095 3300046675 Bacteria 13733
428 Ga0495657_0016677 3300046675 Bacteria 5345
429 Ga0495657_0088711 3300046675 Bacteria 1988
430 Ga0495599_0012852 3300046678 Bacteria 5167
431 Ga0495646_0000377 3300046680 Bacteria 23269
432 Ga0495646_0001920 3300046680 Bacteria 12500
433 Ga0495658_0010862 3300046683 Bacteria 4562
434 Ga0495613_0003429 3300046689 Bacteria 11849
435 Ga0495613_0013738 3300046689 Bacteria 6006
436 Ga0495649_0023208 3300046694 Bacteria 3466
437 Ga0495649_0032929 3300046694 Bacteria 2854
438 Ga0495649_0058085 3300046694 Bacteria 2085
439 Ga0495589_0014667 3300046794 Bacteria 4032
440 Ga0495600_0008571 3300046809 Bacteria 6287
441 Ga0495660_0018871 3300046810 Bacteria 3959
442 Ga0495604_0000208 3300047317 Bacteria 53826
443 Ga0495604_0000705 3300047317 Bacteria 28417
444 Ga0495604_0017173 3300047317 Bacteria 5789
445 Ga0495604_0047728 3300047317 Bacteria 3334
446 Ga0495604_0096871 3300047317 Bacteria 2176
447 Ga0495674_0007626 3300047319 Bacteria 10338
448 Ga0495676_0003615 3300047321 Bacteria 14031
449 Ga0495676_0005286 3300047321 Bacteria 11820
450 Ga0495676_0005604 3300047321 Bacteria 11511
451 Ga0495676_0006839 3300047321 Bacteria 10480
452 Ga0495676_0007821 3300047321 Bacteria 9808
453 Ga0495683_0020101 3300047323 Bacteria 3446
454 Ga0495687_002090 3300047443 Bacteria 16780
455 Ga0495687_007214 3300047443 Bacteria 6604
456 Ga0495687_010803 3300047443 Bacteria 4970
457 Ga0495675_0008267 3300047444 Bacteria 6439
458 Ga0495675_0017903 3300047444 Bacteria 4491
459 Ga0495685_001626 3300047447 Bacteria 6935
460 Ga0495681_0001415 3300047470 Bacteria 18048
461 Ga0495681_0004205 3300047470 Bacteria 9870
462 Ga0495686_0012334 3300047472 Bacteria 5983
463 Ga0495593_0005711 3300047673 Bacteria 7344
464 Ga0495614_0030369 3300048089 Bacteria 2325
465 Ga0496100_0010739 3300048903 Bacteria 5193
466 Ga0496102_0002970 3300048905 Bacteria 14356
467 Ga0496102_0047416 3300048905 Bacteria 3904
468 Ga0496103_0034498 3300048906 Bacteria 3094
469 Ga0496104_0043331 3300048907 Bacteria 4227
470 Ga0496104_0053048 3300048907 Bacteria 3830
471 Ga0496104_0106519 3300048907 Bacteria 2687
472 Ga0496104_0201815 3300048907 Bacteria 1900
473 Ga0496105_0000534 3300048908 Bacteria 25137
474 Ga0496105_0027549 3300048908 Bacteria 4643
475 Ga0496105_0028414 3300048908 Bacteria 4572
476 Ga0496105_0030463 3300048908 Bacteria 4421
477 Ga0496105_0077904 3300048908 Bacteria 2737
478 Ga0496106_0035149 3300048909 Bacteria 3746
479 Ga0496106_0092415 3300048909 Bacteria 2337
480 Ga0496107_0019118 3300048910 Bacteria 4832
481 Ga0496108_0020574 3300048911 Bacteria 5423
482 Ga0496109_0019567 3300048912 Bacteria 5973
483 Ga0496109_0034841 3300048912 Bacteria 4537
484 Ga0496109_0063845 3300048912 Bacteria 3368
485 Ga0496109_0082608 3300048912 Bacteria 2961
486 Ga0496110_0004386 3300048913 Bacteria 10930
487 Ga0496110_0061572 3300048913 Bacteria 3313
488 Ga0496110_0116103 3300048913 Bacteria 2409
489 Ga0496111_0000126 3300048914 Bacteria 33612
490 Ga0496111_0000658 3300048914 Bacteria 18162
491 Ga0496111_0060026 3300048914 Bacteria 2756
492 Ga0496111_0084710 3300048914 Bacteria 2317
493 Ga0496112_0040976 3300048915 Bacteria 4530
494 Ga0496113_0024211 3300048916 Bacteria 4312
495 Ga0496114_0015739 3300048917 Bacteria 6086
496 Ga0496114_0059098 3300048917 Bacteria 3202
497 Ga0496114_0061188 3300048917 Bacteria 3148
498 Ga0496114_0105340 3300048917 Bacteria 2412
499 Ga0496114_0207053 3300048917 Bacteria 1719
500 Ga0496115_0003839 3300048918 Bacteria 10829
501 Ga0496115_0006870 3300048918 Bacteria 8358
502 Ga0496117_0000063 3300048920 Bacteria 254446
503 Ga0496117_0000187 3300048920 Bacteria 127214
504 Ga0496117_0003329 3300048920 Bacteria 18771
505 Ga0496117_0044395 3300048920 Bacteria 3220
506 Ga0496118_0004280 3300048921 Bacteria 17078
507 Ga0496118_0025687 3300048921 Bacteria 5041
508 Ga0496119_0002444 3300048922 Bacteria 20396
509 Ga0496120_0000251 3300048923 Bacteria 90074
510 Ga0496120_0001031 3300048923 Bacteria 37261
511 Ga0496120_0007526 3300048923 Bacteria 8085
512 Ga0496120_0012607 3300048923 Bacteria 5741
513 Ga0496122_0000982 3300048925 Bacteria 50962
514 Ga0496122_0001743 3300048925 Bacteria 33627
515 Ga0496122_0026240 3300048925 Bacteria 5030
516 Ga0496123_0005044 3300048926 Bacteria 13507
517 Ga0496124_0059237 3300048927 Bacteria 3217
518 Ga0496125_0000015 3300048928 Bacteria 516648
519 Ga0496125_0000192 3300048928 Bacteria 130383
520 Ga0496125_0006673 3300048928 Bacteria 12423
521 Ga0496125_0058909 3300048928 Bacteria 3099
522 Ga0496126_0001780 3300048929 Bacteria 31816
523 Ga0496126_0005300 3300048929 Bacteria 14799
524 Ga0496126_0079387 3300048929 Bacteria 2905
525 Ga0501310_000142 3300049130 Bacteria 7123
526 Ga0495678_013219 3300049459 Bacteria 3884
527 Ga0495682_0035457 3300049460 Bacteria 1838
528 Ga0501031_0000150 3300049568 Bacteria 39354
529 Ga0501031_0020631 3300049568 Bacteria 4296
530 Ga0501031_0034789 3300049568 Bacteria 3287
531 Ga0501031_0061773 3300049568 Bacteria 2441
532 Ga0501031_0112861 3300049568 Bacteria 1775
533 Ga0501032_0000101 3300049569 Bacteria 72620
534 Ga0501032_0007906 3300049569 Bacteria 7741
535 Ga0501032_0009201 3300049569 Bacteria 7162
536 Ga0501032_0025058 3300049569 Bacteria 4114
537 Ga0501032_0026687 3300049569 Bacteria 3970
538 Ga0501032_0044961 3300049569 Bacteria 2987
539 Ga0501032_0055216 3300049569 Bacteria 2672
540 Ga0501032_0085590 3300049569 Bacteria 2095
541 Ga0501033_0000373 3300049570 Bacteria 42856
542 Ga0501033_0006214 3300049570 Bacteria 9363
543 Ga0501033_0006684 3300049570 Bacteria 9010
544 Ga0501033_0007978 3300049570 Bacteria 8200
545 Ga0501033_0010371 3300049570 Bacteria 7148
546 Ga0501033_0021259 3300049570 Bacteria 4895
547 Ga0501033_0025673 3300049570 Bacteria 4438
548 Ga0501033_0044387 3300049570 Bacteria 3309
549 Ga0501034_0001646 3300049571 Bacteria 28850
550 Ga0501034_0002967 3300049571 Bacteria 19661
551 Ga0501034_0006214 3300049571 Bacteria 12856
552 Ga0501034_0008198 3300049571 Bacteria 11077
553 Ga0501034_0030124 3300049571 Bacteria 5515
554 Ga0501034_0052016 3300049571 Bacteria 4129
555 Ga0501034_0087533 3300049571 Bacteria 3114
556 Ga0501034_0104433 3300049571 Bacteria 2826
557 Ga0501034_0115758 3300049571 Bacteria 2669
558 Ga0501036_0008125 3300049572 Bacteria 8600
559 Ga0501036_0009768 3300049572 Bacteria 7901
560 Ga0501036_0009984 3300049572 Bacteria 7818
561 Ga0501036_0019288 3300049572 Bacteria 5723
562 Ga0501036_0019839 3300049572 Bacteria 5645
563 Ga0501036_0027031 3300049572 Bacteria 4848
564 Ga0501036_0043223 3300049572 Bacteria 3815
565 Ga0501036_0051342 3300049572 Bacteria 3491
566 Ga0501036_0063006 3300049572 Bacteria 3140
567 Ga0501036_0090298 3300049572 Bacteria 2588
568 Ga0501037_0000287 3300049573 Bacteria 42841
569 Ga0501037_0001612 3300049573 Bacteria 16391
570 Ga0501037_0002493 3300049573 Bacteria 13298
571 Ga0501037_0007483 3300049573 Bacteria 7991
572 Ga0501037_0014649 3300049573 Bacteria 5770
573 Ga0501037_0067903 3300049573 Bacteria 2595
574 Ga0501037_0078929 3300049573 Bacteria 2389
575 Ga0501037_0089567 3300049573 Bacteria 2226
576 Ga0501038_0000125 3300049574 Bacteria 64770
577 Ga0501038_0003501 3300049574 Bacteria 14615
578 Ga0501038_0005244 3300049574 Bacteria 12048
579 Ga0501038_0017750 3300049574 Bacteria 6431
580 Ga0501038_0026104 3300049574 Bacteria 5203
581 Ga0501038_0048118 3300049574 Bacteria 3691
582 Ga0501038_0055070 3300049574 Bacteria 3418
583 Ga0501038_0067130 3300049574 Bacteria 3052
584 Ga0501038_0089180 3300049574 Bacteria 2587
585 Ga0501038_0134163 3300049574 Bacteria 2030
586 Ga0501039_0000086 3300049575 Bacteria 70210
587 Ga0501039_0012289 3300049575 Bacteria 6529
588 Ga0501039_0023860 3300049575 Bacteria 4696
589 Ga0501039_0032375 3300049575 Bacteria 4030
590 Ga0501039_0038612 3300049575 Bacteria 3687
591 Ga0501039_0054131 3300049575 Bacteria 3106
592 Ga0501039_0075308 3300049575 Bacteria 2623
593 Ga0501040_0001847 3300049576 Bacteria 13592
594 Ga0501040_0004044 3300049576 Bacteria 9534
595 Ga0501040_0004700 3300049576 Bacteria 8865
596 Ga0501040_0065715 3300049576 Bacteria 2499
597 Ga0501040_0072055 3300049576 Bacteria 2386
598 Ga0501041_0001255 3300049577 Bacteria 13920
599 Ga0501041_0011207 3300049577 Bacteria 5295
600 Ga0501041_0015065 3300049577 Bacteria 4592
601 Ga0501042_0002756 3300049578 Bacteria 10848
602 Ga0501042_0005112 3300049578 Bacteria 8421
603 Ga0501042_0011371 3300049578 Bacteria 6006
604 Ga0501042_0030318 3300049578 Bacteria 3819
605 Ga0501042_0054966 3300049578 Bacteria 2840
606 Ga0501042_0073307 3300049578 Bacteria 2449
607 Ga0501043_0000098 3300049579 Bacteria 79426
608 Ga0501043_0003443 3300049579 Bacteria 12999
609 Ga0501043_0008977 3300049579 Bacteria 7867
610 Ga0501043_0016590 3300049579 Bacteria 5772
611 Ga0501043_0018266 3300049579 Bacteria 5498
612 Ga0501043_0039478 3300049579 Bacteria 3709
613 Ga0501043_0077718 3300049579 Bacteria 2607
614 Ga0501043_0101861 3300049579 Bacteria 2257
615 Ga0501043_0132321 3300049579 Bacteria 1954
616 Ga0501046_0000160 3300049580 Bacteria 70083
617 Ga0501046_0000982 3300049580 Bacteria 27848
618 Ga0501046_0005851 3300049580 Bacteria 10964
619 Ga0501046_0007054 3300049580 Bacteria 9893
620 Ga0501046_0019912 3300049580 Bacteria 5557
621 Ga0501046_0021972 3300049580 Bacteria 5258
622 Ga0501046_0039506 3300049580 Bacteria 3778
623 Ga0501046_0060243 3300049580 Bacteria 2970
624 Ga0501046_0075575 3300049580 Bacteria 2611
625 Ga0501046_0118369 3300049580 Bacteria 2017
626 Ga0501046_0147897 3300049580 Bacteria 1773
627 Ga0501047_0000033 3300049581 Bacteria 206961
628 Ga0501047_0000496 3300049581 Bacteria 42628
629 Ga0501047_0001456 3300049581 Bacteria 23127
630 Ga0501047_0011926 3300049581 Bacteria 8225
631 Ga0501047_0017804 3300049581 Bacteria 6805
632 Ga0501047_0021359 3300049581 Bacteria 6213
633 Ga0501047_0023804 3300049581 Bacteria 5879
634 Ga0501047_0026519 3300049581 Bacteria 5575
635 Ga0501047_0035672 3300049581 Bacteria 4804
636 Ga0501047_0044079 3300049581 Bacteria 4308
637 Ga0501047_0080339 3300049581 Bacteria 3134
638 Ga0501047_0099911 3300049581 Bacteria 2780
639 Ga0501047_0217690 3300049581 Bacteria 1766
640 Ga0501048_0000364 3300049582 Bacteria 31338
641 Ga0501048_0000461 3300049582 Bacteria 28501
642 Ga0501048_0004238 3300049582 Bacteria 10929
643 Ga0501048_0005799 3300049582 Bacteria 9391
644 Ga0501048_0008484 3300049582 Bacteria 7769
645 Ga0501048_0022584 3300049582 Bacteria 4601
646 Ga0501048_0040358 3300049582 Bacteria 3345
647 Ga0501048_0070547 3300049582 Bacteria 2467
648 Ga0501048_0082826 3300049582 Bacteria 2262
649 Ga0501067_0003318 3300049583 Bacteria 8853
650 Ga0501067_0005483 3300049583 Bacteria 7035
651 Ga0501067_0044920 3300049583 Bacteria 2454
652 Ga0501068_0004509 3300049584 Bacteria 7579
653 Ga0501068_0014086 3300049584 Bacteria 4565
654 Ga0501068_0030429 3300049584 Bacteria 3202
655 Ga0501068_0051515 3300049584 Bacteria 2490
656 Ga0501069_0000178 3300049585 Bacteria 28624
657 Ga0501069_0011669 3300049585 Bacteria 4658
658 Ga0501070_0000306 3300049586 Bacteria 45155
659 Ga0501070_0002053 3300049586 Bacteria 17681
660 Ga0501070_0009626 3300049586 Bacteria 8166
661 Ga0501070_0020337 3300049586 Bacteria 5569
662 Ga0501070_0021914 3300049586 Bacteria 5353
663 Ga0501070_0034872 3300049586 Bacteria 4205
664 Ga0501070_0036781 3300049586 Bacteria 4088
665 Ga0501070_0038268 3300049586 Bacteria 4002
666 Ga0501070_0071495 3300049586 Bacteria 2872
667 Ga0501070_0105502 3300049586 Bacteria 2329
668 Ga0501071_0002907 3300049587 Bacteria 10567
669 Ga0501071_0007246 3300049587 Bacteria 7261
670 Ga0501071_0010676 3300049587 Bacteria 6161
671 Ga0501071_0144982 3300049587 Bacteria 1770
672 Ga0501072_0001898 3300049588 Bacteria 15570
673 Ga0501072_0004789 3300049588 Bacteria 10309
674 Ga0501072_0043624 3300049588 Bacteria 3525
675 Ga0501073_0011973 3300049589 Bacteria 6332
676 Ga0501073_0063935 3300049589 Bacteria 2566
677 Ga0501074_0000058 3300049590 Bacteria 55082
678 Ga0501074_0005958 3300049590 Bacteria 8793
679 Ga0501074_0008098 3300049590 Bacteria 7615
680 Ga0501074_0008131 3300049590 Bacteria 7602
681 Ga0501074_0010701 3300049590 Bacteria 6662
682 Ga0501074_0019956 3300049590 Bacteria 4870
683 Ga0501075_0002633 3300049591 Bacteria 11988
684 Ga0501075_0051482 3300049591 Bacteria 3096
685 Ga0501075_0071812 3300049591 Bacteria 2616
686 Ga0501075_0097485 3300049591 Bacteria 2231
687 Ga0501076_0007334 3300049592 Bacteria 8025
688 Ga0501076_0069645 3300049592 Bacteria 2811
689 Ga0501076_0085437 3300049592 Bacteria 2535
690 Ga0501077_0057380 3300049593 Bacteria 2472
691 Ga0501077_0071697 3300049593 Bacteria 2196
692 Ga0501077_0080723 3300049593 Bacteria 2060
693 Ga0501235_013165 3300049669 Bacteria 1820
694 Ga0501079_0003415 3300049741 Bacteria 11668
695 Ga0501079_0010459 3300049741 Bacteria 7054
696 Ga0501079_0062456 3300049741 Bacteria 2874
697 Ga0501079_0158442 3300049741 Bacteria 1764
698 Ga0501080_0000422 3300049742 Bacteria 32596
699 Ga0501080_0010612 3300049742 Bacteria 8431
700 Ga0501080_0013624 3300049742 Bacteria 7487
701 Ga0501080_0020214 3300049742 Bacteria 6164
702 Ga0501080_0074258 3300049742 Bacteria 3163
703 Ga0501080_0140922 3300049742 Bacteria 2229
704 Ga0501081_0054786 3300049743 Bacteria 2755
705 Ga0501083_0001087 3300049744 Bacteria 18169
706 Ga0501083_0017995 3300049744 Bacteria 4928
707 Ga0501035_0000811 3300049822 Bacteria 33343
708 Ga0501035_0001535 3300049822 Bacteria 23505
709 Ga0501035_0011346 3300049822 Bacteria 8259
710 Ga0501035_0024176 3300049822 Bacteria 5573
711 Ga0501035_0030934 3300049822 Bacteria 4876
712 Ga0501035_0044866 3300049822 Bacteria 3978
713 Ga0501035_0046327 3300049822 Bacteria 3911
714 Ga0501035_0063533 3300049822 Bacteria 3283
715 Ga0501035_0065804 3300049822 Bacteria 3217
716 Ga0501035_0085074 3300049822 Bacteria 2788
717 Ga0501035_0097201 3300049822 Bacteria 2586
718 Ga0501035_0104129 3300049822 Bacteria 2488
719 Ga0501035_0146795 3300049822 Bacteria 2048
720 Ga0501044_0000276 3300049823 Bacteria 65263
721 Ga0501044_0001017 3300049823 Bacteria 33729
722 Ga0501044_0004643 3300049823 Bacteria 15371
723 Ga0501044_0007550 3300049823 Bacteria 11953
724 Ga0501044_0017122 3300049823 Bacteria 7778
725 Ga0501044_0030625 3300049823 Bacteria 5669
726 Ga0501044_0045856 3300049823 Bacteria 4527
727 Ga0501044_0073855 3300049823 Bacteria 3465
728 Ga0501044_0119261 3300049823 Bacteria 2640
729 Ga0501044_0146819 3300049823 Bacteria 2343
730 Ga0501044_0250431 3300049823 Bacteria 1712
731 Ga0501045_0001513 3300049824 Bacteria 15469
732 Ga0501045_0006789 3300049824 Bacteria 7927
733 Ga0501045_0055962 3300049824 Bacteria 2885
734 Ga0501045_0066916 3300049824 Bacteria 2637
735 Ga0501045_0091589 3300049824 Bacteria 2247
736 nmdc:mga00v17_34878_c1 3300050491 Bacteria 2992
737 nmdc:mga00v17_8493_c1 3300050491 Bacteria 5527
738 nmdc:mga0yw44_132422_c1 3300050492 Bacteria 1615
739 nmdc:mga0yw44_25771_c1 3300050492 Bacteria 3350
740 nmdc:mga0yw44_62861_c1 3300050492 Bacteria 2281
741 nmdc:mga06z11_12973_c1 3300050494 Bacteria 3642
742 nmdc:mga06z11_16123_c1 3300050494 Bacteria 3357
743 nmdc:mga04h51_1118_c1 3300050495 Bacteria 6179
744 nmdc:mga04h51_2319_c1 3300050495 Bacteria 4503
745 nmdc:mga09592_9784_c1 3300050508 Bacteria 7791
746 nmdc:mga0qj67_38124_c1 3300050509 Bacteria 3769
747 nmdc:mga06r32_115899_c1 3300050510 Bacteria 2639
748 nmdc:mga08y16_20013_c1 3300050511 Bacteria 7060
749 nmdc:mga0n895_9738_c1 3300050512 Bacteria 8429
750 nmdc:mga0rr50_143841_c1 3300050513 Bacteria 1921
751 nmdc:mga0rr50_1865_c1 3300050513 Bacteria 11701
752 nmdc:mga0a205_1103_c1 3300050515 Bacteria 22399
753 nmdc:mga0a205_620_c1 3300050515 Bacteria 24349
754 nmdc:mga0sz30_10166_c1 3300050516 Bacteria 3599
755 Ga0495612_0007274 3300053078 Bacteria 4530
756 Ga0500635_0000064 3300053080 Bacteria 70317
757 Ga0495619_0010199 3300053085 Bacteria 5918
758 Ga0495619_0047694 3300053085 Bacteria 2822
759 Ga0495619_0055148 3300053085 Bacteria 2632
760 Ga0500643_000341 3300053087 Bacteria 37015
761 Ga0500644_0000206 3300053088 Bacteria 35341
762 Ga0500644_0013971 3300053088 Bacteria 2255
763 Ga0500566_0034520 3300053094 Bacteria 2943
764 Ga0500650_0000299 3300053098 Bacteria 11951
765 Ga0500556_0000028 3300053104 Bacteria 165503
766 Ga0500556_0000394 3300053104 Bacteria 32021
767 Ga0500556_0002167 3300053104 Bacteria 6630
768 Ga0500569_006125 3300053109 Bacteria 2624
769 Ga0500593_006281 3300053117 Bacteria 4745
770 Ga0500652_015492 3300053131 Bacteria 2752
771 Ga0500655_001147 3300053133 Bacteria 5042
772 Ga0500658_0007305 3300053134 Bacteria 4080
773 Ga0500559_0000648 3300053136 Bacteria 23461
774 Ga0500561_0000279 3300053137 Bacteria 8940
775 Ga0500568_0000009 3300053139 Bacteria 270298
776 Ga0500573_0033476 3300053140 Bacteria 2966
777 Ga0500577_0003729 3300053142 Bacteria 3967
778 Ga0500588_0008843 3300053146 Bacteria 2371
779 Ga0500600_0005651 3300053149 Bacteria 7391
780 Ga0500616_0066684 3300053153 Bacteria 1847
781 Ga0500645_006544 3300053730 Bacteria 4142
782 Ga0501084_0000959 3300054114 Bacteria 22332
783 Ga0501084_0015340 3300054114 Bacteria 6352
784 Ga0501084_0020023 3300054114 Bacteria 5578
785 Ga0501084_0025824 3300054114 Bacteria 4899
786 Ga0501084_0075315 3300054114 Bacteria 2827
787 Ga0501084_0158677 3300054114 Bacteria 1908
788 Ga0501082_0005284 3300060353 Bacteria 11225
789 Ga0501082_0017650 3300060353 Bacteria 6146
790 Ga0501082_0050691 3300060353 Bacteria 3579
791 Ga0501082_0075521 3300060353 Bacteria 2903
792 Ga0501082_0101392 3300060353 Bacteria 2490
793 Ga0466962_0009517 3300061719 Bacteria 4660
794 Ga0466962_0014116 3300061719 Bacteria 3849
795 Ga0466962_0021270 3300061719 Bacteria 3116
796 Ga0466962_0036312 3300061719 Bacteria 2358
797 Ga0530510_0003072 3300061734 Bacteria 11468
798 Ga0530510_0069102 3300061734 Bacteria 2563
799 Ga0530510_0070232 3300061734 Bacteria 2542
800 Ga0530510_0134374 3300061734 Bacteria 1821

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025302 Ga0207426_1009898 Ga0207426_10098982 489
2 3300049130 Ga0501310_000142 Ga0501310_000142_5410_6894 489
3 3300041512 Ga0451853_2772043 Ga0451853_2772043_35_1696 491
4 iso_pu_bacteria 2912723979 2912724303 495
5 3300031616 Ga0307508_10003106 Ga0307508_100031063 496
6 3300037853 Ga0436364_0258391 Ga0436364_0258391_2551_4206 497
7 3300053153 Ga0500616_0066684 Ga0500616_0066684_10_1527 501
8 3300050492 nmdc:mga0yw44_132422_c1 nmdc:mga0yw44_132422_c1_37_1551 504
9 3300031649 Ga0307514_10079343 Ga0307514_100793432 505
10 3300025735 Ga0207713_1033608 Ga0207713_10336082 508
11 3300025907 Ga0207645_10000233 Ga0207645_1000023312 508
12 3300025925 Ga0207650_10096742 Ga0207650_100967422 508
13 3300025940 Ga0207691_10010786 Ga0207691_100107865 508
14 3300026121 Ga0207683_10003907 Ga0207683_100039075 508
15 3300048927 Ga0496124_0059237 Ga0496124_0059237_1227_2873 508
16 3300049570 Ga0501033_0007978 Ga0501033_0007978_4145_5827 511
17 3300050516 nmdc:mga0sz30_10166_c1 nmdc:mga0sz30_10166_c1_15_1583 518
18 3300046675 Ga0495657_0088711 Ga0495657_0088711_103_1668 519
19 3300002773 JGI25152J39213_1000323 JGI25152J39213_10003239 524
20 3300025258 Ga0209129_1000109 Ga0209129_100010970 524
21 3300025294 Ga0209025_1000984 Ga0209025_100098438 524
22 3300042435 Ga0439434_0014581 Ga0439434_0014581_742_2319 525
23 3300031548 Ga0307408_100004432 Ga0307408_1000044327 527
24 3300031731 Ga0307405_10017059 Ga0307405_100170591 527
25 3300031824 Ga0307413_10001475 Ga0307413_100014756 527
26 3300031852 Ga0307410_10003801 Ga0307410_100038017 527
27 3300031852 Ga0307410_10006902 Ga0307410_100069022 527
28 3300031901 Ga0307406_10063448 Ga0307406_100634482 527
29 3300031903 Ga0307407_10008074 Ga0307407_100080741 527
30 3300031911 Ga0307412_10023926 Ga0307412_100239262 527
31 3300031911 Ga0307412_10049198 Ga0307412_100491982 527
32 3300031995 Ga0307409_100013785 Ga0307409_1000137854 527
33 3300031995 Ga0307409_100055061 Ga0307409_1000550612 527
34 3300031995 Ga0307409_100101957 Ga0307409_1001019571 527
35 3300032002 Ga0307416_100014102 Ga0307416_1000141024 527
36 3300032004 Ga0307414_10001749 Ga0307414_100017493 527
37 3300032004 Ga0307414_10090288 Ga0307414_100902881 527
38 3300032005 Ga0307411_10005549 Ga0307411_100055494 527
39 3300049568 Ga0501031_0034789 Ga0501031_0034789_814_2457 528
40 3300049570 Ga0501033_0006684 Ga0501033_0006684_2376_4019 528
41 3300049574 Ga0501038_0055070 Ga0501038_0055070_1594_3237 528
42 3300049580 Ga0501046_0075575 Ga0501046_0075575_138_1781 528
43 3300049581 Ga0501047_0017804 Ga0501047_0017804_4355_5998 528
44 3300049581 Ga0501047_0021359 Ga0501047_0021359_1883_3526 528
45 3300049582 Ga0501048_0040358 Ga0501048_0040358_872_2515 528
46 3300049586 Ga0501070_0020337 Ga0501070_0020337_3545_5188 528
47 3300049822 Ga0501035_0104129 Ga0501035_0104129_15_1658 528
48 3300049823 Ga0501044_0250431 Ga0501044_0250431_15_1658 528
49 3300049569 Ga0501032_0007906 Ga0501032_0007906_1211_2809 529
50 3300049572 Ga0501036_0009984 Ga0501036_0009984_4671_6269 529
51 3300049573 Ga0501037_0002493 Ga0501037_0002493_5051_6649 529
52 3300049574 Ga0501038_0048118 Ga0501038_0048118_806_2404 529
53 3300049575 Ga0501039_0012289 Ga0501039_0012289_3817_5415 529
54 3300049579 Ga0501043_0039478 Ga0501043_0039478_795_2393 529
55 3300049581 Ga0501047_0011926 Ga0501047_0011926_3128_4777 529
56 3300049581 Ga0501047_0099911 Ga0501047_0099911_1019_2617 529
57 3300049582 Ga0501048_0008484 Ga0501048_0008484_5130_6728 529
58 3300049584 Ga0501068_0030429 Ga0501068_0030429_789_2387 529
59 3300049669 Ga0501235_013165 Ga0501235_013165_65_1708 529
60 3300049823 Ga0501044_0030625 Ga0501044_0030625_2014_3612 529
61 3300049824 Ga0501045_0091589 Ga0501045_0091589_458_2056 529
62 3300048925 Ga0496122_0000982 Ga0496122_0000982_37986_39590 530
63 3300048926 Ga0496123_0005044 Ga0496123_0005044_7080_8684 530
64 3300049823 Ga0501044_0146819 Ga0501044_0146819_677_2317 530
65 3300049570 Ga0501033_0006214 Ga0501033_0006214_5323_6966 531
66 3300049822 Ga0501035_0065804 Ga0501035_0065804_936_2579 531
67 3300046460 Ga0495638_0084537 Ga0495638_0084537_141_1784 533
68 3300049571 Ga0501034_0030124 Ga0501034_0030124_781_2460 533
69 3300049586 Ga0501070_0021914 Ga0501070_0021914_833_2512 533
70 3300049587 Ga0501071_0002907 Ga0501071_0002907_505_2184 533
71 iso_pu_bacteria 2883821847 2883826238 533
72 3300049742 Ga0501080_0010612 Ga0501080_0010612_3048_4685 535
73 iso_pu_bacteria 2643221576 2643890267 535
74 iso_pu_bacteria 2643221590 2643959323 535
75 3300005563 Ga0068855_100052075 Ga0068855_1000520753 536
76 3300025949 Ga0207667_10035689 Ga0207667_100356894 536
77 3300003203 JGI25406J46586_10002789 JGI25406J46586_100027896 537
78 3300005985 Ga0081539_10001419 Ga0081539_100014194 537
79 3300049593 Ga0501077_0071697 Ga0501077_0071697_463_2115 537
80 3300031728 Ga0316578_10026161 Ga0316578_100261613 538
81 3300032137 Ga0316585_10006278 Ga0316585_100062783 538
82 3300036647 Ga0316582_0035873 Ga0316582_0035873_1378_3009 538
83 3300036712 Ga0316584_0035559 Ga0316584_0035559_1307_2938 538
84 3300044684 Ga0466966_0002663 Ga0466966_0002663_4305_6047 538
85 3300045049 Ga0466959_0047606 Ga0466959_0047606_920_2572 538
86 3300045836 Ga0466958_0062441 Ga0466958_0062441_391_2043 538
87 3300048917 Ga0496114_0105340 Ga0496114_0105340_260_1879 538
88 3300049586 Ga0501070_0071495 Ga0501070_0071495_502_2157 538
89 3300005937 Ga0081455_10031375 Ga0081455_100313751 539
90 3300044693 Ga0466961_0050602 Ga0466961_0050602_965_2632 539
91 3300044765 Ga0466970_0041423 Ga0466970_0041423_81_1748 539
92 3300045976 Ga0466967_0037388 Ga0466967_0037388_199_1866 539
93 iso_pu_bacteria 2585428094 2587864075 539
94 iso_pu_bacteria 2643221542 2643732359 539
95 iso_pu_bacteria 2643221546 2643752550 539
96 iso_pu_bacteria 2643221549 2643766188 539
97 iso_pu_bacteria 2643221553 2643786530 539
98 iso_pu_bacteria 2643221572 2643876264 539
99 iso_pu_bacteria 2643221630 2644171178 539
100 iso_pu_bacteria 2643221632 2644182573 539
101 iso_pu_bacteria 2643221649 2644278601 539
102 iso_pu_bacteria 2643221669 2644383319 539
103 iso_pu_bacteria 2643221724 2644681230 539
104 iso_pu_bacteria 2728369380 2730230337 539
105 iso_pu_bacteria 2747842429 2747952773 539
106 iso_pu_bacteria 2757320536 2758226740 539
107 iso_pu_bacteria 2773857763 2774398709 539
108 iso_pu_bacteria 2784132109 2784471384 539
109 iso_pu_bacteria 2808606306 2808630507 539
110 iso_pu_bacteria 2808606368 2808886269 539
111 iso_pu_bacteria 2808606372 2808901237 539
112 iso_pu_bacteria 2808606447 2809227998 539
113 iso_pu_bacteria 2811994872 2812324013 539
114 iso_pu_bacteria 2844841374 2844843140 539
115 iso_pu_bacteria 2844852863 2844854491 539
116 iso_pu_bacteria 2852632344 2852634702 539
117 iso_pu_bacteria 2852646457 2852648948 539
118 iso_pu_bacteria 2852663356 2852664304 539
119 iso_pu_bacteria 2852677369 2852678744 539
120 iso_pu_bacteria 2857720070 2857720713 539
121 iso_pu_bacteria 2857729791 2857730507 539
122 iso_pu_bacteria 2862993130 2862993455 539
123 iso_pu_bacteria 2884763398 2884766129 539
124 iso_pu_bacteria 2895660088 2895660443 539
125 iso_pu_bacteria 2904509784 2904511333 539
126 iso_pu_bacteria 2906799679 2906800938 539
127 iso_pu_bacteria 2908678064 2908679948 539
128 iso_pu_bacteria 2919055335 2919058635 539
129 iso_pu_bacteria 2919069694 2919072067 539
130 iso_pu_bacteria 2919395869 2919399420 539
131 iso_pu_bacteria 2919443155 2919445741 539
132 iso_pu_bacteria 2919523602 2919525220 539
133 iso_pu_bacteria 2928090899 2928091495 539
134 iso_pu_bacteria 2928121344 2928123754 539
135 iso_pu_bacteria 2928153084 2928153284 539
136 iso_pu_bacteria 2935409751 2935410751 539
137 iso_pu_bacteria 2945968032 2945968556 539
138 iso_pu_bacteria 2946041624 2946044993 539
139 iso_pu_bacteria 2946080515 2946084250 539
140 iso_pu_bacteria 2964326757 2964328612 539
141 iso_pu_bacteria 2974294766 2974296720 539
142 iso_pu_bacteria 2974324384 2974327045 539
143 iso_pu_bacteria 2977251589 2977251706 539
144 iso_pu_bacteria 2977264416 2977267398 539
145 iso_pu_bacteria 2984580707 2984581756 539
146 iso_pu_bacteria 3001889506 3001890350 539
147 iso_pu_bacteria 8004182704 8004184713 539
148 iso_pu_bacteria 8016254467 8016256933 539
149 iso_pu_bacteria 8046352972 8046353599 539
150 iso_pu_bacteria 8056037122 8056039223 539
151 3300005548 Ga0070665_100027096 Ga0070665_1000270964 540
152 3300005841 Ga0068863_100125131 Ga0068863_1001251312 540
153 3300009098 Ga0105245_10008900 Ga0105245_100089006 540
154 3300026088 Ga0207641_10029831 Ga0207641_100298312 540
155 3300044656 Ga0466969_0003997 Ga0466969_0003997_2006_3628 540
156 iso_pu_bacteria 2582581312 2585299199 540
157 iso_pu_bacteria 2643221711 2644610280 540
158 iso_pu_bacteria 2767802112 2768643533 540
159 iso_pu_bacteria 2784746768 2785369565 540
160 iso_pu_bacteria 2802429296 2804846970 540
161 iso_pu_bacteria 2811994882 2812371680 540
162 iso_pu_bacteria 2818991318 2819424871 540
163 iso_pu_bacteria 2818991458 2819667245 540
164 iso_pu_bacteria 2818991472 2819741190 540
165 iso_pu_bacteria 2857733635 2857734283 540
166 iso_pu_bacteria 2862290372 2862294866 540
167 iso_pu_bacteria 2862382967 2862390903 540
168 iso_pu_bacteria 2862705112 2862708242 540
169 iso_pu_bacteria 2867369537 2867371940 540
170 iso_pu_bacteria 2875391855 2875395687 540
171 iso_pu_bacteria 2990044586 2990048090 540
172 iso_pu_bacteria 2990059506 2990065896 540
173 iso_pu_bacteria 3006321560 3006325008 540
174 iso_pu_bacteria 8008485437 8008485441 540
175 iso_pu_bacteria 8008558824 8008567241 540
176 iso_pu_bacteria 8025478263 8025484357 540
177 iso_pu_bacteria 8025524527 8025529915 540
178 iso_pu_bacteria 8033684223 8033690131 540
179 iso_pu_bacteria 8056829672 8056833577 540
180 3300015262 Ga0182007_10002608 Ga0182007_100026083 541
181 3300041498 Ga0451841_0533336 Ga0451841_0533336_21_1658 541
182 3300044658 Ga0466972_0070420 Ga0466972_0070420_14_1651 541
183 3300049568 Ga0501031_0000150 Ga0501031_0000150_23978_25615 541
184 3300049569 Ga0501032_0000101 Ga0501032_0000101_25043_26680 541
185 3300049570 Ga0501033_0000373 Ga0501033_0000373_18619_20256 541
186 3300049571 Ga0501034_0001646 Ga0501034_0001646_21541_23178 541
187 3300049573 Ga0501037_0000287 Ga0501037_0000287_17554_19191 541
188 3300049574 Ga0501038_0000125 Ga0501038_0000125_38622_40259 541
189 3300049575 Ga0501039_0000086 Ga0501039_0000086_17189_18826 541
190 3300049579 Ga0501043_0000098 Ga0501043_0000098_51378_53015 541
191 3300049580 Ga0501046_0000160 Ga0501046_0000160_18655_20292 541
192 3300049581 Ga0501047_0000496 Ga0501047_0000496_22599_24236 541
193 3300049582 Ga0501048_0000364 Ga0501048_0000364_11414_13051 541
194 3300049585 Ga0501069_0000178 Ga0501069_0000178_16855_18492 541
195 3300049586 Ga0501070_0000306 Ga0501070_0000306_18578_20215 541
196 3300049590 Ga0501074_0000058 Ga0501074_0000058_24050_25687 541
197 3300049742 Ga0501080_0000422 Ga0501080_0000422_14105_15742 541
198 3300049744 Ga0501083_0017995 Ga0501083_0017995_2468_4105 541
199 3300049822 Ga0501035_0001535 Ga0501035_0001535_17062_18699 541
200 3300049823 Ga0501044_0001017 Ga0501044_0001017_18225_19862 541
201 3300054114 Ga0501084_0000959 Ga0501084_0000959_3883_5520 541
202 iso_pu_bacteria 2547132111 2547408165 541
203 iso_pu_bacteria 2554235005 2554257786 541
204 iso_pu_bacteria 2582581314 2585313537 541
205 iso_pu_bacteria 2616644814 2616695023 541
206 iso_pu_bacteria 2616644941 2616902241 541
207 iso_pu_bacteria 2643221548 2643764991 541
208 iso_pu_bacteria 2643221561 2643824270 541
209 iso_pu_bacteria 2643221578 2643902526 541
210 iso_pu_bacteria 2643221587 2643942236 541
211 iso_pu_bacteria 2643221601 2644017142 541
212 iso_pu_bacteria 2643221631 2644173897 541
213 iso_pu_bacteria 2643221670 2644389902 541
214 iso_pu_bacteria 2643221673 2644404965 541
215 iso_pu_bacteria 2643221677 2644429319 541
216 iso_pu_bacteria 2643221682 2644461169 541
217 iso_pu_bacteria 2643221696 2644533574 541
218 iso_pu_bacteria 2675903058 2676478758 541
219 iso_pu_bacteria 2721755702 2723641338 541
220 iso_pu_bacteria 2784132148 2784588619 541
221 iso_pu_bacteria 2784746763 2785343244 541
222 iso_pu_bacteria 2791355406 2793979655 541
223 iso_pu_bacteria 2808606365 2808871742 541
224 iso_pu_bacteria 2808606375 2808920629 541
225 iso_pu_bacteria 2808606448 2809232232 541
226 iso_pu_bacteria 2808606982 2811849111 541
227 iso_pu_bacteria 2811994879 2812358032 541
228 iso_pu_bacteria 2811994917 2812480469 541
229 iso_pu_bacteria 2818991463 2819695446 541
230 iso_pu_bacteria 2827628540 2827628639 541
231 iso_pu_bacteria 2852635781 2852636600 541
232 iso_pu_bacteria 2862178590 2862179428 541
233 iso_pu_bacteria 2862281513 2862285716 541
234 iso_pu_bacteria 2862507626 2862511754 541
235 iso_pu_bacteria 2863404153 2863404549 541
236 iso_pu_bacteria 2867346516 2867348883 541
237 iso_pu_bacteria 2867428634 2867434331 541
238 iso_pu_bacteria 2867475112 2867476757 541
239 iso_pu_bacteria 2873151551 2873155678 541
240 iso_pu_bacteria 2877676314 2877681058 541
241 iso_pu_bacteria 2912715099 2912719898 541
242 iso_pu_bacteria 2912757875 2912760837 541
243 iso_pu_bacteria 2918501144 2918505585 541
244 iso_pu_bacteria 2919446982 2919448160 541
245 iso_pu_bacteria 2919468124 2919469470 541
246 iso_pu_bacteria 2935390628 2935393367 541
247 iso_pu_bacteria 2946045630 2946048954 541
248 iso_pu_bacteria 2966598605 2966601685 541
249 iso_pu_bacteria 2984576629 2984579498 541
250 iso_pu_bacteria 2990256926 2990257107 541
251 iso_pu_bacteria 2997451912 2997457791 541
252 iso_pu_bacteria 2997600082 2997600369 541
253 iso_pu_bacteria 3006393351 3006393935 541
254 iso_pu_bacteria 3006486233 3006489402 541
255 iso_pu_bacteria 3006493962 3006500809 541
256 iso_pu_bacteria 8023623736 8023629787 541
257 iso_pu_bacteria 8025530807 8025537974 541
258 iso_pu_bacteria 8047893842 8047898064 541
259 iso_pu_bacteria 8048127548 8048136838 541
260 iso_pu_bacteria 8048356638 8048360829 541
261 iso_pu_bacteria 8048369669 8048375027 541
262 iso_pu_bacteria 8048379754 8048383179 541
263 iso_pu_bacteria 8048406513 8048412699 541
264 iso_pu_bacteria 8054160619 8054166510 541
265 iso_pu_bacteria 8056447290 8056449199 541
266 iso_pu_bacteria 8056667051 8056671185 541
267 3300005437 Ga0070710_10014843 Ga0070710_100148432 542
268 3300005548 Ga0070665_100072414 Ga0070665_1000724141 542
269 3300006038 Ga0075365_10023077 Ga0075365_100230772 542
270 3300006051 Ga0075364_10001480 Ga0075364_100014807 542
271 3300031649 Ga0307514_10001479 Ga0307514_1000147915 542
272 3300046454 Ga0495592_0013615 Ga0495592_0013615_608_2299 542
273 3300046459 Ga0495629_0054622 Ga0495629_0054622_941_2674 542
274 3300046462 Ga0495651_0080573 Ga0495651_0080573_332_2023 542
275 3300046514 Ga0495618_0053599 Ga0495618_0053599_479_2212 542
276 3300046516 Ga0495628_0010249 Ga0495628_0010249_5331_7064 542
277 3300046533 Ga0495640_0053506 Ga0495640_0053506_142_1875 542
278 3300046559 Ga0495667_0054837 Ga0495667_0054837_566_2299 542
279 3300046642 Ga0495634_0012422 Ga0495634_0012422_3520_5211 542
280 3300046675 Ga0495657_0002584 Ga0495657_0002584_635_2368 542
281 3300046689 Ga0495613_0003429 Ga0495613_0003429_783_2516 542
282 3300046809 Ga0495600_0008571 Ga0495600_0008571_597_2330 542
283 3300047321 Ga0495676_0005604 Ga0495676_0005604_9254_10987 542
284 3300048921 Ga0496118_0025687 Ga0496118_0025687_607_2250 542
285 3300048922 Ga0496119_0002444 Ga0496119_0002444_10924_12567 542
286 3300048923 Ga0496120_0000251 Ga0496120_0000251_83687_85330 542
287 3300048923 Ga0496120_0007526 Ga0496120_0007526_4096_5739 542
288 3300049569 Ga0501032_0025058 Ga0501032_0025058_282_1940 542
289 3300049569 Ga0501032_0055216 Ga0501032_0055216_608_2236 542
290 3300049570 Ga0501033_0044387 Ga0501033_0044387_578_2236 542
291 3300049571 Ga0501034_0115758 Ga0501034_0115758_383_2041 542
292 3300049572 Ga0501036_0043223 Ga0501036_0043223_1869_3527 542
293 3300049573 Ga0501037_0007483 Ga0501037_0007483_5845_7473 542
294 3300049573 Ga0501037_0078929 Ga0501037_0078929_175_1833 542
295 3300049579 Ga0501043_0016590 Ga0501043_0016590_2719_4377 542
296 3300049579 Ga0501043_0101861 Ga0501043_0101861_596_2224 542
297 3300049581 Ga0501047_0001456 Ga0501047_0001456_10565_12193 542
298 3300049581 Ga0501047_0217690 Ga0501047_0217690_88_1746 542
299 3300049822 Ga0501035_0044866 Ga0501035_0044866_1175_2803 542
300 3300050491 nmdc:mga00v17_34878_c1 nmdc:mga00v17_34878_c1_775_2415 542
301 3300050492 nmdc:mga0yw44_25771_c1 nmdc:mga0yw44_25771_c1_1160_2800 542
302 3300053104 Ga0500556_0000394 Ga0500556_0000394_11360_13000 542
303 3300053133 Ga0500655_001147 Ga0500655_001147_143_1783 542
304 3300053136 Ga0500559_0000648 Ga0500559_0000648_16381_18021 542
305 iso_pu_bacteria 2515154155 2515856220 542
306 iso_pu_bacteria 2643221567 2643852400 542
307 iso_pu_bacteria 2643221604 2644033220 542
308 iso_pu_bacteria 2643221615 2644091040 542
309 iso_pu_bacteria 2643221617 2644098256 542
310 iso_pu_bacteria 2643221620 2644119017 542
311 iso_pu_bacteria 2643221624 2644136923 542
312 iso_pu_bacteria 2643221641 2644229400 542
313 iso_pu_bacteria 2643221657 2644320843 542
314 iso_pu_bacteria 2643221679 2644444873 542
315 iso_pu_bacteria 2643221690 2644504849 542
316 iso_pu_bacteria 2643221694 2644523680 542
317 iso_pu_bacteria 2643221722 2644667784 542
318 iso_pu_bacteria 2728369276 2729908260 542
319 iso_pu_bacteria 2731639228 2731909131 542
320 iso_pu_bacteria 2739367898 2740168100 542
321 iso_pu_bacteria 2773857762 2774396355 542
322 iso_pu_bacteria 2799112218 2799185777 542
323 iso_pu_bacteria 2808606370 2808894297 542
324 iso_pu_bacteria 2808606439 2809198008 542
325 iso_pu_bacteria 2811994874 2812334494 542
326 iso_pu_bacteria 2811994878 2812353299 542
327 iso_pu_bacteria 2811994880 2812362532 542
328 iso_pu_bacteria 2837268691 2837274760 542
329 iso_pu_bacteria 2844849076 2844851720 542
330 iso_pu_bacteria 2848551377 2848551638 542
331 iso_pu_bacteria 2855386786 2855389923 542
332 iso_pu_bacteria 2856741275 2856744605 542
333 iso_pu_bacteria 2857481737 2857485599 542
334 iso_pu_bacteria 2868088558 2868094047 542
335 iso_pu_bacteria 2873314349 2873316379 542
336 iso_pu_bacteria 2884693830 2884703584 542
337 iso_pu_bacteria 2884994152 2884998148 542
338 iso_pu_bacteria 2887443736 2887446910 542
339 iso_pu_bacteria 2891395885 2891398910 542
340 iso_pu_bacteria 2891554331 2891559118 542
341 iso_pu_bacteria 2891562705 2891569295 542
342 iso_pu_bacteria 2891968417 2891969076 542
343 iso_pu_bacteria 2895427314 2895432055 542
344 iso_pu_bacteria 2895442618 2895443388 542
345 iso_pu_bacteria 2905926851 2905928659 542
346 iso_pu_bacteria 2945920336 2945923860 542
347 iso_pu_bacteria 2946037020 2946040396 542
348 iso_pu_bacteria 2953998280 2954001661 542
349 iso_pu_bacteria 2990088156 2990094209 542
350 iso_pu_bacteria 3002998708 3003007216 542
351 iso_pu_bacteria 8047710418 8047714193 542
352 iso_pu_bacteria 8053945823 8053945825 542
353 iso_pu_bacteria 8054609563 8054613695 542
354 iso_pu_bacteria 8055066027 8055072813 542
355 iso_pu_bacteria 8055172936 8055173914 542
356 3300002772 JGI25164J39214_1000508 JGI25164J39214_100050814 543
357 3300003214 JGI25165J46597_1000004 JGI25165J46597_10000048 543
358 3300003214 JGI25165J46597_1000174 JGI25165J46597_100017438 543
359 3300003578 Ga0006562J51391_1021328 Ga0006562J51391_10213283 543
360 3300003578 Ga0006562J51391_1021330 Ga0006562J51391_10213306 543
361 3300003752 Ga0055539_1000005 Ga0055539_1000005414 543
362 3300003756 Ga0055533_1000001 Ga0055533_10000011483 543
363 3300003759 Ga0055525_1000150 Ga0055525_10001507 543
364 3300003762 Ga0055542_1000023 Ga0055542_100002393 543
365 3300003763 Ga0055529_1000050 Ga0055529_100005093 543
366 3300005327 Ga0070658_10047967 Ga0070658_100479672 543
367 3300005327 Ga0070658_10084451 Ga0070658_100844512 543
368 3300005329 Ga0070683_100011149 Ga0070683_10001114910 543
369 3300005366 Ga0070659_100022773 Ga0070659_1000227732 543
370 3300005535 Ga0070684_100012629 Ga0070684_1000126294 543
371 3300005548 Ga0070665_100006294 Ga0070665_1000062945 543
372 3300005842 Ga0068858_100022773 Ga0068858_1000227732 543
373 3300006048 Ga0075363_100010888 Ga0075363_1000108882 543
374 3300009098 Ga0105245_10017794 Ga0105245_100177946 543
375 3300010375 Ga0105239_10002867 Ga0105239_1000286718 543
376 3300013105 Ga0157369_10000422 Ga0157369_1000042250 543
377 3300013105 Ga0157369_10006480 Ga0157369_100064805 543
378 3300014325 Ga0163163_10004192 Ga0163163_100041924 543
379 3300014745 Ga0157377_10015698 Ga0157377_100156984 543
380 3300020081 Ga0206354_10550714 Ga0206354_105507141 543
381 3300020082 Ga0206353_11057787 Ga0206353_110577877 543
382 3300025225 Ga0209566_100053 Ga0209566_10005369 543
383 3300025226 Ga0209674_100001 Ga0209674_1000011484 543
384 3300025228 Ga0209672_100064 Ga0209672_100064187 543
385 3300025229 Ga0209147_100956 Ga0209147_10095615 543
386 3300025230 Ga0209563_100001 Ga0209563_1000011484 543
387 3300025230 Ga0209563_100349 Ga0209563_10034910 543
388 3300025231 Ga0207427_100010 Ga0207427_100010573 543
389 3300025233 Ga0209437_100290 Ga0209437_10029042 543
390 3300025253 Ga0209677_100001 Ga0209677_1000011484 543
391 3300025253 Ga0209677_101255 Ga0209677_1012559 543
392 3300025254 Ga0209148_1000108 Ga0209148_1000108187 543
393 3300025261 Ga0209233_1000001 Ga0209233_10000011376 543
394 3300025272 Ga0209455_1000102 Ga0209455_10001022 543
395 3300025728 Ga0207655_1004694 Ga0207655_10046944 543
396 3300025909 Ga0207705_10048422 Ga0207705_100484222 543
397 3300025912 Ga0207707_10171067 Ga0207707_101710671 543
398 3300025921 Ga0207652_10016360 Ga0207652_100163602 543
399 3300025932 Ga0207690_10029058 Ga0207690_100290582 543
400 3300025935 Ga0207709_10019826 Ga0207709_100198263 543
401 3300025944 Ga0207661_10032798 Ga0207661_100327982 543
402 3300025961 Ga0207712_10031419 Ga0207712_100314193 543
403 3300025972 Ga0207668_10053874 Ga0207668_100538741 543
404 3300026116 Ga0207674_10023094 Ga0207674_100230944 543
405 3300028379 Ga0268266_10001692 Ga0268266_100016925 543
406 3300031901 Ga0307406_10006506 Ga0307406_100065065 543
407 3300032004 Ga0307414_10074716 Ga0307414_100747162 543
408 3300037312 Ga0395899_0008826 Ga0395899_0008826_4622_6265 543
409 3300037418 Ga0395900_0008453 Ga0395900_0008453_8269_9912 543
410 3300037466 Ga0395898_0000256 Ga0395898_0000256_20341_21984 543
411 3300044765 Ga0466970_0000301 Ga0466970_0000301_2644_4287 543
412 3300045976 Ga0466967_0152474 Ga0466967_0152474_153_1784 543
413 3300046453 Ga0495627_001243 Ga0495627_001243_6946_8586 543
414 3300048905 Ga0496102_0047416 Ga0496102_0047416_1756_3387 543
415 3300048907 Ga0496104_0053048 Ga0496104_0053048_1235_2866 543
416 3300048908 Ga0496105_0000534 Ga0496105_0000534_19838_21469 543
417 3300048908 Ga0496105_0077904 Ga0496105_0077904_969_2600 543
418 3300048909 Ga0496106_0035149 Ga0496106_0035149_1730_3361 543
419 3300048910 Ga0496107_0019118 Ga0496107_0019118_1530_3161 543
420 3300048911 Ga0496108_0020574 Ga0496108_0020574_662_2293 543
421 3300048912 Ga0496109_0019567 Ga0496109_0019567_3896_5527 543
422 3300048912 Ga0496109_0063845 Ga0496109_0063845_761_2404 543
423 3300048913 Ga0496110_0004386 Ga0496110_0004386_1489_3132 543
424 3300048914 Ga0496111_0000126 Ga0496111_0000126_1408_3051 543
425 3300048917 Ga0496114_0061188 Ga0496114_0061188_1445_3085 543
426 3300048918 Ga0496115_0003839 Ga0496115_0003839_5693_7324 543
427 3300048918 Ga0496115_0006870 Ga0496115_0006870_4951_6582 543
428 3300048920 Ga0496117_0000063 Ga0496117_0000063_17105_18754 543
429 3300048920 Ga0496117_0000187 Ga0496117_0000187_66282_67922 543
430 3300048920 Ga0496117_0003329 Ga0496117_0003329_9309_10952 543
431 3300048920 Ga0496117_0044395 Ga0496117_0044395_845_2488 543
432 3300048921 Ga0496118_0004280 Ga0496118_0004280_6831_8474 543
433 3300048923 Ga0496120_0001031 Ga0496120_0001031_11097_12746 543
434 3300048923 Ga0496120_0012607 Ga0496120_0012607_2647_4296 543
435 3300048925 Ga0496122_0026240 Ga0496122_0026240_30_1679 543
436 3300048928 Ga0496125_0000192 Ga0496125_0000192_74175_75818 543
437 3300048928 Ga0496125_0006673 Ga0496125_0006673_7803_9452 543
438 3300048928 Ga0496125_0058909 Ga0496125_0058909_500_2149 543
439 3300048929 Ga0496126_0001780 Ga0496126_0001780_5759_7399 543
440 3300048929 Ga0496126_0005300 Ga0496126_0005300_9149_10798 543
441 3300048929 Ga0496126_0079387 Ga0496126_0079387_990_2633 543
442 3300049571 Ga0501034_0002967 Ga0501034_0002967_3499_5139 543
443 3300049571 Ga0501034_0006214 Ga0501034_0006214_6319_7959 543
444 3300049571 Ga0501034_0008198 Ga0501034_0008198_2408_4048 543
445 3300049571 Ga0501034_0052016 Ga0501034_0052016_2303_3934 543
446 3300049583 Ga0501067_0003318 Ga0501067_0003318_4115_5746 543
447 3300049584 Ga0501068_0004509 Ga0501068_0004509_3520_5151 543
448 3300049586 Ga0501070_0009626 Ga0501070_0009626_2719_4350 543
449 3300049586 Ga0501070_0034872 Ga0501070_0034872_1504_3144 543
450 3300049586 Ga0501070_0036781 Ga0501070_0036781_177_1808 543
451 3300049589 Ga0501073_0011973 Ga0501073_0011973_1422_3053 543
452 3300049590 Ga0501074_0008098 Ga0501074_0008098_4652_6283 543
453 3300049590 Ga0501074_0008131 Ga0501074_0008131_1653_3296 543
454 3300049741 Ga0501079_0062456 Ga0501079_0062456_1213_2844 543
455 3300049742 Ga0501080_0013624 Ga0501080_0013624_3527_5158 543
456 3300049742 Ga0501080_0020214 Ga0501080_0020214_1272_2903 543
457 3300049742 Ga0501080_0140922 Ga0501080_0140922_316_1947 543
458 3300050491 nmdc:mga00v17_8493_c1 nmdc:mga00v17_8493_c1_443_2095 543
459 3300053080 Ga0500635_0000064 Ga0500635_0000064_35226_36866 543
460 3300053087 Ga0500643_000341 Ga0500643_000341_30318_31964 543
461 3300053088 Ga0500644_0000206 Ga0500644_0000206_33289_34938 543
462 3300053098 Ga0500650_0000299 Ga0500650_0000299_54_1715 543
463 3300053104 Ga0500556_0000028 Ga0500556_0000028_43507_45153 543
464 3300053139 Ga0500568_0000009 Ga0500568_0000009_41785_43431 543
465 3300053140 Ga0500573_0033476 Ga0500573_0033476_1128_2780 543
466 3300053142 Ga0500577_0003729 Ga0500577_0003729_197_1858 543
467 3300053146 Ga0500588_0008843 Ga0500588_0008843_698_2341 543
468 3300053730 Ga0500645_006544 Ga0500645_006544_555_2201 543
469 3300054114 Ga0501084_0025824 Ga0501084_0025824_992_2623 543
470 3300054114 Ga0501084_0158677 Ga0501084_0158677_82_1725 543
471 3300060353 Ga0501082_0050691 Ga0501082_0050691_261_1892 543
472 iso_pu_bacteria 2582581313 2585308854 543
473 iso_pu_bacteria 2643221647 2644262337 543
474 iso_pu_bacteria 2773857758 2774380783 543
475 iso_pu_bacteria 2786546132 2786670662 543
476 iso_pu_bacteria 2870622029 2870622445 543
477 iso_pu_bacteria 2939657138 2939659176 543
478 iso_pu_bacteria 2946033335 2946036784 543
479 iso_pu_bacteria 2954380949 2954386174 543
480 iso_pu_bacteria 2954673503 2954676985 543
481 iso_pu_bacteria 2954682443 2954687173 543
482 iso_pu_bacteria 2954691527 2954696816 543
483 iso_pu_bacteria 2954701450 2954705322 543
484 iso_pu_bacteria 2954711539 2954716190 543
485 iso_pu_bacteria 2954721474 2954726133 543
486 iso_pu_bacteria 2954731030 2954735677 543
487 iso_pu_bacteria 2954740390 2954745059 543
488 iso_pu_bacteria 2954749733 2954754533 543
489 iso_pu_bacteria 2954759201 2954764029 543
490 iso_pu_bacteria 2977228692 2977228726 543
491 iso_pu_bacteria 2977236895 2977237433 543
492 iso_pu_bacteria 2984542743 2984544780 543
493 iso_pu_bacteria 2995463766 2995465883 543
494 iso_pu_bacteria 2995463766 2995466737 543
495 3300005548 Ga0070665_100119368 Ga0070665_1001193681 544
496 3300005563 Ga0068855_100011791 Ga0068855_10001179110 544
497 3300005578 Ga0068854_100053247 Ga0068854_1000532471 544
498 3300006038 Ga0075365_10041369 Ga0075365_100413691 544
499 3300009093 Ga0105240_10008261 Ga0105240_100082611 544
500 3300009174 Ga0105241_10000495 Ga0105241_1000049528 544
501 3300009177 Ga0105248_10130643 Ga0105248_101306432 544
502 3300009551 Ga0105238_10001585 Ga0105238_100015851 544
503 3300025911 Ga0207654_10006689 Ga0207654_100066891 544
504 3300025913 Ga0207695_10000324 Ga0207695_10000324109 544
505 3300025914 Ga0207671_10000133 Ga0207671_100001331 544
506 3300025924 Ga0207694_10013035 Ga0207694_100130351 544
507 3300025949 Ga0207667_10026184 Ga0207667_100261841 544
508 3300025981 Ga0207640_10010107 Ga0207640_100101071 544
509 3300026041 Ga0207639_10018528 Ga0207639_100185283 544
510 3300026078 Ga0207702_10045834 Ga0207702_100458341 544
511 3300031727 Ga0316576_10000275 Ga0316576_1000027516 544
512 3300031727 Ga0316576_10038342 Ga0316576_100383422 544
513 3300031728 Ga0316578_10013053 Ga0316578_100130532 544
514 3300031995 Ga0307409_100215234 Ga0307409_1002152341 544
515 3300033180 Ga0307510_10037066 Ga0307510_100370661 544
516 3300035398 Ga0316574_0000641 Ga0316574_0000641_661_2295 544
517 3300036647 Ga0316582_0069879 Ga0316582_0069879_389_2023 544
518 3300037312 Ga0395899_0015433 Ga0395899_0015433_457_2091 544
519 3300044656 Ga0466969_0045608 Ga0466969_0045608_338_1972 544
520 3300044693 Ga0466961_0005498 Ga0466961_0005498_859_2493 544
521 3300045049 Ga0466959_0032776 Ga0466959_0032776_720_2354 544
522 3300046459 Ga0495629_0047846 Ga0495629_0047846_1004_2656 544
523 3300046462 Ga0495651_0049344 Ga0495651_0049344_1512_3158 544
524 3300046462 Ga0495651_0082590 Ga0495651_0082590_279_1919 544
525 3300046476 Ga0495662_0034463 Ga0495662_0034463_355_1989 544
526 3300046499 Ga0495594_0025469 Ga0495594_0025469_57_1709 544
527 3300046516 Ga0495628_0008126 Ga0495628_0008126_7285_8931 544
528 3300046529 Ga0495652_0035283 Ga0495652_0035283_902_2548 544
529 3300046642 Ga0495634_0000538 Ga0495634_0000538_11320_12960 544
530 3300047317 Ga0495604_0000208 Ga0495604_0000208_35936_37576 544
531 3300047317 Ga0495604_0017173 Ga0495604_0017173_2847_4481 544
532 3300047317 Ga0495604_0096871 Ga0495604_0096871_253_1905 544
533 3300047444 Ga0495675_0008267 Ga0495675_0008267_308_1942 544
534 3300048903 Ga0496100_0010739 Ga0496100_0010739_1484_3136 544
535 3300048905 Ga0496102_0002970 Ga0496102_0002970_699_2351 544
536 3300048907 Ga0496104_0043331 Ga0496104_0043331_765_2417 544
537 3300048907 Ga0496104_0201815 Ga0496104_0201815_217_1869 544
538 3300048908 Ga0496105_0027549 Ga0496105_0027549_2892_4544 544
539 3300048908 Ga0496105_0028414 Ga0496105_0028414_937_2589 544
540 3300048908 Ga0496105_0030463 Ga0496105_0030463_1807_3468 544
541 3300048912 Ga0496109_0034841 Ga0496109_0034841_1552_3204 544
542 3300048914 Ga0496111_0060026 Ga0496111_0060026_451_2103 544
543 3300048914 Ga0496111_0084710 Ga0496111_0084710_71_1723 544
544 3300048915 Ga0496112_0040976 Ga0496112_0040976_1993_3645 544
545 3300048917 Ga0496114_0015739 Ga0496114_0015739_4390_6042 544
546 3300048917 Ga0496114_0059098 Ga0496114_0059098_1453_3105 544
547 3300049568 Ga0501031_0020631 Ga0501031_0020631_224_1930 544
548 3300049569 Ga0501032_0044961 Ga0501032_0044961_1058_2764 544
549 3300049570 Ga0501033_0025673 Ga0501033_0025673_2708_4414 544
550 3300049571 Ga0501034_0104433 Ga0501034_0104433_224_1930 544
551 3300049572 Ga0501036_0051342 Ga0501036_0051342_1777_3411 544
552 3300049572 Ga0501036_0090298 Ga0501036_0090298_520_2172 544
553 3300049573 Ga0501037_0067903 Ga0501037_0067903_666_2372 544
554 3300049574 Ga0501038_0017750 Ga0501038_0017750_243_1949 544
555 3300049574 Ga0501038_0067130 Ga0501038_0067130_195_1829 544
556 3300049574 Ga0501038_0134163 Ga0501038_0134163_193_1845 544
557 3300049575 Ga0501039_0032375 Ga0501039_0032375_1334_2968 544
558 3300049575 Ga0501039_0054131 Ga0501039_0054131_232_1884 544
559 3300049575 Ga0501039_0075308 Ga0501039_0075308_585_2291 544
560 3300049576 Ga0501040_0004044 Ga0501040_0004044_7394_9028 544
561 3300049576 Ga0501040_0072055 Ga0501040_0072055_342_1994 544
562 3300049577 Ga0501041_0011207 Ga0501041_0011207_768_2474 544
563 3300049577 Ga0501041_0015065 Ga0501041_0015065_1836_3488 544
564 3300049578 Ga0501042_0002756 Ga0501042_0002756_1109_2743 544
565 3300049578 Ga0501042_0030318 Ga0501042_0030318_190_1842 544
566 3300049579 Ga0501043_0132321 Ga0501043_0132321_25_1731 544
567 3300049580 Ga0501046_0039506 Ga0501046_0039506_463_2115 544
568 3300049580 Ga0501046_0060243 Ga0501046_0060243_224_1930 544
569 3300049581 Ga0501047_0035672 Ga0501047_0035672_943_2649 544
570 3300049582 Ga0501048_0082826 Ga0501048_0082826_224_1930 544
571 3300049583 Ga0501067_0005483 Ga0501067_0005483_843_2549 544
572 3300049584 Ga0501068_0014086 Ga0501068_0014086_2708_4414 544
573 3300049585 Ga0501069_0011669 Ga0501069_0011669_25_1731 544
574 3300049586 Ga0501070_0105502 Ga0501070_0105502_400_2106 544
575 3300049587 Ga0501071_0007246 Ga0501071_0007246_184_1818 544
576 3300049588 Ga0501072_0001898 Ga0501072_0001898_844_2550 544
577 3300049588 Ga0501072_0043624 Ga0501072_0043624_363_1997 544
578 3300049591 Ga0501075_0071812 Ga0501075_0071812_635_2269 544
579 3300049591 Ga0501075_0097485 Ga0501075_0097485_82_1734 544
580 3300049592 Ga0501076_0069645 Ga0501076_0069645_768_2474 544
581 3300049592 Ga0501076_0085437 Ga0501076_0085437_645_2279 544
582 3300049593 Ga0501077_0057380 Ga0501077_0057380_637_2343 544
583 3300049593 Ga0501077_0080723 Ga0501077_0080723_47_1681 544
584 3300049741 Ga0501079_0158442 Ga0501079_0158442_34_1740 544
585 3300049743 Ga0501081_0054786 Ga0501081_0054786_449_2101 544
586 3300049744 Ga0501083_0001087 Ga0501083_0001087_9598_11304 544
587 3300049822 Ga0501035_0030934 Ga0501035_0030934_562_2214 544
588 3300049822 Ga0501035_0046327 Ga0501035_0046327_286_1938 544
589 3300049822 Ga0501035_0097201 Ga0501035_0097201_657_2363 544
590 3300049823 Ga0501044_0045856 Ga0501044_0045856_2293_3936 544
591 3300049823 Ga0501044_0119261 Ga0501044_0119261_711_2417 544
592 3300049824 Ga0501045_0055962 Ga0501045_0055962_274_1908 544
593 3300049824 Ga0501045_0066916 Ga0501045_0066916_708_2414 544
594 3300054114 Ga0501084_0020023 Ga0501084_0020023_3548_5254 544
595 3300054114 Ga0501084_0075315 Ga0501084_0075315_828_2462 544
596 3300060353 Ga0501082_0075521 Ga0501082_0075521_741_2447 544
597 3300060353 Ga0501082_0101392 Ga0501082_0101392_53_1705 544
598 3300061734 Ga0530510_0069102 Ga0530510_0069102_601_2307 544
599 3300061734 Ga0530510_0070232 Ga0530510_0070232_368_2020 544
600 iso_pu_bacteria 2643221678 2644437204 544
601 iso_pu_bacteria 2643221714 2644628946 544
602 iso_pu_bacteria 2675903060 2676495909 544
603 iso_pu_bacteria 2808606359 2808842103 544
604 iso_pu_bacteria 2946072368 2946075962 544
605 3300001989 JGI24739J22299_10013586 JGI24739J22299_100135862 545
606 3300001989 JGI24739J22299_10016409 JGI24739J22299_100164092 545
607 3300003285 Ga0007423J48922_100648 Ga0007423J48922_1006482 545
608 3300003354 JGI25160J50197_1007167 JGI25160J50197_10071671 545
609 3300003578 Ga0006562J51391_1037344 Ga0006562J51391_10373442 545
610 3300003578 Ga0006562J51391_1071059 Ga0006562J51391_10710592 545
611 3300006042 Ga0075368_10017943 Ga0075368_100179431 545
612 3300006178 Ga0075367_10079245 Ga0075367_100792451 545
613 3300009011 Ga0105251_10013865 Ga0105251_100138652 545
614 3300009177 Ga0105248_10140826 Ga0105248_101408262 545
615 3300011119 Ga0105246_10001000 Ga0105246_100010008 545
616 3300015688 Ga0183367_1005 Ga0183367_1005182 545
617 3300025297 Ga0209758_1005903 Ga0209758_10059037 545
618 3300025302 Ga0207426_1001574 Ga0207426_10015747 545
619 3300025302 Ga0207426_1002948 Ga0207426_10029482 545
620 3300025735 Ga0207713_1030611 Ga0207713_10306112 545
621 3300025904 Ga0207647_10005104 Ga0207647_100051045 545
622 3300025935 Ga0207709_10026849 Ga0207709_100268493 545
623 3300025941 Ga0207711_10103018 Ga0207711_101030182 545
624 3300027312 Ga0209371_1009379 Ga0209371_10093793 545
625 3300027866 Ga0209813_10002898 Ga0209813_100028983 545
626 3300028786 Ga0307517_10013607 Ga0307517_100136073 545
627 3300028794 Ga0307515_10000732 Ga0307515_1000073210 545
628 3300028794 Ga0307515_10094610 Ga0307515_100946103 545
629 3300030500 Ga0268256_1015470 Ga0268256_10154702 545
630 3300030521 Ga0307511_10001033 Ga0307511_1000103328 545
631 3300030522 Ga0307512_10002037 Ga0307512_1000203718 545
632 3300030522 Ga0307512_10046544 Ga0307512_100465443 545
633 3300031456 Ga0307513_10016986 Ga0307513_100169864 545
634 3300031456 Ga0307513_10075096 Ga0307513_100750963 545
635 3300031507 Ga0307509_10013840 Ga0307509_100138403 545
636 3300032002 Ga0307416_100025102 Ga0307416_1000251022 545
637 3300033180 Ga0307510_10036910 Ga0307510_100369103 545
638 3300033180 Ga0307510_10063878 Ga0307510_100638782 545
639 3300037466 Ga0395898_0005536 Ga0395898_0005536_11578_13227 545
640 3300037466 Ga0395898_0007727 Ga0395898_0007727_3919_5586 545
641 3300037466 Ga0395898_0025008 Ga0395898_0025008_1612_3285 545
642 3300037853 Ga0436364_0121658 Ga0436364_0121658_1917_3554 545
643 3300038443 Ga0395901_0057386 Ga0395901_0057386_891_2558 545
644 3300041404 Ga0439436_0001355 Ga0439436_0001355_407_2050 545
645 3300041494 Ga0451837_0835599 Ga0451837_0835599_571_2235 545
646 3300042007 Ga0439449_0001993 Ga0439449_0001993_2914_4560 545
647 3300042012 Ga0439455_0000218 Ga0439455_0000218_5025_6674 545
648 3300042014 Ga0439457_000372 Ga0439457_000372_10169_11812 545
649 3300042014 Ga0439457_001355 Ga0439457_001355_4656_6311 545
650 3300042015 Ga0439462_0011765 Ga0439462_0011765_555_2198 545
651 3300042134 Ga0450898_000187 Ga0450898_000187_4883_6529 545
652 3300042138 Ga0450903_000107 Ga0450903_000107_15551_17200 545
653 3300042145 Ga0450906_000549 Ga0450906_000549_3628_5271 545
654 3300042157 Ga0439458_0000589 Ga0439458_0000589_6787_8436 545
655 3300044658 Ga0466972_0007384 Ga0466972_0007384_2538_4220 545
656 3300044658 Ga0466972_0011623 Ga0466972_0011623_2090_3742 545
657 3300044683 Ga0466965_0011800 Ga0466965_0011800_1562_3244 545
658 3300044684 Ga0466966_0004330 Ga0466966_0004330_2073_3755 545
659 3300044693 Ga0466961_0007410 Ga0466961_0007410_2622_4268 545
660 3300044694 Ga0466963_0006524 Ga0466963_0006524_677_2410 545
661 3300044706 Ga0466964_0000503 Ga0466964_0000503_3484_5166 545
662 3300044719 Ga0466971_0017204 Ga0466971_0017204_372_2018 545
663 3300044735 Ga0466968_0011444 Ga0466968_0011444_996_2642 545
664 3300044765 Ga0466970_0002452 Ga0466970_0002452_5557_7239 545
665 3300044765 Ga0466970_0003859 Ga0466970_0003859_1761_3404 545
666 3300044901 Ga0466960_0010191 Ga0466960_0010191_1379_3031 545
667 3300045049 Ga0466959_0000404 Ga0466959_0000404_11604_13286 545
668 3300045836 Ga0466958_0008928 Ga0466958_0008928_2390_4072 545
669 3300046453 Ga0495627_009577 Ga0495627_009577_484_2127 545
670 3300046455 Ga0495603_0000568 Ga0495603_0000568_6295_7932 545
671 3300046455 Ga0495603_0000900 Ga0495603_0000900_124_1767 545
672 3300046455 Ga0495603_0001369 Ga0495603_0001369_7636_9279 545
673 3300046455 Ga0495603_0002351 Ga0495603_0002351_7493_9136 545
674 3300046455 Ga0495603_0005879 Ga0495603_0005879_1606_3252 545
675 3300046459 Ga0495629_0002068 Ga0495629_0002068_1603_3246 545
676 3300046459 Ga0495629_0004829 Ga0495629_0004829_748_2400 545
677 3300046459 Ga0495629_0012678 Ga0495629_0012678_567_2210 545
678 3300046460 Ga0495638_0049126 Ga0495638_0049126_423_2075 545
679 3300046472 Ga0495580_0077511 Ga0495580_0077511_124_1767 545
680 3300046474 Ga0495605_0002215 Ga0495605_0002215_1771_3414 545
681 3300046476 Ga0495662_0001163 Ga0495662_0001163_10325_11977 545
682 3300046491 Ga0495584_0027505 Ga0495584_0027505_1082_2725 545
683 3300046492 Ga0495585_0015186 Ga0495585_0015186_348_2000 545
684 3300046499 Ga0495594_0004425 Ga0495594_0004425_837_2483 545
685 3300046499 Ga0495594_0048816 Ga0495594_0048816_354_1997 545
686 3300046501 Ga0495607_0026057 Ga0495607_0026057_1522_3165 545
687 3300046513 Ga0495616_0008761 Ga0495616_0008761_332_1975 545
688 3300046515 Ga0495620_0003173 Ga0495620_0003173_7642_9285 545
689 3300046518 Ga0495631_0005774 Ga0495631_0005774_3058_4701 545
690 3300046520 Ga0495637_0033247 Ga0495637_0033247_340_1983 545
691 3300046522 Ga0495643_0007450 Ga0495643_0007450_627_2270 545
692 3300046526 Ga0495666_0018950 Ga0495666_0018950_1439_3082 545
693 3300046529 Ga0495652_0016537 Ga0495652_0016537_4667_6319 545
694 3300046529 Ga0495652_0032037 Ga0495652_0032037_2062_3705 545
695 3300046530 Ga0495654_0010771 Ga0495654_0010771_2087_3730 545
696 3300046536 Ga0495587_0013224 Ga0495587_0013224_3362_5014 545
697 3300046542 Ga0495597_0006873 Ga0495597_0006873_2495_4138 545
698 3300046557 Ga0495622_0003939 Ga0495622_0003939_3300_4943 545
699 3300046558 Ga0495633_0016083 Ga0495633_0016083_946_2589 545
700 3300046616 Ga0495668_0006268 Ga0495668_0006268_1771_3414 545
701 3300046642 Ga0495634_0101559 Ga0495634_0101559_35_1678 545
702 3300046648 Ga0495611_0031831 Ga0495611_0031831_331_1974 545
703 3300046660 Ga0495625_0007428 Ga0495625_0007428_1978_3621 545
704 3300046660 Ga0495625_0020111 Ga0495625_0020111_668_2317 545
705 3300046663 Ga0495635_0027825 Ga0495635_0027825_1067_2710 545
706 3300046665 Ga0495661_0014582 Ga0495661_0014582_1649_3292 545
707 3300046674 Ga0495588_0006246 Ga0495588_0006246_3458_5101 545
708 3300046675 Ga0495657_0016677 Ga0495657_0016677_3549_5201 545
709 3300046680 Ga0495646_0001920 Ga0495646_0001920_10243_11895 545
710 3300046689 Ga0495613_0013738 Ga0495613_0013738_1127_2773 545
711 3300046694 Ga0495649_0023208 Ga0495649_0023208_1678_3321 545
712 3300046694 Ga0495649_0032929 Ga0495649_0032929_254_1906 545
713 3300046694 Ga0495649_0058085 Ga0495649_0058085_122_1855 545
714 3300047317 Ga0495604_0047728 Ga0495604_0047728_934_2577 545
715 3300047321 Ga0495676_0003615 Ga0495676_0003615_4881_6524 545
716 3300047321 Ga0495676_0005286 Ga0495676_0005286_3846_5489 545
717 3300047321 Ga0495676_0006839 Ga0495676_0006839_3536_5188 545
718 3300047321 Ga0495676_0007821 Ga0495676_0007821_3769_5412 545
719 3300047443 Ga0495687_002090 Ga0495687_002090_3039_4694 545
720 3300047443 Ga0495687_007214 Ga0495687_007214_207_1850 545
721 3300047443 Ga0495687_010803 Ga0495687_010803_1455_3188 545
722 3300047447 Ga0495685_001626 Ga0495685_001626_4452_6176 545
723 3300047470 Ga0495681_0001415 Ga0495681_0001415_7873_9516 545
724 3300047472 Ga0495686_0012334 Ga0495686_0012334_309_1955 545
725 3300048089 Ga0495614_0030369 Ga0495614_0030369_198_1841 545
726 3300048909 Ga0496106_0092415 Ga0496106_0092415_509_2152 545
727 3300048912 Ga0496109_0082608 Ga0496109_0082608_1305_2951 545
728 3300048917 Ga0496114_0207053 Ga0496114_0207053_45_1700 545
729 3300049459 Ga0495678_013219 Ga0495678_013219_780_2423 545
730 3300049460 Ga0495682_0035457 Ga0495682_0035457_125_1768 545
731 3300049569 Ga0501032_0085590 Ga0501032_0085590_278_1927 545
732 3300049570 Ga0501033_0021259 Ga0501033_0021259_988_2679 545
733 3300049572 Ga0501036_0019839 Ga0501036_0019839_102_1754 545
734 3300049572 Ga0501036_0027031 Ga0501036_0027031_38_1690 545
735 3300049572 Ga0501036_0063006 Ga0501036_0063006_1386_3035 545
736 3300049574 Ga0501038_0003501 Ga0501038_0003501_2761_4407 545
737 3300049575 Ga0501039_0038612 Ga0501039_0038612_123_1775 545
738 3300049576 Ga0501040_0004700 Ga0501040_0004700_4418_6055 545
739 3300049577 Ga0501041_0001255 Ga0501041_0001255_8337_9974 545
740 3300049578 Ga0501042_0073307 Ga0501042_0073307_21_1670 545
741 3300049580 Ga0501046_0005851 Ga0501046_0005851_5336_6973 545
742 3300049580 Ga0501046_0021972 Ga0501046_0021972_2627_4276 545
743 3300049580 Ga0501046_0118369 Ga0501046_0118369_219_1868 545
744 3300049581 Ga0501047_0044079 Ga0501047_0044079_300_1949 545
745 3300049581 Ga0501047_0080339 Ga0501047_0080339_39_1691 545
746 3300049582 Ga0501048_0000461 Ga0501048_0000461_23703_25340 545
747 3300049582 Ga0501048_0070547 Ga0501048_0070547_627_2276 545
748 3300049584 Ga0501068_0051515 Ga0501068_0051515_121_1758 545
749 3300049586 Ga0501070_0002053 Ga0501070_0002053_15332_16984 545
750 3300049587 Ga0501071_0144982 Ga0501071_0144982_44_1681 545
751 3300049588 Ga0501072_0004789 Ga0501072_0004789_8307_9944 545
752 3300049590 Ga0501074_0005958 Ga0501074_0005958_5438_7090 545
753 3300049590 Ga0501074_0010701 Ga0501074_0010701_1895_3532 545
754 3300049591 Ga0501075_0002633 Ga0501075_0002633_9878_11515 545
755 3300049592 Ga0501076_0007334 Ga0501076_0007334_3562_5199 545
756 3300049741 Ga0501079_0003415 Ga0501079_0003415_4132_5769 545
757 3300049822 Ga0501035_0011346 Ga0501035_0011346_569_2206 545
758 3300049822 Ga0501035_0063533 Ga0501035_0063533_1542_3191 545
759 3300049822 Ga0501035_0085074 Ga0501035_0085074_1048_2700 545
760 3300049823 Ga0501044_0000276 Ga0501044_0000276_404_2056 545
761 3300049824 Ga0501045_0001513 Ga0501045_0001513_8708_10345 545
762 3300050494 nmdc:mga06z11_12973_c1 nmdc:mga06z11_12973_c1_1706_3370 545
763 3300050495 nmdc:mga04h51_1118_c1 nmdc:mga04h51_1118_c1_1664_3328 545
764 3300053085 Ga0495619_0055148 Ga0495619_0055148_179_1828 545
765 3300053088 Ga0500644_0013971 Ga0500644_0013971_284_1939 545
766 3300060353 Ga0501082_0005284 Ga0501082_0005284_884_2521 545
767 3300061719 Ga0466962_0009517 Ga0466962_0009517_447_2138 545
768 3300061719 Ga0466962_0014116 Ga0466962_0014116_1805_3451 545
769 3300061719 Ga0466962_0021270 Ga0466962_0021270_1353_3035 545
770 3300061734 Ga0530510_0003072 Ga0530510_0003072_990_2627 545
771 iso_pu_bacteria 2954002825 2954007337 545
772 iso_pu_bacteria 3006425503 3006428750 545
773 iso_pu_bacteria 8008574985 8008578838 545
774 3300001979 JGI24740J21852_10007688 JGI24740J21852_100076884 546
775 3300005345 Ga0070692_10003408 Ga0070692_100034084 546
776 3300005356 Ga0070674_100011905 Ga0070674_1000119054 546
777 3300005366 Ga0070659_100016472 Ga0070659_1000164723 546
778 3300005435 Ga0070714_100018329 Ga0070714_1000183294 546
779 3300005441 Ga0070700_100009817 Ga0070700_1000098172 546
780 3300005457 Ga0070662_100061364 Ga0070662_1000613642 546
781 3300005468 Ga0070707_100154579 Ga0070707_1001545792 546
782 3300005471 Ga0070698_100003436 Ga0070698_10000343612 546
783 3300005530 Ga0070679_100025454 Ga0070679_1000254545 546
784 3300005535 Ga0070684_100047463 Ga0070684_1000474633 546
785 3300005539 Ga0068853_100063338 Ga0068853_1000633383 546
786 3300005543 Ga0070672_100012648 Ga0070672_1000126484 546
787 3300005563 Ga0068855_100022280 Ga0068855_1000222803 546
788 3300005578 Ga0068854_100119775 Ga0068854_1001197752 546
789 3300005616 Ga0068852_100016871 Ga0068852_1000168711 546
790 3300005937 Ga0081455_10004253 Ga0081455_1000425313 546
791 3300005937 Ga0081455_10006608 Ga0081455_1000660810 546
792 3300005981 Ga0081538_10005537 Ga0081538_100055378 546
793 3300005983 Ga0081540_1001898 Ga0081540_100189813 546
794 3300005983 Ga0081540_1013976 Ga0081540_10139765 546
795 3300005985 Ga0081539_10001811 Ga0081539_1000181115 546
796 3300006038 Ga0075365_10001344 Ga0075365_100013448 546
797 3300006042 Ga0075368_10000990 Ga0075368_100009906 546
798 3300006048 Ga0075363_100001385 Ga0075363_1000013857 546
799 3300006058 Ga0075432_10000054 Ga0075432_100000548 546
800 3300006178 Ga0075367_10003044 Ga0075367_100030446 546
801 3300006178 Ga0075367_10003546 Ga0075367_100035462 546
802 3300006844 Ga0075428_100005149 Ga0075428_10000514911 546
803 3300006852 Ga0075433_10001879 Ga0075433_100018798 546
804 3300006852 Ga0075433_10008214 Ga0075433_100082147 546
805 3300006871 Ga0075434_100001494 Ga0075434_10000149412 546
806 3300006871 Ga0075434_100010605 Ga0075434_1000106053 546
807 3300006914 Ga0075436_100000397 Ga0075436_10000039716 546
808 3300007076 Ga0075435_100009820 Ga0075435_1000098203 546
809 3300007076 Ga0075435_100045473 Ga0075435_1000454732 546
810 3300009093 Ga0105240_10004795 Ga0105240_100047955 546
811 3300009094 Ga0111539_10001116 Ga0111539_100011168 546
812 3300009094 Ga0111539_10001701 Ga0111539_100017019 546
813 3300009094 Ga0111539_10051875 Ga0111539_100518754 546
814 3300009147 Ga0114129_10009337 Ga0114129_1000933710 546
815 3300009148 Ga0105243_10004589 Ga0105243_100045895 546
816 3300009148 Ga0105243_10018609 Ga0105243_100186093 546
817 3300009176 Ga0105242_10010498 Ga0105242_100104985 546
818 3300009545 Ga0105237_10101399 Ga0105237_101013991 546
819 3300009553 Ga0105249_10024119 Ga0105249_100241193 546
820 3300009553 Ga0105249_10042998 Ga0105249_100429981 546
821 3300013104 Ga0157370_10019952 Ga0157370_100199523 546
822 3300013105 Ga0157369_10049710 Ga0157369_100497103 546
823 3300013105 Ga0157369_10077141 Ga0157369_100771412 546
824 3300013307 Ga0157372_10168159 Ga0157372_101681592 546
825 3300014326 Ga0157380_10022443 Ga0157380_100224431 546
826 3300020070 Ga0206356_10246010 Ga0206356_102460103 546
827 3300025901 Ga0207688_10005132 Ga0207688_100051325 546
828 3300025908 Ga0207643_10002591 Ga0207643_100025914 546
829 3300025909 Ga0207705_10034687 Ga0207705_100346873 546
830 3300025913 Ga0207695_10020753 Ga0207695_100207537 546
831 3300025914 Ga0207671_10062856 Ga0207671_100628561 546
832 3300025919 Ga0207657_10023495 Ga0207657_100234953 546
833 3300025922 Ga0207646_10143064 Ga0207646_101430641 546
834 3300025932 Ga0207690_10028850 Ga0207690_100288505 546
835 3300025933 Ga0207706_10012759 Ga0207706_100127595 546
836 3300025934 Ga0207686_10041797 Ga0207686_100417972 546
837 3300025935 Ga0207709_10012912 Ga0207709_100129122 546
838 3300025935 Ga0207709_10041797 Ga0207709_100417972 546
839 3300025937 Ga0207669_10014430 Ga0207669_100144303 546
840 3300025944 Ga0207661_10090194 Ga0207661_100901943 546
841 3300025949 Ga0207667_10028691 Ga0207667_100286913 546
842 3300025961 Ga0207712_10039735 Ga0207712_100397353 546
843 3300025972 Ga0207668_10012275 Ga0207668_100122751 546
844 3300025986 Ga0207658_10028254 Ga0207658_100282543 546
845 3300026075 Ga0207708_10000420 Ga0207708_100004204 546
846 3300026075 Ga0207708_10067613 Ga0207708_100676132 546
847 3300026078 Ga0207702_10109043 Ga0207702_101090432 546
848 3300026088 Ga0207641_10142569 Ga0207641_101425691 546
849 3300026089 Ga0207648_10000985 Ga0207648_1000098522 546
850 3300026116 Ga0207674_10035403 Ga0207674_100354031 546
851 3300026116 Ga0207674_10061655 Ga0207674_100616553 546
852 3300026116 Ga0207674_10107618 Ga0207674_101076183 546
853 3300026118 Ga0207675_100002855 Ga0207675_1000028553 546
854 3300027907 Ga0207428_10000732 Ga0207428_1000073212 546
855 3300027907 Ga0207428_10008028 Ga0207428_100080282 546
856 3300027907 Ga0207428_10037470 Ga0207428_100374702 546
857 3300028786 Ga0307517_10037929 Ga0307517_100379291 546
858 3300031247 Ga0265340_10001671 Ga0265340_100016717 546
859 3300031548 Ga0307408_100007289 Ga0307408_1000072893 546
860 3300031616 Ga0307508_10035283 Ga0307508_100352833 546
861 3300031691 Ga0316579_10003809 Ga0316579_100038092 546
862 3300031727 Ga0316576_10004042 Ga0316576_100040426 546
863 3300031728 Ga0316578_10066381 Ga0316578_100663811 546
864 3300031730 Ga0307516_10017407 Ga0307516_100174074 546
865 3300031824 Ga0307413_10002149 Ga0307413_1000214910 546
866 3300031824 Ga0307413_10005023 Ga0307413_100050235 546
867 3300031824 Ga0307413_10005655 Ga0307413_100056553 546
868 3300031824 Ga0307413_10035772 Ga0307413_100357722 546
869 3300031852 Ga0307410_10000556 Ga0307410_100005564 546
870 3300031852 Ga0307410_10004130 Ga0307410_100041303 546
871 3300031852 Ga0307410_10045170 Ga0307410_100451701 546
872 3300031852 Ga0307410_10122649 Ga0307410_101226491 546
873 3300031901 Ga0307406_10000155 Ga0307406_1000015524 546
874 3300031901 Ga0307406_10063908 Ga0307406_100639081 546
875 3300031903 Ga0307407_10008027 Ga0307407_100080274 546
876 3300031903 Ga0307407_10036110 Ga0307407_100361102 546
877 3300031911 Ga0307412_10109300 Ga0307412_101093001 546
878 3300031995 Ga0307409_100012442 Ga0307409_1000124422 546
879 3300031995 Ga0307409_100123006 Ga0307409_1001230062 546
880 3300032002 Ga0307416_100053610 Ga0307416_1000536102 546
881 3300032002 Ga0307416_100067367 Ga0307416_1000673671 546
882 3300032004 Ga0307414_10022367 Ga0307414_100223672 546
883 3300032004 Ga0307414_10028782 Ga0307414_100287822 546
884 3300032004 Ga0307414_10104274 Ga0307414_101042742 546
885 3300032005 Ga0307411_10014304 Ga0307411_100143043 546
886 3300032005 Ga0307411_10047673 Ga0307411_100476731 546
887 3300032126 Ga0307415_100008469 Ga0307415_1000084694 546
888 3300032126 Ga0307415_100048632 Ga0307415_1000486321 546
889 3300032126 Ga0307415_100068610 Ga0307415_1000686102 546
890 3300032137 Ga0316585_10012441 Ga0316585_100124412 546
891 3300035398 Ga0316574_0103777 Ga0316574_0103777_126_1778 546
892 3300036712 Ga0316584_0001293 Ga0316584_0001293_11975_13705 546
893 3300037418 Ga0395900_0205433 Ga0395900_0205433_67_1731 546
894 3300037466 Ga0395898_0035997 Ga0395898_0035997_2842_4485 546
895 3300038443 Ga0395901_0007406 Ga0395901_0007406_5181_6824 546
896 3300038443 Ga0395901_0037134 Ga0395901_0037134_1466_3130 546
897 3300038443 Ga0395901_0049733 Ga0395901_0049733_483_2126 546
898 3300038735 Ga0400485_14478 Ga0400485_14478_8816_10480 546
899 3300038742 Ga0400486_12313 Ga0400486_12313_1269_2933 546
900 3300041997 Ga0439431_0001742 Ga0439431_0001742_1562_3202 546
901 3300042004 Ga0439445_0013224 Ga0439445_0013224_187_1827 546
902 3300042005 Ga0439448_0005088 Ga0439448_0005088_1930_3591 546
903 3300042993 Ga0439440_0001905 Ga0439440_0001905_628_2289 546
904 3300042993 Ga0439440_0006571 Ga0439440_0006571_669_2330 546
905 3300044656 Ga0466969_0002205 Ga0466969_0002205_1392_3053 546
906 3300044658 Ga0466972_0032132 Ga0466972_0032132_558_2222 546
907 3300044683 Ga0466965_0068253 Ga0466965_0068253_106_1746 546
908 3300044693 Ga0466961_0002231 Ga0466961_0002231_2576_4228 546
909 3300044693 Ga0466961_0002683 Ga0466961_0002683_4083_5744 546
910 3300044719 Ga0466971_0046236 Ga0466971_0046236_191_1831 546
911 3300044842 Ga0466957_0002626 Ga0466957_0002626_7709_9349 546
912 3300044842 Ga0466957_0005920 Ga0466957_0005920_1092_2777 546
913 3300044901 Ga0466960_0007762 Ga0466960_0007762_1206_2849 546
914 3300045836 Ga0466958_0006615 Ga0466958_0006615_3187_4872 546
915 3300045836 Ga0466958_0033825 Ga0466958_0033825_115_1761 546
916 3300045836 Ga0466958_0067998 Ga0466958_0067998_232_1872 546
917 3300045976 Ga0466967_0019690 Ga0466967_0019690_2152_3801 546
918 3300045976 Ga0466967_0091223 Ga0466967_0091223_1114_2754 546
919 3300045976 Ga0466967_0127237 Ga0466967_0127237_322_1962 546
920 3300045976 Ga0466967_0199728 Ga0466967_0199728_50_1735 546
921 3300046454 Ga0495592_0001633 Ga0495592_0001633_6311_7963 546
922 3300046476 Ga0495662_0000587 Ga0495662_0000587_5215_6867 546
923 3300046492 Ga0495585_0044475 Ga0495585_0044475_632_2272 546
924 3300046511 Ga0495608_0022842 Ga0495608_0022842_1922_3574 546
925 3300046522 Ga0495643_0002929 Ga0495643_0002929_3627_5510 546
926 3300046525 Ga0495663_0022457 Ga0495663_0022457_92_1753 546
927 3300046526 Ga0495666_0001372 Ga0495666_0001372_3838_5490 546
928 3300046531 Ga0495665_0019191 Ga0495665_0019191_203_1855 546
929 3300046533 Ga0495640_0029284 Ga0495640_0029284_254_1906 546
930 3300046535 Ga0495586_0021797 Ga0495586_0021797_208_1860 546
931 3300046536 Ga0495587_0002070 Ga0495587_0002070_2704_4356 546
932 3300046543 Ga0495645_0004013 Ga0495645_0004013_5295_6947 546
933 3300046543 Ga0495645_0004306 Ga0495645_0004306_5207_6859 546
934 3300046559 Ga0495667_0022051 Ga0495667_0022051_1923_3575 546
935 3300046615 Ga0495656_0032577 Ga0495656_0032577_164_1825 546
936 3300046675 Ga0495657_0003095 Ga0495657_0003095_5773_7425 546
937 3300046678 Ga0495599_0012852 Ga0495599_0012852_671_2323 546
938 3300046680 Ga0495646_0000377 Ga0495646_0000377_15618_17270 546
939 3300046683 Ga0495658_0010862 Ga0495658_0010862_528_2204 546
940 3300046794 Ga0495589_0014667 Ga0495589_0014667_1055_2938 546
941 3300046810 Ga0495660_0018871 Ga0495660_0018871_2132_3772 546
942 3300047317 Ga0495604_0000705 Ga0495604_0000705_5046_6698 546
943 3300047319 Ga0495674_0007626 Ga0495674_0007626_1802_3454 546
944 3300047323 Ga0495683_0020101 Ga0495683_0020101_833_2716 546
945 3300047444 Ga0495675_0017903 Ga0495675_0017903_2586_4238 546
946 3300047470 Ga0495681_0004205 Ga0495681_0004205_3468_5351 546
947 3300047673 Ga0495593_0005711 Ga0495593_0005711_4549_6201 546
948 3300048906 Ga0496103_0034498 Ga0496103_0034498_206_1849 546
949 3300048907 Ga0496104_0106519 Ga0496104_0106519_351_1994 546
950 3300048913 Ga0496110_0061572 Ga0496110_0061572_1632_3275 546
951 3300048913 Ga0496110_0116103 Ga0496110_0116103_224_1867 546
952 3300048914 Ga0496111_0000658 Ga0496111_0000658_5100_6764 546
953 3300048916 Ga0496113_0024211 Ga0496113_0024211_2012_3655 546
954 3300048925 Ga0496122_0001743 Ga0496122_0001743_31506_33161 546
955 3300048928 Ga0496125_0000015 Ga0496125_0000015_439638_441293 546
956 3300049568 Ga0501031_0061773 Ga0501031_0061773_745_2427 546
957 3300049568 Ga0501031_0112861 Ga0501031_0112861_84_1730 546
958 3300049569 Ga0501032_0009201 Ga0501032_0009201_2495_4177 546
959 3300049569 Ga0501032_0026687 Ga0501032_0026687_2033_3679 546
960 3300049570 Ga0501033_0010371 Ga0501033_0010371_1048_2688 546
961 3300049571 Ga0501034_0087533 Ga0501034_0087533_387_2069 546
962 3300049572 Ga0501036_0008125 Ga0501036_0008125_3876_5558 546
963 3300049572 Ga0501036_0009768 Ga0501036_0009768_4555_6210 546
964 3300049572 Ga0501036_0019288 Ga0501036_0019288_778_2463 546
965 3300049573 Ga0501037_0001612 Ga0501037_0001612_7210_8865 546
966 3300049573 Ga0501037_0014649 Ga0501037_0014649_2574_4226 546
967 3300049573 Ga0501037_0089567 Ga0501037_0089567_478_2163 546
968 3300049574 Ga0501038_0005244 Ga0501038_0005244_9821_11476 546
969 3300049574 Ga0501038_0026104 Ga0501038_0026104_1613_3265 546
970 3300049574 Ga0501038_0089180 Ga0501038_0089180_39_1721 546
971 3300049575 Ga0501039_0023860 Ga0501039_0023860_785_2470 546
972 3300049576 Ga0501040_0001847 Ga0501040_0001847_7586_9271 546
973 3300049576 Ga0501040_0065715 Ga0501040_0065715_217_1863 546
974 3300049578 Ga0501042_0005112 Ga0501042_0005112_177_1868 546
975 3300049578 Ga0501042_0011371 Ga0501042_0011371_2966_4621 546
976 3300049578 Ga0501042_0054966 Ga0501042_0054966_1142_2794 546
977 3300049579 Ga0501043_0003443 Ga0501043_0003443_4026_5681 546
978 3300049579 Ga0501043_0008977 Ga0501043_0008977_5464_7224 546
979 3300049579 Ga0501043_0018266 Ga0501043_0018266_1703_3355 546
980 3300049579 Ga0501043_0077718 Ga0501043_0077718_872_2554 546
981 3300049580 Ga0501046_0000982 Ga0501046_0000982_11447_13102 546
982 3300049580 Ga0501046_0007054 Ga0501046_0007054_3601_5256 546
983 3300049580 Ga0501046_0019912 Ga0501046_0019912_1466_3151 546
984 3300049580 Ga0501046_0147897 Ga0501046_0147897_105_1751 546
985 3300049581 Ga0501047_0000033 Ga0501047_0000033_25538_27223 546
986 3300049581 Ga0501047_0023804 Ga0501047_0023804_3755_5437 546
987 3300049581 Ga0501047_0026519 Ga0501047_0026519_1921_3573 546
988 3300049582 Ga0501048_0004238 Ga0501048_0004238_4239_5894 546
989 3300049582 Ga0501048_0005799 Ga0501048_0005799_5851_7503 546
990 3300049582 Ga0501048_0022584 Ga0501048_0022584_624_2264 546
991 3300049583 Ga0501067_0044920 Ga0501067_0044920_246_1895 546
992 3300049586 Ga0501070_0038268 Ga0501070_0038268_1002_2684 546
993 3300049587 Ga0501071_0010676 Ga0501071_0010676_3022_4707 546
994 3300049589 Ga0501073_0063935 Ga0501073_0063935_374_2020 546
995 3300049590 Ga0501074_0019956 Ga0501074_0019956_832_2484 546
996 3300049591 Ga0501075_0051482 Ga0501075_0051482_673_2358 546
997 3300049741 Ga0501079_0010459 Ga0501079_0010459_114_1754 546
998 3300049742 Ga0501080_0074258 Ga0501080_0074258_91_1776 546
999 3300049822 Ga0501035_0000811 Ga0501035_0000811_24123_25883 546
1000 3300049822 Ga0501035_0024176 Ga0501035_0024176_723_2369 546
1001 3300049822 Ga0501035_0146795 Ga0501035_0146795_197_1837 546
1002 3300049823 Ga0501044_0004643 Ga0501044_0004643_11535_13187 546
1003 3300049823 Ga0501044_0007550 Ga0501044_0007550_5487_7247 546
1004 3300049823 Ga0501044_0017122 Ga0501044_0017122_986_2632 546
1005 3300049823 Ga0501044_0073855 Ga0501044_0073855_1707_3389 546
1006 3300049824 Ga0501045_0006789 Ga0501045_0006789_3337_5022 546
1007 3300050492 nmdc:mga0yw44_62861_c1 nmdc:mga0yw44_62861_c1_144_1802 546
1008 3300050494 nmdc:mga06z11_16123_c1 nmdc:mga06z11_16123_c1_1515_3155 546
1009 3300050495 nmdc:mga04h51_2319_c1 nmdc:mga04h51_2319_c1_1832_3472 546
1010 3300050508 nmdc:mga09592_9784_c1 nmdc:mga09592_9784_c1_1164_2825 546
1011 3300050509 nmdc:mga0qj67_38124_c1 nmdc:mga0qj67_38124_c1_693_2354 546
1012 3300050510 nmdc:mga06r32_115899_c1 nmdc:mga06r32_115899_c1_602_2263 546
1013 3300050511 nmdc:mga08y16_20013_c1 nmdc:mga08y16_20013_c1_432_2093 546
1014 3300050512 nmdc:mga0n895_9738_c1 nmdc:mga0n895_9738_c1_1849_3510 546
1015 3300050513 nmdc:mga0rr50_143841_c1 nmdc:mga0rr50_143841_c1_82_1743 546
1016 3300050513 nmdc:mga0rr50_1865_c1 nmdc:mga0rr50_1865_c1_300_1961 546
1017 3300050515 nmdc:mga0a205_1103_c1 nmdc:mga0a205_1103_c1_5189_6850 546
1018 3300050515 nmdc:mga0a205_620_c1 nmdc:mga0a205_620_c1_5220_6881 546
1019 3300053078 Ga0495612_0007274 Ga0495612_0007274_366_2018 546
1020 3300053085 Ga0495619_0010199 Ga0495619_0010199_1393_3045 546
1021 3300053085 Ga0495619_0047694 Ga0495619_0047694_520_2181 546
1022 3300053094 Ga0500566_0034520 Ga0500566_0034520_365_2005 546
1023 3300053104 Ga0500556_0002167 Ga0500556_0002167_2591_4231 546
1024 3300053109 Ga0500569_006125 Ga0500569_006125_215_2098 546
1025 3300053117 Ga0500593_006281 Ga0500593_006281_2208_3848 546
1026 3300053131 Ga0500652_015492 Ga0500652_015492_782_2665 546
1027 3300053134 Ga0500658_0007305 Ga0500658_0007305_960_2600 546
1028 3300053137 Ga0500561_0000279 Ga0500561_0000279_4423_6306 546
1029 3300053149 Ga0500600_0005651 Ga0500600_0005651_3678_5561 546
1030 3300054114 Ga0501084_0015340 Ga0501084_0015340_3729_5414 546
1031 3300060353 Ga0501082_0017650 Ga0501082_0017650_779_2464 546
1032 3300061719 Ga0466962_0036312 Ga0466962_0036312_584_2224 546
1033 3300061734 Ga0530510_0134374 Ga0530510_0134374_75_1724 546
1034 iso_pu_bacteria 8025413630 8025417779 546

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16203

ERCC3_RAD25_C

ERCC3/RAD25/XPB C-terminal helicase

314

508

0.96

PF13625

Helicase_C_3

Helicase conserved C-terminal domain

1

118

0.94

PF00271

Helicase_C

Helicase conserved C-terminal domain

357

462

0.91

PF04851

ResIII

Type III restriction enzyme, res subunit

194

290

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ern-assembly1.cif.gz_A crystal structure of the c-terminal domain of human xpb/ercc-3 excision repair protein at 1.80 a 0.9079 358 540
5of4-assembly1.cif.gz_A the cryo-em structure of human tfiih 0.8463 144 540
8bvw-assembly1.cif.gz_0 rna polymerase ii pre-initiation complex with the distal +1 nucleosome (pic-nuc18w) 0.8331 2 543
8ebw-assembly1.cif.gz_A initial dna-lesion (ap) binding by xpc and tfiih complex2 0.8306 1 540
7ad8-assembly1.cif.gz_A core tfiih-xpa-dna complex with modelled p62 subunit 0.8305 5 540
ID Description Score Start End Superfamily
af_O53873_165_346_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9894 173 352 3.40.50.300
af_O53873_165_346_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9733 173 352 3.40.50.300
af_O53873_347_537_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.954 355 544 3.40.50.300
af_O53873_347_537_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9444 355 544 3.40.50.300
af_Q00578_544_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9048 354 544 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2S8LVG5-F1-model_v4 deleted 0.9777 1 395
AF-A0A0R2Q6K5-F1-model_v4 Helicase 0.9755 1 367 GO:0003677
GO:0004386
GO:0005524
GO:0016787
AF-A0A3D3KWG4-F1-model_v4 Helicase 0.9742 32 168 GO:0004386
AF-A0A0R2Q6K5-F1-model_v4 Helicase 0.9729 1 367 GO:0003677
GO:0004386
GO:0005524
GO:0016787
AF-A0A2S8LVG5-F1-model_v4 deleted 0.9728 1 395

Feature Viewer

pLDDT pTM Quality
83 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map