F488675
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1034 | 595 | 800 | 548 |
Family's Representative Sequence
| Representative Sequence | 3300025735|Ga0207713_1033608|Ga0207713_10336082 |
| Length | 510 |
| Sequence | VNDGPLIVQSDKTILAFAELERAPEHVHSYRLTPLGLWNARAAGLDAEKVLDTLLTYSRFPVPHSLLIDVEETMSRYGRLRLEKDPQHGLVMRTSDYPVLEEVSRAKKIAPLLGPRIDGETVVVHSSQRGQLKQLLLKLGWPAEDLAGYVDGTPHPIVLNESGWKLRPYQQLAAENFWAGGSGVVVLPCGAGKTLVGQWKDELLKRTSLTEEEIGEYSGSVKEVRPVTIATYQVLTTKRGGLYPHLELVDGNDWGLIIYDEVHLLPAPIFRMTADLQARRRLGLTATLVREDGREGEVFSLIGPKRYDAPWKDIEAQGYIAPADCVEVRVDLPRDERVAYAMAEDADKYRLCATSETKTRVVEELVAEHAGEQLLVIGQYIDQLDEIGERLGAPVIKGDTSVKERQRLFDAFRTGEVQTLVVSKVANFSIDLPEASVAIQVSGSFGSRQEEAQRLGRLLRPKKDGRSARFYSLVARDTLDQDFAAKRQRFLAEQGYAYRIMDAKDVGTAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 3 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 4 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 5 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 6 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 7 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 8 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 9 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 10 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 11 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 12 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 13 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 14 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 15 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 16 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 17 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 18 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 19 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 20 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 21 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 22 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 23 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 24 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 25 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 26 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 27 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 28 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 29 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 30 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 31 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 32 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 33 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 34 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 35 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 36 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 37 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 38 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 39 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 40 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 41 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 42 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 43 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 44 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 45 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 46 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 47 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 48 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 49 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 50 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 51 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 52 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 53 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 54 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 55 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 56 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 57 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 58 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 59 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 60 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 61 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 62 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 63 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 64 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 65 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 66 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 67 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 68 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 69 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 70 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 71 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 72 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 73 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 74 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 75 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 76 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 77 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 78 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 79 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 80 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 81 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 82 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 83 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 84 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 85 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 86 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 87 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 88 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 89 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 90 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 91 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 92 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 93 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 94 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 95 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 96 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 97 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 98 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 99 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 100 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 101 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 102 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 103 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 104 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 105 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 106 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 107 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 108 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 109 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 110 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 111 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 112 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 113 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 114 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 115 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 116 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 117 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 118 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 119 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 120 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 121 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 122 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 123 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 124 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 125 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 126 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 127 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 128 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 129 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 130 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 131 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 132 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 133 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 134 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 135 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 136 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 137 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 138 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 139 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 140 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 141 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 142 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 143 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 144 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 145 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 146 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 147 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 148 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 149 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 150 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 151 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 152 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 153 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 154 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 155 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 156 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 157 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 158 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 159 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 160 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 161 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 162 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 163 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 164 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 165 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 166 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 167 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 168 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 169 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 170 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 171 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 172 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 173 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 174 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 175 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 176 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 177 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 178 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 179 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 180 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 181 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 182 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 183 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 184 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 185 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 186 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 187 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 188 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 189 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 190 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 191 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 192 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 193 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 194 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 195 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 196 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 197 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 198 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 199 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 200 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 201 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 202 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 203 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 204 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 205 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 206 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 207 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 208 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 209 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 210 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 211 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 212 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 213 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 214 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 215 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 216 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 217 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 218 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 219 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 220 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 222 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 227 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 228 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 229 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 230 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 231 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 232 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 233 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 234 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 237 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 238 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 239 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 240 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 241 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 242 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 243 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 244 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 245 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 246 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 247 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 248 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 249 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 250 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 251 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 252 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 253 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 254 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 255 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 256 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 264 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 267 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 268 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 269 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 270 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 277 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 278 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 279 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 280 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 281 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 282 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 284 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 290 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 291 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 292 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 293 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 294 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 295 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 296 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 336 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 338 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 339 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 340 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 341 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 342 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 343 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 344 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 345 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 346 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 347 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 348 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 349 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 350 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 351 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 352 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 353 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 354 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 355 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 356 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 357 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 358 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 359 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 360 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 361 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 362 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 363 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 364 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 365 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 366 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 367 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 368 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 369 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 370 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 371 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 372 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 373 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 374 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 375 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 376 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 377 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 378 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 379 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 380 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 381 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 382 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 383 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 384 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 385 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 386 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 387 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 388 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 389 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 390 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 391 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 392 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 393 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 394 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 395 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 396 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 397 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 398 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 399 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 400 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 401 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 402 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 403 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 404 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 405 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 406 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 407 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 470 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 471 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 472 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 473 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 474 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 475 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 476 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 477 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 478 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 479 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 480 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 481 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 482 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 483 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 484 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 485 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 486 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 487 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 488 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 489 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 490 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 491 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 492 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 493 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 494 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 501 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 502 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 505 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 507 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 508 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 509 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 510 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 522 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 523 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 524 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 525 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 526 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 527 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 528 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 531 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 532 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 533 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 534 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 535 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 536 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 537 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 538 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 539 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 540 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 541 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 542 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 544 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 546 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 547 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 548 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 549 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 550 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 551 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 552 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 553 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 554 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 555 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 556 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 557 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 558 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 559 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 560 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 561 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 562 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 563 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 564 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 565 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 566 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 567 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 568 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 569 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 570 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 571 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 572 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 573 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 574 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 575 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 576 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 577 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 578 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 579 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 580 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 581 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 582 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 583 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 584 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 585 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 586 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 587 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 588 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 589 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 590 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 591 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 592 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 593 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 594 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 595 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.5 |
| Metatranscriptomes | 0.87 |
| Isolates | 22.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.39 |
| Bulb | 0 |
| Endosphere | 7.16 |
| Nodule | 0.29 |
| Rhizoplane | 3.68 |
| Rhizosphere | 71.28 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 17.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007688 | 3300001979 | Bacteria | 4361 |
| 2 | JGI24739J22299_10013586 | 3300001989 | Bacteria | 2970 |
| 3 | JGI24739J22299_10016409 | 3300001989 | Bacteria | 2681 |
| 4 | JGI25164J39214_1000508 | 3300002772 | Bacteria | 18811 |
| 5 | JGI25152J39213_1000323 | 3300002773 | Bacteria | 30643 |
| 6 | JGI25406J46586_10002789 | 3300003203 | Bacteria | 8214 |
| 7 | JGI25165J46597_1000004 | 3300003214 | Bacteria | 667510 |
| 8 | JGI25165J46597_1000174 | 3300003214 | Bacteria | 100372 |
| 9 | Ga0007423J48922_100648 | 3300003285 | Bacteria | 2265 |
| 10 | JGI25160J50197_1007167 | 3300003354 | Bacteria | 4395 |
| 11 | Ga0006562J51391_1021328 | 3300003578 | Bacteria | 11190 |
| 12 | Ga0006562J51391_1021330 | 3300003578 | Bacteria | 7080 |
| 13 | Ga0006562J51391_1037344 | 3300003578 | Bacteria | 7210 |
| 14 | Ga0006562J51391_1071059 | 3300003578 | Bacteria | 3520 |
| 15 | Ga0055539_1000005 | 3300003752 | Bacteria | 609598 |
| 16 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 17 | Ga0055525_1000150 | 3300003759 | Bacteria | 94263 |
| 18 | Ga0055542_1000023 | 3300003762 | Bacteria | 292964 |
| 19 | Ga0055529_1000050 | 3300003763 | Bacteria | 206297 |
| 20 | Ga0070658_10047967 | 3300005327 | Bacteria | 3457 |
| 21 | Ga0070658_10084451 | 3300005327 | Bacteria | 2611 |
| 22 | Ga0070683_100011149 | 3300005329 | Bacteria | 7755 |
| 23 | Ga0070692_10003408 | 3300005345 | Bacteria | 6445 |
| 24 | Ga0070674_100011905 | 3300005356 | Bacteria | 5317 |
| 25 | Ga0070659_100016472 | 3300005366 | Bacteria | 5549 |
| 26 | Ga0070659_100022773 | 3300005366 | Bacteria | 4786 |
| 27 | Ga0070714_100018329 | 3300005435 | Bacteria | 5685 |
| 28 | Ga0070710_10014843 | 3300005437 | Bacteria | 3927 |
| 29 | Ga0070700_100009817 | 3300005441 | Bacteria | 5264 |
| 30 | Ga0070662_100061364 | 3300005457 | Bacteria | 2744 |
| 31 | Ga0070707_100154579 | 3300005468 | Bacteria | 2235 |
| 32 | Ga0070698_100003436 | 3300005471 | Bacteria | 17413 |
| 33 | Ga0070679_100025454 | 3300005530 | Bacteria | 5807 |
| 34 | Ga0070684_100012629 | 3300005535 | Bacteria | 6774 |
| 35 | Ga0070684_100047463 | 3300005535 | Bacteria | 3721 |
| 36 | Ga0068853_100063338 | 3300005539 | Bacteria | 3203 |
| 37 | Ga0070672_100012648 | 3300005543 | Bacteria | 5936 |
| 38 | Ga0070665_100006294 | 3300005548 | Bacteria | 12125 |
| 39 | Ga0070665_100027096 | 3300005548 | Bacteria | 5772 |
| 40 | Ga0070665_100072414 | 3300005548 | Bacteria | 3454 |
| 41 | Ga0070665_100119368 | 3300005548 | Bacteria | 2639 |
| 42 | Ga0068855_100011791 | 3300005563 | Bacteria | 10569 |
| 43 | Ga0068855_100022280 | 3300005563 | Bacteria | 7591 |
| 44 | Ga0068855_100052075 | 3300005563 | Bacteria | 4820 |
| 45 | Ga0068854_100053247 | 3300005578 | Bacteria | 2905 |
| 46 | Ga0068854_100119775 | 3300005578 | Bacteria | 1996 |
| 47 | Ga0068852_100016871 | 3300005616 | Bacteria | 5711 |
| 48 | Ga0068863_100125131 | 3300005841 | Bacteria | 2452 |
| 49 | Ga0068858_100022773 | 3300005842 | Bacteria | 5842 |
| 50 | Ga0081455_10004253 | 3300005937 | Bacteria | 16138 |
| 51 | Ga0081455_10006608 | 3300005937 | Bacteria | 12407 |
| 52 | Ga0081455_10031375 | 3300005937 | Bacteria | 4809 |
| 53 | Ga0081538_10005537 | 3300005981 | Bacteria | 11337 |
| 54 | Ga0081540_1001898 | 3300005983 | Bacteria | 17502 |
| 55 | Ga0081540_1013976 | 3300005983 | Bacteria | 5180 |
| 56 | Ga0081539_10001419 | 3300005985 | Bacteria | 41210 |
| 57 | Ga0081539_10001811 | 3300005985 | Bacteria | 33775 |
| 58 | Ga0075365_10001344 | 3300006038 | Bacteria | 11023 |
| 59 | Ga0075365_10023077 | 3300006038 | Bacteria | 3908 |
| 60 | Ga0075365_10041369 | 3300006038 | Bacteria | 3010 |
| 61 | Ga0075368_10000990 | 3300006042 | Bacteria | 8887 |
| 62 | Ga0075368_10017943 | 3300006042 | Bacteria | 2654 |
| 63 | Ga0075363_100001385 | 3300006048 | Bacteria | 9139 |
| 64 | Ga0075363_100010888 | 3300006048 | Bacteria | 4339 |
| 65 | Ga0075364_10001480 | 3300006051 | Bacteria | 12798 |
| 66 | Ga0075432_10000054 | 3300006058 | Bacteria | 22459 |
| 67 | Ga0075367_10003044 | 3300006178 | Bacteria | 7855 |
| 68 | Ga0075367_10003546 | 3300006178 | Bacteria | 7465 |
| 69 | Ga0075367_10079245 | 3300006178 | Bacteria | 1985 |
| 70 | Ga0075428_100005149 | 3300006844 | Bacteria | 14538 |
| 71 | Ga0075433_10001879 | 3300006852 | Bacteria | 15781 |
| 72 | Ga0075433_10008214 | 3300006852 | Bacteria | 8316 |
| 73 | Ga0075434_100001494 | 3300006871 | Bacteria | 19738 |
| 74 | Ga0075434_100010605 | 3300006871 | Bacteria | 8645 |
| 75 | Ga0075436_100000397 | 3300006914 | Bacteria | 28015 |
| 76 | Ga0075435_100009820 | 3300007076 | Bacteria | 6963 |
| 77 | Ga0075435_100045473 | 3300007076 | Bacteria | 3520 |
| 78 | Ga0105251_10013865 | 3300009011 | Bacteria | 4484 |
| 79 | Ga0105240_10004795 | 3300009093 | Bacteria | 20387 |
| 80 | Ga0105240_10008261 | 3300009093 | Bacteria | 14900 |
| 81 | Ga0111539_10001116 | 3300009094 | Bacteria | 35481 |
| 82 | Ga0111539_10001701 | 3300009094 | Bacteria | 29310 |
| 83 | Ga0111539_10051875 | 3300009094 | Bacteria | 4884 |
| 84 | Ga0105245_10008900 | 3300009098 | Bacteria | 8763 |
| 85 | Ga0105245_10017794 | 3300009098 | Bacteria | 6203 |
| 86 | Ga0114129_10009337 | 3300009147 | Bacteria | 13990 |
| 87 | Ga0105243_10004589 | 3300009148 | Bacteria | 10892 |
| 88 | Ga0105243_10018609 | 3300009148 | Bacteria | 5263 |
| 89 | Ga0105241_10000495 | 3300009174 | Bacteria | 29802 |
| 90 | Ga0105242_10010498 | 3300009176 | Bacteria | 7108 |
| 91 | Ga0105248_10130643 | 3300009177 | Bacteria | 2834 |
| 92 | Ga0105248_10140826 | 3300009177 | Bacteria | 2721 |
| 93 | Ga0105237_10101399 | 3300009545 | Bacteria | 2871 |
| 94 | Ga0105238_10001585 | 3300009551 | Bacteria | 22764 |
| 95 | Ga0105249_10024119 | 3300009553 | Bacteria | 5464 |
| 96 | Ga0105249_10042998 | 3300009553 | Bacteria | 4109 |
| 97 | Ga0105239_10002867 | 3300010375 | Bacteria | 21561 |
| 98 | Ga0105246_10001000 | 3300011119 | Bacteria | 16237 |
| 99 | Ga0157370_10019952 | 3300013104 | Bacteria | 6705 |
| 100 | Ga0157369_10000422 | 3300013105 | Bacteria | 56065 |
| 101 | Ga0157369_10006480 | 3300013105 | Bacteria | 13565 |
| 102 | Ga0157369_10049710 | 3300013105 | Bacteria | 4544 |
| 103 | Ga0157369_10077141 | 3300013105 | Bacteria | 3571 |
| 104 | Ga0157372_10168159 | 3300013307 | Bacteria | 2536 |
| 105 | Ga0163163_10004192 | 3300014325 | Bacteria | 12283 |
| 106 | Ga0157380_10022443 | 3300014326 | Bacteria | 4752 |
| 107 | Ga0157377_10015698 | 3300014745 | Bacteria | 3881 |
| 108 | Ga0182007_10002608 | 3300015262 | Bacteria | 8881 |
| 109 | Ga0183367_1005 | 3300015688 | Bacteria | 652063 |
| 110 | Ga0206356_10246010 | 3300020070 | Bacteria | 3356 |
| 111 | Ga0206354_10550714 | 3300020081 | Bacteria | 4638 |
| 112 | Ga0206353_11057787 | 3300020082 | Bacteria | 12106 |
| 113 | Ga0209566_100053 | 3300025225 | Bacteria | 224436 |
| 114 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 115 | Ga0209672_100064 | 3300025228 | Bacteria | 204609 |
| 116 | Ga0209147_100956 | 3300025229 | Bacteria | 12686 |
| 117 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 118 | Ga0209563_100349 | 3300025230 | Bacteria | 17553 |
| 119 | Ga0207427_100010 | 3300025231 | Bacteria | 648610 |
| 120 | Ga0209437_100290 | 3300025233 | Bacteria | 72971 |
| 121 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 122 | Ga0209677_101255 | 3300025253 | Bacteria | 11412 |
| 123 | Ga0209148_1000108 | 3300025254 | Bacteria | 204609 |
| 124 | Ga0209129_1000109 | 3300025258 | Bacteria | 153068 |
| 125 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 126 | Ga0209455_1000102 | 3300025272 | Bacteria | 204609 |
| 127 | Ga0209025_1000984 | 3300025294 | Bacteria | 42427 |
| 128 | Ga0209758_1005903 | 3300025297 | Bacteria | 9116 |
| 129 | Ga0207426_1001574 | 3300025302 | Bacteria | 18395 |
| 130 | Ga0207426_1002948 | 3300025302 | Bacteria | 9992 |
| 131 | Ga0207426_1009898 | 3300025302 | Bacteria | 3737 |
| 132 | Ga0207655_1004694 | 3300025728 | Bacteria | 9569 |
| 133 | Ga0207713_1030611 | 3300025735 | Bacteria | 2394 |
| 134 | Ga0207713_1033608 | 3300025735 | Bacteria | 2238 |
| 135 | Ga0207688_10005132 | 3300025901 | Bacteria | 7115 |
| 136 | Ga0207647_10005104 | 3300025904 | Bacteria | 9672 |
| 137 | Ga0207645_10000233 | 3300025907 | Bacteria | 46095 |
| 138 | Ga0207643_10002591 | 3300025908 | Bacteria | 9772 |
| 139 | Ga0207705_10034687 | 3300025909 | Bacteria | 3608 |
| 140 | Ga0207705_10048422 | 3300025909 | Bacteria | 3057 |
| 141 | Ga0207654_10006689 | 3300025911 | Bacteria | 5801 |
| 142 | Ga0207707_10171067 | 3300025912 | Bacteria | 1898 |
| 143 | Ga0207695_10000324 | 3300025913 | Bacteria | 114066 |
| 144 | Ga0207695_10020753 | 3300025913 | Bacteria | 7516 |
| 145 | Ga0207671_10000133 | 3300025914 | Bacteria | 114011 |
| 146 | Ga0207671_10062856 | 3300025914 | Bacteria | 2758 |
| 147 | Ga0207657_10023495 | 3300025919 | Bacteria | 5740 |
| 148 | Ga0207652_10016360 | 3300025921 | Bacteria | 6055 |
| 149 | Ga0207646_10143064 | 3300025922 | Bacteria | 2154 |
| 150 | Ga0207694_10013035 | 3300025924 | Bacteria | 6258 |
| 151 | Ga0207650_10096742 | 3300025925 | Bacteria | 2265 |
| 152 | Ga0207690_10028850 | 3300025932 | Bacteria | 3520 |
| 153 | Ga0207690_10029058 | 3300025932 | Bacteria | 3511 |
| 154 | Ga0207706_10012759 | 3300025933 | Bacteria | 7648 |
| 155 | Ga0207686_10041797 | 3300025934 | Bacteria | 2798 |
| 156 | Ga0207709_10012912 | 3300025935 | Bacteria | 4606 |
| 157 | Ga0207709_10019826 | 3300025935 | Bacteria | 3785 |
| 158 | Ga0207709_10026849 | 3300025935 | Bacteria | 3311 |
| 159 | Ga0207709_10041797 | 3300025935 | Bacteria | 2753 |
| 160 | Ga0207669_10014430 | 3300025937 | Bacteria | 3959 |
| 161 | Ga0207691_10010786 | 3300025940 | Bacteria | 8772 |
| 162 | Ga0207711_10103018 | 3300025941 | Bacteria | 2527 |
| 163 | Ga0207661_10032798 | 3300025944 | Bacteria | 4027 |
| 164 | Ga0207661_10090194 | 3300025944 | Bacteria | 2552 |
| 165 | Ga0207667_10026184 | 3300025949 | Bacteria | 6376 |
| 166 | Ga0207667_10028691 | 3300025949 | Bacteria | 6042 |
| 167 | Ga0207667_10035689 | 3300025949 | Bacteria | 5334 |
| 168 | Ga0207712_10031419 | 3300025961 | Bacteria | 3577 |
| 169 | Ga0207712_10039735 | 3300025961 | Bacteria | 3225 |
| 170 | Ga0207668_10012275 | 3300025972 | Bacteria | 5238 |
| 171 | Ga0207668_10053874 | 3300025972 | Bacteria | 2790 |
| 172 | Ga0207640_10010107 | 3300025981 | Bacteria | 5305 |
| 173 | Ga0207658_10028254 | 3300025986 | Bacteria | 3949 |
| 174 | Ga0207639_10018528 | 3300026041 | Bacteria | 4949 |
| 175 | Ga0207708_10000420 | 3300026075 | Bacteria | 33209 |
| 176 | Ga0207708_10067613 | 3300026075 | Bacteria | 2733 |
| 177 | Ga0207702_10045834 | 3300026078 | Bacteria | 3679 |
| 178 | Ga0207702_10109043 | 3300026078 | Bacteria | 2457 |
| 179 | Ga0207641_10029831 | 3300026088 | Bacteria | 4511 |
| 180 | Ga0207641_10142569 | 3300026088 | Bacteria | 2164 |
| 181 | Ga0207648_10000985 | 3300026089 | Bacteria | 32132 |
| 182 | Ga0207674_10023094 | 3300026116 | Bacteria | 6670 |
| 183 | Ga0207674_10035403 | 3300026116 | Bacteria | 5209 |
| 184 | Ga0207674_10061655 | 3300026116 | Bacteria | 3789 |
| 185 | Ga0207674_10107618 | 3300026116 | Bacteria | 2765 |
| 186 | Ga0207675_100002855 | 3300026118 | Bacteria | 16992 |
| 187 | Ga0207683_10003907 | 3300026121 | Bacteria | 12917 |
| 188 | Ga0209371_1009379 | 3300027312 | Bacteria | 3117 |
| 189 | Ga0209813_10002898 | 3300027866 | Bacteria | 3971 |
| 190 | Ga0207428_10000732 | 3300027907 | Bacteria | 37790 |
| 191 | Ga0207428_10008028 | 3300027907 | Bacteria | 9578 |
| 192 | Ga0207428_10037470 | 3300027907 | Bacteria | 3944 |
| 193 | Ga0268266_10001692 | 3300028379 | Bacteria | 25320 |
| 194 | Ga0307517_10013607 | 3300028786 | Bacteria | 11026 |
| 195 | Ga0307517_10037929 | 3300028786 | Bacteria | 5359 |
| 196 | Ga0307515_10000732 | 3300028794 | Bacteria | 75720 |
| 197 | Ga0307515_10094610 | 3300028794 | Bacteria | 3688 |
| 198 | Ga0268256_1015470 | 3300030500 | Bacteria | 2225 |
| 199 | Ga0307511_10001033 | 3300030521 | Bacteria | 29558 |
| 200 | Ga0307512_10002037 | 3300030522 | Bacteria | 26685 |
| 201 | Ga0307512_10046544 | 3300030522 | Bacteria | 3536 |
| 202 | Ga0265340_10001671 | 3300031247 | Bacteria | 12760 |
| 203 | Ga0307513_10016986 | 3300031456 | Bacteria | 8742 |
| 204 | Ga0307513_10075096 | 3300031456 | Bacteria | 3512 |
| 205 | Ga0307509_10013840 | 3300031507 | Bacteria | 9516 |
| 206 | Ga0307408_100004432 | 3300031548 | Bacteria | 9530 |
| 207 | Ga0307408_100007289 | 3300031548 | Bacteria | 7317 |
| 208 | Ga0307508_10003106 | 3300031616 | Bacteria | 17036 |
| 209 | Ga0307508_10035283 | 3300031616 | Bacteria | 4507 |
| 210 | Ga0307514_10001479 | 3300031649 | Bacteria | 28450 |
| 211 | Ga0307514_10079343 | 3300031649 | Bacteria | 2434 |
| 212 | Ga0316579_10003809 | 3300031691 | Bacteria | 5939 |
| 213 | Ga0316576_10000275 | 3300031727 | Bacteria | 22518 |
| 214 | Ga0316576_10004042 | 3300031727 | Bacteria | 8731 |
| 215 | Ga0316576_10038342 | 3300031727 | Bacteria | 3436 |
| 216 | Ga0316578_10013053 | 3300031728 | Bacteria | 4393 |
| 217 | Ga0316578_10026161 | 3300031728 | Bacteria | 3288 |
| 218 | Ga0316578_10066381 | 3300031728 | Bacteria | 2131 |
| 219 | Ga0307516_10017407 | 3300031730 | Bacteria | 7494 |
| 220 | Ga0307405_10017059 | 3300031731 | Bacteria | 3976 |
| 221 | Ga0307413_10001475 | 3300031824 | Bacteria | 8948 |
| 222 | Ga0307413_10002149 | 3300031824 | Bacteria | 7916 |
| 223 | Ga0307413_10005023 | 3300031824 | Bacteria | 5842 |
| 224 | Ga0307413_10005655 | 3300031824 | Bacteria | 5608 |
| 225 | Ga0307413_10035772 | 3300031824 | Bacteria | 2852 |
| 226 | Ga0307410_10000556 | 3300031852 | Bacteria | 15312 |
| 227 | Ga0307410_10003801 | 3300031852 | Bacteria | 7663 |
| 228 | Ga0307410_10004130 | 3300031852 | Bacteria | 7442 |
| 229 | Ga0307410_10006902 | 3300031852 | Bacteria | 6169 |
| 230 | Ga0307410_10045170 | 3300031852 | Bacteria | 2931 |
| 231 | Ga0307410_10122649 | 3300031852 | Bacteria | 1897 |
| 232 | Ga0307406_10000155 | 3300031901 | Bacteria | 40861 |
| 233 | Ga0307406_10006506 | 3300031901 | Bacteria | 6455 |
| 234 | Ga0307406_10063448 | 3300031901 | Bacteria | 2393 |
| 235 | Ga0307406_10063908 | 3300031901 | Bacteria | 2386 |
| 236 | Ga0307407_10008027 | 3300031903 | Bacteria | 4816 |
| 237 | Ga0307407_10008074 | 3300031903 | Bacteria | 4807 |
| 238 | Ga0307407_10036110 | 3300031903 | Bacteria | 2720 |
| 239 | Ga0307412_10023926 | 3300031911 | Bacteria | 3765 |
| 240 | Ga0307412_10049198 | 3300031911 | Bacteria | 2776 |
| 241 | Ga0307412_10109300 | 3300031911 | Bacteria | 1971 |
| 242 | Ga0307409_100012442 | 3300031995 | Bacteria | 5423 |
| 243 | Ga0307409_100013785 | 3300031995 | Bacteria | 5223 |
| 244 | Ga0307409_100055061 | 3300031995 | Bacteria | 3068 |
| 245 | Ga0307409_100101957 | 3300031995 | Bacteria | 2383 |
| 246 | Ga0307409_100123006 | 3300031995 | Bacteria | 2201 |
| 247 | Ga0307409_100215234 | 3300031995 | Bacteria | 1730 |
| 248 | Ga0307416_100014102 | 3300032002 | Bacteria | 5458 |
| 249 | Ga0307416_100025102 | 3300032002 | Bacteria | 4363 |
| 250 | Ga0307416_100053610 | 3300032002 | Bacteria | 3237 |
| 251 | Ga0307416_100067367 | 3300032002 | Bacteria | 2952 |
| 252 | Ga0307414_10001749 | 3300032004 | Bacteria | 11266 |
| 253 | Ga0307414_10022367 | 3300032004 | Bacteria | 3986 |
| 254 | Ga0307414_10028782 | 3300032004 | Bacteria | 3607 |
| 255 | Ga0307414_10074716 | 3300032004 | Bacteria | 2457 |
| 256 | Ga0307414_10090288 | 3300032004 | Bacteria | 2273 |
| 257 | Ga0307414_10104274 | 3300032004 | Bacteria | 2141 |
| 258 | Ga0307411_10005549 | 3300032005 | Bacteria | 6209 |
| 259 | Ga0307411_10014304 | 3300032005 | Bacteria | 4410 |
| 260 | Ga0307411_10047673 | 3300032005 | Bacteria | 2771 |
| 261 | Ga0307415_100008469 | 3300032126 | Bacteria | 5702 |
| 262 | Ga0307415_100048632 | 3300032126 | Bacteria | 2863 |
| 263 | Ga0307415_100068610 | 3300032126 | Bacteria | 2482 |
| 264 | Ga0316585_10006278 | 3300032137 | Bacteria | 3391 |
| 265 | Ga0316585_10012441 | 3300032137 | Bacteria | 2522 |
| 266 | Ga0307510_10036910 | 3300033180 | Bacteria | 5432 |
| 267 | Ga0307510_10037066 | 3300033180 | Bacteria | 5417 |
| 268 | Ga0307510_10063878 | 3300033180 | Bacteria | 3744 |
| 269 | Ga0316574_0000641 | 3300035398 | Bacteria | 14669 |
| 270 | Ga0316574_0103777 | 3300035398 | Bacteria | 1820 |
| 271 | Ga0316582_0035873 | 3300036647 | Bacteria | 3065 |
| 272 | Ga0316582_0069879 | 3300036647 | Bacteria | 2271 |
| 273 | Ga0316584_0001293 | 3300036712 | Bacteria | 14772 |
| 274 | Ga0316584_0035559 | 3300036712 | Bacteria | 3696 |
| 275 | Ga0395899_0008826 | 3300037312 | Bacteria | 7759 |
| 276 | Ga0395899_0015433 | 3300037312 | Bacteria | 5823 |
| 277 | Ga0395900_0008453 | 3300037418 | Bacteria | 10584 |
| 278 | Ga0395900_0205433 | 3300037418 | Bacteria | 1991 |
| 279 | Ga0395898_0000256 | 3300037466 | Bacteria | 130878 |
| 280 | Ga0395898_0005536 | 3300037466 | Bacteria | 13627 |
| 281 | Ga0395898_0007727 | 3300037466 | Bacteria | 11416 |
| 282 | Ga0395898_0025008 | 3300037466 | Bacteria | 6020 |
| 283 | Ga0395898_0035997 | 3300037466 | Bacteria | 4919 |
| 284 | Ga0436364_0121658 | 3300037853 | Bacteria | 3655 |
| 285 | Ga0436364_0258391 | 3300037853 | Bacteria | 19221 |
| 286 | Ga0395901_0007406 | 3300038443 | Bacteria | 11074 |
| 287 | Ga0395901_0037134 | 3300038443 | Bacteria | 5039 |
| 288 | Ga0395901_0049733 | 3300038443 | Bacteria | 4356 |
| 289 | Ga0395901_0057386 | 3300038443 | Bacteria | 4049 |
| 290 | Ga0400485_14478 | 3300038735 | Bacteria | 11567 |
| 291 | Ga0400486_12313 | 3300038742 | Bacteria | 11748 |
| 292 | Ga0439436_0001355 | 3300041404 | Bacteria | 7049 |
| 293 | Ga0451837_0835599 | 3300041494 | Bacteria | 3047 |
| 294 | Ga0451841_0533336 | 3300041498 | Bacteria | 2225 |
| 295 | Ga0451853_2772043 | 3300041512 | Bacteria | 2096 |
| 296 | Ga0439431_0001742 | 3300041997 | Bacteria | 4796 |
| 297 | Ga0439445_0013224 | 3300042004 | Bacteria | 1996 |
| 298 | Ga0439448_0005088 | 3300042005 | Bacteria | 3738 |
| 299 | Ga0439449_0001993 | 3300042007 | Bacteria | 8026 |
| 300 | Ga0439455_0000218 | 3300042012 | Bacteria | 6811 |
| 301 | Ga0439457_000372 | 3300042014 | Bacteria | 12620 |
| 302 | Ga0439457_001355 | 3300042014 | Bacteria | 7367 |
| 303 | Ga0439462_0011765 | 3300042015 | Bacteria | 2231 |
| 304 | Ga0450898_000187 | 3300042134 | Bacteria | 6553 |
| 305 | Ga0450903_000107 | 3300042138 | Bacteria | 17718 |
| 306 | Ga0450906_000549 | 3300042145 | Bacteria | 7931 |
| 307 | Ga0439458_0000589 | 3300042157 | Bacteria | 9359 |
| 308 | Ga0439434_0014581 | 3300042435 | Bacteria | 2338 |
| 309 | Ga0439440_0001905 | 3300042993 | Bacteria | 3875 |
| 310 | Ga0439440_0006571 | 3300042993 | Bacteria | 2346 |
| 311 | Ga0466969_0002205 | 3300044656 | Bacteria | 10413 |
| 312 | Ga0466969_0003997 | 3300044656 | Bacteria | 7821 |
| 313 | Ga0466969_0045608 | 3300044656 | Bacteria | 2176 |
| 314 | Ga0466972_0007384 | 3300044658 | Bacteria | 5522 |
| 315 | Ga0466972_0011623 | 3300044658 | Bacteria | 4420 |
| 316 | Ga0466972_0032132 | 3300044658 | Bacteria | 2578 |
| 317 | Ga0466972_0070420 | 3300044658 | Bacteria | 1669 |
| 318 | Ga0466965_0011800 | 3300044683 | Bacteria | 4102 |
| 319 | Ga0466965_0068253 | 3300044683 | Bacteria | 1785 |
| 320 | Ga0466966_0002663 | 3300044684 | Bacteria | 11700 |
| 321 | Ga0466966_0004330 | 3300044684 | Bacteria | 9355 |
| 322 | Ga0466961_0002231 | 3300044693 | Bacteria | 12066 |
| 323 | Ga0466961_0002683 | 3300044693 | Bacteria | 11048 |
| 324 | Ga0466961_0005498 | 3300044693 | Bacteria | 7991 |
| 325 | Ga0466961_0007410 | 3300044693 | Bacteria | 6984 |
| 326 | Ga0466961_0050602 | 3300044693 | Bacteria | 2653 |
| 327 | Ga0466963_0006524 | 3300044694 | Bacteria | 6912 |
| 328 | Ga0466964_0000503 | 3300044706 | Bacteria | 12155 |
| 329 | Ga0466971_0017204 | 3300044719 | Bacteria | 3196 |
| 330 | Ga0466971_0046236 | 3300044719 | Bacteria | 1956 |
| 331 | Ga0466968_0011444 | 3300044735 | Bacteria | 3455 |
| 332 | Ga0466970_0000301 | 3300044765 | Bacteria | 24129 |
| 333 | Ga0466970_0002452 | 3300044765 | Bacteria | 8965 |
| 334 | Ga0466970_0003859 | 3300044765 | Bacteria | 7336 |
| 335 | Ga0466970_0041423 | 3300044765 | Bacteria | 2447 |
| 336 | Ga0466957_0002626 | 3300044842 | Bacteria | 9697 |
| 337 | Ga0466957_0005920 | 3300044842 | Bacteria | 6890 |
| 338 | Ga0466960_0007762 | 3300044901 | Bacteria | 4372 |
| 339 | Ga0466960_0010191 | 3300044901 | Bacteria | 3899 |
| 340 | Ga0466959_0000404 | 3300045049 | Bacteria | 25274 |
| 341 | Ga0466959_0032776 | 3300045049 | Bacteria | 3845 |
| 342 | Ga0466959_0047606 | 3300045049 | Bacteria | 3153 |
| 343 | Ga0466958_0006615 | 3300045836 | Bacteria | 6320 |
| 344 | Ga0466958_0008928 | 3300045836 | Bacteria | 5569 |
| 345 | Ga0466958_0033825 | 3300045836 | Bacteria | 3047 |
| 346 | Ga0466958_0062441 | 3300045836 | Bacteria | 2271 |
| 347 | Ga0466958_0067998 | 3300045836 | Bacteria | 2177 |
| 348 | Ga0466967_0019690 | 3300045976 | Bacteria | 5434 |
| 349 | Ga0466967_0037388 | 3300045976 | Bacteria | 4154 |
| 350 | Ga0466967_0091223 | 3300045976 | Bacteria | 2768 |
| 351 | Ga0466967_0127237 | 3300045976 | Bacteria | 2361 |
| 352 | Ga0466967_0152474 | 3300045976 | Bacteria | 2161 |
| 353 | Ga0466967_0199728 | 3300045976 | Bacteria | 1893 |
| 354 | Ga0495627_001243 | 3300046453 | Bacteria | 15864 |
| 355 | Ga0495627_009577 | 3300046453 | Bacteria | 3558 |
| 356 | Ga0495592_0001633 | 3300046454 | Bacteria | 15715 |
| 357 | Ga0495592_0013615 | 3300046454 | Bacteria | 6185 |
| 358 | Ga0495603_0000568 | 3300046455 | Bacteria | 20742 |
| 359 | Ga0495603_0000900 | 3300046455 | Bacteria | 17124 |
| 360 | Ga0495603_0001369 | 3300046455 | Bacteria | 14159 |
| 361 | Ga0495603_0002351 | 3300046455 | Bacteria | 11095 |
| 362 | Ga0495603_0005879 | 3300046455 | Bacteria | 7332 |
| 363 | Ga0495629_0002068 | 3300046459 | Bacteria | 15572 |
| 364 | Ga0495629_0004829 | 3300046459 | Bacteria | 10107 |
| 365 | Ga0495629_0012678 | 3300046459 | Bacteria | 6105 |
| 366 | Ga0495629_0047846 | 3300046459 | Bacteria | 2999 |
| 367 | Ga0495629_0054622 | 3300046459 | Bacteria | 2793 |
| 368 | Ga0495638_0049126 | 3300046460 | Bacteria | 2638 |
| 369 | Ga0495638_0084537 | 3300046460 | Bacteria | 1920 |
| 370 | Ga0495651_0049344 | 3300046462 | Bacteria | 3248 |
| 371 | Ga0495651_0080573 | 3300046462 | Bacteria | 2459 |
| 372 | Ga0495651_0082590 | 3300046462 | Bacteria | 2424 |
| 373 | Ga0495580_0077511 | 3300046472 | Bacteria | 2318 |
| 374 | Ga0495605_0002215 | 3300046474 | Bacteria | 12139 |
| 375 | Ga0495662_0000587 | 3300046476 | Bacteria | 16777 |
| 376 | Ga0495662_0001163 | 3300046476 | Bacteria | 12964 |
| 377 | Ga0495662_0034463 | 3300046476 | Bacteria | 2443 |
| 378 | Ga0495584_0027505 | 3300046491 | Bacteria | 2882 |
| 379 | Ga0495585_0015186 | 3300046492 | Bacteria | 4475 |
| 380 | Ga0495585_0044475 | 3300046492 | Bacteria | 2481 |
| 381 | Ga0495594_0004425 | 3300046499 | Bacteria | 7227 |
| 382 | Ga0495594_0025469 | 3300046499 | Bacteria | 3180 |
| 383 | Ga0495594_0048816 | 3300046499 | Bacteria | 2325 |
| 384 | Ga0495607_0026057 | 3300046501 | Bacteria | 3630 |
| 385 | Ga0495608_0022842 | 3300046511 | Bacteria | 4291 |
| 386 | Ga0495616_0008761 | 3300046513 | Bacteria | 5962 |
| 387 | Ga0495618_0053599 | 3300046514 | Bacteria | 2550 |
| 388 | Ga0495620_0003173 | 3300046515 | Bacteria | 9431 |
| 389 | Ga0495628_0008126 | 3300046516 | Bacteria | 9030 |
| 390 | Ga0495628_0010249 | 3300046516 | Bacteria | 7972 |
| 391 | Ga0495631_0005774 | 3300046518 | Bacteria | 6456 |
| 392 | Ga0495637_0033247 | 3300046520 | Bacteria | 2266 |
| 393 | Ga0495643_0002929 | 3300046522 | Bacteria | 12936 |
| 394 | Ga0495643_0007450 | 3300046522 | Bacteria | 7050 |
| 395 | Ga0495663_0022457 | 3300046525 | Bacteria | 1823 |
| 396 | Ga0495666_0001372 | 3300046526 | Bacteria | 11800 |
| 397 | Ga0495666_0018950 | 3300046526 | Bacteria | 3418 |
| 398 | Ga0495652_0016537 | 3300046529 | Bacteria | 6598 |
| 399 | Ga0495652_0032037 | 3300046529 | Bacteria | 4599 |
| 400 | Ga0495652_0035283 | 3300046529 | Bacteria | 4354 |
| 401 | Ga0495654_0010771 | 3300046530 | Bacteria | 4969 |
| 402 | Ga0495665_0019191 | 3300046531 | Bacteria | 3675 |
| 403 | Ga0495640_0029284 | 3300046533 | Bacteria | 3955 |
| 404 | Ga0495640_0053506 | 3300046533 | Bacteria | 2767 |
| 405 | Ga0495586_0021797 | 3300046535 | Bacteria | 3419 |
| 406 | Ga0495587_0002070 | 3300046536 | Bacteria | 13400 |
| 407 | Ga0495587_0013224 | 3300046536 | Bacteria | 5187 |
| 408 | Ga0495597_0006873 | 3300046542 | Bacteria | 5839 |
| 409 | Ga0495645_0004013 | 3300046543 | Bacteria | 10050 |
| 410 | Ga0495645_0004306 | 3300046543 | Bacteria | 9722 |
| 411 | Ga0495622_0003939 | 3300046557 | Bacteria | 6935 |
| 412 | Ga0495633_0016083 | 3300046558 | Bacteria | 3868 |
| 413 | Ga0495667_0022051 | 3300046559 | Bacteria | 4292 |
| 414 | Ga0495667_0054837 | 3300046559 | Bacteria | 2622 |
| 415 | Ga0495656_0032577 | 3300046615 | Bacteria | 2122 |
| 416 | Ga0495668_0006268 | 3300046616 | Bacteria | 7838 |
| 417 | Ga0495634_0000538 | 3300046642 | Bacteria | 37243 |
| 418 | Ga0495634_0012422 | 3300046642 | Bacteria | 6164 |
| 419 | Ga0495634_0101559 | 3300046642 | Bacteria | 1857 |
| 420 | Ga0495611_0031831 | 3300046648 | Bacteria | 2323 |
| 421 | Ga0495625_0007428 | 3300046660 | Bacteria | 9536 |
| 422 | Ga0495625_0020111 | 3300046660 | Bacteria | 5160 |
| 423 | Ga0495635_0027825 | 3300046663 | Bacteria | 3931 |
| 424 | Ga0495661_0014582 | 3300046665 | Bacteria | 5264 |
| 425 | Ga0495588_0006246 | 3300046674 | Bacteria | 5354 |
| 426 | Ga0495657_0002584 | 3300046675 | Bacteria | 15156 |
| 427 | Ga0495657_0003095 | 3300046675 | Bacteria | 13733 |
| 428 | Ga0495657_0016677 | 3300046675 | Bacteria | 5345 |
| 429 | Ga0495657_0088711 | 3300046675 | Bacteria | 1988 |
| 430 | Ga0495599_0012852 | 3300046678 | Bacteria | 5167 |
| 431 | Ga0495646_0000377 | 3300046680 | Bacteria | 23269 |
| 432 | Ga0495646_0001920 | 3300046680 | Bacteria | 12500 |
| 433 | Ga0495658_0010862 | 3300046683 | Bacteria | 4562 |
| 434 | Ga0495613_0003429 | 3300046689 | Bacteria | 11849 |
| 435 | Ga0495613_0013738 | 3300046689 | Bacteria | 6006 |
| 436 | Ga0495649_0023208 | 3300046694 | Bacteria | 3466 |
| 437 | Ga0495649_0032929 | 3300046694 | Bacteria | 2854 |
| 438 | Ga0495649_0058085 | 3300046694 | Bacteria | 2085 |
| 439 | Ga0495589_0014667 | 3300046794 | Bacteria | 4032 |
| 440 | Ga0495600_0008571 | 3300046809 | Bacteria | 6287 |
| 441 | Ga0495660_0018871 | 3300046810 | Bacteria | 3959 |
| 442 | Ga0495604_0000208 | 3300047317 | Bacteria | 53826 |
| 443 | Ga0495604_0000705 | 3300047317 | Bacteria | 28417 |
| 444 | Ga0495604_0017173 | 3300047317 | Bacteria | 5789 |
| 445 | Ga0495604_0047728 | 3300047317 | Bacteria | 3334 |
| 446 | Ga0495604_0096871 | 3300047317 | Bacteria | 2176 |
| 447 | Ga0495674_0007626 | 3300047319 | Bacteria | 10338 |
| 448 | Ga0495676_0003615 | 3300047321 | Bacteria | 14031 |
| 449 | Ga0495676_0005286 | 3300047321 | Bacteria | 11820 |
| 450 | Ga0495676_0005604 | 3300047321 | Bacteria | 11511 |
| 451 | Ga0495676_0006839 | 3300047321 | Bacteria | 10480 |
| 452 | Ga0495676_0007821 | 3300047321 | Bacteria | 9808 |
| 453 | Ga0495683_0020101 | 3300047323 | Bacteria | 3446 |
| 454 | Ga0495687_002090 | 3300047443 | Bacteria | 16780 |
| 455 | Ga0495687_007214 | 3300047443 | Bacteria | 6604 |
| 456 | Ga0495687_010803 | 3300047443 | Bacteria | 4970 |
| 457 | Ga0495675_0008267 | 3300047444 | Bacteria | 6439 |
| 458 | Ga0495675_0017903 | 3300047444 | Bacteria | 4491 |
| 459 | Ga0495685_001626 | 3300047447 | Bacteria | 6935 |
| 460 | Ga0495681_0001415 | 3300047470 | Bacteria | 18048 |
| 461 | Ga0495681_0004205 | 3300047470 | Bacteria | 9870 |
| 462 | Ga0495686_0012334 | 3300047472 | Bacteria | 5983 |
| 463 | Ga0495593_0005711 | 3300047673 | Bacteria | 7344 |
| 464 | Ga0495614_0030369 | 3300048089 | Bacteria | 2325 |
| 465 | Ga0496100_0010739 | 3300048903 | Bacteria | 5193 |
| 466 | Ga0496102_0002970 | 3300048905 | Bacteria | 14356 |
| 467 | Ga0496102_0047416 | 3300048905 | Bacteria | 3904 |
| 468 | Ga0496103_0034498 | 3300048906 | Bacteria | 3094 |
| 469 | Ga0496104_0043331 | 3300048907 | Bacteria | 4227 |
| 470 | Ga0496104_0053048 | 3300048907 | Bacteria | 3830 |
| 471 | Ga0496104_0106519 | 3300048907 | Bacteria | 2687 |
| 472 | Ga0496104_0201815 | 3300048907 | Bacteria | 1900 |
| 473 | Ga0496105_0000534 | 3300048908 | Bacteria | 25137 |
| 474 | Ga0496105_0027549 | 3300048908 | Bacteria | 4643 |
| 475 | Ga0496105_0028414 | 3300048908 | Bacteria | 4572 |
| 476 | Ga0496105_0030463 | 3300048908 | Bacteria | 4421 |
| 477 | Ga0496105_0077904 | 3300048908 | Bacteria | 2737 |
| 478 | Ga0496106_0035149 | 3300048909 | Bacteria | 3746 |
| 479 | Ga0496106_0092415 | 3300048909 | Bacteria | 2337 |
| 480 | Ga0496107_0019118 | 3300048910 | Bacteria | 4832 |
| 481 | Ga0496108_0020574 | 3300048911 | Bacteria | 5423 |
| 482 | Ga0496109_0019567 | 3300048912 | Bacteria | 5973 |
| 483 | Ga0496109_0034841 | 3300048912 | Bacteria | 4537 |
| 484 | Ga0496109_0063845 | 3300048912 | Bacteria | 3368 |
| 485 | Ga0496109_0082608 | 3300048912 | Bacteria | 2961 |
| 486 | Ga0496110_0004386 | 3300048913 | Bacteria | 10930 |
| 487 | Ga0496110_0061572 | 3300048913 | Bacteria | 3313 |
| 488 | Ga0496110_0116103 | 3300048913 | Bacteria | 2409 |
| 489 | Ga0496111_0000126 | 3300048914 | Bacteria | 33612 |
| 490 | Ga0496111_0000658 | 3300048914 | Bacteria | 18162 |
| 491 | Ga0496111_0060026 | 3300048914 | Bacteria | 2756 |
| 492 | Ga0496111_0084710 | 3300048914 | Bacteria | 2317 |
| 493 | Ga0496112_0040976 | 3300048915 | Bacteria | 4530 |
| 494 | Ga0496113_0024211 | 3300048916 | Bacteria | 4312 |
| 495 | Ga0496114_0015739 | 3300048917 | Bacteria | 6086 |
| 496 | Ga0496114_0059098 | 3300048917 | Bacteria | 3202 |
| 497 | Ga0496114_0061188 | 3300048917 | Bacteria | 3148 |
| 498 | Ga0496114_0105340 | 3300048917 | Bacteria | 2412 |
| 499 | Ga0496114_0207053 | 3300048917 | Bacteria | 1719 |
| 500 | Ga0496115_0003839 | 3300048918 | Bacteria | 10829 |
| 501 | Ga0496115_0006870 | 3300048918 | Bacteria | 8358 |
| 502 | Ga0496117_0000063 | 3300048920 | Bacteria | 254446 |
| 503 | Ga0496117_0000187 | 3300048920 | Bacteria | 127214 |
| 504 | Ga0496117_0003329 | 3300048920 | Bacteria | 18771 |
| 505 | Ga0496117_0044395 | 3300048920 | Bacteria | 3220 |
| 506 | Ga0496118_0004280 | 3300048921 | Bacteria | 17078 |
| 507 | Ga0496118_0025687 | 3300048921 | Bacteria | 5041 |
| 508 | Ga0496119_0002444 | 3300048922 | Bacteria | 20396 |
| 509 | Ga0496120_0000251 | 3300048923 | Bacteria | 90074 |
| 510 | Ga0496120_0001031 | 3300048923 | Bacteria | 37261 |
| 511 | Ga0496120_0007526 | 3300048923 | Bacteria | 8085 |
| 512 | Ga0496120_0012607 | 3300048923 | Bacteria | 5741 |
| 513 | Ga0496122_0000982 | 3300048925 | Bacteria | 50962 |
| 514 | Ga0496122_0001743 | 3300048925 | Bacteria | 33627 |
| 515 | Ga0496122_0026240 | 3300048925 | Bacteria | 5030 |
| 516 | Ga0496123_0005044 | 3300048926 | Bacteria | 13507 |
| 517 | Ga0496124_0059237 | 3300048927 | Bacteria | 3217 |
| 518 | Ga0496125_0000015 | 3300048928 | Bacteria | 516648 |
| 519 | Ga0496125_0000192 | 3300048928 | Bacteria | 130383 |
| 520 | Ga0496125_0006673 | 3300048928 | Bacteria | 12423 |
| 521 | Ga0496125_0058909 | 3300048928 | Bacteria | 3099 |
| 522 | Ga0496126_0001780 | 3300048929 | Bacteria | 31816 |
| 523 | Ga0496126_0005300 | 3300048929 | Bacteria | 14799 |
| 524 | Ga0496126_0079387 | 3300048929 | Bacteria | 2905 |
| 525 | Ga0501310_000142 | 3300049130 | Bacteria | 7123 |
| 526 | Ga0495678_013219 | 3300049459 | Bacteria | 3884 |
| 527 | Ga0495682_0035457 | 3300049460 | Bacteria | 1838 |
| 528 | Ga0501031_0000150 | 3300049568 | Bacteria | 39354 |
| 529 | Ga0501031_0020631 | 3300049568 | Bacteria | 4296 |
| 530 | Ga0501031_0034789 | 3300049568 | Bacteria | 3287 |
| 531 | Ga0501031_0061773 | 3300049568 | Bacteria | 2441 |
| 532 | Ga0501031_0112861 | 3300049568 | Bacteria | 1775 |
| 533 | Ga0501032_0000101 | 3300049569 | Bacteria | 72620 |
| 534 | Ga0501032_0007906 | 3300049569 | Bacteria | 7741 |
| 535 | Ga0501032_0009201 | 3300049569 | Bacteria | 7162 |
| 536 | Ga0501032_0025058 | 3300049569 | Bacteria | 4114 |
| 537 | Ga0501032_0026687 | 3300049569 | Bacteria | 3970 |
| 538 | Ga0501032_0044961 | 3300049569 | Bacteria | 2987 |
| 539 | Ga0501032_0055216 | 3300049569 | Bacteria | 2672 |
| 540 | Ga0501032_0085590 | 3300049569 | Bacteria | 2095 |
| 541 | Ga0501033_0000373 | 3300049570 | Bacteria | 42856 |
| 542 | Ga0501033_0006214 | 3300049570 | Bacteria | 9363 |
| 543 | Ga0501033_0006684 | 3300049570 | Bacteria | 9010 |
| 544 | Ga0501033_0007978 | 3300049570 | Bacteria | 8200 |
| 545 | Ga0501033_0010371 | 3300049570 | Bacteria | 7148 |
| 546 | Ga0501033_0021259 | 3300049570 | Bacteria | 4895 |
| 547 | Ga0501033_0025673 | 3300049570 | Bacteria | 4438 |
| 548 | Ga0501033_0044387 | 3300049570 | Bacteria | 3309 |
| 549 | Ga0501034_0001646 | 3300049571 | Bacteria | 28850 |
| 550 | Ga0501034_0002967 | 3300049571 | Bacteria | 19661 |
| 551 | Ga0501034_0006214 | 3300049571 | Bacteria | 12856 |
| 552 | Ga0501034_0008198 | 3300049571 | Bacteria | 11077 |
| 553 | Ga0501034_0030124 | 3300049571 | Bacteria | 5515 |
| 554 | Ga0501034_0052016 | 3300049571 | Bacteria | 4129 |
| 555 | Ga0501034_0087533 | 3300049571 | Bacteria | 3114 |
| 556 | Ga0501034_0104433 | 3300049571 | Bacteria | 2826 |
| 557 | Ga0501034_0115758 | 3300049571 | Bacteria | 2669 |
| 558 | Ga0501036_0008125 | 3300049572 | Bacteria | 8600 |
| 559 | Ga0501036_0009768 | 3300049572 | Bacteria | 7901 |
| 560 | Ga0501036_0009984 | 3300049572 | Bacteria | 7818 |
| 561 | Ga0501036_0019288 | 3300049572 | Bacteria | 5723 |
| 562 | Ga0501036_0019839 | 3300049572 | Bacteria | 5645 |
| 563 | Ga0501036_0027031 | 3300049572 | Bacteria | 4848 |
| 564 | Ga0501036_0043223 | 3300049572 | Bacteria | 3815 |
| 565 | Ga0501036_0051342 | 3300049572 | Bacteria | 3491 |
| 566 | Ga0501036_0063006 | 3300049572 | Bacteria | 3140 |
| 567 | Ga0501036_0090298 | 3300049572 | Bacteria | 2588 |
| 568 | Ga0501037_0000287 | 3300049573 | Bacteria | 42841 |
| 569 | Ga0501037_0001612 | 3300049573 | Bacteria | 16391 |
| 570 | Ga0501037_0002493 | 3300049573 | Bacteria | 13298 |
| 571 | Ga0501037_0007483 | 3300049573 | Bacteria | 7991 |
| 572 | Ga0501037_0014649 | 3300049573 | Bacteria | 5770 |
| 573 | Ga0501037_0067903 | 3300049573 | Bacteria | 2595 |
| 574 | Ga0501037_0078929 | 3300049573 | Bacteria | 2389 |
| 575 | Ga0501037_0089567 | 3300049573 | Bacteria | 2226 |
| 576 | Ga0501038_0000125 | 3300049574 | Bacteria | 64770 |
| 577 | Ga0501038_0003501 | 3300049574 | Bacteria | 14615 |
| 578 | Ga0501038_0005244 | 3300049574 | Bacteria | 12048 |
| 579 | Ga0501038_0017750 | 3300049574 | Bacteria | 6431 |
| 580 | Ga0501038_0026104 | 3300049574 | Bacteria | 5203 |
| 581 | Ga0501038_0048118 | 3300049574 | Bacteria | 3691 |
| 582 | Ga0501038_0055070 | 3300049574 | Bacteria | 3418 |
| 583 | Ga0501038_0067130 | 3300049574 | Bacteria | 3052 |
| 584 | Ga0501038_0089180 | 3300049574 | Bacteria | 2587 |
| 585 | Ga0501038_0134163 | 3300049574 | Bacteria | 2030 |
| 586 | Ga0501039_0000086 | 3300049575 | Bacteria | 70210 |
| 587 | Ga0501039_0012289 | 3300049575 | Bacteria | 6529 |
| 588 | Ga0501039_0023860 | 3300049575 | Bacteria | 4696 |
| 589 | Ga0501039_0032375 | 3300049575 | Bacteria | 4030 |
| 590 | Ga0501039_0038612 | 3300049575 | Bacteria | 3687 |
| 591 | Ga0501039_0054131 | 3300049575 | Bacteria | 3106 |
| 592 | Ga0501039_0075308 | 3300049575 | Bacteria | 2623 |
| 593 | Ga0501040_0001847 | 3300049576 | Bacteria | 13592 |
| 594 | Ga0501040_0004044 | 3300049576 | Bacteria | 9534 |
| 595 | Ga0501040_0004700 | 3300049576 | Bacteria | 8865 |
| 596 | Ga0501040_0065715 | 3300049576 | Bacteria | 2499 |
| 597 | Ga0501040_0072055 | 3300049576 | Bacteria | 2386 |
| 598 | Ga0501041_0001255 | 3300049577 | Bacteria | 13920 |
| 599 | Ga0501041_0011207 | 3300049577 | Bacteria | 5295 |
| 600 | Ga0501041_0015065 | 3300049577 | Bacteria | 4592 |
| 601 | Ga0501042_0002756 | 3300049578 | Bacteria | 10848 |
| 602 | Ga0501042_0005112 | 3300049578 | Bacteria | 8421 |
| 603 | Ga0501042_0011371 | 3300049578 | Bacteria | 6006 |
| 604 | Ga0501042_0030318 | 3300049578 | Bacteria | 3819 |
| 605 | Ga0501042_0054966 | 3300049578 | Bacteria | 2840 |
| 606 | Ga0501042_0073307 | 3300049578 | Bacteria | 2449 |
| 607 | Ga0501043_0000098 | 3300049579 | Bacteria | 79426 |
| 608 | Ga0501043_0003443 | 3300049579 | Bacteria | 12999 |
| 609 | Ga0501043_0008977 | 3300049579 | Bacteria | 7867 |
| 610 | Ga0501043_0016590 | 3300049579 | Bacteria | 5772 |
| 611 | Ga0501043_0018266 | 3300049579 | Bacteria | 5498 |
| 612 | Ga0501043_0039478 | 3300049579 | Bacteria | 3709 |
| 613 | Ga0501043_0077718 | 3300049579 | Bacteria | 2607 |
| 614 | Ga0501043_0101861 | 3300049579 | Bacteria | 2257 |
| 615 | Ga0501043_0132321 | 3300049579 | Bacteria | 1954 |
| 616 | Ga0501046_0000160 | 3300049580 | Bacteria | 70083 |
| 617 | Ga0501046_0000982 | 3300049580 | Bacteria | 27848 |
| 618 | Ga0501046_0005851 | 3300049580 | Bacteria | 10964 |
| 619 | Ga0501046_0007054 | 3300049580 | Bacteria | 9893 |
| 620 | Ga0501046_0019912 | 3300049580 | Bacteria | 5557 |
| 621 | Ga0501046_0021972 | 3300049580 | Bacteria | 5258 |
| 622 | Ga0501046_0039506 | 3300049580 | Bacteria | 3778 |
| 623 | Ga0501046_0060243 | 3300049580 | Bacteria | 2970 |
| 624 | Ga0501046_0075575 | 3300049580 | Bacteria | 2611 |
| 625 | Ga0501046_0118369 | 3300049580 | Bacteria | 2017 |
| 626 | Ga0501046_0147897 | 3300049580 | Bacteria | 1773 |
| 627 | Ga0501047_0000033 | 3300049581 | Bacteria | 206961 |
| 628 | Ga0501047_0000496 | 3300049581 | Bacteria | 42628 |
| 629 | Ga0501047_0001456 | 3300049581 | Bacteria | 23127 |
| 630 | Ga0501047_0011926 | 3300049581 | Bacteria | 8225 |
| 631 | Ga0501047_0017804 | 3300049581 | Bacteria | 6805 |
| 632 | Ga0501047_0021359 | 3300049581 | Bacteria | 6213 |
| 633 | Ga0501047_0023804 | 3300049581 | Bacteria | 5879 |
| 634 | Ga0501047_0026519 | 3300049581 | Bacteria | 5575 |
| 635 | Ga0501047_0035672 | 3300049581 | Bacteria | 4804 |
| 636 | Ga0501047_0044079 | 3300049581 | Bacteria | 4308 |
| 637 | Ga0501047_0080339 | 3300049581 | Bacteria | 3134 |
| 638 | Ga0501047_0099911 | 3300049581 | Bacteria | 2780 |
| 639 | Ga0501047_0217690 | 3300049581 | Bacteria | 1766 |
| 640 | Ga0501048_0000364 | 3300049582 | Bacteria | 31338 |
| 641 | Ga0501048_0000461 | 3300049582 | Bacteria | 28501 |
| 642 | Ga0501048_0004238 | 3300049582 | Bacteria | 10929 |
| 643 | Ga0501048_0005799 | 3300049582 | Bacteria | 9391 |
| 644 | Ga0501048_0008484 | 3300049582 | Bacteria | 7769 |
| 645 | Ga0501048_0022584 | 3300049582 | Bacteria | 4601 |
| 646 | Ga0501048_0040358 | 3300049582 | Bacteria | 3345 |
| 647 | Ga0501048_0070547 | 3300049582 | Bacteria | 2467 |
| 648 | Ga0501048_0082826 | 3300049582 | Bacteria | 2262 |
| 649 | Ga0501067_0003318 | 3300049583 | Bacteria | 8853 |
| 650 | Ga0501067_0005483 | 3300049583 | Bacteria | 7035 |
| 651 | Ga0501067_0044920 | 3300049583 | Bacteria | 2454 |
| 652 | Ga0501068_0004509 | 3300049584 | Bacteria | 7579 |
| 653 | Ga0501068_0014086 | 3300049584 | Bacteria | 4565 |
| 654 | Ga0501068_0030429 | 3300049584 | Bacteria | 3202 |
| 655 | Ga0501068_0051515 | 3300049584 | Bacteria | 2490 |
| 656 | Ga0501069_0000178 | 3300049585 | Bacteria | 28624 |
| 657 | Ga0501069_0011669 | 3300049585 | Bacteria | 4658 |
| 658 | Ga0501070_0000306 | 3300049586 | Bacteria | 45155 |
| 659 | Ga0501070_0002053 | 3300049586 | Bacteria | 17681 |
| 660 | Ga0501070_0009626 | 3300049586 | Bacteria | 8166 |
| 661 | Ga0501070_0020337 | 3300049586 | Bacteria | 5569 |
| 662 | Ga0501070_0021914 | 3300049586 | Bacteria | 5353 |
| 663 | Ga0501070_0034872 | 3300049586 | Bacteria | 4205 |
| 664 | Ga0501070_0036781 | 3300049586 | Bacteria | 4088 |
| 665 | Ga0501070_0038268 | 3300049586 | Bacteria | 4002 |
| 666 | Ga0501070_0071495 | 3300049586 | Bacteria | 2872 |
| 667 | Ga0501070_0105502 | 3300049586 | Bacteria | 2329 |
| 668 | Ga0501071_0002907 | 3300049587 | Bacteria | 10567 |
| 669 | Ga0501071_0007246 | 3300049587 | Bacteria | 7261 |
| 670 | Ga0501071_0010676 | 3300049587 | Bacteria | 6161 |
| 671 | Ga0501071_0144982 | 3300049587 | Bacteria | 1770 |
| 672 | Ga0501072_0001898 | 3300049588 | Bacteria | 15570 |
| 673 | Ga0501072_0004789 | 3300049588 | Bacteria | 10309 |
| 674 | Ga0501072_0043624 | 3300049588 | Bacteria | 3525 |
| 675 | Ga0501073_0011973 | 3300049589 | Bacteria | 6332 |
| 676 | Ga0501073_0063935 | 3300049589 | Bacteria | 2566 |
| 677 | Ga0501074_0000058 | 3300049590 | Bacteria | 55082 |
| 678 | Ga0501074_0005958 | 3300049590 | Bacteria | 8793 |
| 679 | Ga0501074_0008098 | 3300049590 | Bacteria | 7615 |
| 680 | Ga0501074_0008131 | 3300049590 | Bacteria | 7602 |
| 681 | Ga0501074_0010701 | 3300049590 | Bacteria | 6662 |
| 682 | Ga0501074_0019956 | 3300049590 | Bacteria | 4870 |
| 683 | Ga0501075_0002633 | 3300049591 | Bacteria | 11988 |
| 684 | Ga0501075_0051482 | 3300049591 | Bacteria | 3096 |
| 685 | Ga0501075_0071812 | 3300049591 | Bacteria | 2616 |
| 686 | Ga0501075_0097485 | 3300049591 | Bacteria | 2231 |
| 687 | Ga0501076_0007334 | 3300049592 | Bacteria | 8025 |
| 688 | Ga0501076_0069645 | 3300049592 | Bacteria | 2811 |
| 689 | Ga0501076_0085437 | 3300049592 | Bacteria | 2535 |
| 690 | Ga0501077_0057380 | 3300049593 | Bacteria | 2472 |
| 691 | Ga0501077_0071697 | 3300049593 | Bacteria | 2196 |
| 692 | Ga0501077_0080723 | 3300049593 | Bacteria | 2060 |
| 693 | Ga0501235_013165 | 3300049669 | Bacteria | 1820 |
| 694 | Ga0501079_0003415 | 3300049741 | Bacteria | 11668 |
| 695 | Ga0501079_0010459 | 3300049741 | Bacteria | 7054 |
| 696 | Ga0501079_0062456 | 3300049741 | Bacteria | 2874 |
| 697 | Ga0501079_0158442 | 3300049741 | Bacteria | 1764 |
| 698 | Ga0501080_0000422 | 3300049742 | Bacteria | 32596 |
| 699 | Ga0501080_0010612 | 3300049742 | Bacteria | 8431 |
| 700 | Ga0501080_0013624 | 3300049742 | Bacteria | 7487 |
| 701 | Ga0501080_0020214 | 3300049742 | Bacteria | 6164 |
| 702 | Ga0501080_0074258 | 3300049742 | Bacteria | 3163 |
| 703 | Ga0501080_0140922 | 3300049742 | Bacteria | 2229 |
| 704 | Ga0501081_0054786 | 3300049743 | Bacteria | 2755 |
| 705 | Ga0501083_0001087 | 3300049744 | Bacteria | 18169 |
| 706 | Ga0501083_0017995 | 3300049744 | Bacteria | 4928 |
| 707 | Ga0501035_0000811 | 3300049822 | Bacteria | 33343 |
| 708 | Ga0501035_0001535 | 3300049822 | Bacteria | 23505 |
| 709 | Ga0501035_0011346 | 3300049822 | Bacteria | 8259 |
| 710 | Ga0501035_0024176 | 3300049822 | Bacteria | 5573 |
| 711 | Ga0501035_0030934 | 3300049822 | Bacteria | 4876 |
| 712 | Ga0501035_0044866 | 3300049822 | Bacteria | 3978 |
| 713 | Ga0501035_0046327 | 3300049822 | Bacteria | 3911 |
| 714 | Ga0501035_0063533 | 3300049822 | Bacteria | 3283 |
| 715 | Ga0501035_0065804 | 3300049822 | Bacteria | 3217 |
| 716 | Ga0501035_0085074 | 3300049822 | Bacteria | 2788 |
| 717 | Ga0501035_0097201 | 3300049822 | Bacteria | 2586 |
| 718 | Ga0501035_0104129 | 3300049822 | Bacteria | 2488 |
| 719 | Ga0501035_0146795 | 3300049822 | Bacteria | 2048 |
| 720 | Ga0501044_0000276 | 3300049823 | Bacteria | 65263 |
| 721 | Ga0501044_0001017 | 3300049823 | Bacteria | 33729 |
| 722 | Ga0501044_0004643 | 3300049823 | Bacteria | 15371 |
| 723 | Ga0501044_0007550 | 3300049823 | Bacteria | 11953 |
| 724 | Ga0501044_0017122 | 3300049823 | Bacteria | 7778 |
| 725 | Ga0501044_0030625 | 3300049823 | Bacteria | 5669 |
| 726 | Ga0501044_0045856 | 3300049823 | Bacteria | 4527 |
| 727 | Ga0501044_0073855 | 3300049823 | Bacteria | 3465 |
| 728 | Ga0501044_0119261 | 3300049823 | Bacteria | 2640 |
| 729 | Ga0501044_0146819 | 3300049823 | Bacteria | 2343 |
| 730 | Ga0501044_0250431 | 3300049823 | Bacteria | 1712 |
| 731 | Ga0501045_0001513 | 3300049824 | Bacteria | 15469 |
| 732 | Ga0501045_0006789 | 3300049824 | Bacteria | 7927 |
| 733 | Ga0501045_0055962 | 3300049824 | Bacteria | 2885 |
| 734 | Ga0501045_0066916 | 3300049824 | Bacteria | 2637 |
| 735 | Ga0501045_0091589 | 3300049824 | Bacteria | 2247 |
| 736 | nmdc:mga00v17_34878_c1 | 3300050491 | Bacteria | 2992 |
| 737 | nmdc:mga00v17_8493_c1 | 3300050491 | Bacteria | 5527 |
| 738 | nmdc:mga0yw44_132422_c1 | 3300050492 | Bacteria | 1615 |
| 739 | nmdc:mga0yw44_25771_c1 | 3300050492 | Bacteria | 3350 |
| 740 | nmdc:mga0yw44_62861_c1 | 3300050492 | Bacteria | 2281 |
| 741 | nmdc:mga06z11_12973_c1 | 3300050494 | Bacteria | 3642 |
| 742 | nmdc:mga06z11_16123_c1 | 3300050494 | Bacteria | 3357 |
| 743 | nmdc:mga04h51_1118_c1 | 3300050495 | Bacteria | 6179 |
| 744 | nmdc:mga04h51_2319_c1 | 3300050495 | Bacteria | 4503 |
| 745 | nmdc:mga09592_9784_c1 | 3300050508 | Bacteria | 7791 |
| 746 | nmdc:mga0qj67_38124_c1 | 3300050509 | Bacteria | 3769 |
| 747 | nmdc:mga06r32_115899_c1 | 3300050510 | Bacteria | 2639 |
| 748 | nmdc:mga08y16_20013_c1 | 3300050511 | Bacteria | 7060 |
| 749 | nmdc:mga0n895_9738_c1 | 3300050512 | Bacteria | 8429 |
| 750 | nmdc:mga0rr50_143841_c1 | 3300050513 | Bacteria | 1921 |
| 751 | nmdc:mga0rr50_1865_c1 | 3300050513 | Bacteria | 11701 |
| 752 | nmdc:mga0a205_1103_c1 | 3300050515 | Bacteria | 22399 |
| 753 | nmdc:mga0a205_620_c1 | 3300050515 | Bacteria | 24349 |
| 754 | nmdc:mga0sz30_10166_c1 | 3300050516 | Bacteria | 3599 |
| 755 | Ga0495612_0007274 | 3300053078 | Bacteria | 4530 |
| 756 | Ga0500635_0000064 | 3300053080 | Bacteria | 70317 |
| 757 | Ga0495619_0010199 | 3300053085 | Bacteria | 5918 |
| 758 | Ga0495619_0047694 | 3300053085 | Bacteria | 2822 |
| 759 | Ga0495619_0055148 | 3300053085 | Bacteria | 2632 |
| 760 | Ga0500643_000341 | 3300053087 | Bacteria | 37015 |
| 761 | Ga0500644_0000206 | 3300053088 | Bacteria | 35341 |
| 762 | Ga0500644_0013971 | 3300053088 | Bacteria | 2255 |
| 763 | Ga0500566_0034520 | 3300053094 | Bacteria | 2943 |
| 764 | Ga0500650_0000299 | 3300053098 | Bacteria | 11951 |
| 765 | Ga0500556_0000028 | 3300053104 | Bacteria | 165503 |
| 766 | Ga0500556_0000394 | 3300053104 | Bacteria | 32021 |
| 767 | Ga0500556_0002167 | 3300053104 | Bacteria | 6630 |
| 768 | Ga0500569_006125 | 3300053109 | Bacteria | 2624 |
| 769 | Ga0500593_006281 | 3300053117 | Bacteria | 4745 |
| 770 | Ga0500652_015492 | 3300053131 | Bacteria | 2752 |
| 771 | Ga0500655_001147 | 3300053133 | Bacteria | 5042 |
| 772 | Ga0500658_0007305 | 3300053134 | Bacteria | 4080 |
| 773 | Ga0500559_0000648 | 3300053136 | Bacteria | 23461 |
| 774 | Ga0500561_0000279 | 3300053137 | Bacteria | 8940 |
| 775 | Ga0500568_0000009 | 3300053139 | Bacteria | 270298 |
| 776 | Ga0500573_0033476 | 3300053140 | Bacteria | 2966 |
| 777 | Ga0500577_0003729 | 3300053142 | Bacteria | 3967 |
| 778 | Ga0500588_0008843 | 3300053146 | Bacteria | 2371 |
| 779 | Ga0500600_0005651 | 3300053149 | Bacteria | 7391 |
| 780 | Ga0500616_0066684 | 3300053153 | Bacteria | 1847 |
| 781 | Ga0500645_006544 | 3300053730 | Bacteria | 4142 |
| 782 | Ga0501084_0000959 | 3300054114 | Bacteria | 22332 |
| 783 | Ga0501084_0015340 | 3300054114 | Bacteria | 6352 |
| 784 | Ga0501084_0020023 | 3300054114 | Bacteria | 5578 |
| 785 | Ga0501084_0025824 | 3300054114 | Bacteria | 4899 |
| 786 | Ga0501084_0075315 | 3300054114 | Bacteria | 2827 |
| 787 | Ga0501084_0158677 | 3300054114 | Bacteria | 1908 |
| 788 | Ga0501082_0005284 | 3300060353 | Bacteria | 11225 |
| 789 | Ga0501082_0017650 | 3300060353 | Bacteria | 6146 |
| 790 | Ga0501082_0050691 | 3300060353 | Bacteria | 3579 |
| 791 | Ga0501082_0075521 | 3300060353 | Bacteria | 2903 |
| 792 | Ga0501082_0101392 | 3300060353 | Bacteria | 2490 |
| 793 | Ga0466962_0009517 | 3300061719 | Bacteria | 4660 |
| 794 | Ga0466962_0014116 | 3300061719 | Bacteria | 3849 |
| 795 | Ga0466962_0021270 | 3300061719 | Bacteria | 3116 |
| 796 | Ga0466962_0036312 | 3300061719 | Bacteria | 2358 |
| 797 | Ga0530510_0003072 | 3300061734 | Bacteria | 11468 |
| 798 | Ga0530510_0069102 | 3300061734 | Bacteria | 2563 |
| 799 | Ga0530510_0070232 | 3300061734 | Bacteria | 2542 |
| 800 | Ga0530510_0134374 | 3300061734 | Bacteria | 1821 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025302 | Ga0207426_1009898 | Ga0207426_10098982 | 489 |
| 2 | 3300049130 | Ga0501310_000142 | Ga0501310_000142_5410_6894 | 489 |
| 3 | 3300041512 | Ga0451853_2772043 | Ga0451853_2772043_35_1696 | 491 |
| 4 | iso_pu_bacteria | 2912723979 | 2912724303 | 495 |
| 5 | 3300031616 | Ga0307508_10003106 | Ga0307508_100031063 | 496 |
| 6 | 3300037853 | Ga0436364_0258391 | Ga0436364_0258391_2551_4206 | 497 |
| 7 | 3300053153 | Ga0500616_0066684 | Ga0500616_0066684_10_1527 | 501 |
| 8 | 3300050492 | nmdc:mga0yw44_132422_c1 | nmdc:mga0yw44_132422_c1_37_1551 | 504 |
| 9 | 3300031649 | Ga0307514_10079343 | Ga0307514_100793432 | 505 |
| 10 | 3300025735 | Ga0207713_1033608 | Ga0207713_10336082 | 508 |
| 11 | 3300025907 | Ga0207645_10000233 | Ga0207645_1000023312 | 508 |
| 12 | 3300025925 | Ga0207650_10096742 | Ga0207650_100967422 | 508 |
| 13 | 3300025940 | Ga0207691_10010786 | Ga0207691_100107865 | 508 |
| 14 | 3300026121 | Ga0207683_10003907 | Ga0207683_100039075 | 508 |
| 15 | 3300048927 | Ga0496124_0059237 | Ga0496124_0059237_1227_2873 | 508 |
| 16 | 3300049570 | Ga0501033_0007978 | Ga0501033_0007978_4145_5827 | 511 |
| 17 | 3300050516 | nmdc:mga0sz30_10166_c1 | nmdc:mga0sz30_10166_c1_15_1583 | 518 |
| 18 | 3300046675 | Ga0495657_0088711 | Ga0495657_0088711_103_1668 | 519 |
| 19 | 3300002773 | JGI25152J39213_1000323 | JGI25152J39213_10003239 | 524 |
| 20 | 3300025258 | Ga0209129_1000109 | Ga0209129_100010970 | 524 |
| 21 | 3300025294 | Ga0209025_1000984 | Ga0209025_100098438 | 524 |
| 22 | 3300042435 | Ga0439434_0014581 | Ga0439434_0014581_742_2319 | 525 |
| 23 | 3300031548 | Ga0307408_100004432 | Ga0307408_1000044327 | 527 |
| 24 | 3300031731 | Ga0307405_10017059 | Ga0307405_100170591 | 527 |
| 25 | 3300031824 | Ga0307413_10001475 | Ga0307413_100014756 | 527 |
| 26 | 3300031852 | Ga0307410_10003801 | Ga0307410_100038017 | 527 |
| 27 | 3300031852 | Ga0307410_10006902 | Ga0307410_100069022 | 527 |
| 28 | 3300031901 | Ga0307406_10063448 | Ga0307406_100634482 | 527 |
| 29 | 3300031903 | Ga0307407_10008074 | Ga0307407_100080741 | 527 |
| 30 | 3300031911 | Ga0307412_10023926 | Ga0307412_100239262 | 527 |
| 31 | 3300031911 | Ga0307412_10049198 | Ga0307412_100491982 | 527 |
| 32 | 3300031995 | Ga0307409_100013785 | Ga0307409_1000137854 | 527 |
| 33 | 3300031995 | Ga0307409_100055061 | Ga0307409_1000550612 | 527 |
| 34 | 3300031995 | Ga0307409_100101957 | Ga0307409_1001019571 | 527 |
| 35 | 3300032002 | Ga0307416_100014102 | Ga0307416_1000141024 | 527 |
| 36 | 3300032004 | Ga0307414_10001749 | Ga0307414_100017493 | 527 |
| 37 | 3300032004 | Ga0307414_10090288 | Ga0307414_100902881 | 527 |
| 38 | 3300032005 | Ga0307411_10005549 | Ga0307411_100055494 | 527 |
| 39 | 3300049568 | Ga0501031_0034789 | Ga0501031_0034789_814_2457 | 528 |
| 40 | 3300049570 | Ga0501033_0006684 | Ga0501033_0006684_2376_4019 | 528 |
| 41 | 3300049574 | Ga0501038_0055070 | Ga0501038_0055070_1594_3237 | 528 |
| 42 | 3300049580 | Ga0501046_0075575 | Ga0501046_0075575_138_1781 | 528 |
| 43 | 3300049581 | Ga0501047_0017804 | Ga0501047_0017804_4355_5998 | 528 |
| 44 | 3300049581 | Ga0501047_0021359 | Ga0501047_0021359_1883_3526 | 528 |
| 45 | 3300049582 | Ga0501048_0040358 | Ga0501048_0040358_872_2515 | 528 |
| 46 | 3300049586 | Ga0501070_0020337 | Ga0501070_0020337_3545_5188 | 528 |
| 47 | 3300049822 | Ga0501035_0104129 | Ga0501035_0104129_15_1658 | 528 |
| 48 | 3300049823 | Ga0501044_0250431 | Ga0501044_0250431_15_1658 | 528 |
| 49 | 3300049569 | Ga0501032_0007906 | Ga0501032_0007906_1211_2809 | 529 |
| 50 | 3300049572 | Ga0501036_0009984 | Ga0501036_0009984_4671_6269 | 529 |
| 51 | 3300049573 | Ga0501037_0002493 | Ga0501037_0002493_5051_6649 | 529 |
| 52 | 3300049574 | Ga0501038_0048118 | Ga0501038_0048118_806_2404 | 529 |
| 53 | 3300049575 | Ga0501039_0012289 | Ga0501039_0012289_3817_5415 | 529 |
| 54 | 3300049579 | Ga0501043_0039478 | Ga0501043_0039478_795_2393 | 529 |
| 55 | 3300049581 | Ga0501047_0011926 | Ga0501047_0011926_3128_4777 | 529 |
| 56 | 3300049581 | Ga0501047_0099911 | Ga0501047_0099911_1019_2617 | 529 |
| 57 | 3300049582 | Ga0501048_0008484 | Ga0501048_0008484_5130_6728 | 529 |
| 58 | 3300049584 | Ga0501068_0030429 | Ga0501068_0030429_789_2387 | 529 |
| 59 | 3300049669 | Ga0501235_013165 | Ga0501235_013165_65_1708 | 529 |
| 60 | 3300049823 | Ga0501044_0030625 | Ga0501044_0030625_2014_3612 | 529 |
| 61 | 3300049824 | Ga0501045_0091589 | Ga0501045_0091589_458_2056 | 529 |
| 62 | 3300048925 | Ga0496122_0000982 | Ga0496122_0000982_37986_39590 | 530 |
| 63 | 3300048926 | Ga0496123_0005044 | Ga0496123_0005044_7080_8684 | 530 |
| 64 | 3300049823 | Ga0501044_0146819 | Ga0501044_0146819_677_2317 | 530 |
| 65 | 3300049570 | Ga0501033_0006214 | Ga0501033_0006214_5323_6966 | 531 |
| 66 | 3300049822 | Ga0501035_0065804 | Ga0501035_0065804_936_2579 | 531 |
| 67 | 3300046460 | Ga0495638_0084537 | Ga0495638_0084537_141_1784 | 533 |
| 68 | 3300049571 | Ga0501034_0030124 | Ga0501034_0030124_781_2460 | 533 |
| 69 | 3300049586 | Ga0501070_0021914 | Ga0501070_0021914_833_2512 | 533 |
| 70 | 3300049587 | Ga0501071_0002907 | Ga0501071_0002907_505_2184 | 533 |
| 71 | iso_pu_bacteria | 2883821847 | 2883826238 | 533 |
| 72 | 3300049742 | Ga0501080_0010612 | Ga0501080_0010612_3048_4685 | 535 |
| 73 | iso_pu_bacteria | 2643221576 | 2643890267 | 535 |
| 74 | iso_pu_bacteria | 2643221590 | 2643959323 | 535 |
| 75 | 3300005563 | Ga0068855_100052075 | Ga0068855_1000520753 | 536 |
| 76 | 3300025949 | Ga0207667_10035689 | Ga0207667_100356894 | 536 |
| 77 | 3300003203 | JGI25406J46586_10002789 | JGI25406J46586_100027896 | 537 |
| 78 | 3300005985 | Ga0081539_10001419 | Ga0081539_100014194 | 537 |
| 79 | 3300049593 | Ga0501077_0071697 | Ga0501077_0071697_463_2115 | 537 |
| 80 | 3300031728 | Ga0316578_10026161 | Ga0316578_100261613 | 538 |
| 81 | 3300032137 | Ga0316585_10006278 | Ga0316585_100062783 | 538 |
| 82 | 3300036647 | Ga0316582_0035873 | Ga0316582_0035873_1378_3009 | 538 |
| 83 | 3300036712 | Ga0316584_0035559 | Ga0316584_0035559_1307_2938 | 538 |
| 84 | 3300044684 | Ga0466966_0002663 | Ga0466966_0002663_4305_6047 | 538 |
| 85 | 3300045049 | Ga0466959_0047606 | Ga0466959_0047606_920_2572 | 538 |
| 86 | 3300045836 | Ga0466958_0062441 | Ga0466958_0062441_391_2043 | 538 |
| 87 | 3300048917 | Ga0496114_0105340 | Ga0496114_0105340_260_1879 | 538 |
| 88 | 3300049586 | Ga0501070_0071495 | Ga0501070_0071495_502_2157 | 538 |
| 89 | 3300005937 | Ga0081455_10031375 | Ga0081455_100313751 | 539 |
| 90 | 3300044693 | Ga0466961_0050602 | Ga0466961_0050602_965_2632 | 539 |
| 91 | 3300044765 | Ga0466970_0041423 | Ga0466970_0041423_81_1748 | 539 |
| 92 | 3300045976 | Ga0466967_0037388 | Ga0466967_0037388_199_1866 | 539 |
| 93 | iso_pu_bacteria | 2585428094 | 2587864075 | 539 |
| 94 | iso_pu_bacteria | 2643221542 | 2643732359 | 539 |
| 95 | iso_pu_bacteria | 2643221546 | 2643752550 | 539 |
| 96 | iso_pu_bacteria | 2643221549 | 2643766188 | 539 |
| 97 | iso_pu_bacteria | 2643221553 | 2643786530 | 539 |
| 98 | iso_pu_bacteria | 2643221572 | 2643876264 | 539 |
| 99 | iso_pu_bacteria | 2643221630 | 2644171178 | 539 |
| 100 | iso_pu_bacteria | 2643221632 | 2644182573 | 539 |
| 101 | iso_pu_bacteria | 2643221649 | 2644278601 | 539 |
| 102 | iso_pu_bacteria | 2643221669 | 2644383319 | 539 |
| 103 | iso_pu_bacteria | 2643221724 | 2644681230 | 539 |
| 104 | iso_pu_bacteria | 2728369380 | 2730230337 | 539 |
| 105 | iso_pu_bacteria | 2747842429 | 2747952773 | 539 |
| 106 | iso_pu_bacteria | 2757320536 | 2758226740 | 539 |
| 107 | iso_pu_bacteria | 2773857763 | 2774398709 | 539 |
| 108 | iso_pu_bacteria | 2784132109 | 2784471384 | 539 |
| 109 | iso_pu_bacteria | 2808606306 | 2808630507 | 539 |
| 110 | iso_pu_bacteria | 2808606368 | 2808886269 | 539 |
| 111 | iso_pu_bacteria | 2808606372 | 2808901237 | 539 |
| 112 | iso_pu_bacteria | 2808606447 | 2809227998 | 539 |
| 113 | iso_pu_bacteria | 2811994872 | 2812324013 | 539 |
| 114 | iso_pu_bacteria | 2844841374 | 2844843140 | 539 |
| 115 | iso_pu_bacteria | 2844852863 | 2844854491 | 539 |
| 116 | iso_pu_bacteria | 2852632344 | 2852634702 | 539 |
| 117 | iso_pu_bacteria | 2852646457 | 2852648948 | 539 |
| 118 | iso_pu_bacteria | 2852663356 | 2852664304 | 539 |
| 119 | iso_pu_bacteria | 2852677369 | 2852678744 | 539 |
| 120 | iso_pu_bacteria | 2857720070 | 2857720713 | 539 |
| 121 | iso_pu_bacteria | 2857729791 | 2857730507 | 539 |
| 122 | iso_pu_bacteria | 2862993130 | 2862993455 | 539 |
| 123 | iso_pu_bacteria | 2884763398 | 2884766129 | 539 |
| 124 | iso_pu_bacteria | 2895660088 | 2895660443 | 539 |
| 125 | iso_pu_bacteria | 2904509784 | 2904511333 | 539 |
| 126 | iso_pu_bacteria | 2906799679 | 2906800938 | 539 |
| 127 | iso_pu_bacteria | 2908678064 | 2908679948 | 539 |
| 128 | iso_pu_bacteria | 2919055335 | 2919058635 | 539 |
| 129 | iso_pu_bacteria | 2919069694 | 2919072067 | 539 |
| 130 | iso_pu_bacteria | 2919395869 | 2919399420 | 539 |
| 131 | iso_pu_bacteria | 2919443155 | 2919445741 | 539 |
| 132 | iso_pu_bacteria | 2919523602 | 2919525220 | 539 |
| 133 | iso_pu_bacteria | 2928090899 | 2928091495 | 539 |
| 134 | iso_pu_bacteria | 2928121344 | 2928123754 | 539 |
| 135 | iso_pu_bacteria | 2928153084 | 2928153284 | 539 |
| 136 | iso_pu_bacteria | 2935409751 | 2935410751 | 539 |
| 137 | iso_pu_bacteria | 2945968032 | 2945968556 | 539 |
| 138 | iso_pu_bacteria | 2946041624 | 2946044993 | 539 |
| 139 | iso_pu_bacteria | 2946080515 | 2946084250 | 539 |
| 140 | iso_pu_bacteria | 2964326757 | 2964328612 | 539 |
| 141 | iso_pu_bacteria | 2974294766 | 2974296720 | 539 |
| 142 | iso_pu_bacteria | 2974324384 | 2974327045 | 539 |
| 143 | iso_pu_bacteria | 2977251589 | 2977251706 | 539 |
| 144 | iso_pu_bacteria | 2977264416 | 2977267398 | 539 |
| 145 | iso_pu_bacteria | 2984580707 | 2984581756 | 539 |
| 146 | iso_pu_bacteria | 3001889506 | 3001890350 | 539 |
| 147 | iso_pu_bacteria | 8004182704 | 8004184713 | 539 |
| 148 | iso_pu_bacteria | 8016254467 | 8016256933 | 539 |
| 149 | iso_pu_bacteria | 8046352972 | 8046353599 | 539 |
| 150 | iso_pu_bacteria | 8056037122 | 8056039223 | 539 |
| 151 | 3300005548 | Ga0070665_100027096 | Ga0070665_1000270964 | 540 |
| 152 | 3300005841 | Ga0068863_100125131 | Ga0068863_1001251312 | 540 |
| 153 | 3300009098 | Ga0105245_10008900 | Ga0105245_100089006 | 540 |
| 154 | 3300026088 | Ga0207641_10029831 | Ga0207641_100298312 | 540 |
| 155 | 3300044656 | Ga0466969_0003997 | Ga0466969_0003997_2006_3628 | 540 |
| 156 | iso_pu_bacteria | 2582581312 | 2585299199 | 540 |
| 157 | iso_pu_bacteria | 2643221711 | 2644610280 | 540 |
| 158 | iso_pu_bacteria | 2767802112 | 2768643533 | 540 |
| 159 | iso_pu_bacteria | 2784746768 | 2785369565 | 540 |
| 160 | iso_pu_bacteria | 2802429296 | 2804846970 | 540 |
| 161 | iso_pu_bacteria | 2811994882 | 2812371680 | 540 |
| 162 | iso_pu_bacteria | 2818991318 | 2819424871 | 540 |
| 163 | iso_pu_bacteria | 2818991458 | 2819667245 | 540 |
| 164 | iso_pu_bacteria | 2818991472 | 2819741190 | 540 |
| 165 | iso_pu_bacteria | 2857733635 | 2857734283 | 540 |
| 166 | iso_pu_bacteria | 2862290372 | 2862294866 | 540 |
| 167 | iso_pu_bacteria | 2862382967 | 2862390903 | 540 |
| 168 | iso_pu_bacteria | 2862705112 | 2862708242 | 540 |
| 169 | iso_pu_bacteria | 2867369537 | 2867371940 | 540 |
| 170 | iso_pu_bacteria | 2875391855 | 2875395687 | 540 |
| 171 | iso_pu_bacteria | 2990044586 | 2990048090 | 540 |
| 172 | iso_pu_bacteria | 2990059506 | 2990065896 | 540 |
| 173 | iso_pu_bacteria | 3006321560 | 3006325008 | 540 |
| 174 | iso_pu_bacteria | 8008485437 | 8008485441 | 540 |
| 175 | iso_pu_bacteria | 8008558824 | 8008567241 | 540 |
| 176 | iso_pu_bacteria | 8025478263 | 8025484357 | 540 |
| 177 | iso_pu_bacteria | 8025524527 | 8025529915 | 540 |
| 178 | iso_pu_bacteria | 8033684223 | 8033690131 | 540 |
| 179 | iso_pu_bacteria | 8056829672 | 8056833577 | 540 |
| 180 | 3300015262 | Ga0182007_10002608 | Ga0182007_100026083 | 541 |
| 181 | 3300041498 | Ga0451841_0533336 | Ga0451841_0533336_21_1658 | 541 |
| 182 | 3300044658 | Ga0466972_0070420 | Ga0466972_0070420_14_1651 | 541 |
| 183 | 3300049568 | Ga0501031_0000150 | Ga0501031_0000150_23978_25615 | 541 |
| 184 | 3300049569 | Ga0501032_0000101 | Ga0501032_0000101_25043_26680 | 541 |
| 185 | 3300049570 | Ga0501033_0000373 | Ga0501033_0000373_18619_20256 | 541 |
| 186 | 3300049571 | Ga0501034_0001646 | Ga0501034_0001646_21541_23178 | 541 |
| 187 | 3300049573 | Ga0501037_0000287 | Ga0501037_0000287_17554_19191 | 541 |
| 188 | 3300049574 | Ga0501038_0000125 | Ga0501038_0000125_38622_40259 | 541 |
| 189 | 3300049575 | Ga0501039_0000086 | Ga0501039_0000086_17189_18826 | 541 |
| 190 | 3300049579 | Ga0501043_0000098 | Ga0501043_0000098_51378_53015 | 541 |
| 191 | 3300049580 | Ga0501046_0000160 | Ga0501046_0000160_18655_20292 | 541 |
| 192 | 3300049581 | Ga0501047_0000496 | Ga0501047_0000496_22599_24236 | 541 |
| 193 | 3300049582 | Ga0501048_0000364 | Ga0501048_0000364_11414_13051 | 541 |
| 194 | 3300049585 | Ga0501069_0000178 | Ga0501069_0000178_16855_18492 | 541 |
| 195 | 3300049586 | Ga0501070_0000306 | Ga0501070_0000306_18578_20215 | 541 |
| 196 | 3300049590 | Ga0501074_0000058 | Ga0501074_0000058_24050_25687 | 541 |
| 197 | 3300049742 | Ga0501080_0000422 | Ga0501080_0000422_14105_15742 | 541 |
| 198 | 3300049744 | Ga0501083_0017995 | Ga0501083_0017995_2468_4105 | 541 |
| 199 | 3300049822 | Ga0501035_0001535 | Ga0501035_0001535_17062_18699 | 541 |
| 200 | 3300049823 | Ga0501044_0001017 | Ga0501044_0001017_18225_19862 | 541 |
| 201 | 3300054114 | Ga0501084_0000959 | Ga0501084_0000959_3883_5520 | 541 |
| 202 | iso_pu_bacteria | 2547132111 | 2547408165 | 541 |
| 203 | iso_pu_bacteria | 2554235005 | 2554257786 | 541 |
| 204 | iso_pu_bacteria | 2582581314 | 2585313537 | 541 |
| 205 | iso_pu_bacteria | 2616644814 | 2616695023 | 541 |
| 206 | iso_pu_bacteria | 2616644941 | 2616902241 | 541 |
| 207 | iso_pu_bacteria | 2643221548 | 2643764991 | 541 |
| 208 | iso_pu_bacteria | 2643221561 | 2643824270 | 541 |
| 209 | iso_pu_bacteria | 2643221578 | 2643902526 | 541 |
| 210 | iso_pu_bacteria | 2643221587 | 2643942236 | 541 |
| 211 | iso_pu_bacteria | 2643221601 | 2644017142 | 541 |
| 212 | iso_pu_bacteria | 2643221631 | 2644173897 | 541 |
| 213 | iso_pu_bacteria | 2643221670 | 2644389902 | 541 |
| 214 | iso_pu_bacteria | 2643221673 | 2644404965 | 541 |
| 215 | iso_pu_bacteria | 2643221677 | 2644429319 | 541 |
| 216 | iso_pu_bacteria | 2643221682 | 2644461169 | 541 |
| 217 | iso_pu_bacteria | 2643221696 | 2644533574 | 541 |
| 218 | iso_pu_bacteria | 2675903058 | 2676478758 | 541 |
| 219 | iso_pu_bacteria | 2721755702 | 2723641338 | 541 |
| 220 | iso_pu_bacteria | 2784132148 | 2784588619 | 541 |
| 221 | iso_pu_bacteria | 2784746763 | 2785343244 | 541 |
| 222 | iso_pu_bacteria | 2791355406 | 2793979655 | 541 |
| 223 | iso_pu_bacteria | 2808606365 | 2808871742 | 541 |
| 224 | iso_pu_bacteria | 2808606375 | 2808920629 | 541 |
| 225 | iso_pu_bacteria | 2808606448 | 2809232232 | 541 |
| 226 | iso_pu_bacteria | 2808606982 | 2811849111 | 541 |
| 227 | iso_pu_bacteria | 2811994879 | 2812358032 | 541 |
| 228 | iso_pu_bacteria | 2811994917 | 2812480469 | 541 |
| 229 | iso_pu_bacteria | 2818991463 | 2819695446 | 541 |
| 230 | iso_pu_bacteria | 2827628540 | 2827628639 | 541 |
| 231 | iso_pu_bacteria | 2852635781 | 2852636600 | 541 |
| 232 | iso_pu_bacteria | 2862178590 | 2862179428 | 541 |
| 233 | iso_pu_bacteria | 2862281513 | 2862285716 | 541 |
| 234 | iso_pu_bacteria | 2862507626 | 2862511754 | 541 |
| 235 | iso_pu_bacteria | 2863404153 | 2863404549 | 541 |
| 236 | iso_pu_bacteria | 2867346516 | 2867348883 | 541 |
| 237 | iso_pu_bacteria | 2867428634 | 2867434331 | 541 |
| 238 | iso_pu_bacteria | 2867475112 | 2867476757 | 541 |
| 239 | iso_pu_bacteria | 2873151551 | 2873155678 | 541 |
| 240 | iso_pu_bacteria | 2877676314 | 2877681058 | 541 |
| 241 | iso_pu_bacteria | 2912715099 | 2912719898 | 541 |
| 242 | iso_pu_bacteria | 2912757875 | 2912760837 | 541 |
| 243 | iso_pu_bacteria | 2918501144 | 2918505585 | 541 |
| 244 | iso_pu_bacteria | 2919446982 | 2919448160 | 541 |
| 245 | iso_pu_bacteria | 2919468124 | 2919469470 | 541 |
| 246 | iso_pu_bacteria | 2935390628 | 2935393367 | 541 |
| 247 | iso_pu_bacteria | 2946045630 | 2946048954 | 541 |
| 248 | iso_pu_bacteria | 2966598605 | 2966601685 | 541 |
| 249 | iso_pu_bacteria | 2984576629 | 2984579498 | 541 |
| 250 | iso_pu_bacteria | 2990256926 | 2990257107 | 541 |
| 251 | iso_pu_bacteria | 2997451912 | 2997457791 | 541 |
| 252 | iso_pu_bacteria | 2997600082 | 2997600369 | 541 |
| 253 | iso_pu_bacteria | 3006393351 | 3006393935 | 541 |
| 254 | iso_pu_bacteria | 3006486233 | 3006489402 | 541 |
| 255 | iso_pu_bacteria | 3006493962 | 3006500809 | 541 |
| 256 | iso_pu_bacteria | 8023623736 | 8023629787 | 541 |
| 257 | iso_pu_bacteria | 8025530807 | 8025537974 | 541 |
| 258 | iso_pu_bacteria | 8047893842 | 8047898064 | 541 |
| 259 | iso_pu_bacteria | 8048127548 | 8048136838 | 541 |
| 260 | iso_pu_bacteria | 8048356638 | 8048360829 | 541 |
| 261 | iso_pu_bacteria | 8048369669 | 8048375027 | 541 |
| 262 | iso_pu_bacteria | 8048379754 | 8048383179 | 541 |
| 263 | iso_pu_bacteria | 8048406513 | 8048412699 | 541 |
| 264 | iso_pu_bacteria | 8054160619 | 8054166510 | 541 |
| 265 | iso_pu_bacteria | 8056447290 | 8056449199 | 541 |
| 266 | iso_pu_bacteria | 8056667051 | 8056671185 | 541 |
| 267 | 3300005437 | Ga0070710_10014843 | Ga0070710_100148432 | 542 |
| 268 | 3300005548 | Ga0070665_100072414 | Ga0070665_1000724141 | 542 |
| 269 | 3300006038 | Ga0075365_10023077 | Ga0075365_100230772 | 542 |
| 270 | 3300006051 | Ga0075364_10001480 | Ga0075364_100014807 | 542 |
| 271 | 3300031649 | Ga0307514_10001479 | Ga0307514_1000147915 | 542 |
| 272 | 3300046454 | Ga0495592_0013615 | Ga0495592_0013615_608_2299 | 542 |
| 273 | 3300046459 | Ga0495629_0054622 | Ga0495629_0054622_941_2674 | 542 |
| 274 | 3300046462 | Ga0495651_0080573 | Ga0495651_0080573_332_2023 | 542 |
| 275 | 3300046514 | Ga0495618_0053599 | Ga0495618_0053599_479_2212 | 542 |
| 276 | 3300046516 | Ga0495628_0010249 | Ga0495628_0010249_5331_7064 | 542 |
| 277 | 3300046533 | Ga0495640_0053506 | Ga0495640_0053506_142_1875 | 542 |
| 278 | 3300046559 | Ga0495667_0054837 | Ga0495667_0054837_566_2299 | 542 |
| 279 | 3300046642 | Ga0495634_0012422 | Ga0495634_0012422_3520_5211 | 542 |
| 280 | 3300046675 | Ga0495657_0002584 | Ga0495657_0002584_635_2368 | 542 |
| 281 | 3300046689 | Ga0495613_0003429 | Ga0495613_0003429_783_2516 | 542 |
| 282 | 3300046809 | Ga0495600_0008571 | Ga0495600_0008571_597_2330 | 542 |
| 283 | 3300047321 | Ga0495676_0005604 | Ga0495676_0005604_9254_10987 | 542 |
| 284 | 3300048921 | Ga0496118_0025687 | Ga0496118_0025687_607_2250 | 542 |
| 285 | 3300048922 | Ga0496119_0002444 | Ga0496119_0002444_10924_12567 | 542 |
| 286 | 3300048923 | Ga0496120_0000251 | Ga0496120_0000251_83687_85330 | 542 |
| 287 | 3300048923 | Ga0496120_0007526 | Ga0496120_0007526_4096_5739 | 542 |
| 288 | 3300049569 | Ga0501032_0025058 | Ga0501032_0025058_282_1940 | 542 |
| 289 | 3300049569 | Ga0501032_0055216 | Ga0501032_0055216_608_2236 | 542 |
| 290 | 3300049570 | Ga0501033_0044387 | Ga0501033_0044387_578_2236 | 542 |
| 291 | 3300049571 | Ga0501034_0115758 | Ga0501034_0115758_383_2041 | 542 |
| 292 | 3300049572 | Ga0501036_0043223 | Ga0501036_0043223_1869_3527 | 542 |
| 293 | 3300049573 | Ga0501037_0007483 | Ga0501037_0007483_5845_7473 | 542 |
| 294 | 3300049573 | Ga0501037_0078929 | Ga0501037_0078929_175_1833 | 542 |
| 295 | 3300049579 | Ga0501043_0016590 | Ga0501043_0016590_2719_4377 | 542 |
| 296 | 3300049579 | Ga0501043_0101861 | Ga0501043_0101861_596_2224 | 542 |
| 297 | 3300049581 | Ga0501047_0001456 | Ga0501047_0001456_10565_12193 | 542 |
| 298 | 3300049581 | Ga0501047_0217690 | Ga0501047_0217690_88_1746 | 542 |
| 299 | 3300049822 | Ga0501035_0044866 | Ga0501035_0044866_1175_2803 | 542 |
| 300 | 3300050491 | nmdc:mga00v17_34878_c1 | nmdc:mga00v17_34878_c1_775_2415 | 542 |
| 301 | 3300050492 | nmdc:mga0yw44_25771_c1 | nmdc:mga0yw44_25771_c1_1160_2800 | 542 |
| 302 | 3300053104 | Ga0500556_0000394 | Ga0500556_0000394_11360_13000 | 542 |
| 303 | 3300053133 | Ga0500655_001147 | Ga0500655_001147_143_1783 | 542 |
| 304 | 3300053136 | Ga0500559_0000648 | Ga0500559_0000648_16381_18021 | 542 |
| 305 | iso_pu_bacteria | 2515154155 | 2515856220 | 542 |
| 306 | iso_pu_bacteria | 2643221567 | 2643852400 | 542 |
| 307 | iso_pu_bacteria | 2643221604 | 2644033220 | 542 |
| 308 | iso_pu_bacteria | 2643221615 | 2644091040 | 542 |
| 309 | iso_pu_bacteria | 2643221617 | 2644098256 | 542 |
| 310 | iso_pu_bacteria | 2643221620 | 2644119017 | 542 |
| 311 | iso_pu_bacteria | 2643221624 | 2644136923 | 542 |
| 312 | iso_pu_bacteria | 2643221641 | 2644229400 | 542 |
| 313 | iso_pu_bacteria | 2643221657 | 2644320843 | 542 |
| 314 | iso_pu_bacteria | 2643221679 | 2644444873 | 542 |
| 315 | iso_pu_bacteria | 2643221690 | 2644504849 | 542 |
| 316 | iso_pu_bacteria | 2643221694 | 2644523680 | 542 |
| 317 | iso_pu_bacteria | 2643221722 | 2644667784 | 542 |
| 318 | iso_pu_bacteria | 2728369276 | 2729908260 | 542 |
| 319 | iso_pu_bacteria | 2731639228 | 2731909131 | 542 |
| 320 | iso_pu_bacteria | 2739367898 | 2740168100 | 542 |
| 321 | iso_pu_bacteria | 2773857762 | 2774396355 | 542 |
| 322 | iso_pu_bacteria | 2799112218 | 2799185777 | 542 |
| 323 | iso_pu_bacteria | 2808606370 | 2808894297 | 542 |
| 324 | iso_pu_bacteria | 2808606439 | 2809198008 | 542 |
| 325 | iso_pu_bacteria | 2811994874 | 2812334494 | 542 |
| 326 | iso_pu_bacteria | 2811994878 | 2812353299 | 542 |
| 327 | iso_pu_bacteria | 2811994880 | 2812362532 | 542 |
| 328 | iso_pu_bacteria | 2837268691 | 2837274760 | 542 |
| 329 | iso_pu_bacteria | 2844849076 | 2844851720 | 542 |
| 330 | iso_pu_bacteria | 2848551377 | 2848551638 | 542 |
| 331 | iso_pu_bacteria | 2855386786 | 2855389923 | 542 |
| 332 | iso_pu_bacteria | 2856741275 | 2856744605 | 542 |
| 333 | iso_pu_bacteria | 2857481737 | 2857485599 | 542 |
| 334 | iso_pu_bacteria | 2868088558 | 2868094047 | 542 |
| 335 | iso_pu_bacteria | 2873314349 | 2873316379 | 542 |
| 336 | iso_pu_bacteria | 2884693830 | 2884703584 | 542 |
| 337 | iso_pu_bacteria | 2884994152 | 2884998148 | 542 |
| 338 | iso_pu_bacteria | 2887443736 | 2887446910 | 542 |
| 339 | iso_pu_bacteria | 2891395885 | 2891398910 | 542 |
| 340 | iso_pu_bacteria | 2891554331 | 2891559118 | 542 |
| 341 | iso_pu_bacteria | 2891562705 | 2891569295 | 542 |
| 342 | iso_pu_bacteria | 2891968417 | 2891969076 | 542 |
| 343 | iso_pu_bacteria | 2895427314 | 2895432055 | 542 |
| 344 | iso_pu_bacteria | 2895442618 | 2895443388 | 542 |
| 345 | iso_pu_bacteria | 2905926851 | 2905928659 | 542 |
| 346 | iso_pu_bacteria | 2945920336 | 2945923860 | 542 |
| 347 | iso_pu_bacteria | 2946037020 | 2946040396 | 542 |
| 348 | iso_pu_bacteria | 2953998280 | 2954001661 | 542 |
| 349 | iso_pu_bacteria | 2990088156 | 2990094209 | 542 |
| 350 | iso_pu_bacteria | 3002998708 | 3003007216 | 542 |
| 351 | iso_pu_bacteria | 8047710418 | 8047714193 | 542 |
| 352 | iso_pu_bacteria | 8053945823 | 8053945825 | 542 |
| 353 | iso_pu_bacteria | 8054609563 | 8054613695 | 542 |
| 354 | iso_pu_bacteria | 8055066027 | 8055072813 | 542 |
| 355 | iso_pu_bacteria | 8055172936 | 8055173914 | 542 |
| 356 | 3300002772 | JGI25164J39214_1000508 | JGI25164J39214_100050814 | 543 |
| 357 | 3300003214 | JGI25165J46597_1000004 | JGI25165J46597_10000048 | 543 |
| 358 | 3300003214 | JGI25165J46597_1000174 | JGI25165J46597_100017438 | 543 |
| 359 | 3300003578 | Ga0006562J51391_1021328 | Ga0006562J51391_10213283 | 543 |
| 360 | 3300003578 | Ga0006562J51391_1021330 | Ga0006562J51391_10213306 | 543 |
| 361 | 3300003752 | Ga0055539_1000005 | Ga0055539_1000005414 | 543 |
| 362 | 3300003756 | Ga0055533_1000001 | Ga0055533_10000011483 | 543 |
| 363 | 3300003759 | Ga0055525_1000150 | Ga0055525_10001507 | 543 |
| 364 | 3300003762 | Ga0055542_1000023 | Ga0055542_100002393 | 543 |
| 365 | 3300003763 | Ga0055529_1000050 | Ga0055529_100005093 | 543 |
| 366 | 3300005327 | Ga0070658_10047967 | Ga0070658_100479672 | 543 |
| 367 | 3300005327 | Ga0070658_10084451 | Ga0070658_100844512 | 543 |
| 368 | 3300005329 | Ga0070683_100011149 | Ga0070683_10001114910 | 543 |
| 369 | 3300005366 | Ga0070659_100022773 | Ga0070659_1000227732 | 543 |
| 370 | 3300005535 | Ga0070684_100012629 | Ga0070684_1000126294 | 543 |
| 371 | 3300005548 | Ga0070665_100006294 | Ga0070665_1000062945 | 543 |
| 372 | 3300005842 | Ga0068858_100022773 | Ga0068858_1000227732 | 543 |
| 373 | 3300006048 | Ga0075363_100010888 | Ga0075363_1000108882 | 543 |
| 374 | 3300009098 | Ga0105245_10017794 | Ga0105245_100177946 | 543 |
| 375 | 3300010375 | Ga0105239_10002867 | Ga0105239_1000286718 | 543 |
| 376 | 3300013105 | Ga0157369_10000422 | Ga0157369_1000042250 | 543 |
| 377 | 3300013105 | Ga0157369_10006480 | Ga0157369_100064805 | 543 |
| 378 | 3300014325 | Ga0163163_10004192 | Ga0163163_100041924 | 543 |
| 379 | 3300014745 | Ga0157377_10015698 | Ga0157377_100156984 | 543 |
| 380 | 3300020081 | Ga0206354_10550714 | Ga0206354_105507141 | 543 |
| 381 | 3300020082 | Ga0206353_11057787 | Ga0206353_110577877 | 543 |
| 382 | 3300025225 | Ga0209566_100053 | Ga0209566_10005369 | 543 |
| 383 | 3300025226 | Ga0209674_100001 | Ga0209674_1000011484 | 543 |
| 384 | 3300025228 | Ga0209672_100064 | Ga0209672_100064187 | 543 |
| 385 | 3300025229 | Ga0209147_100956 | Ga0209147_10095615 | 543 |
| 386 | 3300025230 | Ga0209563_100001 | Ga0209563_1000011484 | 543 |
| 387 | 3300025230 | Ga0209563_100349 | Ga0209563_10034910 | 543 |
| 388 | 3300025231 | Ga0207427_100010 | Ga0207427_100010573 | 543 |
| 389 | 3300025233 | Ga0209437_100290 | Ga0209437_10029042 | 543 |
| 390 | 3300025253 | Ga0209677_100001 | Ga0209677_1000011484 | 543 |
| 391 | 3300025253 | Ga0209677_101255 | Ga0209677_1012559 | 543 |
| 392 | 3300025254 | Ga0209148_1000108 | Ga0209148_1000108187 | 543 |
| 393 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000011376 | 543 |
| 394 | 3300025272 | Ga0209455_1000102 | Ga0209455_10001022 | 543 |
| 395 | 3300025728 | Ga0207655_1004694 | Ga0207655_10046944 | 543 |
| 396 | 3300025909 | Ga0207705_10048422 | Ga0207705_100484222 | 543 |
| 397 | 3300025912 | Ga0207707_10171067 | Ga0207707_101710671 | 543 |
| 398 | 3300025921 | Ga0207652_10016360 | Ga0207652_100163602 | 543 |
| 399 | 3300025932 | Ga0207690_10029058 | Ga0207690_100290582 | 543 |
| 400 | 3300025935 | Ga0207709_10019826 | Ga0207709_100198263 | 543 |
| 401 | 3300025944 | Ga0207661_10032798 | Ga0207661_100327982 | 543 |
| 402 | 3300025961 | Ga0207712_10031419 | Ga0207712_100314193 | 543 |
| 403 | 3300025972 | Ga0207668_10053874 | Ga0207668_100538741 | 543 |
| 404 | 3300026116 | Ga0207674_10023094 | Ga0207674_100230944 | 543 |
| 405 | 3300028379 | Ga0268266_10001692 | Ga0268266_100016925 | 543 |
| 406 | 3300031901 | Ga0307406_10006506 | Ga0307406_100065065 | 543 |
| 407 | 3300032004 | Ga0307414_10074716 | Ga0307414_100747162 | 543 |
| 408 | 3300037312 | Ga0395899_0008826 | Ga0395899_0008826_4622_6265 | 543 |
| 409 | 3300037418 | Ga0395900_0008453 | Ga0395900_0008453_8269_9912 | 543 |
| 410 | 3300037466 | Ga0395898_0000256 | Ga0395898_0000256_20341_21984 | 543 |
| 411 | 3300044765 | Ga0466970_0000301 | Ga0466970_0000301_2644_4287 | 543 |
| 412 | 3300045976 | Ga0466967_0152474 | Ga0466967_0152474_153_1784 | 543 |
| 413 | 3300046453 | Ga0495627_001243 | Ga0495627_001243_6946_8586 | 543 |
| 414 | 3300048905 | Ga0496102_0047416 | Ga0496102_0047416_1756_3387 | 543 |
| 415 | 3300048907 | Ga0496104_0053048 | Ga0496104_0053048_1235_2866 | 543 |
| 416 | 3300048908 | Ga0496105_0000534 | Ga0496105_0000534_19838_21469 | 543 |
| 417 | 3300048908 | Ga0496105_0077904 | Ga0496105_0077904_969_2600 | 543 |
| 418 | 3300048909 | Ga0496106_0035149 | Ga0496106_0035149_1730_3361 | 543 |
| 419 | 3300048910 | Ga0496107_0019118 | Ga0496107_0019118_1530_3161 | 543 |
| 420 | 3300048911 | Ga0496108_0020574 | Ga0496108_0020574_662_2293 | 543 |
| 421 | 3300048912 | Ga0496109_0019567 | Ga0496109_0019567_3896_5527 | 543 |
| 422 | 3300048912 | Ga0496109_0063845 | Ga0496109_0063845_761_2404 | 543 |
| 423 | 3300048913 | Ga0496110_0004386 | Ga0496110_0004386_1489_3132 | 543 |
| 424 | 3300048914 | Ga0496111_0000126 | Ga0496111_0000126_1408_3051 | 543 |
| 425 | 3300048917 | Ga0496114_0061188 | Ga0496114_0061188_1445_3085 | 543 |
| 426 | 3300048918 | Ga0496115_0003839 | Ga0496115_0003839_5693_7324 | 543 |
| 427 | 3300048918 | Ga0496115_0006870 | Ga0496115_0006870_4951_6582 | 543 |
| 428 | 3300048920 | Ga0496117_0000063 | Ga0496117_0000063_17105_18754 | 543 |
| 429 | 3300048920 | Ga0496117_0000187 | Ga0496117_0000187_66282_67922 | 543 |
| 430 | 3300048920 | Ga0496117_0003329 | Ga0496117_0003329_9309_10952 | 543 |
| 431 | 3300048920 | Ga0496117_0044395 | Ga0496117_0044395_845_2488 | 543 |
| 432 | 3300048921 | Ga0496118_0004280 | Ga0496118_0004280_6831_8474 | 543 |
| 433 | 3300048923 | Ga0496120_0001031 | Ga0496120_0001031_11097_12746 | 543 |
| 434 | 3300048923 | Ga0496120_0012607 | Ga0496120_0012607_2647_4296 | 543 |
| 435 | 3300048925 | Ga0496122_0026240 | Ga0496122_0026240_30_1679 | 543 |
| 436 | 3300048928 | Ga0496125_0000192 | Ga0496125_0000192_74175_75818 | 543 |
| 437 | 3300048928 | Ga0496125_0006673 | Ga0496125_0006673_7803_9452 | 543 |
| 438 | 3300048928 | Ga0496125_0058909 | Ga0496125_0058909_500_2149 | 543 |
| 439 | 3300048929 | Ga0496126_0001780 | Ga0496126_0001780_5759_7399 | 543 |
| 440 | 3300048929 | Ga0496126_0005300 | Ga0496126_0005300_9149_10798 | 543 |
| 441 | 3300048929 | Ga0496126_0079387 | Ga0496126_0079387_990_2633 | 543 |
| 442 | 3300049571 | Ga0501034_0002967 | Ga0501034_0002967_3499_5139 | 543 |
| 443 | 3300049571 | Ga0501034_0006214 | Ga0501034_0006214_6319_7959 | 543 |
| 444 | 3300049571 | Ga0501034_0008198 | Ga0501034_0008198_2408_4048 | 543 |
| 445 | 3300049571 | Ga0501034_0052016 | Ga0501034_0052016_2303_3934 | 543 |
| 446 | 3300049583 | Ga0501067_0003318 | Ga0501067_0003318_4115_5746 | 543 |
| 447 | 3300049584 | Ga0501068_0004509 | Ga0501068_0004509_3520_5151 | 543 |
| 448 | 3300049586 | Ga0501070_0009626 | Ga0501070_0009626_2719_4350 | 543 |
| 449 | 3300049586 | Ga0501070_0034872 | Ga0501070_0034872_1504_3144 | 543 |
| 450 | 3300049586 | Ga0501070_0036781 | Ga0501070_0036781_177_1808 | 543 |
| 451 | 3300049589 | Ga0501073_0011973 | Ga0501073_0011973_1422_3053 | 543 |
| 452 | 3300049590 | Ga0501074_0008098 | Ga0501074_0008098_4652_6283 | 543 |
| 453 | 3300049590 | Ga0501074_0008131 | Ga0501074_0008131_1653_3296 | 543 |
| 454 | 3300049741 | Ga0501079_0062456 | Ga0501079_0062456_1213_2844 | 543 |
| 455 | 3300049742 | Ga0501080_0013624 | Ga0501080_0013624_3527_5158 | 543 |
| 456 | 3300049742 | Ga0501080_0020214 | Ga0501080_0020214_1272_2903 | 543 |
| 457 | 3300049742 | Ga0501080_0140922 | Ga0501080_0140922_316_1947 | 543 |
| 458 | 3300050491 | nmdc:mga00v17_8493_c1 | nmdc:mga00v17_8493_c1_443_2095 | 543 |
| 459 | 3300053080 | Ga0500635_0000064 | Ga0500635_0000064_35226_36866 | 543 |
| 460 | 3300053087 | Ga0500643_000341 | Ga0500643_000341_30318_31964 | 543 |
| 461 | 3300053088 | Ga0500644_0000206 | Ga0500644_0000206_33289_34938 | 543 |
| 462 | 3300053098 | Ga0500650_0000299 | Ga0500650_0000299_54_1715 | 543 |
| 463 | 3300053104 | Ga0500556_0000028 | Ga0500556_0000028_43507_45153 | 543 |
| 464 | 3300053139 | Ga0500568_0000009 | Ga0500568_0000009_41785_43431 | 543 |
| 465 | 3300053140 | Ga0500573_0033476 | Ga0500573_0033476_1128_2780 | 543 |
| 466 | 3300053142 | Ga0500577_0003729 | Ga0500577_0003729_197_1858 | 543 |
| 467 | 3300053146 | Ga0500588_0008843 | Ga0500588_0008843_698_2341 | 543 |
| 468 | 3300053730 | Ga0500645_006544 | Ga0500645_006544_555_2201 | 543 |
| 469 | 3300054114 | Ga0501084_0025824 | Ga0501084_0025824_992_2623 | 543 |
| 470 | 3300054114 | Ga0501084_0158677 | Ga0501084_0158677_82_1725 | 543 |
| 471 | 3300060353 | Ga0501082_0050691 | Ga0501082_0050691_261_1892 | 543 |
| 472 | iso_pu_bacteria | 2582581313 | 2585308854 | 543 |
| 473 | iso_pu_bacteria | 2643221647 | 2644262337 | 543 |
| 474 | iso_pu_bacteria | 2773857758 | 2774380783 | 543 |
| 475 | iso_pu_bacteria | 2786546132 | 2786670662 | 543 |
| 476 | iso_pu_bacteria | 2870622029 | 2870622445 | 543 |
| 477 | iso_pu_bacteria | 2939657138 | 2939659176 | 543 |
| 478 | iso_pu_bacteria | 2946033335 | 2946036784 | 543 |
| 479 | iso_pu_bacteria | 2954380949 | 2954386174 | 543 |
| 480 | iso_pu_bacteria | 2954673503 | 2954676985 | 543 |
| 481 | iso_pu_bacteria | 2954682443 | 2954687173 | 543 |
| 482 | iso_pu_bacteria | 2954691527 | 2954696816 | 543 |
| 483 | iso_pu_bacteria | 2954701450 | 2954705322 | 543 |
| 484 | iso_pu_bacteria | 2954711539 | 2954716190 | 543 |
| 485 | iso_pu_bacteria | 2954721474 | 2954726133 | 543 |
| 486 | iso_pu_bacteria | 2954731030 | 2954735677 | 543 |
| 487 | iso_pu_bacteria | 2954740390 | 2954745059 | 543 |
| 488 | iso_pu_bacteria | 2954749733 | 2954754533 | 543 |
| 489 | iso_pu_bacteria | 2954759201 | 2954764029 | 543 |
| 490 | iso_pu_bacteria | 2977228692 | 2977228726 | 543 |
| 491 | iso_pu_bacteria | 2977236895 | 2977237433 | 543 |
| 492 | iso_pu_bacteria | 2984542743 | 2984544780 | 543 |
| 493 | iso_pu_bacteria | 2995463766 | 2995465883 | 543 |
| 494 | iso_pu_bacteria | 2995463766 | 2995466737 | 543 |
| 495 | 3300005548 | Ga0070665_100119368 | Ga0070665_1001193681 | 544 |
| 496 | 3300005563 | Ga0068855_100011791 | Ga0068855_10001179110 | 544 |
| 497 | 3300005578 | Ga0068854_100053247 | Ga0068854_1000532471 | 544 |
| 498 | 3300006038 | Ga0075365_10041369 | Ga0075365_100413691 | 544 |
| 499 | 3300009093 | Ga0105240_10008261 | Ga0105240_100082611 | 544 |
| 500 | 3300009174 | Ga0105241_10000495 | Ga0105241_1000049528 | 544 |
| 501 | 3300009177 | Ga0105248_10130643 | Ga0105248_101306432 | 544 |
| 502 | 3300009551 | Ga0105238_10001585 | Ga0105238_100015851 | 544 |
| 503 | 3300025911 | Ga0207654_10006689 | Ga0207654_100066891 | 544 |
| 504 | 3300025913 | Ga0207695_10000324 | Ga0207695_10000324109 | 544 |
| 505 | 3300025914 | Ga0207671_10000133 | Ga0207671_100001331 | 544 |
| 506 | 3300025924 | Ga0207694_10013035 | Ga0207694_100130351 | 544 |
| 507 | 3300025949 | Ga0207667_10026184 | Ga0207667_100261841 | 544 |
| 508 | 3300025981 | Ga0207640_10010107 | Ga0207640_100101071 | 544 |
| 509 | 3300026041 | Ga0207639_10018528 | Ga0207639_100185283 | 544 |
| 510 | 3300026078 | Ga0207702_10045834 | Ga0207702_100458341 | 544 |
| 511 | 3300031727 | Ga0316576_10000275 | Ga0316576_1000027516 | 544 |
| 512 | 3300031727 | Ga0316576_10038342 | Ga0316576_100383422 | 544 |
| 513 | 3300031728 | Ga0316578_10013053 | Ga0316578_100130532 | 544 |
| 514 | 3300031995 | Ga0307409_100215234 | Ga0307409_1002152341 | 544 |
| 515 | 3300033180 | Ga0307510_10037066 | Ga0307510_100370661 | 544 |
| 516 | 3300035398 | Ga0316574_0000641 | Ga0316574_0000641_661_2295 | 544 |
| 517 | 3300036647 | Ga0316582_0069879 | Ga0316582_0069879_389_2023 | 544 |
| 518 | 3300037312 | Ga0395899_0015433 | Ga0395899_0015433_457_2091 | 544 |
| 519 | 3300044656 | Ga0466969_0045608 | Ga0466969_0045608_338_1972 | 544 |
| 520 | 3300044693 | Ga0466961_0005498 | Ga0466961_0005498_859_2493 | 544 |
| 521 | 3300045049 | Ga0466959_0032776 | Ga0466959_0032776_720_2354 | 544 |
| 522 | 3300046459 | Ga0495629_0047846 | Ga0495629_0047846_1004_2656 | 544 |
| 523 | 3300046462 | Ga0495651_0049344 | Ga0495651_0049344_1512_3158 | 544 |
| 524 | 3300046462 | Ga0495651_0082590 | Ga0495651_0082590_279_1919 | 544 |
| 525 | 3300046476 | Ga0495662_0034463 | Ga0495662_0034463_355_1989 | 544 |
| 526 | 3300046499 | Ga0495594_0025469 | Ga0495594_0025469_57_1709 | 544 |
| 527 | 3300046516 | Ga0495628_0008126 | Ga0495628_0008126_7285_8931 | 544 |
| 528 | 3300046529 | Ga0495652_0035283 | Ga0495652_0035283_902_2548 | 544 |
| 529 | 3300046642 | Ga0495634_0000538 | Ga0495634_0000538_11320_12960 | 544 |
| 530 | 3300047317 | Ga0495604_0000208 | Ga0495604_0000208_35936_37576 | 544 |
| 531 | 3300047317 | Ga0495604_0017173 | Ga0495604_0017173_2847_4481 | 544 |
| 532 | 3300047317 | Ga0495604_0096871 | Ga0495604_0096871_253_1905 | 544 |
| 533 | 3300047444 | Ga0495675_0008267 | Ga0495675_0008267_308_1942 | 544 |
| 534 | 3300048903 | Ga0496100_0010739 | Ga0496100_0010739_1484_3136 | 544 |
| 535 | 3300048905 | Ga0496102_0002970 | Ga0496102_0002970_699_2351 | 544 |
| 536 | 3300048907 | Ga0496104_0043331 | Ga0496104_0043331_765_2417 | 544 |
| 537 | 3300048907 | Ga0496104_0201815 | Ga0496104_0201815_217_1869 | 544 |
| 538 | 3300048908 | Ga0496105_0027549 | Ga0496105_0027549_2892_4544 | 544 |
| 539 | 3300048908 | Ga0496105_0028414 | Ga0496105_0028414_937_2589 | 544 |
| 540 | 3300048908 | Ga0496105_0030463 | Ga0496105_0030463_1807_3468 | 544 |
| 541 | 3300048912 | Ga0496109_0034841 | Ga0496109_0034841_1552_3204 | 544 |
| 542 | 3300048914 | Ga0496111_0060026 | Ga0496111_0060026_451_2103 | 544 |
| 543 | 3300048914 | Ga0496111_0084710 | Ga0496111_0084710_71_1723 | 544 |
| 544 | 3300048915 | Ga0496112_0040976 | Ga0496112_0040976_1993_3645 | 544 |
| 545 | 3300048917 | Ga0496114_0015739 | Ga0496114_0015739_4390_6042 | 544 |
| 546 | 3300048917 | Ga0496114_0059098 | Ga0496114_0059098_1453_3105 | 544 |
| 547 | 3300049568 | Ga0501031_0020631 | Ga0501031_0020631_224_1930 | 544 |
| 548 | 3300049569 | Ga0501032_0044961 | Ga0501032_0044961_1058_2764 | 544 |
| 549 | 3300049570 | Ga0501033_0025673 | Ga0501033_0025673_2708_4414 | 544 |
| 550 | 3300049571 | Ga0501034_0104433 | Ga0501034_0104433_224_1930 | 544 |
| 551 | 3300049572 | Ga0501036_0051342 | Ga0501036_0051342_1777_3411 | 544 |
| 552 | 3300049572 | Ga0501036_0090298 | Ga0501036_0090298_520_2172 | 544 |
| 553 | 3300049573 | Ga0501037_0067903 | Ga0501037_0067903_666_2372 | 544 |
| 554 | 3300049574 | Ga0501038_0017750 | Ga0501038_0017750_243_1949 | 544 |
| 555 | 3300049574 | Ga0501038_0067130 | Ga0501038_0067130_195_1829 | 544 |
| 556 | 3300049574 | Ga0501038_0134163 | Ga0501038_0134163_193_1845 | 544 |
| 557 | 3300049575 | Ga0501039_0032375 | Ga0501039_0032375_1334_2968 | 544 |
| 558 | 3300049575 | Ga0501039_0054131 | Ga0501039_0054131_232_1884 | 544 |
| 559 | 3300049575 | Ga0501039_0075308 | Ga0501039_0075308_585_2291 | 544 |
| 560 | 3300049576 | Ga0501040_0004044 | Ga0501040_0004044_7394_9028 | 544 |
| 561 | 3300049576 | Ga0501040_0072055 | Ga0501040_0072055_342_1994 | 544 |
| 562 | 3300049577 | Ga0501041_0011207 | Ga0501041_0011207_768_2474 | 544 |
| 563 | 3300049577 | Ga0501041_0015065 | Ga0501041_0015065_1836_3488 | 544 |
| 564 | 3300049578 | Ga0501042_0002756 | Ga0501042_0002756_1109_2743 | 544 |
| 565 | 3300049578 | Ga0501042_0030318 | Ga0501042_0030318_190_1842 | 544 |
| 566 | 3300049579 | Ga0501043_0132321 | Ga0501043_0132321_25_1731 | 544 |
| 567 | 3300049580 | Ga0501046_0039506 | Ga0501046_0039506_463_2115 | 544 |
| 568 | 3300049580 | Ga0501046_0060243 | Ga0501046_0060243_224_1930 | 544 |
| 569 | 3300049581 | Ga0501047_0035672 | Ga0501047_0035672_943_2649 | 544 |
| 570 | 3300049582 | Ga0501048_0082826 | Ga0501048_0082826_224_1930 | 544 |
| 571 | 3300049583 | Ga0501067_0005483 | Ga0501067_0005483_843_2549 | 544 |
| 572 | 3300049584 | Ga0501068_0014086 | Ga0501068_0014086_2708_4414 | 544 |
| 573 | 3300049585 | Ga0501069_0011669 | Ga0501069_0011669_25_1731 | 544 |
| 574 | 3300049586 | Ga0501070_0105502 | Ga0501070_0105502_400_2106 | 544 |
| 575 | 3300049587 | Ga0501071_0007246 | Ga0501071_0007246_184_1818 | 544 |
| 576 | 3300049588 | Ga0501072_0001898 | Ga0501072_0001898_844_2550 | 544 |
| 577 | 3300049588 | Ga0501072_0043624 | Ga0501072_0043624_363_1997 | 544 |
| 578 | 3300049591 | Ga0501075_0071812 | Ga0501075_0071812_635_2269 | 544 |
| 579 | 3300049591 | Ga0501075_0097485 | Ga0501075_0097485_82_1734 | 544 |
| 580 | 3300049592 | Ga0501076_0069645 | Ga0501076_0069645_768_2474 | 544 |
| 581 | 3300049592 | Ga0501076_0085437 | Ga0501076_0085437_645_2279 | 544 |
| 582 | 3300049593 | Ga0501077_0057380 | Ga0501077_0057380_637_2343 | 544 |
| 583 | 3300049593 | Ga0501077_0080723 | Ga0501077_0080723_47_1681 | 544 |
| 584 | 3300049741 | Ga0501079_0158442 | Ga0501079_0158442_34_1740 | 544 |
| 585 | 3300049743 | Ga0501081_0054786 | Ga0501081_0054786_449_2101 | 544 |
| 586 | 3300049744 | Ga0501083_0001087 | Ga0501083_0001087_9598_11304 | 544 |
| 587 | 3300049822 | Ga0501035_0030934 | Ga0501035_0030934_562_2214 | 544 |
| 588 | 3300049822 | Ga0501035_0046327 | Ga0501035_0046327_286_1938 | 544 |
| 589 | 3300049822 | Ga0501035_0097201 | Ga0501035_0097201_657_2363 | 544 |
| 590 | 3300049823 | Ga0501044_0045856 | Ga0501044_0045856_2293_3936 | 544 |
| 591 | 3300049823 | Ga0501044_0119261 | Ga0501044_0119261_711_2417 | 544 |
| 592 | 3300049824 | Ga0501045_0055962 | Ga0501045_0055962_274_1908 | 544 |
| 593 | 3300049824 | Ga0501045_0066916 | Ga0501045_0066916_708_2414 | 544 |
| 594 | 3300054114 | Ga0501084_0020023 | Ga0501084_0020023_3548_5254 | 544 |
| 595 | 3300054114 | Ga0501084_0075315 | Ga0501084_0075315_828_2462 | 544 |
| 596 | 3300060353 | Ga0501082_0075521 | Ga0501082_0075521_741_2447 | 544 |
| 597 | 3300060353 | Ga0501082_0101392 | Ga0501082_0101392_53_1705 | 544 |
| 598 | 3300061734 | Ga0530510_0069102 | Ga0530510_0069102_601_2307 | 544 |
| 599 | 3300061734 | Ga0530510_0070232 | Ga0530510_0070232_368_2020 | 544 |
| 600 | iso_pu_bacteria | 2643221678 | 2644437204 | 544 |
| 601 | iso_pu_bacteria | 2643221714 | 2644628946 | 544 |
| 602 | iso_pu_bacteria | 2675903060 | 2676495909 | 544 |
| 603 | iso_pu_bacteria | 2808606359 | 2808842103 | 544 |
| 604 | iso_pu_bacteria | 2946072368 | 2946075962 | 544 |
| 605 | 3300001989 | JGI24739J22299_10013586 | JGI24739J22299_100135862 | 545 |
| 606 | 3300001989 | JGI24739J22299_10016409 | JGI24739J22299_100164092 | 545 |
| 607 | 3300003285 | Ga0007423J48922_100648 | Ga0007423J48922_1006482 | 545 |
| 608 | 3300003354 | JGI25160J50197_1007167 | JGI25160J50197_10071671 | 545 |
| 609 | 3300003578 | Ga0006562J51391_1037344 | Ga0006562J51391_10373442 | 545 |
| 610 | 3300003578 | Ga0006562J51391_1071059 | Ga0006562J51391_10710592 | 545 |
| 611 | 3300006042 | Ga0075368_10017943 | Ga0075368_100179431 | 545 |
| 612 | 3300006178 | Ga0075367_10079245 | Ga0075367_100792451 | 545 |
| 613 | 3300009011 | Ga0105251_10013865 | Ga0105251_100138652 | 545 |
| 614 | 3300009177 | Ga0105248_10140826 | Ga0105248_101408262 | 545 |
| 615 | 3300011119 | Ga0105246_10001000 | Ga0105246_100010008 | 545 |
| 616 | 3300015688 | Ga0183367_1005 | Ga0183367_1005182 | 545 |
| 617 | 3300025297 | Ga0209758_1005903 | Ga0209758_10059037 | 545 |
| 618 | 3300025302 | Ga0207426_1001574 | Ga0207426_10015747 | 545 |
| 619 | 3300025302 | Ga0207426_1002948 | Ga0207426_10029482 | 545 |
| 620 | 3300025735 | Ga0207713_1030611 | Ga0207713_10306112 | 545 |
| 621 | 3300025904 | Ga0207647_10005104 | Ga0207647_100051045 | 545 |
| 622 | 3300025935 | Ga0207709_10026849 | Ga0207709_100268493 | 545 |
| 623 | 3300025941 | Ga0207711_10103018 | Ga0207711_101030182 | 545 |
| 624 | 3300027312 | Ga0209371_1009379 | Ga0209371_10093793 | 545 |
| 625 | 3300027866 | Ga0209813_10002898 | Ga0209813_100028983 | 545 |
| 626 | 3300028786 | Ga0307517_10013607 | Ga0307517_100136073 | 545 |
| 627 | 3300028794 | Ga0307515_10000732 | Ga0307515_1000073210 | 545 |
| 628 | 3300028794 | Ga0307515_10094610 | Ga0307515_100946103 | 545 |
| 629 | 3300030500 | Ga0268256_1015470 | Ga0268256_10154702 | 545 |
| 630 | 3300030521 | Ga0307511_10001033 | Ga0307511_1000103328 | 545 |
| 631 | 3300030522 | Ga0307512_10002037 | Ga0307512_1000203718 | 545 |
| 632 | 3300030522 | Ga0307512_10046544 | Ga0307512_100465443 | 545 |
| 633 | 3300031456 | Ga0307513_10016986 | Ga0307513_100169864 | 545 |
| 634 | 3300031456 | Ga0307513_10075096 | Ga0307513_100750963 | 545 |
| 635 | 3300031507 | Ga0307509_10013840 | Ga0307509_100138403 | 545 |
| 636 | 3300032002 | Ga0307416_100025102 | Ga0307416_1000251022 | 545 |
| 637 | 3300033180 | Ga0307510_10036910 | Ga0307510_100369103 | 545 |
| 638 | 3300033180 | Ga0307510_10063878 | Ga0307510_100638782 | 545 |
| 639 | 3300037466 | Ga0395898_0005536 | Ga0395898_0005536_11578_13227 | 545 |
| 640 | 3300037466 | Ga0395898_0007727 | Ga0395898_0007727_3919_5586 | 545 |
| 641 | 3300037466 | Ga0395898_0025008 | Ga0395898_0025008_1612_3285 | 545 |
| 642 | 3300037853 | Ga0436364_0121658 | Ga0436364_0121658_1917_3554 | 545 |
| 643 | 3300038443 | Ga0395901_0057386 | Ga0395901_0057386_891_2558 | 545 |
| 644 | 3300041404 | Ga0439436_0001355 | Ga0439436_0001355_407_2050 | 545 |
| 645 | 3300041494 | Ga0451837_0835599 | Ga0451837_0835599_571_2235 | 545 |
| 646 | 3300042007 | Ga0439449_0001993 | Ga0439449_0001993_2914_4560 | 545 |
| 647 | 3300042012 | Ga0439455_0000218 | Ga0439455_0000218_5025_6674 | 545 |
| 648 | 3300042014 | Ga0439457_000372 | Ga0439457_000372_10169_11812 | 545 |
| 649 | 3300042014 | Ga0439457_001355 | Ga0439457_001355_4656_6311 | 545 |
| 650 | 3300042015 | Ga0439462_0011765 | Ga0439462_0011765_555_2198 | 545 |
| 651 | 3300042134 | Ga0450898_000187 | Ga0450898_000187_4883_6529 | 545 |
| 652 | 3300042138 | Ga0450903_000107 | Ga0450903_000107_15551_17200 | 545 |
| 653 | 3300042145 | Ga0450906_000549 | Ga0450906_000549_3628_5271 | 545 |
| 654 | 3300042157 | Ga0439458_0000589 | Ga0439458_0000589_6787_8436 | 545 |
| 655 | 3300044658 | Ga0466972_0007384 | Ga0466972_0007384_2538_4220 | 545 |
| 656 | 3300044658 | Ga0466972_0011623 | Ga0466972_0011623_2090_3742 | 545 |
| 657 | 3300044683 | Ga0466965_0011800 | Ga0466965_0011800_1562_3244 | 545 |
| 658 | 3300044684 | Ga0466966_0004330 | Ga0466966_0004330_2073_3755 | 545 |
| 659 | 3300044693 | Ga0466961_0007410 | Ga0466961_0007410_2622_4268 | 545 |
| 660 | 3300044694 | Ga0466963_0006524 | Ga0466963_0006524_677_2410 | 545 |
| 661 | 3300044706 | Ga0466964_0000503 | Ga0466964_0000503_3484_5166 | 545 |
| 662 | 3300044719 | Ga0466971_0017204 | Ga0466971_0017204_372_2018 | 545 |
| 663 | 3300044735 | Ga0466968_0011444 | Ga0466968_0011444_996_2642 | 545 |
| 664 | 3300044765 | Ga0466970_0002452 | Ga0466970_0002452_5557_7239 | 545 |
| 665 | 3300044765 | Ga0466970_0003859 | Ga0466970_0003859_1761_3404 | 545 |
| 666 | 3300044901 | Ga0466960_0010191 | Ga0466960_0010191_1379_3031 | 545 |
| 667 | 3300045049 | Ga0466959_0000404 | Ga0466959_0000404_11604_13286 | 545 |
| 668 | 3300045836 | Ga0466958_0008928 | Ga0466958_0008928_2390_4072 | 545 |
| 669 | 3300046453 | Ga0495627_009577 | Ga0495627_009577_484_2127 | 545 |
| 670 | 3300046455 | Ga0495603_0000568 | Ga0495603_0000568_6295_7932 | 545 |
| 671 | 3300046455 | Ga0495603_0000900 | Ga0495603_0000900_124_1767 | 545 |
| 672 | 3300046455 | Ga0495603_0001369 | Ga0495603_0001369_7636_9279 | 545 |
| 673 | 3300046455 | Ga0495603_0002351 | Ga0495603_0002351_7493_9136 | 545 |
| 674 | 3300046455 | Ga0495603_0005879 | Ga0495603_0005879_1606_3252 | 545 |
| 675 | 3300046459 | Ga0495629_0002068 | Ga0495629_0002068_1603_3246 | 545 |
| 676 | 3300046459 | Ga0495629_0004829 | Ga0495629_0004829_748_2400 | 545 |
| 677 | 3300046459 | Ga0495629_0012678 | Ga0495629_0012678_567_2210 | 545 |
| 678 | 3300046460 | Ga0495638_0049126 | Ga0495638_0049126_423_2075 | 545 |
| 679 | 3300046472 | Ga0495580_0077511 | Ga0495580_0077511_124_1767 | 545 |
| 680 | 3300046474 | Ga0495605_0002215 | Ga0495605_0002215_1771_3414 | 545 |
| 681 | 3300046476 | Ga0495662_0001163 | Ga0495662_0001163_10325_11977 | 545 |
| 682 | 3300046491 | Ga0495584_0027505 | Ga0495584_0027505_1082_2725 | 545 |
| 683 | 3300046492 | Ga0495585_0015186 | Ga0495585_0015186_348_2000 | 545 |
| 684 | 3300046499 | Ga0495594_0004425 | Ga0495594_0004425_837_2483 | 545 |
| 685 | 3300046499 | Ga0495594_0048816 | Ga0495594_0048816_354_1997 | 545 |
| 686 | 3300046501 | Ga0495607_0026057 | Ga0495607_0026057_1522_3165 | 545 |
| 687 | 3300046513 | Ga0495616_0008761 | Ga0495616_0008761_332_1975 | 545 |
| 688 | 3300046515 | Ga0495620_0003173 | Ga0495620_0003173_7642_9285 | 545 |
| 689 | 3300046518 | Ga0495631_0005774 | Ga0495631_0005774_3058_4701 | 545 |
| 690 | 3300046520 | Ga0495637_0033247 | Ga0495637_0033247_340_1983 | 545 |
| 691 | 3300046522 | Ga0495643_0007450 | Ga0495643_0007450_627_2270 | 545 |
| 692 | 3300046526 | Ga0495666_0018950 | Ga0495666_0018950_1439_3082 | 545 |
| 693 | 3300046529 | Ga0495652_0016537 | Ga0495652_0016537_4667_6319 | 545 |
| 694 | 3300046529 | Ga0495652_0032037 | Ga0495652_0032037_2062_3705 | 545 |
| 695 | 3300046530 | Ga0495654_0010771 | Ga0495654_0010771_2087_3730 | 545 |
| 696 | 3300046536 | Ga0495587_0013224 | Ga0495587_0013224_3362_5014 | 545 |
| 697 | 3300046542 | Ga0495597_0006873 | Ga0495597_0006873_2495_4138 | 545 |
| 698 | 3300046557 | Ga0495622_0003939 | Ga0495622_0003939_3300_4943 | 545 |
| 699 | 3300046558 | Ga0495633_0016083 | Ga0495633_0016083_946_2589 | 545 |
| 700 | 3300046616 | Ga0495668_0006268 | Ga0495668_0006268_1771_3414 | 545 |
| 701 | 3300046642 | Ga0495634_0101559 | Ga0495634_0101559_35_1678 | 545 |
| 702 | 3300046648 | Ga0495611_0031831 | Ga0495611_0031831_331_1974 | 545 |
| 703 | 3300046660 | Ga0495625_0007428 | Ga0495625_0007428_1978_3621 | 545 |
| 704 | 3300046660 | Ga0495625_0020111 | Ga0495625_0020111_668_2317 | 545 |
| 705 | 3300046663 | Ga0495635_0027825 | Ga0495635_0027825_1067_2710 | 545 |
| 706 | 3300046665 | Ga0495661_0014582 | Ga0495661_0014582_1649_3292 | 545 |
| 707 | 3300046674 | Ga0495588_0006246 | Ga0495588_0006246_3458_5101 | 545 |
| 708 | 3300046675 | Ga0495657_0016677 | Ga0495657_0016677_3549_5201 | 545 |
| 709 | 3300046680 | Ga0495646_0001920 | Ga0495646_0001920_10243_11895 | 545 |
| 710 | 3300046689 | Ga0495613_0013738 | Ga0495613_0013738_1127_2773 | 545 |
| 711 | 3300046694 | Ga0495649_0023208 | Ga0495649_0023208_1678_3321 | 545 |
| 712 | 3300046694 | Ga0495649_0032929 | Ga0495649_0032929_254_1906 | 545 |
| 713 | 3300046694 | Ga0495649_0058085 | Ga0495649_0058085_122_1855 | 545 |
| 714 | 3300047317 | Ga0495604_0047728 | Ga0495604_0047728_934_2577 | 545 |
| 715 | 3300047321 | Ga0495676_0003615 | Ga0495676_0003615_4881_6524 | 545 |
| 716 | 3300047321 | Ga0495676_0005286 | Ga0495676_0005286_3846_5489 | 545 |
| 717 | 3300047321 | Ga0495676_0006839 | Ga0495676_0006839_3536_5188 | 545 |
| 718 | 3300047321 | Ga0495676_0007821 | Ga0495676_0007821_3769_5412 | 545 |
| 719 | 3300047443 | Ga0495687_002090 | Ga0495687_002090_3039_4694 | 545 |
| 720 | 3300047443 | Ga0495687_007214 | Ga0495687_007214_207_1850 | 545 |
| 721 | 3300047443 | Ga0495687_010803 | Ga0495687_010803_1455_3188 | 545 |
| 722 | 3300047447 | Ga0495685_001626 | Ga0495685_001626_4452_6176 | 545 |
| 723 | 3300047470 | Ga0495681_0001415 | Ga0495681_0001415_7873_9516 | 545 |
| 724 | 3300047472 | Ga0495686_0012334 | Ga0495686_0012334_309_1955 | 545 |
| 725 | 3300048089 | Ga0495614_0030369 | Ga0495614_0030369_198_1841 | 545 |
| 726 | 3300048909 | Ga0496106_0092415 | Ga0496106_0092415_509_2152 | 545 |
| 727 | 3300048912 | Ga0496109_0082608 | Ga0496109_0082608_1305_2951 | 545 |
| 728 | 3300048917 | Ga0496114_0207053 | Ga0496114_0207053_45_1700 | 545 |
| 729 | 3300049459 | Ga0495678_013219 | Ga0495678_013219_780_2423 | 545 |
| 730 | 3300049460 | Ga0495682_0035457 | Ga0495682_0035457_125_1768 | 545 |
| 731 | 3300049569 | Ga0501032_0085590 | Ga0501032_0085590_278_1927 | 545 |
| 732 | 3300049570 | Ga0501033_0021259 | Ga0501033_0021259_988_2679 | 545 |
| 733 | 3300049572 | Ga0501036_0019839 | Ga0501036_0019839_102_1754 | 545 |
| 734 | 3300049572 | Ga0501036_0027031 | Ga0501036_0027031_38_1690 | 545 |
| 735 | 3300049572 | Ga0501036_0063006 | Ga0501036_0063006_1386_3035 | 545 |
| 736 | 3300049574 | Ga0501038_0003501 | Ga0501038_0003501_2761_4407 | 545 |
| 737 | 3300049575 | Ga0501039_0038612 | Ga0501039_0038612_123_1775 | 545 |
| 738 | 3300049576 | Ga0501040_0004700 | Ga0501040_0004700_4418_6055 | 545 |
| 739 | 3300049577 | Ga0501041_0001255 | Ga0501041_0001255_8337_9974 | 545 |
| 740 | 3300049578 | Ga0501042_0073307 | Ga0501042_0073307_21_1670 | 545 |
| 741 | 3300049580 | Ga0501046_0005851 | Ga0501046_0005851_5336_6973 | 545 |
| 742 | 3300049580 | Ga0501046_0021972 | Ga0501046_0021972_2627_4276 | 545 |
| 743 | 3300049580 | Ga0501046_0118369 | Ga0501046_0118369_219_1868 | 545 |
| 744 | 3300049581 | Ga0501047_0044079 | Ga0501047_0044079_300_1949 | 545 |
| 745 | 3300049581 | Ga0501047_0080339 | Ga0501047_0080339_39_1691 | 545 |
| 746 | 3300049582 | Ga0501048_0000461 | Ga0501048_0000461_23703_25340 | 545 |
| 747 | 3300049582 | Ga0501048_0070547 | Ga0501048_0070547_627_2276 | 545 |
| 748 | 3300049584 | Ga0501068_0051515 | Ga0501068_0051515_121_1758 | 545 |
| 749 | 3300049586 | Ga0501070_0002053 | Ga0501070_0002053_15332_16984 | 545 |
| 750 | 3300049587 | Ga0501071_0144982 | Ga0501071_0144982_44_1681 | 545 |
| 751 | 3300049588 | Ga0501072_0004789 | Ga0501072_0004789_8307_9944 | 545 |
| 752 | 3300049590 | Ga0501074_0005958 | Ga0501074_0005958_5438_7090 | 545 |
| 753 | 3300049590 | Ga0501074_0010701 | Ga0501074_0010701_1895_3532 | 545 |
| 754 | 3300049591 | Ga0501075_0002633 | Ga0501075_0002633_9878_11515 | 545 |
| 755 | 3300049592 | Ga0501076_0007334 | Ga0501076_0007334_3562_5199 | 545 |
| 756 | 3300049741 | Ga0501079_0003415 | Ga0501079_0003415_4132_5769 | 545 |
| 757 | 3300049822 | Ga0501035_0011346 | Ga0501035_0011346_569_2206 | 545 |
| 758 | 3300049822 | Ga0501035_0063533 | Ga0501035_0063533_1542_3191 | 545 |
| 759 | 3300049822 | Ga0501035_0085074 | Ga0501035_0085074_1048_2700 | 545 |
| 760 | 3300049823 | Ga0501044_0000276 | Ga0501044_0000276_404_2056 | 545 |
| 761 | 3300049824 | Ga0501045_0001513 | Ga0501045_0001513_8708_10345 | 545 |
| 762 | 3300050494 | nmdc:mga06z11_12973_c1 | nmdc:mga06z11_12973_c1_1706_3370 | 545 |
| 763 | 3300050495 | nmdc:mga04h51_1118_c1 | nmdc:mga04h51_1118_c1_1664_3328 | 545 |
| 764 | 3300053085 | Ga0495619_0055148 | Ga0495619_0055148_179_1828 | 545 |
| 765 | 3300053088 | Ga0500644_0013971 | Ga0500644_0013971_284_1939 | 545 |
| 766 | 3300060353 | Ga0501082_0005284 | Ga0501082_0005284_884_2521 | 545 |
| 767 | 3300061719 | Ga0466962_0009517 | Ga0466962_0009517_447_2138 | 545 |
| 768 | 3300061719 | Ga0466962_0014116 | Ga0466962_0014116_1805_3451 | 545 |
| 769 | 3300061719 | Ga0466962_0021270 | Ga0466962_0021270_1353_3035 | 545 |
| 770 | 3300061734 | Ga0530510_0003072 | Ga0530510_0003072_990_2627 | 545 |
| 771 | iso_pu_bacteria | 2954002825 | 2954007337 | 545 |
| 772 | iso_pu_bacteria | 3006425503 | 3006428750 | 545 |
| 773 | iso_pu_bacteria | 8008574985 | 8008578838 | 545 |
| 774 | 3300001979 | JGI24740J21852_10007688 | JGI24740J21852_100076884 | 546 |
| 775 | 3300005345 | Ga0070692_10003408 | Ga0070692_100034084 | 546 |
| 776 | 3300005356 | Ga0070674_100011905 | Ga0070674_1000119054 | 546 |
| 777 | 3300005366 | Ga0070659_100016472 | Ga0070659_1000164723 | 546 |
| 778 | 3300005435 | Ga0070714_100018329 | Ga0070714_1000183294 | 546 |
| 779 | 3300005441 | Ga0070700_100009817 | Ga0070700_1000098172 | 546 |
| 780 | 3300005457 | Ga0070662_100061364 | Ga0070662_1000613642 | 546 |
| 781 | 3300005468 | Ga0070707_100154579 | Ga0070707_1001545792 | 546 |
| 782 | 3300005471 | Ga0070698_100003436 | Ga0070698_10000343612 | 546 |
| 783 | 3300005530 | Ga0070679_100025454 | Ga0070679_1000254545 | 546 |
| 784 | 3300005535 | Ga0070684_100047463 | Ga0070684_1000474633 | 546 |
| 785 | 3300005539 | Ga0068853_100063338 | Ga0068853_1000633383 | 546 |
| 786 | 3300005543 | Ga0070672_100012648 | Ga0070672_1000126484 | 546 |
| 787 | 3300005563 | Ga0068855_100022280 | Ga0068855_1000222803 | 546 |
| 788 | 3300005578 | Ga0068854_100119775 | Ga0068854_1001197752 | 546 |
| 789 | 3300005616 | Ga0068852_100016871 | Ga0068852_1000168711 | 546 |
| 790 | 3300005937 | Ga0081455_10004253 | Ga0081455_1000425313 | 546 |
| 791 | 3300005937 | Ga0081455_10006608 | Ga0081455_1000660810 | 546 |
| 792 | 3300005981 | Ga0081538_10005537 | Ga0081538_100055378 | 546 |
| 793 | 3300005983 | Ga0081540_1001898 | Ga0081540_100189813 | 546 |
| 794 | 3300005983 | Ga0081540_1013976 | Ga0081540_10139765 | 546 |
| 795 | 3300005985 | Ga0081539_10001811 | Ga0081539_1000181115 | 546 |
| 796 | 3300006038 | Ga0075365_10001344 | Ga0075365_100013448 | 546 |
| 797 | 3300006042 | Ga0075368_10000990 | Ga0075368_100009906 | 546 |
| 798 | 3300006048 | Ga0075363_100001385 | Ga0075363_1000013857 | 546 |
| 799 | 3300006058 | Ga0075432_10000054 | Ga0075432_100000548 | 546 |
| 800 | 3300006178 | Ga0075367_10003044 | Ga0075367_100030446 | 546 |
| 801 | 3300006178 | Ga0075367_10003546 | Ga0075367_100035462 | 546 |
| 802 | 3300006844 | Ga0075428_100005149 | Ga0075428_10000514911 | 546 |
| 803 | 3300006852 | Ga0075433_10001879 | Ga0075433_100018798 | 546 |
| 804 | 3300006852 | Ga0075433_10008214 | Ga0075433_100082147 | 546 |
| 805 | 3300006871 | Ga0075434_100001494 | Ga0075434_10000149412 | 546 |
| 806 | 3300006871 | Ga0075434_100010605 | Ga0075434_1000106053 | 546 |
| 807 | 3300006914 | Ga0075436_100000397 | Ga0075436_10000039716 | 546 |
| 808 | 3300007076 | Ga0075435_100009820 | Ga0075435_1000098203 | 546 |
| 809 | 3300007076 | Ga0075435_100045473 | Ga0075435_1000454732 | 546 |
| 810 | 3300009093 | Ga0105240_10004795 | Ga0105240_100047955 | 546 |
| 811 | 3300009094 | Ga0111539_10001116 | Ga0111539_100011168 | 546 |
| 812 | 3300009094 | Ga0111539_10001701 | Ga0111539_100017019 | 546 |
| 813 | 3300009094 | Ga0111539_10051875 | Ga0111539_100518754 | 546 |
| 814 | 3300009147 | Ga0114129_10009337 | Ga0114129_1000933710 | 546 |
| 815 | 3300009148 | Ga0105243_10004589 | Ga0105243_100045895 | 546 |
| 816 | 3300009148 | Ga0105243_10018609 | Ga0105243_100186093 | 546 |
| 817 | 3300009176 | Ga0105242_10010498 | Ga0105242_100104985 | 546 |
| 818 | 3300009545 | Ga0105237_10101399 | Ga0105237_101013991 | 546 |
| 819 | 3300009553 | Ga0105249_10024119 | Ga0105249_100241193 | 546 |
| 820 | 3300009553 | Ga0105249_10042998 | Ga0105249_100429981 | 546 |
| 821 | 3300013104 | Ga0157370_10019952 | Ga0157370_100199523 | 546 |
| 822 | 3300013105 | Ga0157369_10049710 | Ga0157369_100497103 | 546 |
| 823 | 3300013105 | Ga0157369_10077141 | Ga0157369_100771412 | 546 |
| 824 | 3300013307 | Ga0157372_10168159 | Ga0157372_101681592 | 546 |
| 825 | 3300014326 | Ga0157380_10022443 | Ga0157380_100224431 | 546 |
| 826 | 3300020070 | Ga0206356_10246010 | Ga0206356_102460103 | 546 |
| 827 | 3300025901 | Ga0207688_10005132 | Ga0207688_100051325 | 546 |
| 828 | 3300025908 | Ga0207643_10002591 | Ga0207643_100025914 | 546 |
| 829 | 3300025909 | Ga0207705_10034687 | Ga0207705_100346873 | 546 |
| 830 | 3300025913 | Ga0207695_10020753 | Ga0207695_100207537 | 546 |
| 831 | 3300025914 | Ga0207671_10062856 | Ga0207671_100628561 | 546 |
| 832 | 3300025919 | Ga0207657_10023495 | Ga0207657_100234953 | 546 |
| 833 | 3300025922 | Ga0207646_10143064 | Ga0207646_101430641 | 546 |
| 834 | 3300025932 | Ga0207690_10028850 | Ga0207690_100288505 | 546 |
| 835 | 3300025933 | Ga0207706_10012759 | Ga0207706_100127595 | 546 |
| 836 | 3300025934 | Ga0207686_10041797 | Ga0207686_100417972 | 546 |
| 837 | 3300025935 | Ga0207709_10012912 | Ga0207709_100129122 | 546 |
| 838 | 3300025935 | Ga0207709_10041797 | Ga0207709_100417972 | 546 |
| 839 | 3300025937 | Ga0207669_10014430 | Ga0207669_100144303 | 546 |
| 840 | 3300025944 | Ga0207661_10090194 | Ga0207661_100901943 | 546 |
| 841 | 3300025949 | Ga0207667_10028691 | Ga0207667_100286913 | 546 |
| 842 | 3300025961 | Ga0207712_10039735 | Ga0207712_100397353 | 546 |
| 843 | 3300025972 | Ga0207668_10012275 | Ga0207668_100122751 | 546 |
| 844 | 3300025986 | Ga0207658_10028254 | Ga0207658_100282543 | 546 |
| 845 | 3300026075 | Ga0207708_10000420 | Ga0207708_100004204 | 546 |
| 846 | 3300026075 | Ga0207708_10067613 | Ga0207708_100676132 | 546 |
| 847 | 3300026078 | Ga0207702_10109043 | Ga0207702_101090432 | 546 |
| 848 | 3300026088 | Ga0207641_10142569 | Ga0207641_101425691 | 546 |
| 849 | 3300026089 | Ga0207648_10000985 | Ga0207648_1000098522 | 546 |
| 850 | 3300026116 | Ga0207674_10035403 | Ga0207674_100354031 | 546 |
| 851 | 3300026116 | Ga0207674_10061655 | Ga0207674_100616553 | 546 |
| 852 | 3300026116 | Ga0207674_10107618 | Ga0207674_101076183 | 546 |
| 853 | 3300026118 | Ga0207675_100002855 | Ga0207675_1000028553 | 546 |
| 854 | 3300027907 | Ga0207428_10000732 | Ga0207428_1000073212 | 546 |
| 855 | 3300027907 | Ga0207428_10008028 | Ga0207428_100080282 | 546 |
| 856 | 3300027907 | Ga0207428_10037470 | Ga0207428_100374702 | 546 |
| 857 | 3300028786 | Ga0307517_10037929 | Ga0307517_100379291 | 546 |
| 858 | 3300031247 | Ga0265340_10001671 | Ga0265340_100016717 | 546 |
| 859 | 3300031548 | Ga0307408_100007289 | Ga0307408_1000072893 | 546 |
| 860 | 3300031616 | Ga0307508_10035283 | Ga0307508_100352833 | 546 |
| 861 | 3300031691 | Ga0316579_10003809 | Ga0316579_100038092 | 546 |
| 862 | 3300031727 | Ga0316576_10004042 | Ga0316576_100040426 | 546 |
| 863 | 3300031728 | Ga0316578_10066381 | Ga0316578_100663811 | 546 |
| 864 | 3300031730 | Ga0307516_10017407 | Ga0307516_100174074 | 546 |
| 865 | 3300031824 | Ga0307413_10002149 | Ga0307413_1000214910 | 546 |
| 866 | 3300031824 | Ga0307413_10005023 | Ga0307413_100050235 | 546 |
| 867 | 3300031824 | Ga0307413_10005655 | Ga0307413_100056553 | 546 |
| 868 | 3300031824 | Ga0307413_10035772 | Ga0307413_100357722 | 546 |
| 869 | 3300031852 | Ga0307410_10000556 | Ga0307410_100005564 | 546 |
| 870 | 3300031852 | Ga0307410_10004130 | Ga0307410_100041303 | 546 |
| 871 | 3300031852 | Ga0307410_10045170 | Ga0307410_100451701 | 546 |
| 872 | 3300031852 | Ga0307410_10122649 | Ga0307410_101226491 | 546 |
| 873 | 3300031901 | Ga0307406_10000155 | Ga0307406_1000015524 | 546 |
| 874 | 3300031901 | Ga0307406_10063908 | Ga0307406_100639081 | 546 |
| 875 | 3300031903 | Ga0307407_10008027 | Ga0307407_100080274 | 546 |
| 876 | 3300031903 | Ga0307407_10036110 | Ga0307407_100361102 | 546 |
| 877 | 3300031911 | Ga0307412_10109300 | Ga0307412_101093001 | 546 |
| 878 | 3300031995 | Ga0307409_100012442 | Ga0307409_1000124422 | 546 |
| 879 | 3300031995 | Ga0307409_100123006 | Ga0307409_1001230062 | 546 |
| 880 | 3300032002 | Ga0307416_100053610 | Ga0307416_1000536102 | 546 |
| 881 | 3300032002 | Ga0307416_100067367 | Ga0307416_1000673671 | 546 |
| 882 | 3300032004 | Ga0307414_10022367 | Ga0307414_100223672 | 546 |
| 883 | 3300032004 | Ga0307414_10028782 | Ga0307414_100287822 | 546 |
| 884 | 3300032004 | Ga0307414_10104274 | Ga0307414_101042742 | 546 |
| 885 | 3300032005 | Ga0307411_10014304 | Ga0307411_100143043 | 546 |
| 886 | 3300032005 | Ga0307411_10047673 | Ga0307411_100476731 | 546 |
| 887 | 3300032126 | Ga0307415_100008469 | Ga0307415_1000084694 | 546 |
| 888 | 3300032126 | Ga0307415_100048632 | Ga0307415_1000486321 | 546 |
| 889 | 3300032126 | Ga0307415_100068610 | Ga0307415_1000686102 | 546 |
| 890 | 3300032137 | Ga0316585_10012441 | Ga0316585_100124412 | 546 |
| 891 | 3300035398 | Ga0316574_0103777 | Ga0316574_0103777_126_1778 | 546 |
| 892 | 3300036712 | Ga0316584_0001293 | Ga0316584_0001293_11975_13705 | 546 |
| 893 | 3300037418 | Ga0395900_0205433 | Ga0395900_0205433_67_1731 | 546 |
| 894 | 3300037466 | Ga0395898_0035997 | Ga0395898_0035997_2842_4485 | 546 |
| 895 | 3300038443 | Ga0395901_0007406 | Ga0395901_0007406_5181_6824 | 546 |
| 896 | 3300038443 | Ga0395901_0037134 | Ga0395901_0037134_1466_3130 | 546 |
| 897 | 3300038443 | Ga0395901_0049733 | Ga0395901_0049733_483_2126 | 546 |
| 898 | 3300038735 | Ga0400485_14478 | Ga0400485_14478_8816_10480 | 546 |
| 899 | 3300038742 | Ga0400486_12313 | Ga0400486_12313_1269_2933 | 546 |
| 900 | 3300041997 | Ga0439431_0001742 | Ga0439431_0001742_1562_3202 | 546 |
| 901 | 3300042004 | Ga0439445_0013224 | Ga0439445_0013224_187_1827 | 546 |
| 902 | 3300042005 | Ga0439448_0005088 | Ga0439448_0005088_1930_3591 | 546 |
| 903 | 3300042993 | Ga0439440_0001905 | Ga0439440_0001905_628_2289 | 546 |
| 904 | 3300042993 | Ga0439440_0006571 | Ga0439440_0006571_669_2330 | 546 |
| 905 | 3300044656 | Ga0466969_0002205 | Ga0466969_0002205_1392_3053 | 546 |
| 906 | 3300044658 | Ga0466972_0032132 | Ga0466972_0032132_558_2222 | 546 |
| 907 | 3300044683 | Ga0466965_0068253 | Ga0466965_0068253_106_1746 | 546 |
| 908 | 3300044693 | Ga0466961_0002231 | Ga0466961_0002231_2576_4228 | 546 |
| 909 | 3300044693 | Ga0466961_0002683 | Ga0466961_0002683_4083_5744 | 546 |
| 910 | 3300044719 | Ga0466971_0046236 | Ga0466971_0046236_191_1831 | 546 |
| 911 | 3300044842 | Ga0466957_0002626 | Ga0466957_0002626_7709_9349 | 546 |
| 912 | 3300044842 | Ga0466957_0005920 | Ga0466957_0005920_1092_2777 | 546 |
| 913 | 3300044901 | Ga0466960_0007762 | Ga0466960_0007762_1206_2849 | 546 |
| 914 | 3300045836 | Ga0466958_0006615 | Ga0466958_0006615_3187_4872 | 546 |
| 915 | 3300045836 | Ga0466958_0033825 | Ga0466958_0033825_115_1761 | 546 |
| 916 | 3300045836 | Ga0466958_0067998 | Ga0466958_0067998_232_1872 | 546 |
| 917 | 3300045976 | Ga0466967_0019690 | Ga0466967_0019690_2152_3801 | 546 |
| 918 | 3300045976 | Ga0466967_0091223 | Ga0466967_0091223_1114_2754 | 546 |
| 919 | 3300045976 | Ga0466967_0127237 | Ga0466967_0127237_322_1962 | 546 |
| 920 | 3300045976 | Ga0466967_0199728 | Ga0466967_0199728_50_1735 | 546 |
| 921 | 3300046454 | Ga0495592_0001633 | Ga0495592_0001633_6311_7963 | 546 |
| 922 | 3300046476 | Ga0495662_0000587 | Ga0495662_0000587_5215_6867 | 546 |
| 923 | 3300046492 | Ga0495585_0044475 | Ga0495585_0044475_632_2272 | 546 |
| 924 | 3300046511 | Ga0495608_0022842 | Ga0495608_0022842_1922_3574 | 546 |
| 925 | 3300046522 | Ga0495643_0002929 | Ga0495643_0002929_3627_5510 | 546 |
| 926 | 3300046525 | Ga0495663_0022457 | Ga0495663_0022457_92_1753 | 546 |
| 927 | 3300046526 | Ga0495666_0001372 | Ga0495666_0001372_3838_5490 | 546 |
| 928 | 3300046531 | Ga0495665_0019191 | Ga0495665_0019191_203_1855 | 546 |
| 929 | 3300046533 | Ga0495640_0029284 | Ga0495640_0029284_254_1906 | 546 |
| 930 | 3300046535 | Ga0495586_0021797 | Ga0495586_0021797_208_1860 | 546 |
| 931 | 3300046536 | Ga0495587_0002070 | Ga0495587_0002070_2704_4356 | 546 |
| 932 | 3300046543 | Ga0495645_0004013 | Ga0495645_0004013_5295_6947 | 546 |
| 933 | 3300046543 | Ga0495645_0004306 | Ga0495645_0004306_5207_6859 | 546 |
| 934 | 3300046559 | Ga0495667_0022051 | Ga0495667_0022051_1923_3575 | 546 |
| 935 | 3300046615 | Ga0495656_0032577 | Ga0495656_0032577_164_1825 | 546 |
| 936 | 3300046675 | Ga0495657_0003095 | Ga0495657_0003095_5773_7425 | 546 |
| 937 | 3300046678 | Ga0495599_0012852 | Ga0495599_0012852_671_2323 | 546 |
| 938 | 3300046680 | Ga0495646_0000377 | Ga0495646_0000377_15618_17270 | 546 |
| 939 | 3300046683 | Ga0495658_0010862 | Ga0495658_0010862_528_2204 | 546 |
| 940 | 3300046794 | Ga0495589_0014667 | Ga0495589_0014667_1055_2938 | 546 |
| 941 | 3300046810 | Ga0495660_0018871 | Ga0495660_0018871_2132_3772 | 546 |
| 942 | 3300047317 | Ga0495604_0000705 | Ga0495604_0000705_5046_6698 | 546 |
| 943 | 3300047319 | Ga0495674_0007626 | Ga0495674_0007626_1802_3454 | 546 |
| 944 | 3300047323 | Ga0495683_0020101 | Ga0495683_0020101_833_2716 | 546 |
| 945 | 3300047444 | Ga0495675_0017903 | Ga0495675_0017903_2586_4238 | 546 |
| 946 | 3300047470 | Ga0495681_0004205 | Ga0495681_0004205_3468_5351 | 546 |
| 947 | 3300047673 | Ga0495593_0005711 | Ga0495593_0005711_4549_6201 | 546 |
| 948 | 3300048906 | Ga0496103_0034498 | Ga0496103_0034498_206_1849 | 546 |
| 949 | 3300048907 | Ga0496104_0106519 | Ga0496104_0106519_351_1994 | 546 |
| 950 | 3300048913 | Ga0496110_0061572 | Ga0496110_0061572_1632_3275 | 546 |
| 951 | 3300048913 | Ga0496110_0116103 | Ga0496110_0116103_224_1867 | 546 |
| 952 | 3300048914 | Ga0496111_0000658 | Ga0496111_0000658_5100_6764 | 546 |
| 953 | 3300048916 | Ga0496113_0024211 | Ga0496113_0024211_2012_3655 | 546 |
| 954 | 3300048925 | Ga0496122_0001743 | Ga0496122_0001743_31506_33161 | 546 |
| 955 | 3300048928 | Ga0496125_0000015 | Ga0496125_0000015_439638_441293 | 546 |
| 956 | 3300049568 | Ga0501031_0061773 | Ga0501031_0061773_745_2427 | 546 |
| 957 | 3300049568 | Ga0501031_0112861 | Ga0501031_0112861_84_1730 | 546 |
| 958 | 3300049569 | Ga0501032_0009201 | Ga0501032_0009201_2495_4177 | 546 |
| 959 | 3300049569 | Ga0501032_0026687 | Ga0501032_0026687_2033_3679 | 546 |
| 960 | 3300049570 | Ga0501033_0010371 | Ga0501033_0010371_1048_2688 | 546 |
| 961 | 3300049571 | Ga0501034_0087533 | Ga0501034_0087533_387_2069 | 546 |
| 962 | 3300049572 | Ga0501036_0008125 | Ga0501036_0008125_3876_5558 | 546 |
| 963 | 3300049572 | Ga0501036_0009768 | Ga0501036_0009768_4555_6210 | 546 |
| 964 | 3300049572 | Ga0501036_0019288 | Ga0501036_0019288_778_2463 | 546 |
| 965 | 3300049573 | Ga0501037_0001612 | Ga0501037_0001612_7210_8865 | 546 |
| 966 | 3300049573 | Ga0501037_0014649 | Ga0501037_0014649_2574_4226 | 546 |
| 967 | 3300049573 | Ga0501037_0089567 | Ga0501037_0089567_478_2163 | 546 |
| 968 | 3300049574 | Ga0501038_0005244 | Ga0501038_0005244_9821_11476 | 546 |
| 969 | 3300049574 | Ga0501038_0026104 | Ga0501038_0026104_1613_3265 | 546 |
| 970 | 3300049574 | Ga0501038_0089180 | Ga0501038_0089180_39_1721 | 546 |
| 971 | 3300049575 | Ga0501039_0023860 | Ga0501039_0023860_785_2470 | 546 |
| 972 | 3300049576 | Ga0501040_0001847 | Ga0501040_0001847_7586_9271 | 546 |
| 973 | 3300049576 | Ga0501040_0065715 | Ga0501040_0065715_217_1863 | 546 |
| 974 | 3300049578 | Ga0501042_0005112 | Ga0501042_0005112_177_1868 | 546 |
| 975 | 3300049578 | Ga0501042_0011371 | Ga0501042_0011371_2966_4621 | 546 |
| 976 | 3300049578 | Ga0501042_0054966 | Ga0501042_0054966_1142_2794 | 546 |
| 977 | 3300049579 | Ga0501043_0003443 | Ga0501043_0003443_4026_5681 | 546 |
| 978 | 3300049579 | Ga0501043_0008977 | Ga0501043_0008977_5464_7224 | 546 |
| 979 | 3300049579 | Ga0501043_0018266 | Ga0501043_0018266_1703_3355 | 546 |
| 980 | 3300049579 | Ga0501043_0077718 | Ga0501043_0077718_872_2554 | 546 |
| 981 | 3300049580 | Ga0501046_0000982 | Ga0501046_0000982_11447_13102 | 546 |
| 982 | 3300049580 | Ga0501046_0007054 | Ga0501046_0007054_3601_5256 | 546 |
| 983 | 3300049580 | Ga0501046_0019912 | Ga0501046_0019912_1466_3151 | 546 |
| 984 | 3300049580 | Ga0501046_0147897 | Ga0501046_0147897_105_1751 | 546 |
| 985 | 3300049581 | Ga0501047_0000033 | Ga0501047_0000033_25538_27223 | 546 |
| 986 | 3300049581 | Ga0501047_0023804 | Ga0501047_0023804_3755_5437 | 546 |
| 987 | 3300049581 | Ga0501047_0026519 | Ga0501047_0026519_1921_3573 | 546 |
| 988 | 3300049582 | Ga0501048_0004238 | Ga0501048_0004238_4239_5894 | 546 |
| 989 | 3300049582 | Ga0501048_0005799 | Ga0501048_0005799_5851_7503 | 546 |
| 990 | 3300049582 | Ga0501048_0022584 | Ga0501048_0022584_624_2264 | 546 |
| 991 | 3300049583 | Ga0501067_0044920 | Ga0501067_0044920_246_1895 | 546 |
| 992 | 3300049586 | Ga0501070_0038268 | Ga0501070_0038268_1002_2684 | 546 |
| 993 | 3300049587 | Ga0501071_0010676 | Ga0501071_0010676_3022_4707 | 546 |
| 994 | 3300049589 | Ga0501073_0063935 | Ga0501073_0063935_374_2020 | 546 |
| 995 | 3300049590 | Ga0501074_0019956 | Ga0501074_0019956_832_2484 | 546 |
| 996 | 3300049591 | Ga0501075_0051482 | Ga0501075_0051482_673_2358 | 546 |
| 997 | 3300049741 | Ga0501079_0010459 | Ga0501079_0010459_114_1754 | 546 |
| 998 | 3300049742 | Ga0501080_0074258 | Ga0501080_0074258_91_1776 | 546 |
| 999 | 3300049822 | Ga0501035_0000811 | Ga0501035_0000811_24123_25883 | 546 |
| 1000 | 3300049822 | Ga0501035_0024176 | Ga0501035_0024176_723_2369 | 546 |
| 1001 | 3300049822 | Ga0501035_0146795 | Ga0501035_0146795_197_1837 | 546 |
| 1002 | 3300049823 | Ga0501044_0004643 | Ga0501044_0004643_11535_13187 | 546 |
| 1003 | 3300049823 | Ga0501044_0007550 | Ga0501044_0007550_5487_7247 | 546 |
| 1004 | 3300049823 | Ga0501044_0017122 | Ga0501044_0017122_986_2632 | 546 |
| 1005 | 3300049823 | Ga0501044_0073855 | Ga0501044_0073855_1707_3389 | 546 |
| 1006 | 3300049824 | Ga0501045_0006789 | Ga0501045_0006789_3337_5022 | 546 |
| 1007 | 3300050492 | nmdc:mga0yw44_62861_c1 | nmdc:mga0yw44_62861_c1_144_1802 | 546 |
| 1008 | 3300050494 | nmdc:mga06z11_16123_c1 | nmdc:mga06z11_16123_c1_1515_3155 | 546 |
| 1009 | 3300050495 | nmdc:mga04h51_2319_c1 | nmdc:mga04h51_2319_c1_1832_3472 | 546 |
| 1010 | 3300050508 | nmdc:mga09592_9784_c1 | nmdc:mga09592_9784_c1_1164_2825 | 546 |
| 1011 | 3300050509 | nmdc:mga0qj67_38124_c1 | nmdc:mga0qj67_38124_c1_693_2354 | 546 |
| 1012 | 3300050510 | nmdc:mga06r32_115899_c1 | nmdc:mga06r32_115899_c1_602_2263 | 546 |
| 1013 | 3300050511 | nmdc:mga08y16_20013_c1 | nmdc:mga08y16_20013_c1_432_2093 | 546 |
| 1014 | 3300050512 | nmdc:mga0n895_9738_c1 | nmdc:mga0n895_9738_c1_1849_3510 | 546 |
| 1015 | 3300050513 | nmdc:mga0rr50_143841_c1 | nmdc:mga0rr50_143841_c1_82_1743 | 546 |
| 1016 | 3300050513 | nmdc:mga0rr50_1865_c1 | nmdc:mga0rr50_1865_c1_300_1961 | 546 |
| 1017 | 3300050515 | nmdc:mga0a205_1103_c1 | nmdc:mga0a205_1103_c1_5189_6850 | 546 |
| 1018 | 3300050515 | nmdc:mga0a205_620_c1 | nmdc:mga0a205_620_c1_5220_6881 | 546 |
| 1019 | 3300053078 | Ga0495612_0007274 | Ga0495612_0007274_366_2018 | 546 |
| 1020 | 3300053085 | Ga0495619_0010199 | Ga0495619_0010199_1393_3045 | 546 |
| 1021 | 3300053085 | Ga0495619_0047694 | Ga0495619_0047694_520_2181 | 546 |
| 1022 | 3300053094 | Ga0500566_0034520 | Ga0500566_0034520_365_2005 | 546 |
| 1023 | 3300053104 | Ga0500556_0002167 | Ga0500556_0002167_2591_4231 | 546 |
| 1024 | 3300053109 | Ga0500569_006125 | Ga0500569_006125_215_2098 | 546 |
| 1025 | 3300053117 | Ga0500593_006281 | Ga0500593_006281_2208_3848 | 546 |
| 1026 | 3300053131 | Ga0500652_015492 | Ga0500652_015492_782_2665 | 546 |
| 1027 | 3300053134 | Ga0500658_0007305 | Ga0500658_0007305_960_2600 | 546 |
| 1028 | 3300053137 | Ga0500561_0000279 | Ga0500561_0000279_4423_6306 | 546 |
| 1029 | 3300053149 | Ga0500600_0005651 | Ga0500600_0005651_3678_5561 | 546 |
| 1030 | 3300054114 | Ga0501084_0015340 | Ga0501084_0015340_3729_5414 | 546 |
| 1031 | 3300060353 | Ga0501082_0017650 | Ga0501082_0017650_779_2464 | 546 |
| 1032 | 3300061719 | Ga0466962_0036312 | Ga0466962_0036312_584_2224 | 546 |
| 1033 | 3300061734 | Ga0530510_0134374 | Ga0530510_0134374_75_1724 | 546 |
| 1034 | iso_pu_bacteria | 8025413630 | 8025417779 | 546 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ern-assembly1.cif.gz_A | crystal structure of the c-terminal domain of human xpb/ercc-3 excision repair protein at 1.80 a | 0.9079 | 358 | 540 |
| 5of4-assembly1.cif.gz_A | the cryo-em structure of human tfiih | 0.8463 | 144 | 540 |
| 8bvw-assembly1.cif.gz_0 | rna polymerase ii pre-initiation complex with the distal +1 nucleosome (pic-nuc18w) | 0.8331 | 2 | 543 |
| 8ebw-assembly1.cif.gz_A | initial dna-lesion (ap) binding by xpc and tfiih complex2 | 0.8306 | 1 | 540 |
| 7ad8-assembly1.cif.gz_A | core tfiih-xpa-dna complex with modelled p62 subunit | 0.8305 | 5 | 540 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53873_165_346_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9894 | 173 | 352 | 3.40.50.300 |
| af_O53873_165_346_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9733 | 173 | 352 | 3.40.50.300 |
| af_O53873_347_537_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.954 | 355 | 544 | 3.40.50.300 |
| af_O53873_347_537_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9444 | 355 | 544 | 3.40.50.300 |
| af_Q00578_544_774_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9048 | 354 | 544 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8LVG5-F1-model_v4 | deleted | 0.9777 | 1 | 395 |
|
| AF-A0A0R2Q6K5-F1-model_v4 | Helicase | 0.9755 | 1 | 367 |
GO:0003677
GO:0004386 GO:0005524 GO:0016787 |
| AF-A0A3D3KWG4-F1-model_v4 | Helicase | 0.9742 | 32 | 168 |
GO:0004386
|
| AF-A0A0R2Q6K5-F1-model_v4 | Helicase | 0.9729 | 1 | 367 |
GO:0003677
GO:0004386 GO:0005524 GO:0016787 |
| AF-A0A2S8LVG5-F1-model_v4 | deleted | 0.9728 | 1 | 395 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar