F488676

General Info

Members Datasets Scaffolds Average Seq Length
1034 331 2068 364

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10035996|Ga0207707_100359966
Length 349
Sequence MASTTAVDVVMPQMGVSVSEGTITKWSKNVGDTIEADETLLEISTDKVDTEVPSPASGVVTEILVQEGETVEVGTVLARIGGEAPAQAADNGKAFVSPVVARIAAEHGIDPSQIPGTGTGGRVTKKDIVAFVEGQAAAPTSLQPQAAGQGETLEPMSAMRRGIAEHMRRSLDTSAHVTSAIEVDMTRVVQIREKLKKEYQSAYGVNPTYLAFIARATVETLRDYPWVNGELRGDQIVTRNYVNLGFAVELADGKGLIVPNLKNAETLNLLGMAKGIAEIAKRARDKKLTPDDVAGGSFTITNPGGYGTFHGTPVISQPQAGILGTYAIVKRPWVITDESGADAIAIRSM

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
161 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
205 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
206 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
325 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
328 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
331 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.7
Rhizosphere 88.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10035996 3300025912 Bacteria 4328
2 Ga0070658_10048517 3300005327 Bacteria 3438
3 Ga0070658_10090251 3300005327 Bacteria 2524
4 Ga0070683_100001612 3300005329 Bacteria 17467
5 Ga0070683_100028245 3300005329 Bacteria 5069
6 Ga0070683_100031746 3300005329 Bacteria 4806
7 Ga0070683_100053781 3300005329 Bacteria 3731
8 Ga0070683_100107785 3300005329 Bacteria 2627
9 Ga0070690_100074147 3300005330 Bacteria 2216
10 Ga0070666_10044989 3300005335 Bacteria 2959
11 Ga0070666_10094012 3300005335 Bacteria 2062
12 Ga0070680_100001193 3300005336 Bacteria 18731
13 Ga0070680_100007929 3300005336 Bacteria 8101
14 Ga0070682_100018411 3300005337 Bacteria 4082
15 Ga0070682_100060420 3300005337 Bacteria 2397
16 Ga0068868_100027694 3300005338 Bacteria 4324
17 Ga0068868_100038181 3300005338 Bacteria 3727
18 Ga0068868_100121115 3300005338 Bacteria 2134
19 Ga0070660_100003043 3300005339 Bacteria 11544
20 Ga0070660_100007452 3300005339 Bacteria 7626
21 Ga0070660_100014797 3300005339 Bacteria 5629
22 Ga0070660_100062766 3300005339 Bacteria 2887
23 Ga0070689_100003195 3300005340 Bacteria 10846
24 Ga0070689_100080529 3300005340 Bacteria 2556
25 Ga0070691_10028892 3300005341 Bacteria 2593
26 Ga0070691_10037142 3300005341 Bacteria 2298
27 Ga0070691_10042030 3300005341 Bacteria 2163
28 Ga0070661_100040044 3300005344 Bacteria 3417
29 Ga0070661_100052069 3300005344 Bacteria 2997
30 Ga0070661_100060072 3300005344 Bacteria 2789
31 Ga0070661_100061907 3300005344 Bacteria 2747
32 Ga0070661_100076218 3300005344 Bacteria 2471
33 Ga0070692_10013638 3300005345 Bacteria 3793
34 Ga0070692_10067405 3300005345 Bacteria 1900
35 Ga0070675_100036864 3300005354 Bacteria 3981
36 Ga0070671_100039895 3300005355 Bacteria 3898
37 Ga0070674_100000543 3300005356 Bacteria 18923
38 Ga0070674_100015836 3300005356 Bacteria 4716
39 Ga0070674_100026295 3300005356 Bacteria 3799
40 Ga0070673_100011197 3300005364 Bacteria 6116
41 Ga0070688_100001134 3300005365 Bacteria 13349
42 Ga0070688_100008762 3300005365 Bacteria 5504
43 Ga0070659_100003675 3300005366 Bacteria 10938
44 Ga0070659_100014416 3300005366 Bacteria 5908
45 Ga0070714_100016781 3300005435 Bacteria 5920
46 Ga0070714_100020904 3300005435 Bacteria 5350
47 Ga0070714_100034628 3300005435 Bacteria 4229
48 Ga0070714_100054193 3300005435 Bacteria 3425
49 Ga0070714_100070067 3300005435 Bacteria 3030
50 Ga0070714_100134464 3300005435 Bacteria 2213
51 Ga0070714_100210159 3300005435 Bacteria 1783
52 Ga0070713_100013107 3300005436 Bacteria 6110
53 Ga0070713_100104198 3300005436 Bacteria 2462
54 Ga0070710_10002265 3300005437 Bacteria 9098
55 Ga0070710_10045399 3300005437 Bacteria 2442
56 Ga0070710_10054617 3300005437 Bacteria 2254
57 Ga0070711_100001299 3300005439 Bacteria 13593
58 Ga0070711_100005506 3300005439 Bacteria 7577
59 Ga0070711_100020141 3300005439 Bacteria 4293
60 Ga0070711_100135546 3300005439 Bacteria 1840
61 Ga0070700_100001551 3300005441 Bacteria 11464
62 Ga0070694_100022946 3300005444 Bacteria 4006
63 Ga0070694_100060885 3300005444 Bacteria 2576
64 Ga0070694_100076570 3300005444 Bacteria 2316
65 Ga0070694_100118010 3300005444 Bacteria 1900
66 Ga0070708_100008348 3300005445 Bacteria 8316
67 Ga0070663_100017434 3300005455 Bacteria 4687
68 Ga0070663_100034149 3300005455 Bacteria 3520
69 Ga0070678_100003432 3300005456 Bacteria 8840
70 Ga0070678_100039088 3300005456 Bacteria 3345
71 Ga0070678_100050596 3300005456 Bacteria 3007
72 Ga0070681_10014740 3300005458 Bacteria 7772
73 Ga0070681_10049046 3300005458 Bacteria 4218
74 Ga0070681_10075487 3300005458 Bacteria 3331
75 Ga0070681_10096251 3300005458 Bacteria 2908
76 Ga0070681_10148986 3300005458 Bacteria 2267
77 Ga0070681_10204372 3300005458 Bacteria 1893
78 Ga0068867_100000290 3300005459 Bacteria 32965
79 Ga0070706_100011218 3300005467 Bacteria 8322
80 Ga0070706_100048234 3300005467 Bacteria 3931
81 Ga0070706_100196822 3300005467 Bacteria 1883
82 Ga0070707_100001971 3300005468 Bacteria 19646
83 Ga0070707_100006528 3300005468 Bacteria 10830
84 Ga0070707_100023400 3300005468 Bacteria 5845
85 Ga0070698_100008197 3300005471 Bacteria 11302
86 Ga0070698_100024916 3300005471 Bacteria 6236
87 Ga0070698_100026236 3300005471 Bacteria 6067
88 Ga0070698_100052694 3300005471 Bacteria 4138
89 Ga0070698_100063589 3300005471 Bacteria 3721
90 Ga0070699_100043399 3300005518 Bacteria 3892
91 Ga0070699_100132275 3300005518 Bacteria 2199
92 Ga0070679_100005801 3300005530 Bacteria 11458
93 Ga0070679_100012416 3300005530 Bacteria 8140
94 Ga0070679_100035772 3300005530 Bacteria 4926
95 Ga0070679_100080839 3300005530 Bacteria 3240
96 Ga0070679_100088554 3300005530 Bacteria 3083
97 Ga0070679_100105410 3300005530 Bacteria 2805
98 Ga0070679_100152799 3300005530 Bacteria 2285
99 Ga0070684_100023758 3300005535 Bacteria 5133
100 Ga0070684_100059887 3300005535 Bacteria 3329
101 Ga0070684_100074455 3300005535 Bacteria 2993
102 Ga0070684_100092946 3300005535 Bacteria 2685
103 Ga0070684_100093795 3300005535 Bacteria 2672
104 Ga0068853_100100694 3300005539 Bacteria 2554
105 Ga0070672_100200075 3300005543 Bacteria 1670
106 Ga0070686_100002931 3300005544 Bacteria 9362
107 Ga0070686_100044438 3300005544 Bacteria 2792
108 Ga0070695_100000746 3300005545 Bacteria 17422
109 Ga0070695_100036301 3300005545 Bacteria 3101
110 Ga0070695_100127536 3300005545 Bacteria 1749
111 Ga0070696_100002162 3300005546 Bacteria 12949
112 Ga0070696_100051214 3300005546 Bacteria 2871
113 Ga0070696_100070011 3300005546 Bacteria 2466
114 Ga0070693_100010201 3300005547 Bacteria 4697
115 Ga0070693_100128295 3300005547 Bacteria 1582
116 Ga0070665_100070335 3300005548 Bacteria 3507
117 Ga0070704_100092796 3300005549 Bacteria 2254
118 Ga0068855_100044686 3300005563 Bacteria 5242
119 Ga0068855_100087304 3300005563 Bacteria 3605
120 Ga0070664_100034418 3300005564 Bacteria 4250
121 Ga0070664_100054750 3300005564 Bacteria 3386
122 Ga0070664_100092738 3300005564 Bacteria 2615
123 Ga0070664_100209317 3300005564 Bacteria 1742
124 Ga0068857_100075954 3300005577 Bacteria 2995
125 Ga0068857_100079569 3300005577 Bacteria 2926
126 Ga0068856_100120729 3300005614 Bacteria 2622
127 Ga0070702_100000583 3300005615 Bacteria 13368
128 Ga0070702_100058442 3300005615 Bacteria 2234
129 Ga0070702_100072254 3300005615 Bacteria 2041
130 Ga0068852_100016361 3300005616 Bacteria 5780
131 Ga0068852_100261307 3300005616 Bacteria 1662
132 Ga0068864_100054424 3300005618 Bacteria 3454
133 Ga0068866_10000154 3300005718 Bacteria 31512
134 Ga0068861_100069512 3300005719 Bacteria 2724
135 Ga0068861_100123084 3300005719 Bacteria 2095
136 Ga0068858_100055537 3300005842 Bacteria 3661
137 Ga0068860_100042034 3300005843 Bacteria 4368
138 Ga0068862_100071626 3300005844 Bacteria 2992
139 Ga0081455_10002410 3300005937 Bacteria 22324
140 Ga0081455_10002626 3300005937 Bacteria 21306
141 Ga0081455_10004721 3300005937 Bacteria 15146
142 Ga0081455_10030501 3300005937 Bacteria 4896
143 Ga0081538_10000151 3300005981 Bacteria 72583
144 Ga0081538_10000492 3300005981 Bacteria 44066
145 Ga0081538_10000613 3300005981 Bacteria 39554
146 Ga0081538_10002077 3300005981 Bacteria 19957
147 Ga0081538_10002734 3300005981 Bacteria 16934
148 Ga0081538_10003142 3300005981 Bacteria 15692
149 Ga0081538_10004272 3300005981 Bacteria 13228
150 Ga0081538_10007389 3300005981 Bacteria 9516
151 Ga0081538_10008374 3300005981 Bacteria 8793
152 Ga0081540_1007223 3300005983 Bacteria 7965
153 Ga0081539_10000200 3300005985 Bacteria 139291
154 Ga0081539_10000867 3300005985 Bacteria 57938
155 Ga0081539_10002620 3300005985 Bacteria 24595
156 Ga0070717_10003839 3300006028 Bacteria 10815
157 Ga0070717_10081446 3300006028 Bacteria 2718
158 Ga0070717_10224919 3300006028 Bacteria 1650
159 Ga0075432_10003010 3300006058 Bacteria 5681
160 Ga0075432_10007679 3300006058 Bacteria 3677
161 Ga0070715_10001264 3300006163 Bacteria 7251
162 Ga0070716_100034410 3300006173 Bacteria 2778
163 Ga0070712_100008840 3300006175 Bacteria 6342
164 Ga0070712_100012447 3300006175 Bacteria 5409
165 Ga0070712_100123005 3300006175 Bacteria 1955
166 Ga0097621_100024884 3300006237 Bacteria 4680
167 Ga0097621_100046132 3300006237 Bacteria 3524
168 Ga0068871_100004124 3300006358 Bacteria 10049
169 Ga0075428_100007989 3300006844 Bacteria 11737
170 Ga0075428_100023960 3300006844 Bacteria 6754
171 Ga0075428_100041907 3300006844 Bacteria 5034
172 Ga0075428_100047776 3300006844 Bacteria 4699
173 Ga0075428_100066941 3300006844 Bacteria 3933
174 Ga0075428_100149670 3300006844 Bacteria 2536
175 Ga0075430_100044310 3300006846 Bacteria 3763
176 Ga0075431_100006255 3300006847 Bacteria 11830
177 Ga0075431_100067676 3300006847 Bacteria 3687
178 Ga0075431_100078992 3300006847 Bacteria 3397
179 Ga0075433_10029961 3300006852 Bacteria 4639
180 Ga0075434_100071797 3300006871 Bacteria 3453
181 Ga0075434_100125690 3300006871 Bacteria 2581
182 Ga0075429_100009903 3300006880 Bacteria 8264
183 Ga0075429_100010729 3300006880 Bacteria 7922
184 Ga0075429_100035324 3300006880 Bacteria 4347
185 Ga0068865_100000501 3300006881 Bacteria 21962
186 Ga0068865_100009127 3300006881 Bacteria 6138
187 Ga0075436_100035492 3300006914 Bacteria 3439
188 Ga0075435_100001081 3300007076 Bacteria 17333
189 Ga0075435_100020517 3300007076 Bacteria 5065
190 Ga0075435_100034635 3300007076 Bacteria 4002
191 Ga0075435_100049337 3300007076 Bacteria 3385
192 Ga0075435_100054993 3300007076 Bacteria 3213
193 Ga0075435_100168104 3300007076 Bacteria 1850
194 Ga0105240_10011339 3300009093 Bacteria 12415
195 Ga0105240_10023789 3300009093 Bacteria 8093
196 Ga0105240_10330296 3300009093 Bacteria 1735
197 Ga0111539_10005525 3300009094 Bacteria 16350
198 Ga0111539_10005906 3300009094 Bacteria 15814
199 Ga0111539_10045158 3300009094 Bacteria 5275
200 Ga0111539_10048461 3300009094 Bacteria 5072
201 Ga0111539_10068447 3300009094 Bacteria 4192
202 Ga0111539_10155399 3300009094 Bacteria 2677
203 Ga0105245_10010962 3300009098 Bacteria 7887
204 Ga0105245_10020166 3300009098 Bacteria 5843
205 Ga0114129_10009560 3300009147 Bacteria 13828
206 Ga0114129_10023764 3300009147 Bacteria 8687
207 Ga0114129_10032301 3300009147 Bacteria 7398
208 Ga0114129_10139883 3300009147 Bacteria 3319
209 Ga0105243_10001079 3300009148 Bacteria 24973
210 Ga0105243_10015682 3300009148 Bacteria 5729
211 Ga0105243_10045523 3300009148 Bacteria 3448
212 Ga0105242_10048550 3300009176 Bacteria 3450
213 Ga0105242_10095225 3300009176 Bacteria 2513
214 Ga0105242_10194739 3300009176 Bacteria 1797
215 Ga0105248_10032131 3300009177 Bacteria 5866
216 Ga0105237_10079052 3300009545 Bacteria 3279
217 Ga0105238_10074842 3300009551 Bacteria 3379
218 Ga0105238_10096800 3300009551 Bacteria 2937
219 Ga0105238_10269620 3300009551 Bacteria 1683
220 Ga0105249_10001927 3300009553 Bacteria 18015
221 Ga0105249_10052943 3300009553 Bacteria 3709
222 Ga0105249_10077117 3300009553 Bacteria 3090
223 Ga0105249_10148260 3300009553 Bacteria 2256
224 Ga0105239_10001224 3300010375 Bacteria 34981
225 Ga0105239_10073178 3300010375 Bacteria 3767
226 Ga0105239_10078673 3300010375 Bacteria 3629
227 Ga0105239_10081462 3300010375 Bacteria 3563
228 Ga0105239_10095690 3300010375 Bacteria 3280
229 Ga0157371_10031282 3300013102 Bacteria 3834
230 Ga0157370_10050293 3300013104 Bacteria 3984
231 Ga0157370_10082653 3300013104 Bacteria 3020
232 Ga0157369_10009001 3300013105 Bacteria 11437
233 Ga0157369_10016530 3300013105 Bacteria 8296
234 Ga0157369_10018494 3300013105 Bacteria 7811
235 Ga0157369_10195219 3300013105 Bacteria 2126
236 Ga0157374_10001561 3300013296 Bacteria 19271
237 Ga0157378_10002273 3300013297 Bacteria 17055
238 Ga0163162_10023555 3300013306 Bacteria 6077
239 Ga0157372_10040929 3300013307 Bacteria 5121
240 Ga0157372_10045867 3300013307 Bacteria 4850
241 Ga0157375_10003215 3300013308 Bacteria 14184
242 Ga0157375_10122267 3300013308 Bacteria 2714
243 Ga0157375_10144771 3300013308 Bacteria 2506
244 Ga0157375_10231632 3300013308 Bacteria 2006
245 Ga0157375_10325069 3300013308 Bacteria 1703
246 Ga0163163_10189411 3300014325 Bacteria 2106
247 Ga0157380_10049297 3300014326 Bacteria 3321
248 Ga0157380_10064273 3300014326 Bacteria 2945
249 Ga0157380_10102898 3300014326 Bacteria 2382
250 Ga0157380_10106757 3300014326 Bacteria 2344
251 Ga0182008_10010441 3300014497 Bacteria 4969
252 Ga0157377_10018972 3300014745 Bacteria 3586
253 Ga0157376_10015090 3300014969 Bacteria 5824
254 Ga0157376_10114693 3300014969 Bacteria 2378
255 Ga0197907_10084652 3300020069 Bacteria 2234
256 Ga0206356_10153600 3300020070 Bacteria 2619
257 Ga0206356_10750028 3300020070 Bacteria 1686
258 Ga0206349_1027768 3300020075 Bacteria 1645
259 Ga0206354_11273170 3300020081 Bacteria 3405
260 Ga0206353_10723334 3300020082 Bacteria 1685
261 Ga0213874_10027387 3300021377 Bacteria 1621
262 Ga0224712_10006017 3300022467 Bacteria 3428
263 Ga0224712_10015516 3300022467 Bacteria 2480
264 Ga0207642_10000121 3300025899 Bacteria 21373
265 Ga0207688_10018244 3300025901 Bacteria 3820
266 Ga0207688_10031001 3300025901 Bacteria 2950
267 Ga0207680_10057138 3300025903 Bacteria 2360
268 Ga0207699_10055578 3300025906 Bacteria 2356
269 Ga0207643_10022128 3300025908 Bacteria 3498
270 Ga0207705_10056981 3300025909 Bacteria 2818
271 Ga0207705_10062374 3300025909 Bacteria 2692
272 Ga0207684_10086593 3300025910 Bacteria 2669
273 Ga0207654_10041893 3300025911 Bacteria 2588
274 Ga0207707_10051969 3300025912 Bacteria 3568
275 Ga0207707_10113915 3300025912 Bacteria 2363
276 Ga0207707_10115209 3300025912 Bacteria 2349
277 Ga0207707_10153453 3300025912 Bacteria 2013
278 Ga0207695_10027770 3300025913 Bacteria 6296
279 Ga0207695_10184941 3300025913 Bacteria 2003
280 Ga0207671_10035733 3300025914 Bacteria 3685
281 Ga0207693_10000499 3300025915 Bacteria 35458
282 Ga0207693_10001416 3300025915 Bacteria 21252
283 Ga0207693_10002670 3300025915 Bacteria 15487
284 Ga0207693_10008705 3300025915 Bacteria 8297
285 Ga0207693_10011959 3300025915 Bacteria 7016
286 Ga0207693_10014553 3300025915 Bacteria 6322
287 Ga0207693_10135413 3300025915 Bacteria 1937
288 Ga0207663_10025014 3300025916 Bacteria 3445
289 Ga0207657_10002712 3300025919 Bacteria 19070
290 Ga0207657_10027905 3300025919 Bacteria 5161
291 Ga0207657_10050254 3300025919 Bacteria 3629
292 Ga0207657_10094033 3300025919 Bacteria 2496
293 Ga0207649_10033336 3300025920 Bacteria 3077
294 Ga0207649_10134178 3300025920 Bacteria 1686
295 Ga0207652_10018853 3300025921 Bacteria 5663
296 Ga0207646_10000757 3300025922 Bacteria 41947
297 Ga0207646_10001072 3300025922 Bacteria 34848
298 Ga0207681_10072251 3300025923 Bacteria 2409
299 Ga0207659_10085313 3300025926 Bacteria 2346
300 Ga0207659_10130136 3300025926 Bacteria 1941
301 Ga0207687_10004288 3300025927 Bacteria 9526
302 Ga0207687_10160103 3300025927 Bacteria 1727
303 Ga0207700_10000001 3300025928 Bacteria 1122509
304 Ga0207700_10015258 3300025928 Bacteria 5059
305 Ga0207664_10002805 3300025929 Bacteria 11574
306 Ga0207664_10009266 3300025929 Bacteria 6899
307 Ga0207664_10137754 3300025929 Bacteria 2061
308 Ga0207690_10045481 3300025932 Bacteria 2900
309 Ga0207690_10054930 3300025932 Bacteria 2680
310 Ga0207690_10155782 3300025932 Bacteria 1698
311 Ga0207706_10051002 3300025933 Bacteria 3655
312 Ga0207686_10052622 3300025934 Bacteria 2542
313 Ga0207709_10000781 3300025935 Bacteria 24924
314 Ga0207709_10037200 3300025935 Bacteria 2890
315 Ga0207669_10003091 3300025937 Bacteria 7168
316 Ga0207669_10030400 3300025937 Bacteria 3001
317 Ga0207704_10001528 3300025938 Bacteria 10371
318 Ga0207665_10003907 3300025939 Bacteria 9973
319 Ga0207665_10016660 3300025939 Bacteria 4826
320 Ga0207691_10013943 3300025940 Bacteria 7668
321 Ga0207691_10054726 3300025940 Bacteria 3639
322 Ga0207661_10000580 3300025944 Bacteria 23346
323 Ga0207661_10058766 3300025944 Bacteria 3096
324 Ga0207661_10072502 3300025944 Bacteria 2817
325 Ga0207661_10080608 3300025944 Bacteria 2686
326 Ga0207661_10086981 3300025944 Bacteria 2594
327 Ga0207661_10089816 3300025944 Bacteria 2557
328 Ga0207661_10137995 3300025944 Bacteria 2096
329 Ga0207679_10033525 3300025945 Bacteria 3614
330 Ga0207679_10060316 3300025945 Bacteria 2818
331 Ga0207667_10050908 3300025949 Bacteria 4369
332 Ga0207667_10137314 3300025949 Bacteria 2517
333 Ga0207667_10142369 3300025949 Bacteria 2469
334 Ga0207667_10239005 3300025949 Bacteria 1859
335 Ga0207712_10004576 3300025961 Bacteria 8726
336 Ga0207668_10003765 3300025972 Bacteria 8932
337 Ga0207658_10047922 3300025986 Bacteria 3130
338 Ga0207677_10008583 3300026023 Bacteria 5718
339 Ga0207677_10018980 3300026023 Bacteria 4141
340 Ga0207677_10031235 3300026023 Bacteria 3409
341 Ga0207703_10021711 3300026035 Bacteria 5025
342 Ga0207639_10008584 3300026041 Bacteria 7010
343 Ga0207678_10047114 3300026067 Bacteria 3728
344 Ga0207678_10090283 3300026067 Bacteria 2619
345 Ga0207708_10001823 3300026075 Bacteria 15722
346 Ga0207702_10004445 3300026078 Bacteria 12451
347 Ga0207702_10017385 3300026078 Bacteria 5950
348 Ga0207641_10070569 3300026088 Bacteria 3002
349 Ga0207648_10002767 3300026089 Bacteria 18606
350 Ga0207648_10012419 3300026089 Bacteria 7974
351 Ga0207674_10037873 3300026116 Bacteria 5011
352 Ga0207675_100001891 3300026118 Bacteria 20924
353 Ga0207675_100017381 3300026118 Bacteria 6714
354 Ga0207675_100020606 3300026118 Bacteria 6145
355 Ga0207683_10001565 3300026121 Bacteria 20601
356 Ga0207428_10000244 3300027907 Bacteria 74209
357 Ga0207428_10057044 3300027907 Bacteria 3101
358 Ga0268266_10130681 3300028379 Bacteria 2246
359 Ga0268265_10144192 3300028380 Bacteria 1998
360 Ga0268264_10027757 3300028381 Bacteria 4627
361 Ga0265319_1009630 3300028563 Bacteria 4095
362 Ga0265319_1018835 3300028563 Bacteria 2591
363 Ga0265319_1019652 3300028563 Bacteria 2517
364 Ga0265334_10042546 3300028573 Bacteria 1770
365 Ga0265322_10007725 3300028654 Bacteria 3134
366 Ga0265336_10008333 3300028666 Bacteria 3640
367 Ga0265338_10006251 3300028800 Bacteria 15241
368 Ga0265338_10008857 3300028800 Bacteria 12133
369 Ga0265338_10077537 3300028800 Bacteria 2808
370 Ga0265338_10147231 3300028800 Bacteria 1835
371 Ga0265330_10031876 3300031235 Bacteria 2362
372 Ga0265330_10035924 3300031235 Bacteria 2210
373 Ga0265320_10031846 3300031240 Bacteria 2705
374 Ga0265329_10010080 3300031242 Bacteria 3489
375 Ga0265340_10019740 3300031247 Bacteria 3468
376 Ga0265340_10022673 3300031247 Bacteria 3209
377 Ga0265339_10002054 3300031249 Bacteria 14790
378 Ga0265316_10019125 3300031344 Bacteria 5865
379 Ga0265316_10020308 3300031344 Bacteria 5659
380 Ga0265316_10087603 3300031344 Bacteria 2378
381 Ga0265316_10143485 3300031344 Bacteria 1792
382 Ga0307408_100006069 3300031548 Bacteria 8037
383 Ga0265313_10005116 3300031595 Bacteria 9768
384 Ga0265313_10027386 3300031595 Bacteria 2984
385 Ga0265314_10005028 3300031711 Bacteria 12047
386 Ga0265314_10007429 3300031711 Bacteria 9505
387 Ga0265342_10010488 3300031712 Bacteria 6422
388 Ga0307405_10004696 3300031731 Bacteria 6498
389 Ga0307406_10006630 3300031901 Bacteria 6401
390 Ga0307409_100085809 3300031995 Bacteria 2560
391 Ga0307416_100022597 3300032002 Bacteria 4543
392 Ga0307416_100056338 3300032002 Bacteria 3172
393 Ga0307416_100070320 3300032002 Bacteria 2901
394 Ga0307411_10016379 3300032005 Bacteria 4194
395 Ga0307415_100000242 3300032126 Bacteria 23821
396 Ga0307415_100000296 3300032126 Bacteria 21625
397 Ga0307415_100078049 3300032126 Bacteria 2354
398 Ga0373958_0003559 3300034819 Bacteria 2255
399 Ga0373959_0007324 3300034820 Bacteria 1853
400 Ga0373938_0001594 3300034957 Bacteria 3646
401 Ga0373932_0004267 3300035112 Bacteria 3392
402 Ga0373941_0001838 3300035115 Bacteria 4575
403 Ga0373945_0003703 3300035116 Bacteria 4820
404 Ga0373960_0000512 3300035121 Bacteria 7752
405 Ga0373943_0000299 3300035170 Bacteria 20623
406 Ga0373943_0026853 3300035170 Bacteria 2701
407 Ga0373946_0055940 3300035171 Bacteria 1665
408 Ga0373955_0072045 3300035172 Bacteria 1934
409 Ga0373942_0003061 3300035207 Bacteria 3961
410 Ga0373961_0005198 3300035241 Bacteria 3131
411 Ga0373962_0004247 3300035242 Bacteria 3456
412 Ga0373962_0005842 3300035242 Bacteria 2970
413 Ga0373931_0040054 3300035691 Bacteria 2456
414 Ga0373935_0012275 3300035692 Bacteria 5153
415 Ga0373927_0020520 3300035695 Bacteria 4333
416 Ga0373947_0003334 3300035725 Bacteria 9514
417 Ga0373947_0003997 3300035725 Bacteria 8660
418 Ga0373947_0014253 3300035725 Bacteria 4559
419 Ga0373925_0014062 3300037068 Bacteria 5792
420 Ga0395899_0001169 3300037312 Bacteria 23172
421 Ga0395899_0002224 3300037312 Bacteria 15901
422 Ga0395899_0004452 3300037312 Bacteria 10926
423 Ga0395899_0008461 3300037312 Bacteria 7927
424 Ga0395899_0009648 3300037312 Bacteria 7409
425 Ga0395899_0016439 3300037312 Bacteria 5640
426 Ga0395899_0028251 3300037312 Bacteria 4224
427 Ga0395899_0040607 3300037312 Bacteria 3480
428 Ga0395899_0047137 3300037312 Bacteria 3209
429 Ga0395899_0076678 3300037312 Bacteria 2440
430 Ga0395899_0153004 3300037312 Bacteria 1634
431 Ga0395900_0005122 3300037418 Bacteria 13764
432 Ga0395900_0005149 3300037418 Bacteria 13734
433 Ga0395900_0005255 3300037418 Bacteria 13580
434 Ga0395900_0006094 3300037418 Bacteria 12574
435 Ga0395900_0006594 3300037418 Bacteria 12075
436 Ga0395900_0009359 3300037418 Bacteria 10045
437 Ga0395900_0016810 3300037418 Bacteria 7462
438 Ga0395900_0036606 3300037418 Bacteria 5059
439 Ga0395900_0063720 3300037418 Bacteria 3789
440 Ga0395900_0064020 3300037418 Bacteria 3780
441 Ga0395900_0081145 3300037418 Bacteria 3332
442 Ga0395900_0088565 3300037418 Bacteria 3182
443 Ga0395900_0128124 3300037418 Bacteria 2602
444 Ga0395900_0158173 3300037418 Bacteria 2313
445 Ga0395900_0161847 3300037418 Bacteria 2282
446 Ga0395900_0238681 3300037418 Bacteria 1824
447 Ga0395900_0261847 3300037418 Bacteria 1727
448 Ga0395900_0278413 3300037418 Bacteria 1666
449 Ga0395898_0003908 3300037466 Bacteria 16453
450 Ga0395898_0005694 3300037466 Bacteria 13425
451 Ga0395898_0006540 3300037466 Bacteria 12438
452 Ga0395898_0007369 3300037466 Bacteria 11674
453 Ga0395898_0008036 3300037466 Bacteria 11183
454 Ga0395898_0010359 3300037466 Bacteria 9750
455 Ga0395898_0011736 3300037466 Bacteria 9083
456 Ga0395898_0012306 3300037466 Bacteria 8847
457 Ga0395898_0014022 3300037466 Bacteria 8236
458 Ga0395898_0014716 3300037466 Bacteria 8031
459 Ga0395898_0020301 3300037466 Bacteria 6748
460 Ga0395898_0020346 3300037466 Bacteria 6739
461 Ga0395898_0032145 3300037466 Bacteria 5237
462 Ga0395898_0058395 3300037466 Bacteria 3755
463 Ga0395898_0072492 3300037466 Bacteria 3327
464 Ga0395898_0090227 3300037466 Bacteria 2949
465 Ga0395898_0136526 3300037466 Bacteria 2348
466 Ga0395905_0005427 3300037471 Bacteria 13026
467 Ga0395905_0007309 3300037471 Bacteria 11005
468 Ga0395905_0007430 3300037471 Bacteria 10893
469 Ga0395905_0009544 3300037471 Bacteria 9479
470 Ga0395905_0018418 3300037471 Bacteria 6627
471 Ga0395905_0028812 3300037471 Bacteria 5233
472 Ga0395905_0033659 3300037471 Bacteria 4812
473 Ga0395905_0035066 3300037471 Bacteria 4710
474 Ga0395905_0038856 3300037471 Bacteria 4464
475 Ga0395905_0039367 3300037471 Bacteria 4435
476 Ga0395905_0053183 3300037471 Bacteria 3790
477 Ga0395905_0058225 3300037471 Bacteria 3614
478 Ga0395905_0062670 3300037471 Bacteria 3478
479 Ga0395905_0100291 3300037471 Bacteria 2719
480 Ga0395905_0103368 3300037471 Bacteria 2674
481 Ga0395905_0133502 3300037471 Bacteria 2335
482 Ga0395905_0154951 3300037471 Bacteria 2155
483 Ga0395905_0179054 3300037471 Bacteria 1990
484 Ga0395905_0231827 3300037471 Bacteria 1726
485 Ga0395901_0001057 3300038443 Bacteria 29607
486 Ga0395901_0001077 3300038443 Bacteria 29182
487 Ga0395901_0002248 3300038443 Bacteria 19701
488 Ga0395901_0003646 3300038443 Bacteria 15530
489 Ga0395901_0004617 3300038443 Bacteria 13903
490 Ga0395901_0005172 3300038443 Bacteria 13163
491 Ga0395901_0007398 3300038443 Bacteria 11079
492 Ga0395901_0012458 3300038443 Bacteria 8630
493 Ga0395901_0018337 3300038443 Bacteria 7145
494 Ga0395901_0019264 3300038443 Bacteria 6976
495 Ga0395901_0021879 3300038443 Bacteria 6553
496 Ga0395901_0028507 3300038443 Bacteria 5741
497 Ga0395901_0035315 3300038443 Bacteria 5163
498 Ga0395901_0036915 3300038443 Bacteria 5052
499 Ga0395901_0044519 3300038443 Bacteria 4603
500 Ga0395901_0143511 3300038443 Bacteria 2509
501 Ga0436360_0487569 3300039438 Bacteria 13324
502 Ga0436363_0891141 3300039450 Bacteria 2699
503 Ga0439438_012206 3300041405 Bacteria 2641
504 Ga0439439_0000991 3300041406 Bacteria 5326
505 Ga0439433_0000482 3300041999 Bacteria 7385
506 Ga0439446_0002523 3300042156 Bacteria 4405
507 Ga0439446_0006535 3300042156 Bacteria 3044
508 Ga0439458_0011982 3300042157 Bacteria 1942
509 Ga0439434_0022679 3300042435 Bacteria 1887
510 Ga0466969_0001126 3300044656 Bacteria 14386
511 Ga0466965_0046829 3300044683 Bacteria 2141
512 Ga0466966_0007848 3300044684 Bacteria 7063
513 Ga0466966_0015704 3300044684 Bacteria 5006
514 Ga0466966_0077835 3300044684 Bacteria 2069
515 Ga0466966_0113135 3300044684 Bacteria 1672
516 Ga0466961_0013305 3300044693 Bacteria 5266
517 Ga0466963_0000481 3300044694 Bacteria 18603
518 Ga0466963_0001325 3300044694 Bacteria 13185
519 Ga0466963_0001333 3300044694 Bacteria 13149
520 Ga0466963_0003978 3300044694 Bacteria 8546
521 Ga0466963_0026825 3300044694 Bacteria 3686
522 Ga0466963_0028114 3300044694 Bacteria 3607
523 Ga0466963_0029723 3300044694 Bacteria 3520
524 Ga0466963_0053674 3300044694 Bacteria 2676
525 Ga0466963_0071803 3300044694 Bacteria 2330
526 Ga0466964_0003730 3300044706 Bacteria 5581
527 Ga0466964_0010882 3300044706 Bacteria 3436
528 Ga0466964_0027735 3300044706 Bacteria 2225
529 Ga0466964_0048637 3300044706 Bacteria 1734
530 Ga0466971_0005631 3300044719 Bacteria 5447
531 Ga0466970_0002928 3300044765 Bacteria 8270
532 Ga0466970_0053697 3300044765 Bacteria 2152
533 Ga0466957_0000932 3300044842 Bacteria 14961
534 Ga0466957_0003321 3300044842 Bacteria 8817
535 Ga0466957_0004549 3300044842 Bacteria 7744
536 Ga0466957_0029409 3300044842 Bacteria 3277
537 Ga0466957_0029425 3300044842 Bacteria 3275
538 Ga0466960_0009316 3300044901 Bacteria 4043
539 Ga0466960_0015644 3300044901 Bacteria 3275
540 Ga0466960_0026689 3300044901 Bacteria 2626
541 Ga0466959_0003610 3300045049 Bacteria 10199
542 Ga0466959_0010632 3300045049 Bacteria 6590
543 Ga0466959_0045996 3300045049 Bacteria 3213
544 Ga0466958_0000447 3300045836 Bacteria 17123
545 Ga0466958_0002557 3300045836 Bacteria 9180
546 Ga0466958_0006920 3300045836 Bacteria 6204
547 Ga0466958_0009219 3300045836 Bacteria 5491
548 Ga0466967_0000291 3300045976 Bacteria 22401
549 Ga0466967_0002093 3300045976 Bacteria 12229
550 Ga0466967_0003596 3300045976 Bacteria 10174
551 Ga0466967_0003679 3300045976 Bacteria 10093
552 Ga0466967_0005179 3300045976 Bacteria 8976
553 Ga0466967_0006520 3300045976 Bacteria 8273
554 Ga0466967_0010493 3300045976 Bacteria 6954
555 Ga0466967_0012008 3300045976 Bacteria 6600
556 Ga0466967_0018485 3300045976 Bacteria 5572
557 Ga0466967_0048711 3300045976 Bacteria 3702
558 Ga0466967_0049464 3300045976 Bacteria 3676
559 Ga0466967_0064511 3300045976 Bacteria 3257
560 Ga0466967_0068375 3300045976 Bacteria 3171
561 Ga0466967_0070681 3300045976 Bacteria 3123
562 Ga0466967_0072929 3300045976 Bacteria 3079
563 Ga0466967_0100924 3300045976 Bacteria 2637
564 Ga0466967_0122896 3300045976 Bacteria 2401
565 Ga0466967_0133349 3300045976 Bacteria 2308
566 Ga0466967_0138592 3300045976 Bacteria 2264
567 Ga0466967_0191375 3300045976 Bacteria 1933
568 Ga0495592_0000989 3300046454 Bacteria 19699
569 Ga0495592_0027546 3300046454 Bacteria 4308
570 Ga0495592_0036920 3300046454 Bacteria 3678
571 Ga0495603_0011232 3300046455 Bacteria 5424
572 Ga0495629_0000403 3300046459 Bacteria 36268
573 Ga0495629_0008955 3300046459 Bacteria 7351
574 Ga0495629_0081982 3300046459 Bacteria 2251
575 Ga0495641_0000331 3300046461 Bacteria 38511
576 Ga0495641_0051979 3300046461 Bacteria 1869
577 Ga0495651_0000064 3300046462 Bacteria 78474
578 Ga0495651_0008032 3300046462 Bacteria 8091
579 Ga0495651_0069600 3300046462 Bacteria 2679
580 Ga0495651_0121885 3300046462 Bacteria 1914
581 Ga0495653_0000351 3300046463 Bacteria 37392
582 Ga0495653_0014756 3300046463 Bacteria 6371
583 Ga0495653_0040238 3300046463 Bacteria 3655
584 Ga0495653_0093272 3300046463 Bacteria 2196
585 Ga0495582_0000426 3300046473 Bacteria 23059
586 Ga0495582_0010215 3300046473 Bacteria 5170
587 Ga0495582_0035117 3300046473 Bacteria 2757
588 Ga0495582_0064436 3300046473 Bacteria 2023
589 Ga0495639_0000619 3300046475 Bacteria 16494
590 Ga0495662_0004650 3300046476 Bacteria 6889
591 Ga0495664_0040502 3300046477 Bacteria 2755
592 Ga0495664_0052194 3300046477 Bacteria 2429
593 Ga0495585_0029861 3300046492 Bacteria 3102
594 Ga0495608_0004037 3300046511 Bacteria 10535
595 Ga0495608_0006061 3300046511 Bacteria 8585
596 Ga0495608_0006677 3300046511 Bacteria 8183
597 Ga0495618_0000613 3300046514 Bacteria 25324
598 Ga0495618_0021181 3300046514 Bacteria 4007
599 Ga0495628_0000069 3300046516 Bacteria 82366
600 Ga0495628_0025798 3300046516 Bacteria 4799
601 Ga0495628_0055727 3300046516 Bacteria 3113
602 Ga0495630_0006653 3300046517 Bacteria 8237
603 Ga0495652_0011521 3300046529 Bacteria 7995
604 Ga0495652_0059185 3300046529 Bacteria 3242
605 Ga0495665_0007390 3300046531 Bacteria 5940
606 Ga0495665_0042941 3300046531 Bacteria 2405
607 Ga0495640_0024614 3300046533 Bacteria 4378
608 Ga0495640_0034641 3300046533 Bacteria 3577
609 Ga0495587_0004197 3300046536 Bacteria 9540
610 Ga0495645_0000085 3300046543 Bacteria 64444
611 Ga0495645_0033047 3300046543 Bacteria 3773
612 Ga0495667_0011723 3300046559 Bacteria 5935
613 Ga0495667_0032603 3300046559 Bacteria 3490
614 Ga0495667_0103416 3300046559 Bacteria 1842
615 Ga0495634_0021939 3300046642 Bacteria 4505
616 Ga0495634_0053894 3300046642 Bacteria 2692
617 Ga0495634_0073673 3300046642 Bacteria 2245
618 Ga0495635_0030960 3300046663 Bacteria 3716
619 Ga0495635_0040315 3300046663 Bacteria 3227
620 Ga0495635_0106595 3300046663 Bacteria 1914
621 Ga0495657_0003621 3300046675 Bacteria 12553
622 Ga0495657_0064673 3300046675 Bacteria 2408
623 Ga0495599_0000146 3300046678 Bacteria 45799
624 Ga0495599_0095665 3300046678 Bacteria 1852
625 Ga0495623_0000030 3300046679 Bacteria 85003
626 Ga0495623_0006977 3300046679 Bacteria 7341
627 Ga0495646_0001436 3300046680 Bacteria 14159
628 Ga0495658_0000302 3300046683 Bacteria 27945
629 Ga0495658_0004983 3300046683 Bacteria 6519
630 Ga0495669_0046726 3300046684 Bacteria 1933
631 Ga0495613_0005126 3300046689 Bacteria 9831
632 Ga0495613_0044632 3300046689 Bacteria 3278
633 Ga0495624_0001304 3300046690 Bacteria 19574
634 Ga0495624_0059108 3300046690 Bacteria 2406
635 Ga0495600_0089147 3300046809 Bacteria 2012
636 Ga0495581_0000117 3300047315 Bacteria 33592
637 Ga0495581_0000815 3300047315 Bacteria 16569
638 Ga0495581_0006138 3300047315 Bacteria 6966
639 Ga0495604_0000103 3300047317 Bacteria 71556
640 Ga0495604_0007052 3300047317 Bacteria 8913
641 Ga0495674_0041491 3300047319 Bacteria 4110
642 Ga0495674_0059974 3300047319 Bacteria 3321
643 Ga0495674_0078384 3300047319 Bacteria 2838
644 Ga0495674_0192630 3300047319 Bacteria 1694
645 Ga0495676_0000268 3300047321 Bacteria 42236
646 Ga0495676_0027491 3300047321 Bacteria 4875
647 Ga0495676_0037003 3300047321 Bacteria 4068
648 Ga0495676_0041028 3300047321 Bacteria 3814
649 Ga0495680_0006548 3300047322 Bacteria 10809
650 Ga0495680_0009114 3300047322 Bacteria 8956
651 Ga0495680_0021704 3300047322 Bacteria 5370
652 Ga0495680_0023092 3300047322 Bacteria 5175
653 Ga0495675_0000509 3300047444 Bacteria 25202
654 Ga0495677_0015913 3300047445 Bacteria 2731
655 Ga0495684_0029398 3300047471 Bacteria 4217
656 Ga0495684_0037130 3300047471 Bacteria 3736
657 Ga0495684_0042600 3300047471 Bacteria 3476
658 Ga0495684_0046375 3300047471 Bacteria 3324
659 Ga0495593_0024595 3300047673 Bacteria 3337
660 Ga0495602_0000080 3300048088 Bacteria 94171
661 Ga0495602_0067752 3300048088 Bacteria 3068
662 Ga0496100_0056841 3300048903 Bacteria 2561
663 Ga0496100_0066431 3300048903 Bacteria 2392
664 Ga0496101_0001887 3300048904 Bacteria 12659
665 Ga0496101_0002078 3300048904 Bacteria 12198
666 Ga0496101_0017603 3300048904 Bacteria 4848
667 Ga0496101_0037828 3300048904 Bacteria 3425
668 Ga0496101_0066151 3300048904 Bacteria 2636
669 Ga0496101_0084755 3300048904 Bacteria 2347
670 Ga0496101_0093921 3300048904 Bacteria 2235
671 Ga0496102_0000944 3300048905 Bacteria 27441
672 Ga0496102_0001216 3300048905 Bacteria 23348
673 Ga0496102_0004404 3300048905 Bacteria 11901
674 Ga0496102_0026332 3300048905 Bacteria 5186
675 Ga0496102_0177981 3300048905 Bacteria 2003
676 Ga0496102_0255133 3300048905 Bacteria 1653
677 Ga0496103_0000709 3300048906 Bacteria 24669
678 Ga0496103_0002863 3300048906 Bacteria 10729
679 Ga0496103_0009008 3300048906 Bacteria 5912
680 Ga0496103_0026438 3300048906 Bacteria 3513
681 Ga0496103_0044774 3300048906 Bacteria 2728
682 Ga0496103_0050733 3300048906 Bacteria 2567
683 Ga0496103_0079495 3300048906 Bacteria 2060
684 Ga0496104_0000557 3300048907 Bacteria 31776
685 Ga0496104_0000803 3300048907 Bacteria 27008
686 Ga0496104_0015511 3300048907 Bacteria 6900
687 Ga0496104_0048420 3300048907 Bacteria 4007
688 Ga0496104_0050879 3300048907 Bacteria 3909
689 Ga0496104_0054188 3300048907 Bacteria 3791
690 Ga0496104_0073981 3300048907 Bacteria 3242
691 Ga0496104_0077240 3300048907 Bacteria 3173
692 Ga0496104_0078219 3300048907 Bacteria 3152
693 Ga0496104_0122633 3300048907 Bacteria 2495
694 Ga0496104_0170603 3300048907 Bacteria 2086
695 Ga0496105_0000609 3300048908 Bacteria 23924
696 Ga0496105_0001118 3300048908 Bacteria 18689
697 Ga0496105_0001193 3300048908 Bacteria 18081
698 Ga0496105_0015049 3300048908 Bacteria 6156
699 Ga0496105_0112543 3300048908 Bacteria 2246
700 Ga0496105_0139676 3300048908 Bacteria 1994
701 Ga0496106_0002624 3300048909 Bacteria 13370
702 Ga0496106_0003561 3300048909 Bacteria 11599
703 Ga0496106_0005352 3300048909 Bacteria 9498
704 Ga0496106_0005639 3300048909 Bacteria 9264
705 Ga0496106_0008920 3300048909 Bacteria 7414
706 Ga0496106_0032617 3300048909 Bacteria 3884
707 Ga0496106_0039546 3300048909 Bacteria 3533
708 Ga0496106_0089814 3300048909 Bacteria 2370
709 Ga0496106_0091210 3300048909 Bacteria 2352
710 Ga0496107_0000316 3300048910 Bacteria 26097
711 Ga0496107_0003225 3300048910 Bacteria 10858
712 Ga0496107_0009186 3300048910 Bacteria 6852
713 Ga0496107_0009483 3300048910 Bacteria 6750
714 Ga0496107_0012003 3300048910 Bacteria 6044
715 Ga0496107_0069792 3300048910 Bacteria 2551
716 Ga0496108_0002980 3300048911 Bacteria 13606
717 Ga0496108_0004461 3300048911 Bacteria 11265
718 Ga0496108_0005258 3300048911 Bacteria 10455
719 Ga0496108_0009378 3300048911 Bacteria 7924
720 Ga0496108_0014225 3300048911 Bacteria 6493
721 Ga0496108_0015755 3300048911 Bacteria 6162
722 Ga0496108_0041165 3300048911 Bacteria 3855
723 Ga0496108_0084990 3300048911 Bacteria 2686
724 Ga0496109_0000533 3300048912 Bacteria 32234
725 Ga0496109_0005342 3300048912 Bacteria 10741
726 Ga0496109_0013614 3300048912 Bacteria 7064
727 Ga0496109_0018687 3300048912 Bacteria 6093
728 Ga0496109_0020769 3300048912 Bacteria 5800
729 Ga0496109_0027342 3300048912 Bacteria 5092
730 Ga0496109_0070927 3300048912 Bacteria 3198
731 Ga0496109_0075342 3300048912 Bacteria 3102
732 Ga0496109_0077438 3300048912 Bacteria 3060
733 Ga0496109_0126829 3300048912 Bacteria 2380
734 Ga0496110_0000411 3300048913 Bacteria 29120
735 Ga0496110_0000564 3300048913 Bacteria 25354
736 Ga0496110_0002200 3300048913 Bacteria 14568
737 Ga0496110_0006619 3300048913 Bacteria 9206
738 Ga0496110_0010041 3300048913 Bacteria 7684
739 Ga0496110_0010182 3300048913 Bacteria 7639
740 Ga0496110_0018708 3300048913 Bacteria 5811
741 Ga0496110_0035022 3300048913 Bacteria 4353
742 Ga0496110_0053588 3300048913 Bacteria 3547
743 Ga0496110_0055947 3300048913 Bacteria 3471
744 Ga0496110_0206876 3300048913 Bacteria 1784
745 Ga0496111_0000084 3300048914 Bacteria 39267
746 Ga0496111_0002152 3300048914 Bacteria 11790
747 Ga0496111_0002910 3300048914 Bacteria 10462
748 Ga0496111_0005171 3300048914 Bacteria 8319
749 Ga0496111_0011785 3300048914 Bacteria 5903
750 Ga0496111_0017815 3300048914 Bacteria 4912
751 Ga0496111_0049655 3300048914 Bacteria 3025
752 Ga0496112_0005317 3300048915 Bacteria 11111
753 Ga0496112_0010136 3300048915 Bacteria 8536
754 Ga0496112_0042540 3300048915 Bacteria 4444
755 Ga0496112_0058123 3300048915 Bacteria 3808
756 Ga0496112_0094135 3300048915 Bacteria 2966
757 Ga0496112_0112007 3300048915 Bacteria 2698
758 Ga0496112_0112008 3300048915 Bacteria 2698
759 Ga0496112_0169739 3300048915 Bacteria 2147
760 Ga0496112_0307529 3300048915 Bacteria 1530
761 Ga0496113_0002984 3300048916 Bacteria 10015
762 Ga0496113_0006885 3300048916 Bacteria 7254
763 Ga0496113_0032874 3300048916 Bacteria 3772
764 Ga0496113_0047449 3300048916 Bacteria 3192
765 Ga0496113_0157758 3300048916 Bacteria 1793
766 Ga0496114_0000177 3300048917 Bacteria 45143
767 Ga0496114_0002173 3300048917 Bacteria 14931
768 Ga0496114_0004084 3300048917 Bacteria 11279
769 Ga0496114_0004101 3300048917 Bacteria 11265
770 Ga0496114_0012037 3300048917 Bacteria 6920
771 Ga0496114_0013794 3300048917 Bacteria 6477
772 Ga0496114_0036190 3300048917 Bacteria 4080
773 Ga0496114_0051653 3300048917 Bacteria 3423
774 Ga0496114_0072300 3300048917 Bacteria 2900
775 Ga0496114_0075135 3300048917 Bacteria 2846
776 Ga0496114_0077140 3300048917 Bacteria 2809
777 Ga0496114_0153561 3300048917 Bacteria 1998
778 Ga0496115_0000276 3300048918 Bacteria 45046
779 Ga0496115_0000825 3300048918 Bacteria 22720
780 Ga0496115_0008631 3300048918 Bacteria 7547
781 Ga0496115_0013740 3300048918 Bacteria 6130
782 Ga0496115_0028657 3300048918 Bacteria 4366
783 Ga0501031_0000033 3300049568 Bacteria 76506
784 Ga0501031_0001619 3300049568 Bacteria 14078
785 Ga0501031_0001976 3300049568 Bacteria 12947
786 Ga0501031_0007791 3300049568 Bacteria 6971
787 Ga0501031_0010773 3300049568 Bacteria 5955
788 Ga0501031_0071414 3300049568 Bacteria 2261
789 Ga0501031_0087831 3300049568 Bacteria 2027
790 Ga0501032_0006726 3300049569 Bacteria 8438
791 Ga0501032_0018372 3300049569 Bacteria 4899
792 Ga0501032_0045697 3300049569 Bacteria 2960
793 Ga0501033_0000388 3300049570 Bacteria 42262
794 Ga0501033_0004305 3300049570 Bacteria 11427
795 Ga0501033_0008760 3300049570 Bacteria 7821
796 Ga0501034_0005985 3300049571 Bacteria 13159
797 Ga0501034_0043882 3300049571 Bacteria 4522
798 Ga0501034_0176971 3300049571 Bacteria 2099
799 Ga0501036_0000462 3300049572 Bacteria 29122
800 Ga0501036_0006015 3300049572 Bacteria 9841
801 Ga0501036_0014753 3300049572 Bacteria 6516
802 Ga0501036_0021834 3300049572 Bacteria 5381
803 Ga0501036_0033191 3300049572 Bacteria 4365
804 Ga0501036_0150469 3300049572 Bacteria 1963
805 Ga0501037_0050998 3300049573 Bacteria 3026
806 Ga0501037_0141543 3300049573 Bacteria 1721
807 Ga0501038_0001345 3300049574 Bacteria 22388
808 Ga0501038_0003559 3300049574 Bacteria 14496
809 Ga0501038_0003931 3300049574 Bacteria 13810
810 Ga0501038_0051955 3300049574 Bacteria 3534
811 Ga0501038_0063654 3300049574 Bacteria 3147
812 Ga0501038_0065149 3300049574 Bacteria 3105
813 Ga0501039_0000528 3300049575 Bacteria 27658
814 Ga0501039_0004944 3300049575 Bacteria 10108
815 Ga0501039_0005475 3300049575 Bacteria 9605
816 Ga0501039_0019537 3300049575 Bacteria 5194
817 Ga0501039_0062956 3300049575 Bacteria 2874
818 Ga0501039_0069825 3300049575 Bacteria 2729
819 Ga0501039_0102448 3300049575 Bacteria 2234
820 Ga0501040_0000234 3300049576 Bacteria 32549
821 Ga0501040_0000862 3300049576 Bacteria 19019
822 Ga0501040_0001857 3300049576 Bacteria 13550
823 Ga0501040_0023262 3300049576 Bacteria 4154
824 Ga0501040_0026007 3300049576 Bacteria 3937
825 Ga0501040_0057479 3300049576 Bacteria 2670
826 Ga0501040_0081988 3300049576 Bacteria 2235
827 Ga0501041_0000176 3300049577 Bacteria 28688
828 Ga0501041_0000463 3300049577 Bacteria 20567
829 Ga0501041_0001181 3300049577 Bacteria 14214
830 Ga0501041_0010616 3300049577 Bacteria 5430
831 Ga0501041_0020227 3300049577 Bacteria 3977
832 Ga0501041_0038298 3300049577 Bacteria 2907
833 Ga0501042_0000717 3300049578 Bacteria 17980
834 Ga0501042_0001430 3300049578 Bacteria 14053
835 Ga0501042_0002112 3300049578 Bacteria 12048
836 Ga0501042_0004174 3300049578 Bacteria 9182
837 Ga0501042_0006865 3300049578 Bacteria 7428
838 Ga0501042_0034503 3300049578 Bacteria 3588
839 Ga0501042_0037226 3300049578 Bacteria 3453
840 Ga0501042_0107991 3300049578 Bacteria 2003
841 Ga0501043_0000798 3300049579 Bacteria 27990
842 Ga0501043_0004708 3300049579 Bacteria 11060
843 Ga0501043_0009672 3300049579 Bacteria 7557
844 Ga0501043_0030381 3300049579 Bacteria 4246
845 Ga0501043_0039536 3300049579 Bacteria 3706
846 Ga0501043_0099439 3300049579 Bacteria 2287
847 Ga0501043_0146066 3300049579 Bacteria 1852
848 Ga0501046_0000577 3300049580 Bacteria 36233
849 Ga0501046_0001998 3300049580 Bacteria 19348
850 Ga0501046_0010127 3300049580 Bacteria 8114
851 Ga0501046_0016777 3300049580 Bacteria 6122
852 Ga0501046_0025265 3300049580 Bacteria 4862
853 Ga0501046_0080128 3300049580 Bacteria 2524
854 Ga0501047_0001088 3300049581 Bacteria 27110
855 Ga0501047_0049901 3300049581 Bacteria 4040
856 Ga0501048_0000440 3300049582 Bacteria 29199
857 Ga0501048_0001055 3300049582 Bacteria 20637
858 Ga0501048_0001065 3300049582 Bacteria 20549
859 Ga0501048_0008231 3300049582 Bacteria 7888
860 Ga0501048_0027709 3300049582 Bacteria 4114
861 Ga0501067_0001736 3300049583 Bacteria 11985
862 Ga0501067_0003340 3300049583 Bacteria 8820
863 Ga0501067_0010687 3300049583 Bacteria 5079
864 Ga0501067_0013198 3300049583 Bacteria 4575
865 Ga0501067_0021136 3300049583 Bacteria 3602
866 Ga0501067_0022424 3300049583 Bacteria 3494
867 Ga0501067_0052719 3300049583 Bacteria 2254
868 Ga0501067_0064032 3300049583 Bacteria 2036
869 Ga0501068_0003123 3300049584 Bacteria 8860
870 Ga0501068_0003454 3300049584 Bacteria 8508
871 Ga0501068_0004344 3300049584 Bacteria 7701
872 Ga0501068_0006523 3300049584 Bacteria 6437
873 Ga0501068_0043889 3300049584 Bacteria 2690
874 Ga0501068_0051652 3300049584 Bacteria 2487
875 Ga0501069_0000870 3300049585 Bacteria 14363
876 Ga0501069_0004128 3300049585 Bacteria 7499
877 Ga0501069_0018444 3300049585 Bacteria 3765
878 Ga0501069_0080936 3300049585 Bacteria 1829
879 Ga0501070_0001222 3300049586 Bacteria 22995
880 Ga0501070_0002078 3300049586 Bacteria 17588
881 Ga0501070_0002312 3300049586 Bacteria 16724
882 Ga0501070_0005213 3300049586 Bacteria 11078
883 Ga0501070_0015415 3300049586 Bacteria 6430
884 Ga0501070_0017574 3300049586 Bacteria 6003
885 Ga0501070_0052438 3300049586 Bacteria 3386
886 Ga0501070_0054578 3300049586 Bacteria 3313
887 Ga0501070_0087253 3300049586 Bacteria 2583
888 Ga0501071_0000054 3300049587 Bacteria 38443
889 Ga0501071_0000117 3300049587 Bacteria 31405
890 Ga0501071_0003445 3300049587 Bacteria 9881
891 Ga0501071_0008444 3300049587 Bacteria 6808
892 Ga0501071_0009697 3300049587 Bacteria 6424
893 Ga0501071_0027431 3300049587 Bacteria 4006
894 Ga0501072_0001204 3300049588 Bacteria 19296
895 Ga0501072_0003186 3300049588 Bacteria 12338
896 Ga0501072_0024167 3300049588 Bacteria 4725
897 Ga0501072_0061672 3300049588 Bacteria 2958
898 Ga0501072_0068909 3300049588 Bacteria 2792
899 Ga0501072_0075382 3300049588 Bacteria 2668
900 Ga0501072_0110584 3300049588 Bacteria 2187
901 Ga0501073_0004823 3300049589 Bacteria 10126
902 Ga0501073_0007092 3300049589 Bacteria 8347
903 Ga0501073_0010771 3300049589 Bacteria 6697
904 Ga0501073_0023451 3300049589 Bacteria 4431
905 Ga0501074_0000008 3300049590 Bacteria 105048
906 Ga0501074_0002914 3300049590 Bacteria 12012
907 Ga0501074_0019307 3300049590 Bacteria 4951
908 Ga0501074_0019904 3300049590 Bacteria 4875
909 Ga0501074_0020522 3300049590 Bacteria 4801
910 Ga0501074_0023533 3300049590 Bacteria 4476
911 Ga0501074_0078352 3300049590 Bacteria 2371
912 Ga0501075_0000096 3300049591 Bacteria 40796
913 Ga0501075_0000800 3300049591 Bacteria 19695
914 Ga0501075_0011467 3300049591 Bacteria 6273
915 Ga0501075_0029522 3300049591 Bacteria 4056
916 Ga0501075_0029926 3300049591 Bacteria 4028
917 Ga0501075_0032826 3300049591 Bacteria 3859
918 Ga0501075_0073051 3300049591 Bacteria 2593
919 Ga0501076_0000020 3300049592 Bacteria 86221
920 Ga0501076_0000459 3300049592 Bacteria 25828
921 Ga0501076_0000951 3300049592 Bacteria 18911
922 Ga0501076_0037309 3300049592 Bacteria 3810
923 Ga0501076_0040264 3300049592 Bacteria 3671
924 Ga0501076_0043060 3300049592 Bacteria 3556
925 Ga0501076_0064067 3300049592 Bacteria 2929
926 Ga0501077_0000624 3300049593 Bacteria 21474
927 Ga0501077_0003516 3300049593 Bacteria 9408
928 Ga0501077_0016052 3300049593 Bacteria 4717
929 Ga0501077_0022187 3300049593 Bacteria 4020
930 Ga0501079_0000001 3300049741 Bacteria 121247
931 Ga0501079_0005831 3300049741 Bacteria 9209
932 Ga0501079_0008513 3300049741 Bacteria 7779
933 Ga0501079_0016128 3300049741 Bacteria 5710
934 Ga0501079_0036694 3300049741 Bacteria 3775
935 Ga0501079_0135057 3300049741 Bacteria 1920
936 Ga0501080_0002158 3300049742 Bacteria 17095
937 Ga0501080_0013819 3300049742 Bacteria 7433
938 Ga0501080_0018882 3300049742 Bacteria 6384
939 Ga0501080_0028840 3300049742 Bacteria 5166
940 Ga0501080_0034259 3300049742 Bacteria 4739
941 Ga0501080_0046933 3300049742 Bacteria 4020
942 Ga0501080_0055987 3300049742 Bacteria 3672
943 Ga0501080_0169167 3300049742 Bacteria 2016
944 Ga0501081_0001766 3300049743 Bacteria 13416
945 Ga0501081_0004360 3300049743 Bacteria 9074
946 Ga0501081_0026249 3300049743 Bacteria 3926
947 Ga0501081_0026767 3300049743 Bacteria 3890
948 Ga0501081_0027159 3300049743 Bacteria 3862
949 Ga0501081_0039825 3300049743 Bacteria 3216
950 Ga0501081_0102380 3300049743 Bacteria 2025
951 Ga0501083_0000739 3300049744 Bacteria 21326
952 Ga0501083_0002179 3300049744 Bacteria 13402
953 Ga0501083_0002761 3300049744 Bacteria 12131
954 Ga0501083_0003927 3300049744 Bacteria 10441
955 Ga0501083_0058501 3300049744 Bacteria 2579
956 Ga0501035_0028764 3300049822 Bacteria 5071
957 Ga0501035_0029303 3300049822 Bacteria 5019
958 Ga0501035_0112285 3300049822 Bacteria 2388
959 Ga0501044_0014620 3300049823 Bacteria 8464
960 Ga0501044_0063936 3300049823 Bacteria 3757
961 Ga0501045_0000708 3300049824 Bacteria 21218
962 Ga0501045_0000755 3300049824 Bacteria 20714
963 Ga0501045_0008054 3300049824 Bacteria 7341
964 Ga0501045_0026513 3300049824 Bacteria 4169
965 Ga0501045_0030710 3300049824 Bacteria 3889
966 Ga0501045_0043394 3300049824 Bacteria 3274
967 Ga0501045_0060316 3300049824 Bacteria 2780
968 nmdc:mga05p37_2214_c1 3300050507 Bacteria 22643
969 nmdc:mga05p37_299697_c1 3300050507 Bacteria 1910
970 nmdc:mga05p37_38898_c1 3300050507 Bacteria 5835
971 nmdc:mga05p37_47650_c1 3300050507 Bacteria 5270
972 nmdc:mga05p37_5442_c1 3300050507 Bacteria 14956
973 nmdc:mga09592_16354_c1 3300050508 Bacteria 6068
974 nmdc:mga09592_176511_c1 3300050508 Bacteria 1848
975 nmdc:mga09592_26880_c1 3300050508 Bacteria 4771
976 nmdc:mga06r32_266104_c1 3300050510 Bacteria 1702
977 nmdc:mga06r32_30187_c1 3300050510 Bacteria 5086
978 nmdc:mga06r32_33245_c1 3300050510 Bacteria 4857
979 nmdc:mga08y16_11668_c1 3300050511 Bacteria 9233
980 nmdc:mga08y16_16997_c1 3300050511 Bacteria 7660
981 nmdc:mga08y16_22993_c1 3300050511 Bacteria 6580
982 nmdc:mga08y16_28182_c1 3300050511 Bacteria 5920
983 nmdc:mga08y16_5500_c1 3300050511 Bacteria 13247
984 nmdc:mga0n895_128789_c1 3300050512 Bacteria 2555
985 nmdc:mga0n895_19412_c1 3300050512 Bacteria 6318
986 nmdc:mga0n895_76270_c1 3300050512 Bacteria 3334
987 nmdc:mga0rr50_32967_c1 3300050513 Bacteria 3697
988 nmdc:mga0rr50_72255_c1 3300050513 Bacteria 2634
989 nmdc:mga08x19_5201_c1 3300050514 Bacteria 7694
990 nmdc:mga08x19_93237_c1 3300050514 Bacteria 1990
991 nmdc:mga0a205_172373_c1 3300050515 Bacteria 2060
992 nmdc:mga0a205_20523_c1 3300050515 Bacteria 6236
993 nmdc:mga0a205_41630_c1 3300050515 Bacteria 4424
994 nmdc:mga0a205_46359_c1 3300050515 Bacteria 2926
995 nmdc:mga0a205_48698_c1 3300050515 Bacteria 4091
996 nmdc:mga0a205_6767_c1 3300050515 Bacteria 10367
997 Ga0495601_0001431 3300053077 Bacteria 13145
998 Ga0495601_0005282 3300053077 Bacteria 7513
999 Ga0495601_0048569 3300053077 Bacteria 2673
1000 Ga0495601_0054569 3300053077 Bacteria 2528
1001 Ga0495612_0004034 3300053078 Bacteria 6082
1002 Ga0495655_0009798 3300053083 Bacteria 1870
1003 Ga0495595_0006334 3300053084 Bacteria 4820
1004 Ga0495595_0013553 3300053084 Bacteria 3445
1005 Ga0495619_0002382 3300053085 Bacteria 12347
1006 Ga0495619_0017531 3300053085 Bacteria 4535
1007 Ga0495619_0018337 3300053085 Bacteria 4440
1008 Ga0501084_0000283 3300054114 Bacteria 38382
1009 Ga0501084_0008666 3300054114 Bacteria 8407
1010 Ga0501084_0013886 3300054114 Bacteria 6665
1011 Ga0501084_0050558 3300054114 Bacteria 3479
1012 Ga0501084_0050733 3300054114 Bacteria 3471
1013 Ga0501084_0137099 3300054114 Bacteria 2060
1014 Ga0501084_0179551 3300054114 Bacteria 1787
1015 Ga0590075_007928 3300059424 Bacteria 2528
1016 Ga0501082_0000620 3300060353 Bacteria 31200
1017 Ga0501082_0002904 3300060353 Bacteria 14943
1018 Ga0501082_0017448 3300060353 Bacteria 6184
1019 Ga0501082_0038647 3300060353 Bacteria 4117
1020 Ga0501082_0068574 3300060353 Bacteria 3053
1021 Ga0501082_0113879 3300060353 Bacteria 2342
1022 Ga0466962_0001376 3300061719 Bacteria 11265
1023 Ga0466962_0003375 3300061719 Bacteria 7601
1024 Ga0466962_0004440 3300061719 Bacteria 6718
1025 Ga0466962_0011665 3300061719 Bacteria 4232
1026 Ga0466962_0014473 3300061719 Bacteria 3803
1027 Ga0466962_0024540 3300061719 Bacteria 2896
1028 Ga0530510_0001002 3300061734 Bacteria 18761
1029 Ga0530510_0001060 3300061734 Bacteria 18252
1030 Ga0530510_0001361 3300061734 Bacteria 16335
1031 Ga0530510_0014530 3300061734 Bacteria 5554
1032 Ga0530510_0036421 3300061734 Bacteria 3546
1033 Ga0530510_0038731 3300061734 Bacteria 3442
1034 Ga0530510_0039015 3300061734 Bacteria 3428
1035 Ga0207707_10035996
1036 Ga0070658_10048517
1037 Ga0070658_10090251
1038 Ga0070683_100001612
1039 Ga0070683_100028245
1040 Ga0070683_100031746
1041 Ga0070683_100053781
1042 Ga0070683_100107785
1043 Ga0070690_100074147
1044 Ga0070666_10044989
1045 Ga0070666_10094012
1046 Ga0070680_100001193
1047 Ga0070680_100007929
1048 Ga0070682_100018411
1049 Ga0070682_100060420
1050 Ga0068868_100027694
1051 Ga0068868_100038181
1052 Ga0068868_100121115
1053 Ga0070660_100003043
1054 Ga0070660_100007452
1055 Ga0070660_100014797
1056 Ga0070660_100062766
1057 Ga0070689_100003195
1058 Ga0070689_100080529
1059 Ga0070691_10028892
1060 Ga0070691_10037142
1061 Ga0070691_10042030
1062 Ga0070661_100040044
1063 Ga0070661_100052069
1064 Ga0070661_100060072
1065 Ga0070661_100061907
1066 Ga0070661_100076218
1067 Ga0070692_10013638
1068 Ga0070692_10067405
1069 Ga0070675_100036864
1070 Ga0070671_100039895
1071 Ga0070674_100000543
1072 Ga0070674_100015836
1073 Ga0070674_100026295
1074 Ga0070673_100011197
1075 Ga0070688_100001134
1076 Ga0070688_100008762
1077 Ga0070659_100003675
1078 Ga0070659_100014416
1079 Ga0070714_100016781
1080 Ga0070714_100020904
1081 Ga0070714_100034628
1082 Ga0070714_100054193
1083 Ga0070714_100070067
1084 Ga0070714_100134464
1085 Ga0070714_100210159
1086 Ga0070713_100013107
1087 Ga0070713_100104198
1088 Ga0070710_10002265
1089 Ga0070710_10045399
1090 Ga0070710_10054617
1091 Ga0070711_100001299
1092 Ga0070711_100005506
1093 Ga0070711_100020141
1094 Ga0070711_100135546
1095 Ga0070700_100001551
1096 Ga0070694_100022946
1097 Ga0070694_100060885
1098 Ga0070694_100076570
1099 Ga0070694_100118010
1100 Ga0070708_100008348
1101 Ga0070663_100017434
1102 Ga0070663_100034149
1103 Ga0070678_100003432
1104 Ga0070678_100039088
1105 Ga0070678_100050596
1106 Ga0070681_10014740
1107 Ga0070681_10049046
1108 Ga0070681_10075487
1109 Ga0070681_10096251
1110 Ga0070681_10148986
1111 Ga0070681_10204372
1112 Ga0068867_100000290
1113 Ga0070706_100011218
1114 Ga0070706_100048234
1115 Ga0070706_100196822
1116 Ga0070707_100001971
1117 Ga0070707_100006528
1118 Ga0070707_100023400
1119 Ga0070698_100008197
1120 Ga0070698_100024916
1121 Ga0070698_100026236
1122 Ga0070698_100052694
1123 Ga0070698_100063589
1124 Ga0070699_100043399
1125 Ga0070699_100132275
1126 Ga0070679_100005801
1127 Ga0070679_100012416
1128 Ga0070679_100035772
1129 Ga0070679_100080839
1130 Ga0070679_100088554
1131 Ga0070679_100105410
1132 Ga0070679_100152799
1133 Ga0070684_100023758
1134 Ga0070684_100059887
1135 Ga0070684_100074455
1136 Ga0070684_100092946
1137 Ga0070684_100093795
1138 Ga0068853_100100694
1139 Ga0070672_100200075
1140 Ga0070686_100002931
1141 Ga0070686_100044438
1142 Ga0070695_100000746
1143 Ga0070695_100036301
1144 Ga0070695_100127536
1145 Ga0070696_100002162
1146 Ga0070696_100051214
1147 Ga0070696_100070011
1148 Ga0070693_100010201
1149 Ga0070693_100128295
1150 Ga0070665_100070335
1151 Ga0070704_100092796
1152 Ga0068855_100044686
1153 Ga0068855_100087304
1154 Ga0070664_100034418
1155 Ga0070664_100054750
1156 Ga0070664_100092738
1157 Ga0070664_100209317
1158 Ga0068857_100075954
1159 Ga0068857_100079569
1160 Ga0068856_100120729
1161 Ga0070702_100000583
1162 Ga0070702_100058442
1163 Ga0070702_100072254
1164 Ga0068852_100016361
1165 Ga0068852_100261307
1166 Ga0068864_100054424
1167 Ga0068866_10000154
1168 Ga0068861_100069512
1169 Ga0068861_100123084
1170 Ga0068858_100055537
1171 Ga0068860_100042034
1172 Ga0068862_100071626
1173 Ga0081455_10002410
1174 Ga0081455_10002626
1175 Ga0081455_10004721
1176 Ga0081455_10030501
1177 Ga0081538_10000151
1178 Ga0081538_10000492
1179 Ga0081538_10000613
1180 Ga0081538_10002077
1181 Ga0081538_10002734
1182 Ga0081538_10003142
1183 Ga0081538_10004272
1184 Ga0081538_10007389
1185 Ga0081538_10008374
1186 Ga0081540_1007223
1187 Ga0081539_10000200
1188 Ga0081539_10000867
1189 Ga0081539_10002620
1190 Ga0070717_10003839
1191 Ga0070717_10081446
1192 Ga0070717_10224919
1193 Ga0075432_10003010
1194 Ga0075432_10007679
1195 Ga0070715_10001264
1196 Ga0070716_100034410
1197 Ga0070712_100008840
1198 Ga0070712_100012447
1199 Ga0070712_100123005
1200 Ga0097621_100024884
1201 Ga0097621_100046132
1202 Ga0068871_100004124
1203 Ga0075428_100007989
1204 Ga0075428_100023960
1205 Ga0075428_100041907
1206 Ga0075428_100047776
1207 Ga0075428_100066941
1208 Ga0075428_100149670
1209 Ga0075430_100044310
1210 Ga0075431_100006255
1211 Ga0075431_100067676
1212 Ga0075431_100078992
1213 Ga0075433_10029961
1214 Ga0075434_100071797
1215 Ga0075434_100125690
1216 Ga0075429_100009903
1217 Ga0075429_100010729
1218 Ga0075429_100035324
1219 Ga0068865_100000501
1220 Ga0068865_100009127
1221 Ga0075436_100035492
1222 Ga0075435_100001081
1223 Ga0075435_100020517
1224 Ga0075435_100034635
1225 Ga0075435_100049337
1226 Ga0075435_100054993
1227 Ga0075435_100168104
1228 Ga0105240_10011339
1229 Ga0105240_10023789
1230 Ga0105240_10330296
1231 Ga0111539_10005525
1232 Ga0111539_10005906
1233 Ga0111539_10045158
1234 Ga0111539_10048461
1235 Ga0111539_10068447
1236 Ga0111539_10155399
1237 Ga0105245_10010962
1238 Ga0105245_10020166
1239 Ga0114129_10009560
1240 Ga0114129_10023764
1241 Ga0114129_10032301
1242 Ga0114129_10139883
1243 Ga0105243_10001079
1244 Ga0105243_10015682
1245 Ga0105243_10045523
1246 Ga0105242_10048550
1247 Ga0105242_10095225
1248 Ga0105242_10194739
1249 Ga0105248_10032131
1250 Ga0105237_10079052
1251 Ga0105238_10074842
1252 Ga0105238_10096800
1253 Ga0105238_10269620
1254 Ga0105249_10001927
1255 Ga0105249_10052943
1256 Ga0105249_10077117
1257 Ga0105249_10148260
1258 Ga0105239_10001224
1259 Ga0105239_10073178
1260 Ga0105239_10078673
1261 Ga0105239_10081462
1262 Ga0105239_10095690
1263 Ga0157371_10031282
1264 Ga0157370_10050293
1265 Ga0157370_10082653
1266 Ga0157369_10009001
1267 Ga0157369_10016530
1268 Ga0157369_10018494
1269 Ga0157369_10195219
1270 Ga0157374_10001561
1271 Ga0157378_10002273
1272 Ga0163162_10023555
1273 Ga0157372_10040929
1274 Ga0157372_10045867
1275 Ga0157375_10003215
1276 Ga0157375_10122267
1277 Ga0157375_10144771
1278 Ga0157375_10231632
1279 Ga0157375_10325069
1280 Ga0163163_10189411
1281 Ga0157380_10049297
1282 Ga0157380_10064273
1283 Ga0157380_10102898
1284 Ga0157380_10106757
1285 Ga0182008_10010441
1286 Ga0157377_10018972
1287 Ga0157376_10015090
1288 Ga0157376_10114693
1289 Ga0197907_10084652
1290 Ga0206356_10153600
1291 Ga0206356_10750028
1292 Ga0206349_1027768
1293 Ga0206354_11273170
1294 Ga0206353_10723334
1295 Ga0213874_10027387
1296 Ga0224712_10006017
1297 Ga0224712_10015516
1298 Ga0207642_10000121
1299 Ga0207688_10018244
1300 Ga0207688_10031001
1301 Ga0207680_10057138
1302 Ga0207699_10055578
1303 Ga0207643_10022128
1304 Ga0207705_10056981
1305 Ga0207705_10062374
1306 Ga0207684_10086593
1307 Ga0207654_10041893
1308 Ga0207707_10051969
1309 Ga0207707_10113915
1310 Ga0207707_10115209
1311 Ga0207707_10153453
1312 Ga0207695_10027770
1313 Ga0207695_10184941
1314 Ga0207671_10035733
1315 Ga0207693_10000499
1316 Ga0207693_10001416
1317 Ga0207693_10002670
1318 Ga0207693_10008705
1319 Ga0207693_10011959
1320 Ga0207693_10014553
1321 Ga0207693_10135413
1322 Ga0207663_10025014
1323 Ga0207657_10002712
1324 Ga0207657_10027905
1325 Ga0207657_10050254
1326 Ga0207657_10094033
1327 Ga0207649_10033336
1328 Ga0207649_10134178
1329 Ga0207652_10018853
1330 Ga0207646_10000757
1331 Ga0207646_10001072
1332 Ga0207681_10072251
1333 Ga0207659_10085313
1334 Ga0207659_10130136
1335 Ga0207687_10004288
1336 Ga0207687_10160103
1337 Ga0207700_10000001
1338 Ga0207700_10015258
1339 Ga0207664_10002805
1340 Ga0207664_10009266
1341 Ga0207664_10137754
1342 Ga0207690_10045481
1343 Ga0207690_10054930
1344 Ga0207690_10155782
1345 Ga0207706_10051002
1346 Ga0207686_10052622
1347 Ga0207709_10000781
1348 Ga0207709_10037200
1349 Ga0207669_10003091
1350 Ga0207669_10030400
1351 Ga0207704_10001528
1352 Ga0207665_10003907
1353 Ga0207665_10016660
1354 Ga0207691_10013943
1355 Ga0207691_10054726
1356 Ga0207661_10000580
1357 Ga0207661_10058766
1358 Ga0207661_10072502
1359 Ga0207661_10080608
1360 Ga0207661_10086981
1361 Ga0207661_10089816
1362 Ga0207661_10137995
1363 Ga0207679_10033525
1364 Ga0207679_10060316
1365 Ga0207667_10050908
1366 Ga0207667_10137314
1367 Ga0207667_10142369
1368 Ga0207667_10239005
1369 Ga0207712_10004576
1370 Ga0207668_10003765
1371 Ga0207658_10047922
1372 Ga0207677_10008583
1373 Ga0207677_10018980
1374 Ga0207677_10031235
1375 Ga0207703_10021711
1376 Ga0207639_10008584
1377 Ga0207678_10047114
1378 Ga0207678_10090283
1379 Ga0207708_10001823
1380 Ga0207702_10004445
1381 Ga0207702_10017385
1382 Ga0207641_10070569
1383 Ga0207648_10002767
1384 Ga0207648_10012419
1385 Ga0207674_10037873
1386 Ga0207675_100001891
1387 Ga0207675_100017381
1388 Ga0207675_100020606
1389 Ga0207683_10001565
1390 Ga0207428_10000244
1391 Ga0207428_10057044
1392 Ga0268266_10130681
1393 Ga0268265_10144192
1394 Ga0268264_10027757
1395 Ga0265319_1009630
1396 Ga0265319_1018835
1397 Ga0265319_1019652
1398 Ga0265334_10042546
1399 Ga0265322_10007725
1400 Ga0265336_10008333
1401 Ga0265338_10006251
1402 Ga0265338_10008857
1403 Ga0265338_10077537
1404 Ga0265338_10147231
1405 Ga0265330_10031876
1406 Ga0265330_10035924
1407 Ga0265320_10031846
1408 Ga0265329_10010080
1409 Ga0265340_10019740
1410 Ga0265340_10022673
1411 Ga0265339_10002054
1412 Ga0265316_10019125
1413 Ga0265316_10020308
1414 Ga0265316_10087603
1415 Ga0265316_10143485
1416 Ga0307408_100006069
1417 Ga0265313_10005116
1418 Ga0265313_10027386
1419 Ga0265314_10005028
1420 Ga0265314_10007429
1421 Ga0265342_10010488
1422 Ga0307405_10004696
1423 Ga0307406_10006630
1424 Ga0307409_100085809
1425 Ga0307416_100022597
1426 Ga0307416_100056338
1427 Ga0307416_100070320
1428 Ga0307411_10016379
1429 Ga0307415_100000242
1430 Ga0307415_100000296
1431 Ga0307415_100078049
1432 Ga0373958_0003559
1433 Ga0373959_0007324
1434 Ga0373938_0001594
1435 Ga0373932_0004267
1436 Ga0373941_0001838
1437 Ga0373945_0003703
1438 Ga0373960_0000512
1439 Ga0373943_0000299
1440 Ga0373943_0026853
1441 Ga0373946_0055940
1442 Ga0373955_0072045
1443 Ga0373942_0003061
1444 Ga0373961_0005198
1445 Ga0373962_0004247
1446 Ga0373962_0005842
1447 Ga0373931_0040054
1448 Ga0373935_0012275
1449 Ga0373927_0020520
1450 Ga0373947_0003334
1451 Ga0373947_0003997
1452 Ga0373947_0014253
1453 Ga0373925_0014062
1454 Ga0395899_0001169
1455 Ga0395899_0002224
1456 Ga0395899_0004452
1457 Ga0395899_0008461
1458 Ga0395899_0009648
1459 Ga0395899_0016439
1460 Ga0395899_0028251
1461 Ga0395899_0040607
1462 Ga0395899_0047137
1463 Ga0395899_0076678
1464 Ga0395899_0153004
1465 Ga0395900_0005122
1466 Ga0395900_0005149
1467 Ga0395900_0005255
1468 Ga0395900_0006094
1469 Ga0395900_0006594
1470 Ga0395900_0009359
1471 Ga0395900_0016810
1472 Ga0395900_0036606
1473 Ga0395900_0063720
1474 Ga0395900_0064020
1475 Ga0395900_0081145
1476 Ga0395900_0088565
1477 Ga0395900_0128124
1478 Ga0395900_0158173
1479 Ga0395900_0161847
1480 Ga0395900_0238681
1481 Ga0395900_0261847
1482 Ga0395900_0278413
1483 Ga0395898_0003908
1484 Ga0395898_0005694
1485 Ga0395898_0006540
1486 Ga0395898_0007369
1487 Ga0395898_0008036
1488 Ga0395898_0010359
1489 Ga0395898_0011736
1490 Ga0395898_0012306
1491 Ga0395898_0014022
1492 Ga0395898_0014716
1493 Ga0395898_0020301
1494 Ga0395898_0020346
1495 Ga0395898_0032145
1496 Ga0395898_0058395
1497 Ga0395898_0072492
1498 Ga0395898_0090227
1499 Ga0395898_0136526
1500 Ga0395905_0005427
1501 Ga0395905_0007309
1502 Ga0395905_0007430
1503 Ga0395905_0009544
1504 Ga0395905_0018418
1505 Ga0395905_0028812
1506 Ga0395905_0033659
1507 Ga0395905_0035066
1508 Ga0395905_0038856
1509 Ga0395905_0039367
1510 Ga0395905_0053183
1511 Ga0395905_0058225
1512 Ga0395905_0062670
1513 Ga0395905_0100291
1514 Ga0395905_0103368
1515 Ga0395905_0133502
1516 Ga0395905_0154951
1517 Ga0395905_0179054
1518 Ga0395905_0231827
1519 Ga0395901_0001057
1520 Ga0395901_0001077
1521 Ga0395901_0002248
1522 Ga0395901_0003646
1523 Ga0395901_0004617
1524 Ga0395901_0005172
1525 Ga0395901_0007398
1526 Ga0395901_0012458
1527 Ga0395901_0018337
1528 Ga0395901_0019264
1529 Ga0395901_0021879
1530 Ga0395901_0028507
1531 Ga0395901_0035315
1532 Ga0395901_0036915
1533 Ga0395901_0044519
1534 Ga0395901_0143511
1535 Ga0436360_0487569
1536 Ga0436363_0891141
1537 Ga0439438_012206
1538 Ga0439439_0000991
1539 Ga0439433_0000482
1540 Ga0439446_0002523
1541 Ga0439446_0006535
1542 Ga0439458_0011982
1543 Ga0439434_0022679
1544 Ga0466969_0001126
1545 Ga0466965_0046829
1546 Ga0466966_0007848
1547 Ga0466966_0015704
1548 Ga0466966_0077835
1549 Ga0466966_0113135
1550 Ga0466961_0013305
1551 Ga0466963_0000481
1552 Ga0466963_0001325
1553 Ga0466963_0001333
1554 Ga0466963_0003978
1555 Ga0466963_0026825
1556 Ga0466963_0028114
1557 Ga0466963_0029723
1558 Ga0466963_0053674
1559 Ga0466963_0071803
1560 Ga0466964_0003730
1561 Ga0466964_0010882
1562 Ga0466964_0027735
1563 Ga0466964_0048637
1564 Ga0466971_0005631
1565 Ga0466970_0002928
1566 Ga0466970_0053697
1567 Ga0466957_0000932
1568 Ga0466957_0003321
1569 Ga0466957_0004549
1570 Ga0466957_0029409
1571 Ga0466957_0029425
1572 Ga0466960_0009316
1573 Ga0466960_0015644
1574 Ga0466960_0026689
1575 Ga0466959_0003610
1576 Ga0466959_0010632
1577 Ga0466959_0045996
1578 Ga0466958_0000447
1579 Ga0466958_0002557
1580 Ga0466958_0006920
1581 Ga0466958_0009219
1582 Ga0466967_0000291
1583 Ga0466967_0002093
1584 Ga0466967_0003596
1585 Ga0466967_0003679
1586 Ga0466967_0005179
1587 Ga0466967_0006520
1588 Ga0466967_0010493
1589 Ga0466967_0012008
1590 Ga0466967_0018485
1591 Ga0466967_0048711
1592 Ga0466967_0049464
1593 Ga0466967_0064511
1594 Ga0466967_0068375
1595 Ga0466967_0070681
1596 Ga0466967_0072929
1597 Ga0466967_0100924
1598 Ga0466967_0122896
1599 Ga0466967_0133349
1600 Ga0466967_0138592
1601 Ga0466967_0191375
1602 Ga0495592_0000989
1603 Ga0495592_0027546
1604 Ga0495592_0036920
1605 Ga0495603_0011232
1606 Ga0495629_0000403
1607 Ga0495629_0008955
1608 Ga0495629_0081982
1609 Ga0495641_0000331
1610 Ga0495641_0051979
1611 Ga0495651_0000064
1612 Ga0495651_0008032
1613 Ga0495651_0069600
1614 Ga0495651_0121885
1615 Ga0495653_0000351
1616 Ga0495653_0014756
1617 Ga0495653_0040238
1618 Ga0495653_0093272
1619 Ga0495582_0000426
1620 Ga0495582_0010215
1621 Ga0495582_0035117
1622 Ga0495582_0064436
1623 Ga0495639_0000619
1624 Ga0495662_0004650
1625 Ga0495664_0040502
1626 Ga0495664_0052194
1627 Ga0495585_0029861
1628 Ga0495608_0004037
1629 Ga0495608_0006061
1630 Ga0495608_0006677
1631 Ga0495618_0000613
1632 Ga0495618_0021181
1633 Ga0495628_0000069
1634 Ga0495628_0025798
1635 Ga0495628_0055727
1636 Ga0495630_0006653
1637 Ga0495652_0011521
1638 Ga0495652_0059185
1639 Ga0495665_0007390
1640 Ga0495665_0042941
1641 Ga0495640_0024614
1642 Ga0495640_0034641
1643 Ga0495587_0004197
1644 Ga0495645_0000085
1645 Ga0495645_0033047
1646 Ga0495667_0011723
1647 Ga0495667_0032603
1648 Ga0495667_0103416
1649 Ga0495634_0021939
1650 Ga0495634_0053894
1651 Ga0495634_0073673
1652 Ga0495635_0030960
1653 Ga0495635_0040315
1654 Ga0495635_0106595
1655 Ga0495657_0003621
1656 Ga0495657_0064673
1657 Ga0495599_0000146
1658 Ga0495599_0095665
1659 Ga0495623_0000030
1660 Ga0495623_0006977
1661 Ga0495646_0001436
1662 Ga0495658_0000302
1663 Ga0495658_0004983
1664 Ga0495669_0046726
1665 Ga0495613_0005126
1666 Ga0495613_0044632
1667 Ga0495624_0001304
1668 Ga0495624_0059108
1669 Ga0495600_0089147
1670 Ga0495581_0000117
1671 Ga0495581_0000815
1672 Ga0495581_0006138
1673 Ga0495604_0000103
1674 Ga0495604_0007052
1675 Ga0495674_0041491
1676 Ga0495674_0059974
1677 Ga0495674_0078384
1678 Ga0495674_0192630
1679 Ga0495676_0000268
1680 Ga0495676_0027491
1681 Ga0495676_0037003
1682 Ga0495676_0041028
1683 Ga0495680_0006548
1684 Ga0495680_0009114
1685 Ga0495680_0021704
1686 Ga0495680_0023092
1687 Ga0495675_0000509
1688 Ga0495677_0015913
1689 Ga0495684_0029398
1690 Ga0495684_0037130
1691 Ga0495684_0042600
1692 Ga0495684_0046375
1693 Ga0495593_0024595
1694 Ga0495602_0000080
1695 Ga0495602_0067752
1696 Ga0496100_0056841
1697 Ga0496100_0066431
1698 Ga0496101_0001887
1699 Ga0496101_0002078
1700 Ga0496101_0017603
1701 Ga0496101_0037828
1702 Ga0496101_0066151
1703 Ga0496101_0084755
1704 Ga0496101_0093921
1705 Ga0496102_0000944
1706 Ga0496102_0001216
1707 Ga0496102_0004404
1708 Ga0496102_0026332
1709 Ga0496102_0177981
1710 Ga0496102_0255133
1711 Ga0496103_0000709
1712 Ga0496103_0002863
1713 Ga0496103_0009008
1714 Ga0496103_0026438
1715 Ga0496103_0044774
1716 Ga0496103_0050733
1717 Ga0496103_0079495
1718 Ga0496104_0000557
1719 Ga0496104_0000803
1720 Ga0496104_0015511
1721 Ga0496104_0048420
1722 Ga0496104_0050879
1723 Ga0496104_0054188
1724 Ga0496104_0073981
1725 Ga0496104_0077240
1726 Ga0496104_0078219
1727 Ga0496104_0122633
1728 Ga0496104_0170603
1729 Ga0496105_0000609
1730 Ga0496105_0001118
1731 Ga0496105_0001193
1732 Ga0496105_0015049
1733 Ga0496105_0112543
1734 Ga0496105_0139676
1735 Ga0496106_0002624
1736 Ga0496106_0003561
1737 Ga0496106_0005352
1738 Ga0496106_0005639
1739 Ga0496106_0008920
1740 Ga0496106_0032617
1741 Ga0496106_0039546
1742 Ga0496106_0089814
1743 Ga0496106_0091210
1744 Ga0496107_0000316
1745 Ga0496107_0003225
1746 Ga0496107_0009186
1747 Ga0496107_0009483
1748 Ga0496107_0012003
1749 Ga0496107_0069792
1750 Ga0496108_0002980
1751 Ga0496108_0004461
1752 Ga0496108_0005258
1753 Ga0496108_0009378
1754 Ga0496108_0014225
1755 Ga0496108_0015755
1756 Ga0496108_0041165
1757 Ga0496108_0084990
1758 Ga0496109_0000533
1759 Ga0496109_0005342
1760 Ga0496109_0013614
1761 Ga0496109_0018687
1762 Ga0496109_0020769
1763 Ga0496109_0027342
1764 Ga0496109_0070927
1765 Ga0496109_0075342
1766 Ga0496109_0077438
1767 Ga0496109_0126829
1768 Ga0496110_0000411
1769 Ga0496110_0000564
1770 Ga0496110_0002200
1771 Ga0496110_0006619
1772 Ga0496110_0010041
1773 Ga0496110_0010182
1774 Ga0496110_0018708
1775 Ga0496110_0035022
1776 Ga0496110_0053588
1777 Ga0496110_0055947
1778 Ga0496110_0206876
1779 Ga0496111_0000084
1780 Ga0496111_0002152
1781 Ga0496111_0002910
1782 Ga0496111_0005171
1783 Ga0496111_0011785
1784 Ga0496111_0017815
1785 Ga0496111_0049655
1786 Ga0496112_0005317
1787 Ga0496112_0010136
1788 Ga0496112_0042540
1789 Ga0496112_0058123
1790 Ga0496112_0094135
1791 Ga0496112_0112007
1792 Ga0496112_0112008
1793 Ga0496112_0169739
1794 Ga0496112_0307529
1795 Ga0496113_0002984
1796 Ga0496113_0006885
1797 Ga0496113_0032874
1798 Ga0496113_0047449
1799 Ga0496113_0157758
1800 Ga0496114_0000177
1801 Ga0496114_0002173
1802 Ga0496114_0004084
1803 Ga0496114_0004101
1804 Ga0496114_0012037
1805 Ga0496114_0013794
1806 Ga0496114_0036190
1807 Ga0496114_0051653
1808 Ga0496114_0072300
1809 Ga0496114_0075135
1810 Ga0496114_0077140
1811 Ga0496114_0153561
1812 Ga0496115_0000276
1813 Ga0496115_0000825
1814 Ga0496115_0008631
1815 Ga0496115_0013740
1816 Ga0496115_0028657
1817 Ga0501031_0000033
1818 Ga0501031_0001619
1819 Ga0501031_0001976
1820 Ga0501031_0007791
1821 Ga0501031_0010773
1822 Ga0501031_0071414
1823 Ga0501031_0087831
1824 Ga0501032_0006726
1825 Ga0501032_0018372
1826 Ga0501032_0045697
1827 Ga0501033_0000388
1828 Ga0501033_0004305
1829 Ga0501033_0008760
1830 Ga0501034_0005985
1831 Ga0501034_0043882
1832 Ga0501034_0176971
1833 Ga0501036_0000462
1834 Ga0501036_0006015
1835 Ga0501036_0014753
1836 Ga0501036_0021834
1837 Ga0501036_0033191
1838 Ga0501036_0150469
1839 Ga0501037_0050998
1840 Ga0501037_0141543
1841 Ga0501038_0001345
1842 Ga0501038_0003559
1843 Ga0501038_0003931
1844 Ga0501038_0051955
1845 Ga0501038_0063654
1846 Ga0501038_0065149
1847 Ga0501039_0000528
1848 Ga0501039_0004944
1849 Ga0501039_0005475
1850 Ga0501039_0019537
1851 Ga0501039_0062956
1852 Ga0501039_0069825
1853 Ga0501039_0102448
1854 Ga0501040_0000234
1855 Ga0501040_0000862
1856 Ga0501040_0001857
1857 Ga0501040_0023262
1858 Ga0501040_0026007
1859 Ga0501040_0057479
1860 Ga0501040_0081988
1861 Ga0501041_0000176
1862 Ga0501041_0000463
1863 Ga0501041_0001181
1864 Ga0501041_0010616
1865 Ga0501041_0020227
1866 Ga0501041_0038298
1867 Ga0501042_0000717
1868 Ga0501042_0001430
1869 Ga0501042_0002112
1870 Ga0501042_0004174
1871 Ga0501042_0006865
1872 Ga0501042_0034503
1873 Ga0501042_0037226
1874 Ga0501042_0107991
1875 Ga0501043_0000798
1876 Ga0501043_0004708
1877 Ga0501043_0009672
1878 Ga0501043_0030381
1879 Ga0501043_0039536
1880 Ga0501043_0099439
1881 Ga0501043_0146066
1882 Ga0501046_0000577
1883 Ga0501046_0001998
1884 Ga0501046_0010127
1885 Ga0501046_0016777
1886 Ga0501046_0025265
1887 Ga0501046_0080128
1888 Ga0501047_0001088
1889 Ga0501047_0049901
1890 Ga0501048_0000440
1891 Ga0501048_0001055
1892 Ga0501048_0001065
1893 Ga0501048_0008231
1894 Ga0501048_0027709
1895 Ga0501067_0001736
1896 Ga0501067_0003340
1897 Ga0501067_0010687
1898 Ga0501067_0013198
1899 Ga0501067_0021136
1900 Ga0501067_0022424
1901 Ga0501067_0052719
1902 Ga0501067_0064032
1903 Ga0501068_0003123
1904 Ga0501068_0003454
1905 Ga0501068_0004344
1906 Ga0501068_0006523
1907 Ga0501068_0043889
1908 Ga0501068_0051652
1909 Ga0501069_0000870
1910 Ga0501069_0004128
1911 Ga0501069_0018444
1912 Ga0501069_0080936
1913 Ga0501070_0001222
1914 Ga0501070_0002078
1915 Ga0501070_0002312
1916 Ga0501070_0005213
1917 Ga0501070_0015415
1918 Ga0501070_0017574
1919 Ga0501070_0052438
1920 Ga0501070_0054578
1921 Ga0501070_0087253
1922 Ga0501071_0000054
1923 Ga0501071_0000117
1924 Ga0501071_0003445
1925 Ga0501071_0008444
1926 Ga0501071_0009697
1927 Ga0501071_0027431
1928 Ga0501072_0001204
1929 Ga0501072_0003186
1930 Ga0501072_0024167
1931 Ga0501072_0061672
1932 Ga0501072_0068909
1933 Ga0501072_0075382
1934 Ga0501072_0110584
1935 Ga0501073_0004823
1936 Ga0501073_0007092
1937 Ga0501073_0010771
1938 Ga0501073_0023451
1939 Ga0501074_0000008
1940 Ga0501074_0002914
1941 Ga0501074_0019307
1942 Ga0501074_0019904
1943 Ga0501074_0020522
1944 Ga0501074_0023533
1945 Ga0501074_0078352
1946 Ga0501075_0000096
1947 Ga0501075_0000800
1948 Ga0501075_0011467
1949 Ga0501075_0029522
1950 Ga0501075_0029926
1951 Ga0501075_0032826
1952 Ga0501075_0073051
1953 Ga0501076_0000020
1954 Ga0501076_0000459
1955 Ga0501076_0000951
1956 Ga0501076_0037309
1957 Ga0501076_0040264
1958 Ga0501076_0043060
1959 Ga0501076_0064067
1960 Ga0501077_0000624
1961 Ga0501077_0003516
1962 Ga0501077_0016052
1963 Ga0501077_0022187
1964 Ga0501079_0000001
1965 Ga0501079_0005831
1966 Ga0501079_0008513
1967 Ga0501079_0016128
1968 Ga0501079_0036694
1969 Ga0501079_0135057
1970 Ga0501080_0002158
1971 Ga0501080_0013819
1972 Ga0501080_0018882
1973 Ga0501080_0028840
1974 Ga0501080_0034259
1975 Ga0501080_0046933
1976 Ga0501080_0055987
1977 Ga0501080_0169167
1978 Ga0501081_0001766
1979 Ga0501081_0004360
1980 Ga0501081_0026249
1981 Ga0501081_0026767
1982 Ga0501081_0027159
1983 Ga0501081_0039825
1984 Ga0501081_0102380
1985 Ga0501083_0000739
1986 Ga0501083_0002179
1987 Ga0501083_0002761
1988 Ga0501083_0003927
1989 Ga0501083_0058501
1990 Ga0501035_0028764
1991 Ga0501035_0029303
1992 Ga0501035_0112285
1993 Ga0501044_0014620
1994 Ga0501044_0063936
1995 Ga0501045_0000708
1996 Ga0501045_0000755
1997 Ga0501045_0008054
1998 Ga0501045_0026513
1999 Ga0501045_0030710
2000 Ga0501045_0043394
2001 Ga0501045_0060316
2002 nmdc:mga05p37_2214_c1
2003 nmdc:mga05p37_299697_c1
2004 nmdc:mga05p37_38898_c1
2005 nmdc:mga05p37_47650_c1
2006 nmdc:mga05p37_5442_c1
2007 nmdc:mga09592_16354_c1
2008 nmdc:mga09592_176511_c1
2009 nmdc:mga09592_26880_c1
2010 nmdc:mga06r32_266104_c1
2011 nmdc:mga06r32_30187_c1
2012 nmdc:mga06r32_33245_c1
2013 nmdc:mga08y16_11668_c1
2014 nmdc:mga08y16_16997_c1
2015 nmdc:mga08y16_22993_c1
2016 nmdc:mga08y16_28182_c1
2017 nmdc:mga08y16_5500_c1
2018 nmdc:mga0n895_128789_c1
2019 nmdc:mga0n895_19412_c1
2020 nmdc:mga0n895_76270_c1
2021 nmdc:mga0rr50_32967_c1
2022 nmdc:mga0rr50_72255_c1
2023 nmdc:mga08x19_5201_c1
2024 nmdc:mga08x19_93237_c1
2025 nmdc:mga0a205_172373_c1
2026 nmdc:mga0a205_20523_c1
2027 nmdc:mga0a205_41630_c1
2028 nmdc:mga0a205_46359_c1
2029 nmdc:mga0a205_48698_c1
2030 nmdc:mga0a205_6767_c1
2031 Ga0495601_0001431
2032 Ga0495601_0005282
2033 Ga0495601_0048569
2034 Ga0495601_0054569
2035 Ga0495612_0004034
2036 Ga0495655_0009798
2037 Ga0495595_0006334
2038 Ga0495595_0013553
2039 Ga0495619_0002382
2040 Ga0495619_0017531
2041 Ga0495619_0018337
2042 Ga0501084_0000283
2043 Ga0501084_0008666
2044 Ga0501084_0013886
2045 Ga0501084_0050558
2046 Ga0501084_0050733
2047 Ga0501084_0137099
2048 Ga0501084_0179551
2049 Ga0590075_007928
2050 Ga0501082_0000620
2051 Ga0501082_0002904
2052 Ga0501082_0017448
2053 Ga0501082_0038647
2054 Ga0501082_0068574
2055 Ga0501082_0113879
2056 Ga0466962_0001376
2057 Ga0466962_0003375
2058 Ga0466962_0004440
2059 Ga0466962_0011665
2060 Ga0466962_0014473
2061 Ga0466962_0024540
2062 Ga0530510_0001002
2063 Ga0530510_0001060
2064 Ga0530510_0001361
2065 Ga0530510_0014530
2066 Ga0530510_0036421
2067 Ga0530510_0038731
2068 Ga0530510_0039015

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

7

80

0.98

PF02817

E3_binding

e3 binding domain

94

129

0.96

PF00198

2-oxoacid_dh

2-oxoacid dehydrogenases acyltransferase (catalytic domain)

148

349

0.94

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

47

92

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rnm-assembly1.cif.gz_E the crystal structure of the subunit binding of human dihydrolipoamide transacylase (e2b) bound to human dihydrolipoamide dehydrogenase (e3) 0.9194 84 126
1w88-assembly1.cif.gz_I the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.919 83 121
2ejg-assembly1.cif.gz_C crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9148 9 74
1w85-assembly1.cif.gz_I the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 0.9119 83 122
3rnm-assembly2.cif.gz_F the crystal structure of the subunit binding of human dihydrolipoamide transacylase (e2b) bound to human dihydrolipoamide dehydrogenase (e3) 0.9087 85 126
ID Description Score Start End Superfamily
af_P9WPQ1_4_71_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9299 20 75 2.40.50.100
3rnmE00 Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain 0.9195 84 126 4.10.320.10
1w88J00 Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain 0.9151 83 122 4.10.320.10
3rnmF00 Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain 0.9087 85 126 4.10.320.10
1w3dA00 Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain 0.9073 81 122 4.10.320.10
ID Description Score Start End GO Terms
AF-A0A7S3IEW3-F1-model_v4 dihydrolipoyllysine-residue succinyltransferase (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) 0.9308 156 357 GO:0004149
GO:0005739
GO:0006099
AF-A0A5N5T3V9-F1-model_v4 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (E2K) 0.9289 156 357 GO:0004149
GO:0005739
GO:0006099
GO:0045252
AF-A0A7C8GWK0-F1-model_v4 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) 0.927 160 357 GO:0004149
GO:0005829
GO:0006099
AF-A0A3C1FGT1-F1-model_v4 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase 0.9254 158 362 GO:0005737
GO:0016407
GO:0031405
AF-A0A7C5WM39-F1-model_v4 2-oxoacid dehydrogenase acyltransferase catalytic domain-containing protein 0.9227 158 358 GO:0005737
GO:0016407
GO:0031405

Map