F488676
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1034 | 331 | 2068 | 364 |
Family's Representative Sequence
| Representative Sequence | 3300025912|Ga0207707_10035996|Ga0207707_100359966 |
| Length | 349 |
| Sequence | MASTTAVDVVMPQMGVSVSEGTITKWSKNVGDTIEADETLLEISTDKVDTEVPSPASGVVTEILVQEGETVEVGTVLARIGGEAPAQAADNGKAFVSPVVARIAAEHGIDPSQIPGTGTGGRVTKKDIVAFVEGQAAAPTSLQPQAAGQGETLEPMSAMRRGIAEHMRRSLDTSAHVTSAIEVDMTRVVQIREKLKKEYQSAYGVNPTYLAFIARATVETLRDYPWVNGELRGDQIVTRNYVNLGFAVELADGKGLIVPNLKNAETLNLLGMAKGIAEIAKRARDKKLTPDDVAGGSFTITNPGGYGTFHGTPVISQPQAGILGTYAIVKRPWVITDESGADAIAIRSM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 180 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 205 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 206 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 207 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 208 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 217 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 268 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 269 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 270 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 271 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 272 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 331 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.23 |
| Metatranscriptomes | 0.77 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.7 |
| Rhizosphere | 88.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207707_10035996 | 3300025912 | Bacteria | 4328 |
| 2 | Ga0070658_10048517 | 3300005327 | Bacteria | 3438 |
| 3 | Ga0070658_10090251 | 3300005327 | Bacteria | 2524 |
| 4 | Ga0070683_100001612 | 3300005329 | Bacteria | 17467 |
| 5 | Ga0070683_100028245 | 3300005329 | Bacteria | 5069 |
| 6 | Ga0070683_100031746 | 3300005329 | Bacteria | 4806 |
| 7 | Ga0070683_100053781 | 3300005329 | Bacteria | 3731 |
| 8 | Ga0070683_100107785 | 3300005329 | Bacteria | 2627 |
| 9 | Ga0070690_100074147 | 3300005330 | Bacteria | 2216 |
| 10 | Ga0070666_10044989 | 3300005335 | Bacteria | 2959 |
| 11 | Ga0070666_10094012 | 3300005335 | Bacteria | 2062 |
| 12 | Ga0070680_100001193 | 3300005336 | Bacteria | 18731 |
| 13 | Ga0070680_100007929 | 3300005336 | Bacteria | 8101 |
| 14 | Ga0070682_100018411 | 3300005337 | Bacteria | 4082 |
| 15 | Ga0070682_100060420 | 3300005337 | Bacteria | 2397 |
| 16 | Ga0068868_100027694 | 3300005338 | Bacteria | 4324 |
| 17 | Ga0068868_100038181 | 3300005338 | Bacteria | 3727 |
| 18 | Ga0068868_100121115 | 3300005338 | Bacteria | 2134 |
| 19 | Ga0070660_100003043 | 3300005339 | Bacteria | 11544 |
| 20 | Ga0070660_100007452 | 3300005339 | Bacteria | 7626 |
| 21 | Ga0070660_100014797 | 3300005339 | Bacteria | 5629 |
| 22 | Ga0070660_100062766 | 3300005339 | Bacteria | 2887 |
| 23 | Ga0070689_100003195 | 3300005340 | Bacteria | 10846 |
| 24 | Ga0070689_100080529 | 3300005340 | Bacteria | 2556 |
| 25 | Ga0070691_10028892 | 3300005341 | Bacteria | 2593 |
| 26 | Ga0070691_10037142 | 3300005341 | Bacteria | 2298 |
| 27 | Ga0070691_10042030 | 3300005341 | Bacteria | 2163 |
| 28 | Ga0070661_100040044 | 3300005344 | Bacteria | 3417 |
| 29 | Ga0070661_100052069 | 3300005344 | Bacteria | 2997 |
| 30 | Ga0070661_100060072 | 3300005344 | Bacteria | 2789 |
| 31 | Ga0070661_100061907 | 3300005344 | Bacteria | 2747 |
| 32 | Ga0070661_100076218 | 3300005344 | Bacteria | 2471 |
| 33 | Ga0070692_10013638 | 3300005345 | Bacteria | 3793 |
| 34 | Ga0070692_10067405 | 3300005345 | Bacteria | 1900 |
| 35 | Ga0070675_100036864 | 3300005354 | Bacteria | 3981 |
| 36 | Ga0070671_100039895 | 3300005355 | Bacteria | 3898 |
| 37 | Ga0070674_100000543 | 3300005356 | Bacteria | 18923 |
| 38 | Ga0070674_100015836 | 3300005356 | Bacteria | 4716 |
| 39 | Ga0070674_100026295 | 3300005356 | Bacteria | 3799 |
| 40 | Ga0070673_100011197 | 3300005364 | Bacteria | 6116 |
| 41 | Ga0070688_100001134 | 3300005365 | Bacteria | 13349 |
| 42 | Ga0070688_100008762 | 3300005365 | Bacteria | 5504 |
| 43 | Ga0070659_100003675 | 3300005366 | Bacteria | 10938 |
| 44 | Ga0070659_100014416 | 3300005366 | Bacteria | 5908 |
| 45 | Ga0070714_100016781 | 3300005435 | Bacteria | 5920 |
| 46 | Ga0070714_100020904 | 3300005435 | Bacteria | 5350 |
| 47 | Ga0070714_100034628 | 3300005435 | Bacteria | 4229 |
| 48 | Ga0070714_100054193 | 3300005435 | Bacteria | 3425 |
| 49 | Ga0070714_100070067 | 3300005435 | Bacteria | 3030 |
| 50 | Ga0070714_100134464 | 3300005435 | Bacteria | 2213 |
| 51 | Ga0070714_100210159 | 3300005435 | Bacteria | 1783 |
| 52 | Ga0070713_100013107 | 3300005436 | Bacteria | 6110 |
| 53 | Ga0070713_100104198 | 3300005436 | Bacteria | 2462 |
| 54 | Ga0070710_10002265 | 3300005437 | Bacteria | 9098 |
| 55 | Ga0070710_10045399 | 3300005437 | Bacteria | 2442 |
| 56 | Ga0070710_10054617 | 3300005437 | Bacteria | 2254 |
| 57 | Ga0070711_100001299 | 3300005439 | Bacteria | 13593 |
| 58 | Ga0070711_100005506 | 3300005439 | Bacteria | 7577 |
| 59 | Ga0070711_100020141 | 3300005439 | Bacteria | 4293 |
| 60 | Ga0070711_100135546 | 3300005439 | Bacteria | 1840 |
| 61 | Ga0070700_100001551 | 3300005441 | Bacteria | 11464 |
| 62 | Ga0070694_100022946 | 3300005444 | Bacteria | 4006 |
| 63 | Ga0070694_100060885 | 3300005444 | Bacteria | 2576 |
| 64 | Ga0070694_100076570 | 3300005444 | Bacteria | 2316 |
| 65 | Ga0070694_100118010 | 3300005444 | Bacteria | 1900 |
| 66 | Ga0070708_100008348 | 3300005445 | Bacteria | 8316 |
| 67 | Ga0070663_100017434 | 3300005455 | Bacteria | 4687 |
| 68 | Ga0070663_100034149 | 3300005455 | Bacteria | 3520 |
| 69 | Ga0070678_100003432 | 3300005456 | Bacteria | 8840 |
| 70 | Ga0070678_100039088 | 3300005456 | Bacteria | 3345 |
| 71 | Ga0070678_100050596 | 3300005456 | Bacteria | 3007 |
| 72 | Ga0070681_10014740 | 3300005458 | Bacteria | 7772 |
| 73 | Ga0070681_10049046 | 3300005458 | Bacteria | 4218 |
| 74 | Ga0070681_10075487 | 3300005458 | Bacteria | 3331 |
| 75 | Ga0070681_10096251 | 3300005458 | Bacteria | 2908 |
| 76 | Ga0070681_10148986 | 3300005458 | Bacteria | 2267 |
| 77 | Ga0070681_10204372 | 3300005458 | Bacteria | 1893 |
| 78 | Ga0068867_100000290 | 3300005459 | Bacteria | 32965 |
| 79 | Ga0070706_100011218 | 3300005467 | Bacteria | 8322 |
| 80 | Ga0070706_100048234 | 3300005467 | Bacteria | 3931 |
| 81 | Ga0070706_100196822 | 3300005467 | Bacteria | 1883 |
| 82 | Ga0070707_100001971 | 3300005468 | Bacteria | 19646 |
| 83 | Ga0070707_100006528 | 3300005468 | Bacteria | 10830 |
| 84 | Ga0070707_100023400 | 3300005468 | Bacteria | 5845 |
| 85 | Ga0070698_100008197 | 3300005471 | Bacteria | 11302 |
| 86 | Ga0070698_100024916 | 3300005471 | Bacteria | 6236 |
| 87 | Ga0070698_100026236 | 3300005471 | Bacteria | 6067 |
| 88 | Ga0070698_100052694 | 3300005471 | Bacteria | 4138 |
| 89 | Ga0070698_100063589 | 3300005471 | Bacteria | 3721 |
| 90 | Ga0070699_100043399 | 3300005518 | Bacteria | 3892 |
| 91 | Ga0070699_100132275 | 3300005518 | Bacteria | 2199 |
| 92 | Ga0070679_100005801 | 3300005530 | Bacteria | 11458 |
| 93 | Ga0070679_100012416 | 3300005530 | Bacteria | 8140 |
| 94 | Ga0070679_100035772 | 3300005530 | Bacteria | 4926 |
| 95 | Ga0070679_100080839 | 3300005530 | Bacteria | 3240 |
| 96 | Ga0070679_100088554 | 3300005530 | Bacteria | 3083 |
| 97 | Ga0070679_100105410 | 3300005530 | Bacteria | 2805 |
| 98 | Ga0070679_100152799 | 3300005530 | Bacteria | 2285 |
| 99 | Ga0070684_100023758 | 3300005535 | Bacteria | 5133 |
| 100 | Ga0070684_100059887 | 3300005535 | Bacteria | 3329 |
| 101 | Ga0070684_100074455 | 3300005535 | Bacteria | 2993 |
| 102 | Ga0070684_100092946 | 3300005535 | Bacteria | 2685 |
| 103 | Ga0070684_100093795 | 3300005535 | Bacteria | 2672 |
| 104 | Ga0068853_100100694 | 3300005539 | Bacteria | 2554 |
| 105 | Ga0070672_100200075 | 3300005543 | Bacteria | 1670 |
| 106 | Ga0070686_100002931 | 3300005544 | Bacteria | 9362 |
| 107 | Ga0070686_100044438 | 3300005544 | Bacteria | 2792 |
| 108 | Ga0070695_100000746 | 3300005545 | Bacteria | 17422 |
| 109 | Ga0070695_100036301 | 3300005545 | Bacteria | 3101 |
| 110 | Ga0070695_100127536 | 3300005545 | Bacteria | 1749 |
| 111 | Ga0070696_100002162 | 3300005546 | Bacteria | 12949 |
| 112 | Ga0070696_100051214 | 3300005546 | Bacteria | 2871 |
| 113 | Ga0070696_100070011 | 3300005546 | Bacteria | 2466 |
| 114 | Ga0070693_100010201 | 3300005547 | Bacteria | 4697 |
| 115 | Ga0070693_100128295 | 3300005547 | Bacteria | 1582 |
| 116 | Ga0070665_100070335 | 3300005548 | Bacteria | 3507 |
| 117 | Ga0070704_100092796 | 3300005549 | Bacteria | 2254 |
| 118 | Ga0068855_100044686 | 3300005563 | Bacteria | 5242 |
| 119 | Ga0068855_100087304 | 3300005563 | Bacteria | 3605 |
| 120 | Ga0070664_100034418 | 3300005564 | Bacteria | 4250 |
| 121 | Ga0070664_100054750 | 3300005564 | Bacteria | 3386 |
| 122 | Ga0070664_100092738 | 3300005564 | Bacteria | 2615 |
| 123 | Ga0070664_100209317 | 3300005564 | Bacteria | 1742 |
| 124 | Ga0068857_100075954 | 3300005577 | Bacteria | 2995 |
| 125 | Ga0068857_100079569 | 3300005577 | Bacteria | 2926 |
| 126 | Ga0068856_100120729 | 3300005614 | Bacteria | 2622 |
| 127 | Ga0070702_100000583 | 3300005615 | Bacteria | 13368 |
| 128 | Ga0070702_100058442 | 3300005615 | Bacteria | 2234 |
| 129 | Ga0070702_100072254 | 3300005615 | Bacteria | 2041 |
| 130 | Ga0068852_100016361 | 3300005616 | Bacteria | 5780 |
| 131 | Ga0068852_100261307 | 3300005616 | Bacteria | 1662 |
| 132 | Ga0068864_100054424 | 3300005618 | Bacteria | 3454 |
| 133 | Ga0068866_10000154 | 3300005718 | Bacteria | 31512 |
| 134 | Ga0068861_100069512 | 3300005719 | Bacteria | 2724 |
| 135 | Ga0068861_100123084 | 3300005719 | Bacteria | 2095 |
| 136 | Ga0068858_100055537 | 3300005842 | Bacteria | 3661 |
| 137 | Ga0068860_100042034 | 3300005843 | Bacteria | 4368 |
| 138 | Ga0068862_100071626 | 3300005844 | Bacteria | 2992 |
| 139 | Ga0081455_10002410 | 3300005937 | Bacteria | 22324 |
| 140 | Ga0081455_10002626 | 3300005937 | Bacteria | 21306 |
| 141 | Ga0081455_10004721 | 3300005937 | Bacteria | 15146 |
| 142 | Ga0081455_10030501 | 3300005937 | Bacteria | 4896 |
| 143 | Ga0081538_10000151 | 3300005981 | Bacteria | 72583 |
| 144 | Ga0081538_10000492 | 3300005981 | Bacteria | 44066 |
| 145 | Ga0081538_10000613 | 3300005981 | Bacteria | 39554 |
| 146 | Ga0081538_10002077 | 3300005981 | Bacteria | 19957 |
| 147 | Ga0081538_10002734 | 3300005981 | Bacteria | 16934 |
| 148 | Ga0081538_10003142 | 3300005981 | Bacteria | 15692 |
| 149 | Ga0081538_10004272 | 3300005981 | Bacteria | 13228 |
| 150 | Ga0081538_10007389 | 3300005981 | Bacteria | 9516 |
| 151 | Ga0081538_10008374 | 3300005981 | Bacteria | 8793 |
| 152 | Ga0081540_1007223 | 3300005983 | Bacteria | 7965 |
| 153 | Ga0081539_10000200 | 3300005985 | Bacteria | 139291 |
| 154 | Ga0081539_10000867 | 3300005985 | Bacteria | 57938 |
| 155 | Ga0081539_10002620 | 3300005985 | Bacteria | 24595 |
| 156 | Ga0070717_10003839 | 3300006028 | Bacteria | 10815 |
| 157 | Ga0070717_10081446 | 3300006028 | Bacteria | 2718 |
| 158 | Ga0070717_10224919 | 3300006028 | Bacteria | 1650 |
| 159 | Ga0075432_10003010 | 3300006058 | Bacteria | 5681 |
| 160 | Ga0075432_10007679 | 3300006058 | Bacteria | 3677 |
| 161 | Ga0070715_10001264 | 3300006163 | Bacteria | 7251 |
| 162 | Ga0070716_100034410 | 3300006173 | Bacteria | 2778 |
| 163 | Ga0070712_100008840 | 3300006175 | Bacteria | 6342 |
| 164 | Ga0070712_100012447 | 3300006175 | Bacteria | 5409 |
| 165 | Ga0070712_100123005 | 3300006175 | Bacteria | 1955 |
| 166 | Ga0097621_100024884 | 3300006237 | Bacteria | 4680 |
| 167 | Ga0097621_100046132 | 3300006237 | Bacteria | 3524 |
| 168 | Ga0068871_100004124 | 3300006358 | Bacteria | 10049 |
| 169 | Ga0075428_100007989 | 3300006844 | Bacteria | 11737 |
| 170 | Ga0075428_100023960 | 3300006844 | Bacteria | 6754 |
| 171 | Ga0075428_100041907 | 3300006844 | Bacteria | 5034 |
| 172 | Ga0075428_100047776 | 3300006844 | Bacteria | 4699 |
| 173 | Ga0075428_100066941 | 3300006844 | Bacteria | 3933 |
| 174 | Ga0075428_100149670 | 3300006844 | Bacteria | 2536 |
| 175 | Ga0075430_100044310 | 3300006846 | Bacteria | 3763 |
| 176 | Ga0075431_100006255 | 3300006847 | Bacteria | 11830 |
| 177 | Ga0075431_100067676 | 3300006847 | Bacteria | 3687 |
| 178 | Ga0075431_100078992 | 3300006847 | Bacteria | 3397 |
| 179 | Ga0075433_10029961 | 3300006852 | Bacteria | 4639 |
| 180 | Ga0075434_100071797 | 3300006871 | Bacteria | 3453 |
| 181 | Ga0075434_100125690 | 3300006871 | Bacteria | 2581 |
| 182 | Ga0075429_100009903 | 3300006880 | Bacteria | 8264 |
| 183 | Ga0075429_100010729 | 3300006880 | Bacteria | 7922 |
| 184 | Ga0075429_100035324 | 3300006880 | Bacteria | 4347 |
| 185 | Ga0068865_100000501 | 3300006881 | Bacteria | 21962 |
| 186 | Ga0068865_100009127 | 3300006881 | Bacteria | 6138 |
| 187 | Ga0075436_100035492 | 3300006914 | Bacteria | 3439 |
| 188 | Ga0075435_100001081 | 3300007076 | Bacteria | 17333 |
| 189 | Ga0075435_100020517 | 3300007076 | Bacteria | 5065 |
| 190 | Ga0075435_100034635 | 3300007076 | Bacteria | 4002 |
| 191 | Ga0075435_100049337 | 3300007076 | Bacteria | 3385 |
| 192 | Ga0075435_100054993 | 3300007076 | Bacteria | 3213 |
| 193 | Ga0075435_100168104 | 3300007076 | Bacteria | 1850 |
| 194 | Ga0105240_10011339 | 3300009093 | Bacteria | 12415 |
| 195 | Ga0105240_10023789 | 3300009093 | Bacteria | 8093 |
| 196 | Ga0105240_10330296 | 3300009093 | Bacteria | 1735 |
| 197 | Ga0111539_10005525 | 3300009094 | Bacteria | 16350 |
| 198 | Ga0111539_10005906 | 3300009094 | Bacteria | 15814 |
| 199 | Ga0111539_10045158 | 3300009094 | Bacteria | 5275 |
| 200 | Ga0111539_10048461 | 3300009094 | Bacteria | 5072 |
| 201 | Ga0111539_10068447 | 3300009094 | Bacteria | 4192 |
| 202 | Ga0111539_10155399 | 3300009094 | Bacteria | 2677 |
| 203 | Ga0105245_10010962 | 3300009098 | Bacteria | 7887 |
| 204 | Ga0105245_10020166 | 3300009098 | Bacteria | 5843 |
| 205 | Ga0114129_10009560 | 3300009147 | Bacteria | 13828 |
| 206 | Ga0114129_10023764 | 3300009147 | Bacteria | 8687 |
| 207 | Ga0114129_10032301 | 3300009147 | Bacteria | 7398 |
| 208 | Ga0114129_10139883 | 3300009147 | Bacteria | 3319 |
| 209 | Ga0105243_10001079 | 3300009148 | Bacteria | 24973 |
| 210 | Ga0105243_10015682 | 3300009148 | Bacteria | 5729 |
| 211 | Ga0105243_10045523 | 3300009148 | Bacteria | 3448 |
| 212 | Ga0105242_10048550 | 3300009176 | Bacteria | 3450 |
| 213 | Ga0105242_10095225 | 3300009176 | Bacteria | 2513 |
| 214 | Ga0105242_10194739 | 3300009176 | Bacteria | 1797 |
| 215 | Ga0105248_10032131 | 3300009177 | Bacteria | 5866 |
| 216 | Ga0105237_10079052 | 3300009545 | Bacteria | 3279 |
| 217 | Ga0105238_10074842 | 3300009551 | Bacteria | 3379 |
| 218 | Ga0105238_10096800 | 3300009551 | Bacteria | 2937 |
| 219 | Ga0105238_10269620 | 3300009551 | Bacteria | 1683 |
| 220 | Ga0105249_10001927 | 3300009553 | Bacteria | 18015 |
| 221 | Ga0105249_10052943 | 3300009553 | Bacteria | 3709 |
| 222 | Ga0105249_10077117 | 3300009553 | Bacteria | 3090 |
| 223 | Ga0105249_10148260 | 3300009553 | Bacteria | 2256 |
| 224 | Ga0105239_10001224 | 3300010375 | Bacteria | 34981 |
| 225 | Ga0105239_10073178 | 3300010375 | Bacteria | 3767 |
| 226 | Ga0105239_10078673 | 3300010375 | Bacteria | 3629 |
| 227 | Ga0105239_10081462 | 3300010375 | Bacteria | 3563 |
| 228 | Ga0105239_10095690 | 3300010375 | Bacteria | 3280 |
| 229 | Ga0157371_10031282 | 3300013102 | Bacteria | 3834 |
| 230 | Ga0157370_10050293 | 3300013104 | Bacteria | 3984 |
| 231 | Ga0157370_10082653 | 3300013104 | Bacteria | 3020 |
| 232 | Ga0157369_10009001 | 3300013105 | Bacteria | 11437 |
| 233 | Ga0157369_10016530 | 3300013105 | Bacteria | 8296 |
| 234 | Ga0157369_10018494 | 3300013105 | Bacteria | 7811 |
| 235 | Ga0157369_10195219 | 3300013105 | Bacteria | 2126 |
| 236 | Ga0157374_10001561 | 3300013296 | Bacteria | 19271 |
| 237 | Ga0157378_10002273 | 3300013297 | Bacteria | 17055 |
| 238 | Ga0163162_10023555 | 3300013306 | Bacteria | 6077 |
| 239 | Ga0157372_10040929 | 3300013307 | Bacteria | 5121 |
| 240 | Ga0157372_10045867 | 3300013307 | Bacteria | 4850 |
| 241 | Ga0157375_10003215 | 3300013308 | Bacteria | 14184 |
| 242 | Ga0157375_10122267 | 3300013308 | Bacteria | 2714 |
| 243 | Ga0157375_10144771 | 3300013308 | Bacteria | 2506 |
| 244 | Ga0157375_10231632 | 3300013308 | Bacteria | 2006 |
| 245 | Ga0157375_10325069 | 3300013308 | Bacteria | 1703 |
| 246 | Ga0163163_10189411 | 3300014325 | Bacteria | 2106 |
| 247 | Ga0157380_10049297 | 3300014326 | Bacteria | 3321 |
| 248 | Ga0157380_10064273 | 3300014326 | Bacteria | 2945 |
| 249 | Ga0157380_10102898 | 3300014326 | Bacteria | 2382 |
| 250 | Ga0157380_10106757 | 3300014326 | Bacteria | 2344 |
| 251 | Ga0182008_10010441 | 3300014497 | Bacteria | 4969 |
| 252 | Ga0157377_10018972 | 3300014745 | Bacteria | 3586 |
| 253 | Ga0157376_10015090 | 3300014969 | Bacteria | 5824 |
| 254 | Ga0157376_10114693 | 3300014969 | Bacteria | 2378 |
| 255 | Ga0197907_10084652 | 3300020069 | Bacteria | 2234 |
| 256 | Ga0206356_10153600 | 3300020070 | Bacteria | 2619 |
| 257 | Ga0206356_10750028 | 3300020070 | Bacteria | 1686 |
| 258 | Ga0206349_1027768 | 3300020075 | Bacteria | 1645 |
| 259 | Ga0206354_11273170 | 3300020081 | Bacteria | 3405 |
| 260 | Ga0206353_10723334 | 3300020082 | Bacteria | 1685 |
| 261 | Ga0213874_10027387 | 3300021377 | Bacteria | 1621 |
| 262 | Ga0224712_10006017 | 3300022467 | Bacteria | 3428 |
| 263 | Ga0224712_10015516 | 3300022467 | Bacteria | 2480 |
| 264 | Ga0207642_10000121 | 3300025899 | Bacteria | 21373 |
| 265 | Ga0207688_10018244 | 3300025901 | Bacteria | 3820 |
| 266 | Ga0207688_10031001 | 3300025901 | Bacteria | 2950 |
| 267 | Ga0207680_10057138 | 3300025903 | Bacteria | 2360 |
| 268 | Ga0207699_10055578 | 3300025906 | Bacteria | 2356 |
| 269 | Ga0207643_10022128 | 3300025908 | Bacteria | 3498 |
| 270 | Ga0207705_10056981 | 3300025909 | Bacteria | 2818 |
| 271 | Ga0207705_10062374 | 3300025909 | Bacteria | 2692 |
| 272 | Ga0207684_10086593 | 3300025910 | Bacteria | 2669 |
| 273 | Ga0207654_10041893 | 3300025911 | Bacteria | 2588 |
| 274 | Ga0207707_10051969 | 3300025912 | Bacteria | 3568 |
| 275 | Ga0207707_10113915 | 3300025912 | Bacteria | 2363 |
| 276 | Ga0207707_10115209 | 3300025912 | Bacteria | 2349 |
| 277 | Ga0207707_10153453 | 3300025912 | Bacteria | 2013 |
| 278 | Ga0207695_10027770 | 3300025913 | Bacteria | 6296 |
| 279 | Ga0207695_10184941 | 3300025913 | Bacteria | 2003 |
| 280 | Ga0207671_10035733 | 3300025914 | Bacteria | 3685 |
| 281 | Ga0207693_10000499 | 3300025915 | Bacteria | 35458 |
| 282 | Ga0207693_10001416 | 3300025915 | Bacteria | 21252 |
| 283 | Ga0207693_10002670 | 3300025915 | Bacteria | 15487 |
| 284 | Ga0207693_10008705 | 3300025915 | Bacteria | 8297 |
| 285 | Ga0207693_10011959 | 3300025915 | Bacteria | 7016 |
| 286 | Ga0207693_10014553 | 3300025915 | Bacteria | 6322 |
| 287 | Ga0207693_10135413 | 3300025915 | Bacteria | 1937 |
| 288 | Ga0207663_10025014 | 3300025916 | Bacteria | 3445 |
| 289 | Ga0207657_10002712 | 3300025919 | Bacteria | 19070 |
| 290 | Ga0207657_10027905 | 3300025919 | Bacteria | 5161 |
| 291 | Ga0207657_10050254 | 3300025919 | Bacteria | 3629 |
| 292 | Ga0207657_10094033 | 3300025919 | Bacteria | 2496 |
| 293 | Ga0207649_10033336 | 3300025920 | Bacteria | 3077 |
| 294 | Ga0207649_10134178 | 3300025920 | Bacteria | 1686 |
| 295 | Ga0207652_10018853 | 3300025921 | Bacteria | 5663 |
| 296 | Ga0207646_10000757 | 3300025922 | Bacteria | 41947 |
| 297 | Ga0207646_10001072 | 3300025922 | Bacteria | 34848 |
| 298 | Ga0207681_10072251 | 3300025923 | Bacteria | 2409 |
| 299 | Ga0207659_10085313 | 3300025926 | Bacteria | 2346 |
| 300 | Ga0207659_10130136 | 3300025926 | Bacteria | 1941 |
| 301 | Ga0207687_10004288 | 3300025927 | Bacteria | 9526 |
| 302 | Ga0207687_10160103 | 3300025927 | Bacteria | 1727 |
| 303 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 304 | Ga0207700_10015258 | 3300025928 | Bacteria | 5059 |
| 305 | Ga0207664_10002805 | 3300025929 | Bacteria | 11574 |
| 306 | Ga0207664_10009266 | 3300025929 | Bacteria | 6899 |
| 307 | Ga0207664_10137754 | 3300025929 | Bacteria | 2061 |
| 308 | Ga0207690_10045481 | 3300025932 | Bacteria | 2900 |
| 309 | Ga0207690_10054930 | 3300025932 | Bacteria | 2680 |
| 310 | Ga0207690_10155782 | 3300025932 | Bacteria | 1698 |
| 311 | Ga0207706_10051002 | 3300025933 | Bacteria | 3655 |
| 312 | Ga0207686_10052622 | 3300025934 | Bacteria | 2542 |
| 313 | Ga0207709_10000781 | 3300025935 | Bacteria | 24924 |
| 314 | Ga0207709_10037200 | 3300025935 | Bacteria | 2890 |
| 315 | Ga0207669_10003091 | 3300025937 | Bacteria | 7168 |
| 316 | Ga0207669_10030400 | 3300025937 | Bacteria | 3001 |
| 317 | Ga0207704_10001528 | 3300025938 | Bacteria | 10371 |
| 318 | Ga0207665_10003907 | 3300025939 | Bacteria | 9973 |
| 319 | Ga0207665_10016660 | 3300025939 | Bacteria | 4826 |
| 320 | Ga0207691_10013943 | 3300025940 | Bacteria | 7668 |
| 321 | Ga0207691_10054726 | 3300025940 | Bacteria | 3639 |
| 322 | Ga0207661_10000580 | 3300025944 | Bacteria | 23346 |
| 323 | Ga0207661_10058766 | 3300025944 | Bacteria | 3096 |
| 324 | Ga0207661_10072502 | 3300025944 | Bacteria | 2817 |
| 325 | Ga0207661_10080608 | 3300025944 | Bacteria | 2686 |
| 326 | Ga0207661_10086981 | 3300025944 | Bacteria | 2594 |
| 327 | Ga0207661_10089816 | 3300025944 | Bacteria | 2557 |
| 328 | Ga0207661_10137995 | 3300025944 | Bacteria | 2096 |
| 329 | Ga0207679_10033525 | 3300025945 | Bacteria | 3614 |
| 330 | Ga0207679_10060316 | 3300025945 | Bacteria | 2818 |
| 331 | Ga0207667_10050908 | 3300025949 | Bacteria | 4369 |
| 332 | Ga0207667_10137314 | 3300025949 | Bacteria | 2517 |
| 333 | Ga0207667_10142369 | 3300025949 | Bacteria | 2469 |
| 334 | Ga0207667_10239005 | 3300025949 | Bacteria | 1859 |
| 335 | Ga0207712_10004576 | 3300025961 | Bacteria | 8726 |
| 336 | Ga0207668_10003765 | 3300025972 | Bacteria | 8932 |
| 337 | Ga0207658_10047922 | 3300025986 | Bacteria | 3130 |
| 338 | Ga0207677_10008583 | 3300026023 | Bacteria | 5718 |
| 339 | Ga0207677_10018980 | 3300026023 | Bacteria | 4141 |
| 340 | Ga0207677_10031235 | 3300026023 | Bacteria | 3409 |
| 341 | Ga0207703_10021711 | 3300026035 | Bacteria | 5025 |
| 342 | Ga0207639_10008584 | 3300026041 | Bacteria | 7010 |
| 343 | Ga0207678_10047114 | 3300026067 | Bacteria | 3728 |
| 344 | Ga0207678_10090283 | 3300026067 | Bacteria | 2619 |
| 345 | Ga0207708_10001823 | 3300026075 | Bacteria | 15722 |
| 346 | Ga0207702_10004445 | 3300026078 | Bacteria | 12451 |
| 347 | Ga0207702_10017385 | 3300026078 | Bacteria | 5950 |
| 348 | Ga0207641_10070569 | 3300026088 | Bacteria | 3002 |
| 349 | Ga0207648_10002767 | 3300026089 | Bacteria | 18606 |
| 350 | Ga0207648_10012419 | 3300026089 | Bacteria | 7974 |
| 351 | Ga0207674_10037873 | 3300026116 | Bacteria | 5011 |
| 352 | Ga0207675_100001891 | 3300026118 | Bacteria | 20924 |
| 353 | Ga0207675_100017381 | 3300026118 | Bacteria | 6714 |
| 354 | Ga0207675_100020606 | 3300026118 | Bacteria | 6145 |
| 355 | Ga0207683_10001565 | 3300026121 | Bacteria | 20601 |
| 356 | Ga0207428_10000244 | 3300027907 | Bacteria | 74209 |
| 357 | Ga0207428_10057044 | 3300027907 | Bacteria | 3101 |
| 358 | Ga0268266_10130681 | 3300028379 | Bacteria | 2246 |
| 359 | Ga0268265_10144192 | 3300028380 | Bacteria | 1998 |
| 360 | Ga0268264_10027757 | 3300028381 | Bacteria | 4627 |
| 361 | Ga0265319_1009630 | 3300028563 | Bacteria | 4095 |
| 362 | Ga0265319_1018835 | 3300028563 | Bacteria | 2591 |
| 363 | Ga0265319_1019652 | 3300028563 | Bacteria | 2517 |
| 364 | Ga0265334_10042546 | 3300028573 | Bacteria | 1770 |
| 365 | Ga0265322_10007725 | 3300028654 | Bacteria | 3134 |
| 366 | Ga0265336_10008333 | 3300028666 | Bacteria | 3640 |
| 367 | Ga0265338_10006251 | 3300028800 | Bacteria | 15241 |
| 368 | Ga0265338_10008857 | 3300028800 | Bacteria | 12133 |
| 369 | Ga0265338_10077537 | 3300028800 | Bacteria | 2808 |
| 370 | Ga0265338_10147231 | 3300028800 | Bacteria | 1835 |
| 371 | Ga0265330_10031876 | 3300031235 | Bacteria | 2362 |
| 372 | Ga0265330_10035924 | 3300031235 | Bacteria | 2210 |
| 373 | Ga0265320_10031846 | 3300031240 | Bacteria | 2705 |
| 374 | Ga0265329_10010080 | 3300031242 | Bacteria | 3489 |
| 375 | Ga0265340_10019740 | 3300031247 | Bacteria | 3468 |
| 376 | Ga0265340_10022673 | 3300031247 | Bacteria | 3209 |
| 377 | Ga0265339_10002054 | 3300031249 | Bacteria | 14790 |
| 378 | Ga0265316_10019125 | 3300031344 | Bacteria | 5865 |
| 379 | Ga0265316_10020308 | 3300031344 | Bacteria | 5659 |
| 380 | Ga0265316_10087603 | 3300031344 | Bacteria | 2378 |
| 381 | Ga0265316_10143485 | 3300031344 | Bacteria | 1792 |
| 382 | Ga0307408_100006069 | 3300031548 | Bacteria | 8037 |
| 383 | Ga0265313_10005116 | 3300031595 | Bacteria | 9768 |
| 384 | Ga0265313_10027386 | 3300031595 | Bacteria | 2984 |
| 385 | Ga0265314_10005028 | 3300031711 | Bacteria | 12047 |
| 386 | Ga0265314_10007429 | 3300031711 | Bacteria | 9505 |
| 387 | Ga0265342_10010488 | 3300031712 | Bacteria | 6422 |
| 388 | Ga0307405_10004696 | 3300031731 | Bacteria | 6498 |
| 389 | Ga0307406_10006630 | 3300031901 | Bacteria | 6401 |
| 390 | Ga0307409_100085809 | 3300031995 | Bacteria | 2560 |
| 391 | Ga0307416_100022597 | 3300032002 | Bacteria | 4543 |
| 392 | Ga0307416_100056338 | 3300032002 | Bacteria | 3172 |
| 393 | Ga0307416_100070320 | 3300032002 | Bacteria | 2901 |
| 394 | Ga0307411_10016379 | 3300032005 | Bacteria | 4194 |
| 395 | Ga0307415_100000242 | 3300032126 | Bacteria | 23821 |
| 396 | Ga0307415_100000296 | 3300032126 | Bacteria | 21625 |
| 397 | Ga0307415_100078049 | 3300032126 | Bacteria | 2354 |
| 398 | Ga0373958_0003559 | 3300034819 | Bacteria | 2255 |
| 399 | Ga0373959_0007324 | 3300034820 | Bacteria | 1853 |
| 400 | Ga0373938_0001594 | 3300034957 | Bacteria | 3646 |
| 401 | Ga0373932_0004267 | 3300035112 | Bacteria | 3392 |
| 402 | Ga0373941_0001838 | 3300035115 | Bacteria | 4575 |
| 403 | Ga0373945_0003703 | 3300035116 | Bacteria | 4820 |
| 404 | Ga0373960_0000512 | 3300035121 | Bacteria | 7752 |
| 405 | Ga0373943_0000299 | 3300035170 | Bacteria | 20623 |
| 406 | Ga0373943_0026853 | 3300035170 | Bacteria | 2701 |
| 407 | Ga0373946_0055940 | 3300035171 | Bacteria | 1665 |
| 408 | Ga0373955_0072045 | 3300035172 | Bacteria | 1934 |
| 409 | Ga0373942_0003061 | 3300035207 | Bacteria | 3961 |
| 410 | Ga0373961_0005198 | 3300035241 | Bacteria | 3131 |
| 411 | Ga0373962_0004247 | 3300035242 | Bacteria | 3456 |
| 412 | Ga0373962_0005842 | 3300035242 | Bacteria | 2970 |
| 413 | Ga0373931_0040054 | 3300035691 | Bacteria | 2456 |
| 414 | Ga0373935_0012275 | 3300035692 | Bacteria | 5153 |
| 415 | Ga0373927_0020520 | 3300035695 | Bacteria | 4333 |
| 416 | Ga0373947_0003334 | 3300035725 | Bacteria | 9514 |
| 417 | Ga0373947_0003997 | 3300035725 | Bacteria | 8660 |
| 418 | Ga0373947_0014253 | 3300035725 | Bacteria | 4559 |
| 419 | Ga0373925_0014062 | 3300037068 | Bacteria | 5792 |
| 420 | Ga0395899_0001169 | 3300037312 | Bacteria | 23172 |
| 421 | Ga0395899_0002224 | 3300037312 | Bacteria | 15901 |
| 422 | Ga0395899_0004452 | 3300037312 | Bacteria | 10926 |
| 423 | Ga0395899_0008461 | 3300037312 | Bacteria | 7927 |
| 424 | Ga0395899_0009648 | 3300037312 | Bacteria | 7409 |
| 425 | Ga0395899_0016439 | 3300037312 | Bacteria | 5640 |
| 426 | Ga0395899_0028251 | 3300037312 | Bacteria | 4224 |
| 427 | Ga0395899_0040607 | 3300037312 | Bacteria | 3480 |
| 428 | Ga0395899_0047137 | 3300037312 | Bacteria | 3209 |
| 429 | Ga0395899_0076678 | 3300037312 | Bacteria | 2440 |
| 430 | Ga0395899_0153004 | 3300037312 | Bacteria | 1634 |
| 431 | Ga0395900_0005122 | 3300037418 | Bacteria | 13764 |
| 432 | Ga0395900_0005149 | 3300037418 | Bacteria | 13734 |
| 433 | Ga0395900_0005255 | 3300037418 | Bacteria | 13580 |
| 434 | Ga0395900_0006094 | 3300037418 | Bacteria | 12574 |
| 435 | Ga0395900_0006594 | 3300037418 | Bacteria | 12075 |
| 436 | Ga0395900_0009359 | 3300037418 | Bacteria | 10045 |
| 437 | Ga0395900_0016810 | 3300037418 | Bacteria | 7462 |
| 438 | Ga0395900_0036606 | 3300037418 | Bacteria | 5059 |
| 439 | Ga0395900_0063720 | 3300037418 | Bacteria | 3789 |
| 440 | Ga0395900_0064020 | 3300037418 | Bacteria | 3780 |
| 441 | Ga0395900_0081145 | 3300037418 | Bacteria | 3332 |
| 442 | Ga0395900_0088565 | 3300037418 | Bacteria | 3182 |
| 443 | Ga0395900_0128124 | 3300037418 | Bacteria | 2602 |
| 444 | Ga0395900_0158173 | 3300037418 | Bacteria | 2313 |
| 445 | Ga0395900_0161847 | 3300037418 | Bacteria | 2282 |
| 446 | Ga0395900_0238681 | 3300037418 | Bacteria | 1824 |
| 447 | Ga0395900_0261847 | 3300037418 | Bacteria | 1727 |
| 448 | Ga0395900_0278413 | 3300037418 | Bacteria | 1666 |
| 449 | Ga0395898_0003908 | 3300037466 | Bacteria | 16453 |
| 450 | Ga0395898_0005694 | 3300037466 | Bacteria | 13425 |
| 451 | Ga0395898_0006540 | 3300037466 | Bacteria | 12438 |
| 452 | Ga0395898_0007369 | 3300037466 | Bacteria | 11674 |
| 453 | Ga0395898_0008036 | 3300037466 | Bacteria | 11183 |
| 454 | Ga0395898_0010359 | 3300037466 | Bacteria | 9750 |
| 455 | Ga0395898_0011736 | 3300037466 | Bacteria | 9083 |
| 456 | Ga0395898_0012306 | 3300037466 | Bacteria | 8847 |
| 457 | Ga0395898_0014022 | 3300037466 | Bacteria | 8236 |
| 458 | Ga0395898_0014716 | 3300037466 | Bacteria | 8031 |
| 459 | Ga0395898_0020301 | 3300037466 | Bacteria | 6748 |
| 460 | Ga0395898_0020346 | 3300037466 | Bacteria | 6739 |
| 461 | Ga0395898_0032145 | 3300037466 | Bacteria | 5237 |
| 462 | Ga0395898_0058395 | 3300037466 | Bacteria | 3755 |
| 463 | Ga0395898_0072492 | 3300037466 | Bacteria | 3327 |
| 464 | Ga0395898_0090227 | 3300037466 | Bacteria | 2949 |
| 465 | Ga0395898_0136526 | 3300037466 | Bacteria | 2348 |
| 466 | Ga0395905_0005427 | 3300037471 | Bacteria | 13026 |
| 467 | Ga0395905_0007309 | 3300037471 | Bacteria | 11005 |
| 468 | Ga0395905_0007430 | 3300037471 | Bacteria | 10893 |
| 469 | Ga0395905_0009544 | 3300037471 | Bacteria | 9479 |
| 470 | Ga0395905_0018418 | 3300037471 | Bacteria | 6627 |
| 471 | Ga0395905_0028812 | 3300037471 | Bacteria | 5233 |
| 472 | Ga0395905_0033659 | 3300037471 | Bacteria | 4812 |
| 473 | Ga0395905_0035066 | 3300037471 | Bacteria | 4710 |
| 474 | Ga0395905_0038856 | 3300037471 | Bacteria | 4464 |
| 475 | Ga0395905_0039367 | 3300037471 | Bacteria | 4435 |
| 476 | Ga0395905_0053183 | 3300037471 | Bacteria | 3790 |
| 477 | Ga0395905_0058225 | 3300037471 | Bacteria | 3614 |
| 478 | Ga0395905_0062670 | 3300037471 | Bacteria | 3478 |
| 479 | Ga0395905_0100291 | 3300037471 | Bacteria | 2719 |
| 480 | Ga0395905_0103368 | 3300037471 | Bacteria | 2674 |
| 481 | Ga0395905_0133502 | 3300037471 | Bacteria | 2335 |
| 482 | Ga0395905_0154951 | 3300037471 | Bacteria | 2155 |
| 483 | Ga0395905_0179054 | 3300037471 | Bacteria | 1990 |
| 484 | Ga0395905_0231827 | 3300037471 | Bacteria | 1726 |
| 485 | Ga0395901_0001057 | 3300038443 | Bacteria | 29607 |
| 486 | Ga0395901_0001077 | 3300038443 | Bacteria | 29182 |
| 487 | Ga0395901_0002248 | 3300038443 | Bacteria | 19701 |
| 488 | Ga0395901_0003646 | 3300038443 | Bacteria | 15530 |
| 489 | Ga0395901_0004617 | 3300038443 | Bacteria | 13903 |
| 490 | Ga0395901_0005172 | 3300038443 | Bacteria | 13163 |
| 491 | Ga0395901_0007398 | 3300038443 | Bacteria | 11079 |
| 492 | Ga0395901_0012458 | 3300038443 | Bacteria | 8630 |
| 493 | Ga0395901_0018337 | 3300038443 | Bacteria | 7145 |
| 494 | Ga0395901_0019264 | 3300038443 | Bacteria | 6976 |
| 495 | Ga0395901_0021879 | 3300038443 | Bacteria | 6553 |
| 496 | Ga0395901_0028507 | 3300038443 | Bacteria | 5741 |
| 497 | Ga0395901_0035315 | 3300038443 | Bacteria | 5163 |
| 498 | Ga0395901_0036915 | 3300038443 | Bacteria | 5052 |
| 499 | Ga0395901_0044519 | 3300038443 | Bacteria | 4603 |
| 500 | Ga0395901_0143511 | 3300038443 | Bacteria | 2509 |
| 501 | Ga0436360_0487569 | 3300039438 | Bacteria | 13324 |
| 502 | Ga0436363_0891141 | 3300039450 | Bacteria | 2699 |
| 503 | Ga0439438_012206 | 3300041405 | Bacteria | 2641 |
| 504 | Ga0439439_0000991 | 3300041406 | Bacteria | 5326 |
| 505 | Ga0439433_0000482 | 3300041999 | Bacteria | 7385 |
| 506 | Ga0439446_0002523 | 3300042156 | Bacteria | 4405 |
| 507 | Ga0439446_0006535 | 3300042156 | Bacteria | 3044 |
| 508 | Ga0439458_0011982 | 3300042157 | Bacteria | 1942 |
| 509 | Ga0439434_0022679 | 3300042435 | Bacteria | 1887 |
| 510 | Ga0466969_0001126 | 3300044656 | Bacteria | 14386 |
| 511 | Ga0466965_0046829 | 3300044683 | Bacteria | 2141 |
| 512 | Ga0466966_0007848 | 3300044684 | Bacteria | 7063 |
| 513 | Ga0466966_0015704 | 3300044684 | Bacteria | 5006 |
| 514 | Ga0466966_0077835 | 3300044684 | Bacteria | 2069 |
| 515 | Ga0466966_0113135 | 3300044684 | Bacteria | 1672 |
| 516 | Ga0466961_0013305 | 3300044693 | Bacteria | 5266 |
| 517 | Ga0466963_0000481 | 3300044694 | Bacteria | 18603 |
| 518 | Ga0466963_0001325 | 3300044694 | Bacteria | 13185 |
| 519 | Ga0466963_0001333 | 3300044694 | Bacteria | 13149 |
| 520 | Ga0466963_0003978 | 3300044694 | Bacteria | 8546 |
| 521 | Ga0466963_0026825 | 3300044694 | Bacteria | 3686 |
| 522 | Ga0466963_0028114 | 3300044694 | Bacteria | 3607 |
| 523 | Ga0466963_0029723 | 3300044694 | Bacteria | 3520 |
| 524 | Ga0466963_0053674 | 3300044694 | Bacteria | 2676 |
| 525 | Ga0466963_0071803 | 3300044694 | Bacteria | 2330 |
| 526 | Ga0466964_0003730 | 3300044706 | Bacteria | 5581 |
| 527 | Ga0466964_0010882 | 3300044706 | Bacteria | 3436 |
| 528 | Ga0466964_0027735 | 3300044706 | Bacteria | 2225 |
| 529 | Ga0466964_0048637 | 3300044706 | Bacteria | 1734 |
| 530 | Ga0466971_0005631 | 3300044719 | Bacteria | 5447 |
| 531 | Ga0466970_0002928 | 3300044765 | Bacteria | 8270 |
| 532 | Ga0466970_0053697 | 3300044765 | Bacteria | 2152 |
| 533 | Ga0466957_0000932 | 3300044842 | Bacteria | 14961 |
| 534 | Ga0466957_0003321 | 3300044842 | Bacteria | 8817 |
| 535 | Ga0466957_0004549 | 3300044842 | Bacteria | 7744 |
| 536 | Ga0466957_0029409 | 3300044842 | Bacteria | 3277 |
| 537 | Ga0466957_0029425 | 3300044842 | Bacteria | 3275 |
| 538 | Ga0466960_0009316 | 3300044901 | Bacteria | 4043 |
| 539 | Ga0466960_0015644 | 3300044901 | Bacteria | 3275 |
| 540 | Ga0466960_0026689 | 3300044901 | Bacteria | 2626 |
| 541 | Ga0466959_0003610 | 3300045049 | Bacteria | 10199 |
| 542 | Ga0466959_0010632 | 3300045049 | Bacteria | 6590 |
| 543 | Ga0466959_0045996 | 3300045049 | Bacteria | 3213 |
| 544 | Ga0466958_0000447 | 3300045836 | Bacteria | 17123 |
| 545 | Ga0466958_0002557 | 3300045836 | Bacteria | 9180 |
| 546 | Ga0466958_0006920 | 3300045836 | Bacteria | 6204 |
| 547 | Ga0466958_0009219 | 3300045836 | Bacteria | 5491 |
| 548 | Ga0466967_0000291 | 3300045976 | Bacteria | 22401 |
| 549 | Ga0466967_0002093 | 3300045976 | Bacteria | 12229 |
| 550 | Ga0466967_0003596 | 3300045976 | Bacteria | 10174 |
| 551 | Ga0466967_0003679 | 3300045976 | Bacteria | 10093 |
| 552 | Ga0466967_0005179 | 3300045976 | Bacteria | 8976 |
| 553 | Ga0466967_0006520 | 3300045976 | Bacteria | 8273 |
| 554 | Ga0466967_0010493 | 3300045976 | Bacteria | 6954 |
| 555 | Ga0466967_0012008 | 3300045976 | Bacteria | 6600 |
| 556 | Ga0466967_0018485 | 3300045976 | Bacteria | 5572 |
| 557 | Ga0466967_0048711 | 3300045976 | Bacteria | 3702 |
| 558 | Ga0466967_0049464 | 3300045976 | Bacteria | 3676 |
| 559 | Ga0466967_0064511 | 3300045976 | Bacteria | 3257 |
| 560 | Ga0466967_0068375 | 3300045976 | Bacteria | 3171 |
| 561 | Ga0466967_0070681 | 3300045976 | Bacteria | 3123 |
| 562 | Ga0466967_0072929 | 3300045976 | Bacteria | 3079 |
| 563 | Ga0466967_0100924 | 3300045976 | Bacteria | 2637 |
| 564 | Ga0466967_0122896 | 3300045976 | Bacteria | 2401 |
| 565 | Ga0466967_0133349 | 3300045976 | Bacteria | 2308 |
| 566 | Ga0466967_0138592 | 3300045976 | Bacteria | 2264 |
| 567 | Ga0466967_0191375 | 3300045976 | Bacteria | 1933 |
| 568 | Ga0495592_0000989 | 3300046454 | Bacteria | 19699 |
| 569 | Ga0495592_0027546 | 3300046454 | Bacteria | 4308 |
| 570 | Ga0495592_0036920 | 3300046454 | Bacteria | 3678 |
| 571 | Ga0495603_0011232 | 3300046455 | Bacteria | 5424 |
| 572 | Ga0495629_0000403 | 3300046459 | Bacteria | 36268 |
| 573 | Ga0495629_0008955 | 3300046459 | Bacteria | 7351 |
| 574 | Ga0495629_0081982 | 3300046459 | Bacteria | 2251 |
| 575 | Ga0495641_0000331 | 3300046461 | Bacteria | 38511 |
| 576 | Ga0495641_0051979 | 3300046461 | Bacteria | 1869 |
| 577 | Ga0495651_0000064 | 3300046462 | Bacteria | 78474 |
| 578 | Ga0495651_0008032 | 3300046462 | Bacteria | 8091 |
| 579 | Ga0495651_0069600 | 3300046462 | Bacteria | 2679 |
| 580 | Ga0495651_0121885 | 3300046462 | Bacteria | 1914 |
| 581 | Ga0495653_0000351 | 3300046463 | Bacteria | 37392 |
| 582 | Ga0495653_0014756 | 3300046463 | Bacteria | 6371 |
| 583 | Ga0495653_0040238 | 3300046463 | Bacteria | 3655 |
| 584 | Ga0495653_0093272 | 3300046463 | Bacteria | 2196 |
| 585 | Ga0495582_0000426 | 3300046473 | Bacteria | 23059 |
| 586 | Ga0495582_0010215 | 3300046473 | Bacteria | 5170 |
| 587 | Ga0495582_0035117 | 3300046473 | Bacteria | 2757 |
| 588 | Ga0495582_0064436 | 3300046473 | Bacteria | 2023 |
| 589 | Ga0495639_0000619 | 3300046475 | Bacteria | 16494 |
| 590 | Ga0495662_0004650 | 3300046476 | Bacteria | 6889 |
| 591 | Ga0495664_0040502 | 3300046477 | Bacteria | 2755 |
| 592 | Ga0495664_0052194 | 3300046477 | Bacteria | 2429 |
| 593 | Ga0495585_0029861 | 3300046492 | Bacteria | 3102 |
| 594 | Ga0495608_0004037 | 3300046511 | Bacteria | 10535 |
| 595 | Ga0495608_0006061 | 3300046511 | Bacteria | 8585 |
| 596 | Ga0495608_0006677 | 3300046511 | Bacteria | 8183 |
| 597 | Ga0495618_0000613 | 3300046514 | Bacteria | 25324 |
| 598 | Ga0495618_0021181 | 3300046514 | Bacteria | 4007 |
| 599 | Ga0495628_0000069 | 3300046516 | Bacteria | 82366 |
| 600 | Ga0495628_0025798 | 3300046516 | Bacteria | 4799 |
| 601 | Ga0495628_0055727 | 3300046516 | Bacteria | 3113 |
| 602 | Ga0495630_0006653 | 3300046517 | Bacteria | 8237 |
| 603 | Ga0495652_0011521 | 3300046529 | Bacteria | 7995 |
| 604 | Ga0495652_0059185 | 3300046529 | Bacteria | 3242 |
| 605 | Ga0495665_0007390 | 3300046531 | Bacteria | 5940 |
| 606 | Ga0495665_0042941 | 3300046531 | Bacteria | 2405 |
| 607 | Ga0495640_0024614 | 3300046533 | Bacteria | 4378 |
| 608 | Ga0495640_0034641 | 3300046533 | Bacteria | 3577 |
| 609 | Ga0495587_0004197 | 3300046536 | Bacteria | 9540 |
| 610 | Ga0495645_0000085 | 3300046543 | Bacteria | 64444 |
| 611 | Ga0495645_0033047 | 3300046543 | Bacteria | 3773 |
| 612 | Ga0495667_0011723 | 3300046559 | Bacteria | 5935 |
| 613 | Ga0495667_0032603 | 3300046559 | Bacteria | 3490 |
| 614 | Ga0495667_0103416 | 3300046559 | Bacteria | 1842 |
| 615 | Ga0495634_0021939 | 3300046642 | Bacteria | 4505 |
| 616 | Ga0495634_0053894 | 3300046642 | Bacteria | 2692 |
| 617 | Ga0495634_0073673 | 3300046642 | Bacteria | 2245 |
| 618 | Ga0495635_0030960 | 3300046663 | Bacteria | 3716 |
| 619 | Ga0495635_0040315 | 3300046663 | Bacteria | 3227 |
| 620 | Ga0495635_0106595 | 3300046663 | Bacteria | 1914 |
| 621 | Ga0495657_0003621 | 3300046675 | Bacteria | 12553 |
| 622 | Ga0495657_0064673 | 3300046675 | Bacteria | 2408 |
| 623 | Ga0495599_0000146 | 3300046678 | Bacteria | 45799 |
| 624 | Ga0495599_0095665 | 3300046678 | Bacteria | 1852 |
| 625 | Ga0495623_0000030 | 3300046679 | Bacteria | 85003 |
| 626 | Ga0495623_0006977 | 3300046679 | Bacteria | 7341 |
| 627 | Ga0495646_0001436 | 3300046680 | Bacteria | 14159 |
| 628 | Ga0495658_0000302 | 3300046683 | Bacteria | 27945 |
| 629 | Ga0495658_0004983 | 3300046683 | Bacteria | 6519 |
| 630 | Ga0495669_0046726 | 3300046684 | Bacteria | 1933 |
| 631 | Ga0495613_0005126 | 3300046689 | Bacteria | 9831 |
| 632 | Ga0495613_0044632 | 3300046689 | Bacteria | 3278 |
| 633 | Ga0495624_0001304 | 3300046690 | Bacteria | 19574 |
| 634 | Ga0495624_0059108 | 3300046690 | Bacteria | 2406 |
| 635 | Ga0495600_0089147 | 3300046809 | Bacteria | 2012 |
| 636 | Ga0495581_0000117 | 3300047315 | Bacteria | 33592 |
| 637 | Ga0495581_0000815 | 3300047315 | Bacteria | 16569 |
| 638 | Ga0495581_0006138 | 3300047315 | Bacteria | 6966 |
| 639 | Ga0495604_0000103 | 3300047317 | Bacteria | 71556 |
| 640 | Ga0495604_0007052 | 3300047317 | Bacteria | 8913 |
| 641 | Ga0495674_0041491 | 3300047319 | Bacteria | 4110 |
| 642 | Ga0495674_0059974 | 3300047319 | Bacteria | 3321 |
| 643 | Ga0495674_0078384 | 3300047319 | Bacteria | 2838 |
| 644 | Ga0495674_0192630 | 3300047319 | Bacteria | 1694 |
| 645 | Ga0495676_0000268 | 3300047321 | Bacteria | 42236 |
| 646 | Ga0495676_0027491 | 3300047321 | Bacteria | 4875 |
| 647 | Ga0495676_0037003 | 3300047321 | Bacteria | 4068 |
| 648 | Ga0495676_0041028 | 3300047321 | Bacteria | 3814 |
| 649 | Ga0495680_0006548 | 3300047322 | Bacteria | 10809 |
| 650 | Ga0495680_0009114 | 3300047322 | Bacteria | 8956 |
| 651 | Ga0495680_0021704 | 3300047322 | Bacteria | 5370 |
| 652 | Ga0495680_0023092 | 3300047322 | Bacteria | 5175 |
| 653 | Ga0495675_0000509 | 3300047444 | Bacteria | 25202 |
| 654 | Ga0495677_0015913 | 3300047445 | Bacteria | 2731 |
| 655 | Ga0495684_0029398 | 3300047471 | Bacteria | 4217 |
| 656 | Ga0495684_0037130 | 3300047471 | Bacteria | 3736 |
| 657 | Ga0495684_0042600 | 3300047471 | Bacteria | 3476 |
| 658 | Ga0495684_0046375 | 3300047471 | Bacteria | 3324 |
| 659 | Ga0495593_0024595 | 3300047673 | Bacteria | 3337 |
| 660 | Ga0495602_0000080 | 3300048088 | Bacteria | 94171 |
| 661 | Ga0495602_0067752 | 3300048088 | Bacteria | 3068 |
| 662 | Ga0496100_0056841 | 3300048903 | Bacteria | 2561 |
| 663 | Ga0496100_0066431 | 3300048903 | Bacteria | 2392 |
| 664 | Ga0496101_0001887 | 3300048904 | Bacteria | 12659 |
| 665 | Ga0496101_0002078 | 3300048904 | Bacteria | 12198 |
| 666 | Ga0496101_0017603 | 3300048904 | Bacteria | 4848 |
| 667 | Ga0496101_0037828 | 3300048904 | Bacteria | 3425 |
| 668 | Ga0496101_0066151 | 3300048904 | Bacteria | 2636 |
| 669 | Ga0496101_0084755 | 3300048904 | Bacteria | 2347 |
| 670 | Ga0496101_0093921 | 3300048904 | Bacteria | 2235 |
| 671 | Ga0496102_0000944 | 3300048905 | Bacteria | 27441 |
| 672 | Ga0496102_0001216 | 3300048905 | Bacteria | 23348 |
| 673 | Ga0496102_0004404 | 3300048905 | Bacteria | 11901 |
| 674 | Ga0496102_0026332 | 3300048905 | Bacteria | 5186 |
| 675 | Ga0496102_0177981 | 3300048905 | Bacteria | 2003 |
| 676 | Ga0496102_0255133 | 3300048905 | Bacteria | 1653 |
| 677 | Ga0496103_0000709 | 3300048906 | Bacteria | 24669 |
| 678 | Ga0496103_0002863 | 3300048906 | Bacteria | 10729 |
| 679 | Ga0496103_0009008 | 3300048906 | Bacteria | 5912 |
| 680 | Ga0496103_0026438 | 3300048906 | Bacteria | 3513 |
| 681 | Ga0496103_0044774 | 3300048906 | Bacteria | 2728 |
| 682 | Ga0496103_0050733 | 3300048906 | Bacteria | 2567 |
| 683 | Ga0496103_0079495 | 3300048906 | Bacteria | 2060 |
| 684 | Ga0496104_0000557 | 3300048907 | Bacteria | 31776 |
| 685 | Ga0496104_0000803 | 3300048907 | Bacteria | 27008 |
| 686 | Ga0496104_0015511 | 3300048907 | Bacteria | 6900 |
| 687 | Ga0496104_0048420 | 3300048907 | Bacteria | 4007 |
| 688 | Ga0496104_0050879 | 3300048907 | Bacteria | 3909 |
| 689 | Ga0496104_0054188 | 3300048907 | Bacteria | 3791 |
| 690 | Ga0496104_0073981 | 3300048907 | Bacteria | 3242 |
| 691 | Ga0496104_0077240 | 3300048907 | Bacteria | 3173 |
| 692 | Ga0496104_0078219 | 3300048907 | Bacteria | 3152 |
| 693 | Ga0496104_0122633 | 3300048907 | Bacteria | 2495 |
| 694 | Ga0496104_0170603 | 3300048907 | Bacteria | 2086 |
| 695 | Ga0496105_0000609 | 3300048908 | Bacteria | 23924 |
| 696 | Ga0496105_0001118 | 3300048908 | Bacteria | 18689 |
| 697 | Ga0496105_0001193 | 3300048908 | Bacteria | 18081 |
| 698 | Ga0496105_0015049 | 3300048908 | Bacteria | 6156 |
| 699 | Ga0496105_0112543 | 3300048908 | Bacteria | 2246 |
| 700 | Ga0496105_0139676 | 3300048908 | Bacteria | 1994 |
| 701 | Ga0496106_0002624 | 3300048909 | Bacteria | 13370 |
| 702 | Ga0496106_0003561 | 3300048909 | Bacteria | 11599 |
| 703 | Ga0496106_0005352 | 3300048909 | Bacteria | 9498 |
| 704 | Ga0496106_0005639 | 3300048909 | Bacteria | 9264 |
| 705 | Ga0496106_0008920 | 3300048909 | Bacteria | 7414 |
| 706 | Ga0496106_0032617 | 3300048909 | Bacteria | 3884 |
| 707 | Ga0496106_0039546 | 3300048909 | Bacteria | 3533 |
| 708 | Ga0496106_0089814 | 3300048909 | Bacteria | 2370 |
| 709 | Ga0496106_0091210 | 3300048909 | Bacteria | 2352 |
| 710 | Ga0496107_0000316 | 3300048910 | Bacteria | 26097 |
| 711 | Ga0496107_0003225 | 3300048910 | Bacteria | 10858 |
| 712 | Ga0496107_0009186 | 3300048910 | Bacteria | 6852 |
| 713 | Ga0496107_0009483 | 3300048910 | Bacteria | 6750 |
| 714 | Ga0496107_0012003 | 3300048910 | Bacteria | 6044 |
| 715 | Ga0496107_0069792 | 3300048910 | Bacteria | 2551 |
| 716 | Ga0496108_0002980 | 3300048911 | Bacteria | 13606 |
| 717 | Ga0496108_0004461 | 3300048911 | Bacteria | 11265 |
| 718 | Ga0496108_0005258 | 3300048911 | Bacteria | 10455 |
| 719 | Ga0496108_0009378 | 3300048911 | Bacteria | 7924 |
| 720 | Ga0496108_0014225 | 3300048911 | Bacteria | 6493 |
| 721 | Ga0496108_0015755 | 3300048911 | Bacteria | 6162 |
| 722 | Ga0496108_0041165 | 3300048911 | Bacteria | 3855 |
| 723 | Ga0496108_0084990 | 3300048911 | Bacteria | 2686 |
| 724 | Ga0496109_0000533 | 3300048912 | Bacteria | 32234 |
| 725 | Ga0496109_0005342 | 3300048912 | Bacteria | 10741 |
| 726 | Ga0496109_0013614 | 3300048912 | Bacteria | 7064 |
| 727 | Ga0496109_0018687 | 3300048912 | Bacteria | 6093 |
| 728 | Ga0496109_0020769 | 3300048912 | Bacteria | 5800 |
| 729 | Ga0496109_0027342 | 3300048912 | Bacteria | 5092 |
| 730 | Ga0496109_0070927 | 3300048912 | Bacteria | 3198 |
| 731 | Ga0496109_0075342 | 3300048912 | Bacteria | 3102 |
| 732 | Ga0496109_0077438 | 3300048912 | Bacteria | 3060 |
| 733 | Ga0496109_0126829 | 3300048912 | Bacteria | 2380 |
| 734 | Ga0496110_0000411 | 3300048913 | Bacteria | 29120 |
| 735 | Ga0496110_0000564 | 3300048913 | Bacteria | 25354 |
| 736 | Ga0496110_0002200 | 3300048913 | Bacteria | 14568 |
| 737 | Ga0496110_0006619 | 3300048913 | Bacteria | 9206 |
| 738 | Ga0496110_0010041 | 3300048913 | Bacteria | 7684 |
| 739 | Ga0496110_0010182 | 3300048913 | Bacteria | 7639 |
| 740 | Ga0496110_0018708 | 3300048913 | Bacteria | 5811 |
| 741 | Ga0496110_0035022 | 3300048913 | Bacteria | 4353 |
| 742 | Ga0496110_0053588 | 3300048913 | Bacteria | 3547 |
| 743 | Ga0496110_0055947 | 3300048913 | Bacteria | 3471 |
| 744 | Ga0496110_0206876 | 3300048913 | Bacteria | 1784 |
| 745 | Ga0496111_0000084 | 3300048914 | Bacteria | 39267 |
| 746 | Ga0496111_0002152 | 3300048914 | Bacteria | 11790 |
| 747 | Ga0496111_0002910 | 3300048914 | Bacteria | 10462 |
| 748 | Ga0496111_0005171 | 3300048914 | Bacteria | 8319 |
| 749 | Ga0496111_0011785 | 3300048914 | Bacteria | 5903 |
| 750 | Ga0496111_0017815 | 3300048914 | Bacteria | 4912 |
| 751 | Ga0496111_0049655 | 3300048914 | Bacteria | 3025 |
| 752 | Ga0496112_0005317 | 3300048915 | Bacteria | 11111 |
| 753 | Ga0496112_0010136 | 3300048915 | Bacteria | 8536 |
| 754 | Ga0496112_0042540 | 3300048915 | Bacteria | 4444 |
| 755 | Ga0496112_0058123 | 3300048915 | Bacteria | 3808 |
| 756 | Ga0496112_0094135 | 3300048915 | Bacteria | 2966 |
| 757 | Ga0496112_0112007 | 3300048915 | Bacteria | 2698 |
| 758 | Ga0496112_0112008 | 3300048915 | Bacteria | 2698 |
| 759 | Ga0496112_0169739 | 3300048915 | Bacteria | 2147 |
| 760 | Ga0496112_0307529 | 3300048915 | Bacteria | 1530 |
| 761 | Ga0496113_0002984 | 3300048916 | Bacteria | 10015 |
| 762 | Ga0496113_0006885 | 3300048916 | Bacteria | 7254 |
| 763 | Ga0496113_0032874 | 3300048916 | Bacteria | 3772 |
| 764 | Ga0496113_0047449 | 3300048916 | Bacteria | 3192 |
| 765 | Ga0496113_0157758 | 3300048916 | Bacteria | 1793 |
| 766 | Ga0496114_0000177 | 3300048917 | Bacteria | 45143 |
| 767 | Ga0496114_0002173 | 3300048917 | Bacteria | 14931 |
| 768 | Ga0496114_0004084 | 3300048917 | Bacteria | 11279 |
| 769 | Ga0496114_0004101 | 3300048917 | Bacteria | 11265 |
| 770 | Ga0496114_0012037 | 3300048917 | Bacteria | 6920 |
| 771 | Ga0496114_0013794 | 3300048917 | Bacteria | 6477 |
| 772 | Ga0496114_0036190 | 3300048917 | Bacteria | 4080 |
| 773 | Ga0496114_0051653 | 3300048917 | Bacteria | 3423 |
| 774 | Ga0496114_0072300 | 3300048917 | Bacteria | 2900 |
| 775 | Ga0496114_0075135 | 3300048917 | Bacteria | 2846 |
| 776 | Ga0496114_0077140 | 3300048917 | Bacteria | 2809 |
| 777 | Ga0496114_0153561 | 3300048917 | Bacteria | 1998 |
| 778 | Ga0496115_0000276 | 3300048918 | Bacteria | 45046 |
| 779 | Ga0496115_0000825 | 3300048918 | Bacteria | 22720 |
| 780 | Ga0496115_0008631 | 3300048918 | Bacteria | 7547 |
| 781 | Ga0496115_0013740 | 3300048918 | Bacteria | 6130 |
| 782 | Ga0496115_0028657 | 3300048918 | Bacteria | 4366 |
| 783 | Ga0501031_0000033 | 3300049568 | Bacteria | 76506 |
| 784 | Ga0501031_0001619 | 3300049568 | Bacteria | 14078 |
| 785 | Ga0501031_0001976 | 3300049568 | Bacteria | 12947 |
| 786 | Ga0501031_0007791 | 3300049568 | Bacteria | 6971 |
| 787 | Ga0501031_0010773 | 3300049568 | Bacteria | 5955 |
| 788 | Ga0501031_0071414 | 3300049568 | Bacteria | 2261 |
| 789 | Ga0501031_0087831 | 3300049568 | Bacteria | 2027 |
| 790 | Ga0501032_0006726 | 3300049569 | Bacteria | 8438 |
| 791 | Ga0501032_0018372 | 3300049569 | Bacteria | 4899 |
| 792 | Ga0501032_0045697 | 3300049569 | Bacteria | 2960 |
| 793 | Ga0501033_0000388 | 3300049570 | Bacteria | 42262 |
| 794 | Ga0501033_0004305 | 3300049570 | Bacteria | 11427 |
| 795 | Ga0501033_0008760 | 3300049570 | Bacteria | 7821 |
| 796 | Ga0501034_0005985 | 3300049571 | Bacteria | 13159 |
| 797 | Ga0501034_0043882 | 3300049571 | Bacteria | 4522 |
| 798 | Ga0501034_0176971 | 3300049571 | Bacteria | 2099 |
| 799 | Ga0501036_0000462 | 3300049572 | Bacteria | 29122 |
| 800 | Ga0501036_0006015 | 3300049572 | Bacteria | 9841 |
| 801 | Ga0501036_0014753 | 3300049572 | Bacteria | 6516 |
| 802 | Ga0501036_0021834 | 3300049572 | Bacteria | 5381 |
| 803 | Ga0501036_0033191 | 3300049572 | Bacteria | 4365 |
| 804 | Ga0501036_0150469 | 3300049572 | Bacteria | 1963 |
| 805 | Ga0501037_0050998 | 3300049573 | Bacteria | 3026 |
| 806 | Ga0501037_0141543 | 3300049573 | Bacteria | 1721 |
| 807 | Ga0501038_0001345 | 3300049574 | Bacteria | 22388 |
| 808 | Ga0501038_0003559 | 3300049574 | Bacteria | 14496 |
| 809 | Ga0501038_0003931 | 3300049574 | Bacteria | 13810 |
| 810 | Ga0501038_0051955 | 3300049574 | Bacteria | 3534 |
| 811 | Ga0501038_0063654 | 3300049574 | Bacteria | 3147 |
| 812 | Ga0501038_0065149 | 3300049574 | Bacteria | 3105 |
| 813 | Ga0501039_0000528 | 3300049575 | Bacteria | 27658 |
| 814 | Ga0501039_0004944 | 3300049575 | Bacteria | 10108 |
| 815 | Ga0501039_0005475 | 3300049575 | Bacteria | 9605 |
| 816 | Ga0501039_0019537 | 3300049575 | Bacteria | 5194 |
| 817 | Ga0501039_0062956 | 3300049575 | Bacteria | 2874 |
| 818 | Ga0501039_0069825 | 3300049575 | Bacteria | 2729 |
| 819 | Ga0501039_0102448 | 3300049575 | Bacteria | 2234 |
| 820 | Ga0501040_0000234 | 3300049576 | Bacteria | 32549 |
| 821 | Ga0501040_0000862 | 3300049576 | Bacteria | 19019 |
| 822 | Ga0501040_0001857 | 3300049576 | Bacteria | 13550 |
| 823 | Ga0501040_0023262 | 3300049576 | Bacteria | 4154 |
| 824 | Ga0501040_0026007 | 3300049576 | Bacteria | 3937 |
| 825 | Ga0501040_0057479 | 3300049576 | Bacteria | 2670 |
| 826 | Ga0501040_0081988 | 3300049576 | Bacteria | 2235 |
| 827 | Ga0501041_0000176 | 3300049577 | Bacteria | 28688 |
| 828 | Ga0501041_0000463 | 3300049577 | Bacteria | 20567 |
| 829 | Ga0501041_0001181 | 3300049577 | Bacteria | 14214 |
| 830 | Ga0501041_0010616 | 3300049577 | Bacteria | 5430 |
| 831 | Ga0501041_0020227 | 3300049577 | Bacteria | 3977 |
| 832 | Ga0501041_0038298 | 3300049577 | Bacteria | 2907 |
| 833 | Ga0501042_0000717 | 3300049578 | Bacteria | 17980 |
| 834 | Ga0501042_0001430 | 3300049578 | Bacteria | 14053 |
| 835 | Ga0501042_0002112 | 3300049578 | Bacteria | 12048 |
| 836 | Ga0501042_0004174 | 3300049578 | Bacteria | 9182 |
| 837 | Ga0501042_0006865 | 3300049578 | Bacteria | 7428 |
| 838 | Ga0501042_0034503 | 3300049578 | Bacteria | 3588 |
| 839 | Ga0501042_0037226 | 3300049578 | Bacteria | 3453 |
| 840 | Ga0501042_0107991 | 3300049578 | Bacteria | 2003 |
| 841 | Ga0501043_0000798 | 3300049579 | Bacteria | 27990 |
| 842 | Ga0501043_0004708 | 3300049579 | Bacteria | 11060 |
| 843 | Ga0501043_0009672 | 3300049579 | Bacteria | 7557 |
| 844 | Ga0501043_0030381 | 3300049579 | Bacteria | 4246 |
| 845 | Ga0501043_0039536 | 3300049579 | Bacteria | 3706 |
| 846 | Ga0501043_0099439 | 3300049579 | Bacteria | 2287 |
| 847 | Ga0501043_0146066 | 3300049579 | Bacteria | 1852 |
| 848 | Ga0501046_0000577 | 3300049580 | Bacteria | 36233 |
| 849 | Ga0501046_0001998 | 3300049580 | Bacteria | 19348 |
| 850 | Ga0501046_0010127 | 3300049580 | Bacteria | 8114 |
| 851 | Ga0501046_0016777 | 3300049580 | Bacteria | 6122 |
| 852 | Ga0501046_0025265 | 3300049580 | Bacteria | 4862 |
| 853 | Ga0501046_0080128 | 3300049580 | Bacteria | 2524 |
| 854 | Ga0501047_0001088 | 3300049581 | Bacteria | 27110 |
| 855 | Ga0501047_0049901 | 3300049581 | Bacteria | 4040 |
| 856 | Ga0501048_0000440 | 3300049582 | Bacteria | 29199 |
| 857 | Ga0501048_0001055 | 3300049582 | Bacteria | 20637 |
| 858 | Ga0501048_0001065 | 3300049582 | Bacteria | 20549 |
| 859 | Ga0501048_0008231 | 3300049582 | Bacteria | 7888 |
| 860 | Ga0501048_0027709 | 3300049582 | Bacteria | 4114 |
| 861 | Ga0501067_0001736 | 3300049583 | Bacteria | 11985 |
| 862 | Ga0501067_0003340 | 3300049583 | Bacteria | 8820 |
| 863 | Ga0501067_0010687 | 3300049583 | Bacteria | 5079 |
| 864 | Ga0501067_0013198 | 3300049583 | Bacteria | 4575 |
| 865 | Ga0501067_0021136 | 3300049583 | Bacteria | 3602 |
| 866 | Ga0501067_0022424 | 3300049583 | Bacteria | 3494 |
| 867 | Ga0501067_0052719 | 3300049583 | Bacteria | 2254 |
| 868 | Ga0501067_0064032 | 3300049583 | Bacteria | 2036 |
| 869 | Ga0501068_0003123 | 3300049584 | Bacteria | 8860 |
| 870 | Ga0501068_0003454 | 3300049584 | Bacteria | 8508 |
| 871 | Ga0501068_0004344 | 3300049584 | Bacteria | 7701 |
| 872 | Ga0501068_0006523 | 3300049584 | Bacteria | 6437 |
| 873 | Ga0501068_0043889 | 3300049584 | Bacteria | 2690 |
| 874 | Ga0501068_0051652 | 3300049584 | Bacteria | 2487 |
| 875 | Ga0501069_0000870 | 3300049585 | Bacteria | 14363 |
| 876 | Ga0501069_0004128 | 3300049585 | Bacteria | 7499 |
| 877 | Ga0501069_0018444 | 3300049585 | Bacteria | 3765 |
| 878 | Ga0501069_0080936 | 3300049585 | Bacteria | 1829 |
| 879 | Ga0501070_0001222 | 3300049586 | Bacteria | 22995 |
| 880 | Ga0501070_0002078 | 3300049586 | Bacteria | 17588 |
| 881 | Ga0501070_0002312 | 3300049586 | Bacteria | 16724 |
| 882 | Ga0501070_0005213 | 3300049586 | Bacteria | 11078 |
| 883 | Ga0501070_0015415 | 3300049586 | Bacteria | 6430 |
| 884 | Ga0501070_0017574 | 3300049586 | Bacteria | 6003 |
| 885 | Ga0501070_0052438 | 3300049586 | Bacteria | 3386 |
| 886 | Ga0501070_0054578 | 3300049586 | Bacteria | 3313 |
| 887 | Ga0501070_0087253 | 3300049586 | Bacteria | 2583 |
| 888 | Ga0501071_0000054 | 3300049587 | Bacteria | 38443 |
| 889 | Ga0501071_0000117 | 3300049587 | Bacteria | 31405 |
| 890 | Ga0501071_0003445 | 3300049587 | Bacteria | 9881 |
| 891 | Ga0501071_0008444 | 3300049587 | Bacteria | 6808 |
| 892 | Ga0501071_0009697 | 3300049587 | Bacteria | 6424 |
| 893 | Ga0501071_0027431 | 3300049587 | Bacteria | 4006 |
| 894 | Ga0501072_0001204 | 3300049588 | Bacteria | 19296 |
| 895 | Ga0501072_0003186 | 3300049588 | Bacteria | 12338 |
| 896 | Ga0501072_0024167 | 3300049588 | Bacteria | 4725 |
| 897 | Ga0501072_0061672 | 3300049588 | Bacteria | 2958 |
| 898 | Ga0501072_0068909 | 3300049588 | Bacteria | 2792 |
| 899 | Ga0501072_0075382 | 3300049588 | Bacteria | 2668 |
| 900 | Ga0501072_0110584 | 3300049588 | Bacteria | 2187 |
| 901 | Ga0501073_0004823 | 3300049589 | Bacteria | 10126 |
| 902 | Ga0501073_0007092 | 3300049589 | Bacteria | 8347 |
| 903 | Ga0501073_0010771 | 3300049589 | Bacteria | 6697 |
| 904 | Ga0501073_0023451 | 3300049589 | Bacteria | 4431 |
| 905 | Ga0501074_0000008 | 3300049590 | Bacteria | 105048 |
| 906 | Ga0501074_0002914 | 3300049590 | Bacteria | 12012 |
| 907 | Ga0501074_0019307 | 3300049590 | Bacteria | 4951 |
| 908 | Ga0501074_0019904 | 3300049590 | Bacteria | 4875 |
| 909 | Ga0501074_0020522 | 3300049590 | Bacteria | 4801 |
| 910 | Ga0501074_0023533 | 3300049590 | Bacteria | 4476 |
| 911 | Ga0501074_0078352 | 3300049590 | Bacteria | 2371 |
| 912 | Ga0501075_0000096 | 3300049591 | Bacteria | 40796 |
| 913 | Ga0501075_0000800 | 3300049591 | Bacteria | 19695 |
| 914 | Ga0501075_0011467 | 3300049591 | Bacteria | 6273 |
| 915 | Ga0501075_0029522 | 3300049591 | Bacteria | 4056 |
| 916 | Ga0501075_0029926 | 3300049591 | Bacteria | 4028 |
| 917 | Ga0501075_0032826 | 3300049591 | Bacteria | 3859 |
| 918 | Ga0501075_0073051 | 3300049591 | Bacteria | 2593 |
| 919 | Ga0501076_0000020 | 3300049592 | Bacteria | 86221 |
| 920 | Ga0501076_0000459 | 3300049592 | Bacteria | 25828 |
| 921 | Ga0501076_0000951 | 3300049592 | Bacteria | 18911 |
| 922 | Ga0501076_0037309 | 3300049592 | Bacteria | 3810 |
| 923 | Ga0501076_0040264 | 3300049592 | Bacteria | 3671 |
| 924 | Ga0501076_0043060 | 3300049592 | Bacteria | 3556 |
| 925 | Ga0501076_0064067 | 3300049592 | Bacteria | 2929 |
| 926 | Ga0501077_0000624 | 3300049593 | Bacteria | 21474 |
| 927 | Ga0501077_0003516 | 3300049593 | Bacteria | 9408 |
| 928 | Ga0501077_0016052 | 3300049593 | Bacteria | 4717 |
| 929 | Ga0501077_0022187 | 3300049593 | Bacteria | 4020 |
| 930 | Ga0501079_0000001 | 3300049741 | Bacteria | 121247 |
| 931 | Ga0501079_0005831 | 3300049741 | Bacteria | 9209 |
| 932 | Ga0501079_0008513 | 3300049741 | Bacteria | 7779 |
| 933 | Ga0501079_0016128 | 3300049741 | Bacteria | 5710 |
| 934 | Ga0501079_0036694 | 3300049741 | Bacteria | 3775 |
| 935 | Ga0501079_0135057 | 3300049741 | Bacteria | 1920 |
| 936 | Ga0501080_0002158 | 3300049742 | Bacteria | 17095 |
| 937 | Ga0501080_0013819 | 3300049742 | Bacteria | 7433 |
| 938 | Ga0501080_0018882 | 3300049742 | Bacteria | 6384 |
| 939 | Ga0501080_0028840 | 3300049742 | Bacteria | 5166 |
| 940 | Ga0501080_0034259 | 3300049742 | Bacteria | 4739 |
| 941 | Ga0501080_0046933 | 3300049742 | Bacteria | 4020 |
| 942 | Ga0501080_0055987 | 3300049742 | Bacteria | 3672 |
| 943 | Ga0501080_0169167 | 3300049742 | Bacteria | 2016 |
| 944 | Ga0501081_0001766 | 3300049743 | Bacteria | 13416 |
| 945 | Ga0501081_0004360 | 3300049743 | Bacteria | 9074 |
| 946 | Ga0501081_0026249 | 3300049743 | Bacteria | 3926 |
| 947 | Ga0501081_0026767 | 3300049743 | Bacteria | 3890 |
| 948 | Ga0501081_0027159 | 3300049743 | Bacteria | 3862 |
| 949 | Ga0501081_0039825 | 3300049743 | Bacteria | 3216 |
| 950 | Ga0501081_0102380 | 3300049743 | Bacteria | 2025 |
| 951 | Ga0501083_0000739 | 3300049744 | Bacteria | 21326 |
| 952 | Ga0501083_0002179 | 3300049744 | Bacteria | 13402 |
| 953 | Ga0501083_0002761 | 3300049744 | Bacteria | 12131 |
| 954 | Ga0501083_0003927 | 3300049744 | Bacteria | 10441 |
| 955 | Ga0501083_0058501 | 3300049744 | Bacteria | 2579 |
| 956 | Ga0501035_0028764 | 3300049822 | Bacteria | 5071 |
| 957 | Ga0501035_0029303 | 3300049822 | Bacteria | 5019 |
| 958 | Ga0501035_0112285 | 3300049822 | Bacteria | 2388 |
| 959 | Ga0501044_0014620 | 3300049823 | Bacteria | 8464 |
| 960 | Ga0501044_0063936 | 3300049823 | Bacteria | 3757 |
| 961 | Ga0501045_0000708 | 3300049824 | Bacteria | 21218 |
| 962 | Ga0501045_0000755 | 3300049824 | Bacteria | 20714 |
| 963 | Ga0501045_0008054 | 3300049824 | Bacteria | 7341 |
| 964 | Ga0501045_0026513 | 3300049824 | Bacteria | 4169 |
| 965 | Ga0501045_0030710 | 3300049824 | Bacteria | 3889 |
| 966 | Ga0501045_0043394 | 3300049824 | Bacteria | 3274 |
| 967 | Ga0501045_0060316 | 3300049824 | Bacteria | 2780 |
| 968 | nmdc:mga05p37_2214_c1 | 3300050507 | Bacteria | 22643 |
| 969 | nmdc:mga05p37_299697_c1 | 3300050507 | Bacteria | 1910 |
| 970 | nmdc:mga05p37_38898_c1 | 3300050507 | Bacteria | 5835 |
| 971 | nmdc:mga05p37_47650_c1 | 3300050507 | Bacteria | 5270 |
| 972 | nmdc:mga05p37_5442_c1 | 3300050507 | Bacteria | 14956 |
| 973 | nmdc:mga09592_16354_c1 | 3300050508 | Bacteria | 6068 |
| 974 | nmdc:mga09592_176511_c1 | 3300050508 | Bacteria | 1848 |
| 975 | nmdc:mga09592_26880_c1 | 3300050508 | Bacteria | 4771 |
| 976 | nmdc:mga06r32_266104_c1 | 3300050510 | Bacteria | 1702 |
| 977 | nmdc:mga06r32_30187_c1 | 3300050510 | Bacteria | 5086 |
| 978 | nmdc:mga06r32_33245_c1 | 3300050510 | Bacteria | 4857 |
| 979 | nmdc:mga08y16_11668_c1 | 3300050511 | Bacteria | 9233 |
| 980 | nmdc:mga08y16_16997_c1 | 3300050511 | Bacteria | 7660 |
| 981 | nmdc:mga08y16_22993_c1 | 3300050511 | Bacteria | 6580 |
| 982 | nmdc:mga08y16_28182_c1 | 3300050511 | Bacteria | 5920 |
| 983 | nmdc:mga08y16_5500_c1 | 3300050511 | Bacteria | 13247 |
| 984 | nmdc:mga0n895_128789_c1 | 3300050512 | Bacteria | 2555 |
| 985 | nmdc:mga0n895_19412_c1 | 3300050512 | Bacteria | 6318 |
| 986 | nmdc:mga0n895_76270_c1 | 3300050512 | Bacteria | 3334 |
| 987 | nmdc:mga0rr50_32967_c1 | 3300050513 | Bacteria | 3697 |
| 988 | nmdc:mga0rr50_72255_c1 | 3300050513 | Bacteria | 2634 |
| 989 | nmdc:mga08x19_5201_c1 | 3300050514 | Bacteria | 7694 |
| 990 | nmdc:mga08x19_93237_c1 | 3300050514 | Bacteria | 1990 |
| 991 | nmdc:mga0a205_172373_c1 | 3300050515 | Bacteria | 2060 |
| 992 | nmdc:mga0a205_20523_c1 | 3300050515 | Bacteria | 6236 |
| 993 | nmdc:mga0a205_41630_c1 | 3300050515 | Bacteria | 4424 |
| 994 | nmdc:mga0a205_46359_c1 | 3300050515 | Bacteria | 2926 |
| 995 | nmdc:mga0a205_48698_c1 | 3300050515 | Bacteria | 4091 |
| 996 | nmdc:mga0a205_6767_c1 | 3300050515 | Bacteria | 10367 |
| 997 | Ga0495601_0001431 | 3300053077 | Bacteria | 13145 |
| 998 | Ga0495601_0005282 | 3300053077 | Bacteria | 7513 |
| 999 | Ga0495601_0048569 | 3300053077 | Bacteria | 2673 |
| 1000 | Ga0495601_0054569 | 3300053077 | Bacteria | 2528 |
| 1001 | Ga0495612_0004034 | 3300053078 | Bacteria | 6082 |
| 1002 | Ga0495655_0009798 | 3300053083 | Bacteria | 1870 |
| 1003 | Ga0495595_0006334 | 3300053084 | Bacteria | 4820 |
| 1004 | Ga0495595_0013553 | 3300053084 | Bacteria | 3445 |
| 1005 | Ga0495619_0002382 | 3300053085 | Bacteria | 12347 |
| 1006 | Ga0495619_0017531 | 3300053085 | Bacteria | 4535 |
| 1007 | Ga0495619_0018337 | 3300053085 | Bacteria | 4440 |
| 1008 | Ga0501084_0000283 | 3300054114 | Bacteria | 38382 |
| 1009 | Ga0501084_0008666 | 3300054114 | Bacteria | 8407 |
| 1010 | Ga0501084_0013886 | 3300054114 | Bacteria | 6665 |
| 1011 | Ga0501084_0050558 | 3300054114 | Bacteria | 3479 |
| 1012 | Ga0501084_0050733 | 3300054114 | Bacteria | 3471 |
| 1013 | Ga0501084_0137099 | 3300054114 | Bacteria | 2060 |
| 1014 | Ga0501084_0179551 | 3300054114 | Bacteria | 1787 |
| 1015 | Ga0590075_007928 | 3300059424 | Bacteria | 2528 |
| 1016 | Ga0501082_0000620 | 3300060353 | Bacteria | 31200 |
| 1017 | Ga0501082_0002904 | 3300060353 | Bacteria | 14943 |
| 1018 | Ga0501082_0017448 | 3300060353 | Bacteria | 6184 |
| 1019 | Ga0501082_0038647 | 3300060353 | Bacteria | 4117 |
| 1020 | Ga0501082_0068574 | 3300060353 | Bacteria | 3053 |
| 1021 | Ga0501082_0113879 | 3300060353 | Bacteria | 2342 |
| 1022 | Ga0466962_0001376 | 3300061719 | Bacteria | 11265 |
| 1023 | Ga0466962_0003375 | 3300061719 | Bacteria | 7601 |
| 1024 | Ga0466962_0004440 | 3300061719 | Bacteria | 6718 |
| 1025 | Ga0466962_0011665 | 3300061719 | Bacteria | 4232 |
| 1026 | Ga0466962_0014473 | 3300061719 | Bacteria | 3803 |
| 1027 | Ga0466962_0024540 | 3300061719 | Bacteria | 2896 |
| 1028 | Ga0530510_0001002 | 3300061734 | Bacteria | 18761 |
| 1029 | Ga0530510_0001060 | 3300061734 | Bacteria | 18252 |
| 1030 | Ga0530510_0001361 | 3300061734 | Bacteria | 16335 |
| 1031 | Ga0530510_0014530 | 3300061734 | Bacteria | 5554 |
| 1032 | Ga0530510_0036421 | 3300061734 | Bacteria | 3546 |
| 1033 | Ga0530510_0038731 | 3300061734 | Bacteria | 3442 |
| 1034 | Ga0530510_0039015 | 3300061734 | Bacteria | 3428 |
| 1035 | Ga0207707_10035996 | |||
| 1036 | Ga0070658_10048517 | |||
| 1037 | Ga0070658_10090251 | |||
| 1038 | Ga0070683_100001612 | |||
| 1039 | Ga0070683_100028245 | |||
| 1040 | Ga0070683_100031746 | |||
| 1041 | Ga0070683_100053781 | |||
| 1042 | Ga0070683_100107785 | |||
| 1043 | Ga0070690_100074147 | |||
| 1044 | Ga0070666_10044989 | |||
| 1045 | Ga0070666_10094012 | |||
| 1046 | Ga0070680_100001193 | |||
| 1047 | Ga0070680_100007929 | |||
| 1048 | Ga0070682_100018411 | |||
| 1049 | Ga0070682_100060420 | |||
| 1050 | Ga0068868_100027694 | |||
| 1051 | Ga0068868_100038181 | |||
| 1052 | Ga0068868_100121115 | |||
| 1053 | Ga0070660_100003043 | |||
| 1054 | Ga0070660_100007452 | |||
| 1055 | Ga0070660_100014797 | |||
| 1056 | Ga0070660_100062766 | |||
| 1057 | Ga0070689_100003195 | |||
| 1058 | Ga0070689_100080529 | |||
| 1059 | Ga0070691_10028892 | |||
| 1060 | Ga0070691_10037142 | |||
| 1061 | Ga0070691_10042030 | |||
| 1062 | Ga0070661_100040044 | |||
| 1063 | Ga0070661_100052069 | |||
| 1064 | Ga0070661_100060072 | |||
| 1065 | Ga0070661_100061907 | |||
| 1066 | Ga0070661_100076218 | |||
| 1067 | Ga0070692_10013638 | |||
| 1068 | Ga0070692_10067405 | |||
| 1069 | Ga0070675_100036864 | |||
| 1070 | Ga0070671_100039895 | |||
| 1071 | Ga0070674_100000543 | |||
| 1072 | Ga0070674_100015836 | |||
| 1073 | Ga0070674_100026295 | |||
| 1074 | Ga0070673_100011197 | |||
| 1075 | Ga0070688_100001134 | |||
| 1076 | Ga0070688_100008762 | |||
| 1077 | Ga0070659_100003675 | |||
| 1078 | Ga0070659_100014416 | |||
| 1079 | Ga0070714_100016781 | |||
| 1080 | Ga0070714_100020904 | |||
| 1081 | Ga0070714_100034628 | |||
| 1082 | Ga0070714_100054193 | |||
| 1083 | Ga0070714_100070067 | |||
| 1084 | Ga0070714_100134464 | |||
| 1085 | Ga0070714_100210159 | |||
| 1086 | Ga0070713_100013107 | |||
| 1087 | Ga0070713_100104198 | |||
| 1088 | Ga0070710_10002265 | |||
| 1089 | Ga0070710_10045399 | |||
| 1090 | Ga0070710_10054617 | |||
| 1091 | Ga0070711_100001299 | |||
| 1092 | Ga0070711_100005506 | |||
| 1093 | Ga0070711_100020141 | |||
| 1094 | Ga0070711_100135546 | |||
| 1095 | Ga0070700_100001551 | |||
| 1096 | Ga0070694_100022946 | |||
| 1097 | Ga0070694_100060885 | |||
| 1098 | Ga0070694_100076570 | |||
| 1099 | Ga0070694_100118010 | |||
| 1100 | Ga0070708_100008348 | |||
| 1101 | Ga0070663_100017434 | |||
| 1102 | Ga0070663_100034149 | |||
| 1103 | Ga0070678_100003432 | |||
| 1104 | Ga0070678_100039088 | |||
| 1105 | Ga0070678_100050596 | |||
| 1106 | Ga0070681_10014740 | |||
| 1107 | Ga0070681_10049046 | |||
| 1108 | Ga0070681_10075487 | |||
| 1109 | Ga0070681_10096251 | |||
| 1110 | Ga0070681_10148986 | |||
| 1111 | Ga0070681_10204372 | |||
| 1112 | Ga0068867_100000290 | |||
| 1113 | Ga0070706_100011218 | |||
| 1114 | Ga0070706_100048234 | |||
| 1115 | Ga0070706_100196822 | |||
| 1116 | Ga0070707_100001971 | |||
| 1117 | Ga0070707_100006528 | |||
| 1118 | Ga0070707_100023400 | |||
| 1119 | Ga0070698_100008197 | |||
| 1120 | Ga0070698_100024916 | |||
| 1121 | Ga0070698_100026236 | |||
| 1122 | Ga0070698_100052694 | |||
| 1123 | Ga0070698_100063589 | |||
| 1124 | Ga0070699_100043399 | |||
| 1125 | Ga0070699_100132275 | |||
| 1126 | Ga0070679_100005801 | |||
| 1127 | Ga0070679_100012416 | |||
| 1128 | Ga0070679_100035772 | |||
| 1129 | Ga0070679_100080839 | |||
| 1130 | Ga0070679_100088554 | |||
| 1131 | Ga0070679_100105410 | |||
| 1132 | Ga0070679_100152799 | |||
| 1133 | Ga0070684_100023758 | |||
| 1134 | Ga0070684_100059887 | |||
| 1135 | Ga0070684_100074455 | |||
| 1136 | Ga0070684_100092946 | |||
| 1137 | Ga0070684_100093795 | |||
| 1138 | Ga0068853_100100694 | |||
| 1139 | Ga0070672_100200075 | |||
| 1140 | Ga0070686_100002931 | |||
| 1141 | Ga0070686_100044438 | |||
| 1142 | Ga0070695_100000746 | |||
| 1143 | Ga0070695_100036301 | |||
| 1144 | Ga0070695_100127536 | |||
| 1145 | Ga0070696_100002162 | |||
| 1146 | Ga0070696_100051214 | |||
| 1147 | Ga0070696_100070011 | |||
| 1148 | Ga0070693_100010201 | |||
| 1149 | Ga0070693_100128295 | |||
| 1150 | Ga0070665_100070335 | |||
| 1151 | Ga0070704_100092796 | |||
| 1152 | Ga0068855_100044686 | |||
| 1153 | Ga0068855_100087304 | |||
| 1154 | Ga0070664_100034418 | |||
| 1155 | Ga0070664_100054750 | |||
| 1156 | Ga0070664_100092738 | |||
| 1157 | Ga0070664_100209317 | |||
| 1158 | Ga0068857_100075954 | |||
| 1159 | Ga0068857_100079569 | |||
| 1160 | Ga0068856_100120729 | |||
| 1161 | Ga0070702_100000583 | |||
| 1162 | Ga0070702_100058442 | |||
| 1163 | Ga0070702_100072254 | |||
| 1164 | Ga0068852_100016361 | |||
| 1165 | Ga0068852_100261307 | |||
| 1166 | Ga0068864_100054424 | |||
| 1167 | Ga0068866_10000154 | |||
| 1168 | Ga0068861_100069512 | |||
| 1169 | Ga0068861_100123084 | |||
| 1170 | Ga0068858_100055537 | |||
| 1171 | Ga0068860_100042034 | |||
| 1172 | Ga0068862_100071626 | |||
| 1173 | Ga0081455_10002410 | |||
| 1174 | Ga0081455_10002626 | |||
| 1175 | Ga0081455_10004721 | |||
| 1176 | Ga0081455_10030501 | |||
| 1177 | Ga0081538_10000151 | |||
| 1178 | Ga0081538_10000492 | |||
| 1179 | Ga0081538_10000613 | |||
| 1180 | Ga0081538_10002077 | |||
| 1181 | Ga0081538_10002734 | |||
| 1182 | Ga0081538_10003142 | |||
| 1183 | Ga0081538_10004272 | |||
| 1184 | Ga0081538_10007389 | |||
| 1185 | Ga0081538_10008374 | |||
| 1186 | Ga0081540_1007223 | |||
| 1187 | Ga0081539_10000200 | |||
| 1188 | Ga0081539_10000867 | |||
| 1189 | Ga0081539_10002620 | |||
| 1190 | Ga0070717_10003839 | |||
| 1191 | Ga0070717_10081446 | |||
| 1192 | Ga0070717_10224919 | |||
| 1193 | Ga0075432_10003010 | |||
| 1194 | Ga0075432_10007679 | |||
| 1195 | Ga0070715_10001264 | |||
| 1196 | Ga0070716_100034410 | |||
| 1197 | Ga0070712_100008840 | |||
| 1198 | Ga0070712_100012447 | |||
| 1199 | Ga0070712_100123005 | |||
| 1200 | Ga0097621_100024884 | |||
| 1201 | Ga0097621_100046132 | |||
| 1202 | Ga0068871_100004124 | |||
| 1203 | Ga0075428_100007989 | |||
| 1204 | Ga0075428_100023960 | |||
| 1205 | Ga0075428_100041907 | |||
| 1206 | Ga0075428_100047776 | |||
| 1207 | Ga0075428_100066941 | |||
| 1208 | Ga0075428_100149670 | |||
| 1209 | Ga0075430_100044310 | |||
| 1210 | Ga0075431_100006255 | |||
| 1211 | Ga0075431_100067676 | |||
| 1212 | Ga0075431_100078992 | |||
| 1213 | Ga0075433_10029961 | |||
| 1214 | Ga0075434_100071797 | |||
| 1215 | Ga0075434_100125690 | |||
| 1216 | Ga0075429_100009903 | |||
| 1217 | Ga0075429_100010729 | |||
| 1218 | Ga0075429_100035324 | |||
| 1219 | Ga0068865_100000501 | |||
| 1220 | Ga0068865_100009127 | |||
| 1221 | Ga0075436_100035492 | |||
| 1222 | Ga0075435_100001081 | |||
| 1223 | Ga0075435_100020517 | |||
| 1224 | Ga0075435_100034635 | |||
| 1225 | Ga0075435_100049337 | |||
| 1226 | Ga0075435_100054993 | |||
| 1227 | Ga0075435_100168104 | |||
| 1228 | Ga0105240_10011339 | |||
| 1229 | Ga0105240_10023789 | |||
| 1230 | Ga0105240_10330296 | |||
| 1231 | Ga0111539_10005525 | |||
| 1232 | Ga0111539_10005906 | |||
| 1233 | Ga0111539_10045158 | |||
| 1234 | Ga0111539_10048461 | |||
| 1235 | Ga0111539_10068447 | |||
| 1236 | Ga0111539_10155399 | |||
| 1237 | Ga0105245_10010962 | |||
| 1238 | Ga0105245_10020166 | |||
| 1239 | Ga0114129_10009560 | |||
| 1240 | Ga0114129_10023764 | |||
| 1241 | Ga0114129_10032301 | |||
| 1242 | Ga0114129_10139883 | |||
| 1243 | Ga0105243_10001079 | |||
| 1244 | Ga0105243_10015682 | |||
| 1245 | Ga0105243_10045523 | |||
| 1246 | Ga0105242_10048550 | |||
| 1247 | Ga0105242_10095225 | |||
| 1248 | Ga0105242_10194739 | |||
| 1249 | Ga0105248_10032131 | |||
| 1250 | Ga0105237_10079052 | |||
| 1251 | Ga0105238_10074842 | |||
| 1252 | Ga0105238_10096800 | |||
| 1253 | Ga0105238_10269620 | |||
| 1254 | Ga0105249_10001927 | |||
| 1255 | Ga0105249_10052943 | |||
| 1256 | Ga0105249_10077117 | |||
| 1257 | Ga0105249_10148260 | |||
| 1258 | Ga0105239_10001224 | |||
| 1259 | Ga0105239_10073178 | |||
| 1260 | Ga0105239_10078673 | |||
| 1261 | Ga0105239_10081462 | |||
| 1262 | Ga0105239_10095690 | |||
| 1263 | Ga0157371_10031282 | |||
| 1264 | Ga0157370_10050293 | |||
| 1265 | Ga0157370_10082653 | |||
| 1266 | Ga0157369_10009001 | |||
| 1267 | Ga0157369_10016530 | |||
| 1268 | Ga0157369_10018494 | |||
| 1269 | Ga0157369_10195219 | |||
| 1270 | Ga0157374_10001561 | |||
| 1271 | Ga0157378_10002273 | |||
| 1272 | Ga0163162_10023555 | |||
| 1273 | Ga0157372_10040929 | |||
| 1274 | Ga0157372_10045867 | |||
| 1275 | Ga0157375_10003215 | |||
| 1276 | Ga0157375_10122267 | |||
| 1277 | Ga0157375_10144771 | |||
| 1278 | Ga0157375_10231632 | |||
| 1279 | Ga0157375_10325069 | |||
| 1280 | Ga0163163_10189411 | |||
| 1281 | Ga0157380_10049297 | |||
| 1282 | Ga0157380_10064273 | |||
| 1283 | Ga0157380_10102898 | |||
| 1284 | Ga0157380_10106757 | |||
| 1285 | Ga0182008_10010441 | |||
| 1286 | Ga0157377_10018972 | |||
| 1287 | Ga0157376_10015090 | |||
| 1288 | Ga0157376_10114693 | |||
| 1289 | Ga0197907_10084652 | |||
| 1290 | Ga0206356_10153600 | |||
| 1291 | Ga0206356_10750028 | |||
| 1292 | Ga0206349_1027768 | |||
| 1293 | Ga0206354_11273170 | |||
| 1294 | Ga0206353_10723334 | |||
| 1295 | Ga0213874_10027387 | |||
| 1296 | Ga0224712_10006017 | |||
| 1297 | Ga0224712_10015516 | |||
| 1298 | Ga0207642_10000121 | |||
| 1299 | Ga0207688_10018244 | |||
| 1300 | Ga0207688_10031001 | |||
| 1301 | Ga0207680_10057138 | |||
| 1302 | Ga0207699_10055578 | |||
| 1303 | Ga0207643_10022128 | |||
| 1304 | Ga0207705_10056981 | |||
| 1305 | Ga0207705_10062374 | |||
| 1306 | Ga0207684_10086593 | |||
| 1307 | Ga0207654_10041893 | |||
| 1308 | Ga0207707_10051969 | |||
| 1309 | Ga0207707_10113915 | |||
| 1310 | Ga0207707_10115209 | |||
| 1311 | Ga0207707_10153453 | |||
| 1312 | Ga0207695_10027770 | |||
| 1313 | Ga0207695_10184941 | |||
| 1314 | Ga0207671_10035733 | |||
| 1315 | Ga0207693_10000499 | |||
| 1316 | Ga0207693_10001416 | |||
| 1317 | Ga0207693_10002670 | |||
| 1318 | Ga0207693_10008705 | |||
| 1319 | Ga0207693_10011959 | |||
| 1320 | Ga0207693_10014553 | |||
| 1321 | Ga0207693_10135413 | |||
| 1322 | Ga0207663_10025014 | |||
| 1323 | Ga0207657_10002712 | |||
| 1324 | Ga0207657_10027905 | |||
| 1325 | Ga0207657_10050254 | |||
| 1326 | Ga0207657_10094033 | |||
| 1327 | Ga0207649_10033336 | |||
| 1328 | Ga0207649_10134178 | |||
| 1329 | Ga0207652_10018853 | |||
| 1330 | Ga0207646_10000757 | |||
| 1331 | Ga0207646_10001072 | |||
| 1332 | Ga0207681_10072251 | |||
| 1333 | Ga0207659_10085313 | |||
| 1334 | Ga0207659_10130136 | |||
| 1335 | Ga0207687_10004288 | |||
| 1336 | Ga0207687_10160103 | |||
| 1337 | Ga0207700_10000001 | |||
| 1338 | Ga0207700_10015258 | |||
| 1339 | Ga0207664_10002805 | |||
| 1340 | Ga0207664_10009266 | |||
| 1341 | Ga0207664_10137754 | |||
| 1342 | Ga0207690_10045481 | |||
| 1343 | Ga0207690_10054930 | |||
| 1344 | Ga0207690_10155782 | |||
| 1345 | Ga0207706_10051002 | |||
| 1346 | Ga0207686_10052622 | |||
| 1347 | Ga0207709_10000781 | |||
| 1348 | Ga0207709_10037200 | |||
| 1349 | Ga0207669_10003091 | |||
| 1350 | Ga0207669_10030400 | |||
| 1351 | Ga0207704_10001528 | |||
| 1352 | Ga0207665_10003907 | |||
| 1353 | Ga0207665_10016660 | |||
| 1354 | Ga0207691_10013943 | |||
| 1355 | Ga0207691_10054726 | |||
| 1356 | Ga0207661_10000580 | |||
| 1357 | Ga0207661_10058766 | |||
| 1358 | Ga0207661_10072502 | |||
| 1359 | Ga0207661_10080608 | |||
| 1360 | Ga0207661_10086981 | |||
| 1361 | Ga0207661_10089816 | |||
| 1362 | Ga0207661_10137995 | |||
| 1363 | Ga0207679_10033525 | |||
| 1364 | Ga0207679_10060316 | |||
| 1365 | Ga0207667_10050908 | |||
| 1366 | Ga0207667_10137314 | |||
| 1367 | Ga0207667_10142369 | |||
| 1368 | Ga0207667_10239005 | |||
| 1369 | Ga0207712_10004576 | |||
| 1370 | Ga0207668_10003765 | |||
| 1371 | Ga0207658_10047922 | |||
| 1372 | Ga0207677_10008583 | |||
| 1373 | Ga0207677_10018980 | |||
| 1374 | Ga0207677_10031235 | |||
| 1375 | Ga0207703_10021711 | |||
| 1376 | Ga0207639_10008584 | |||
| 1377 | Ga0207678_10047114 | |||
| 1378 | Ga0207678_10090283 | |||
| 1379 | Ga0207708_10001823 | |||
| 1380 | Ga0207702_10004445 | |||
| 1381 | Ga0207702_10017385 | |||
| 1382 | Ga0207641_10070569 | |||
| 1383 | Ga0207648_10002767 | |||
| 1384 | Ga0207648_10012419 | |||
| 1385 | Ga0207674_10037873 | |||
| 1386 | Ga0207675_100001891 | |||
| 1387 | Ga0207675_100017381 | |||
| 1388 | Ga0207675_100020606 | |||
| 1389 | Ga0207683_10001565 | |||
| 1390 | Ga0207428_10000244 | |||
| 1391 | Ga0207428_10057044 | |||
| 1392 | Ga0268266_10130681 | |||
| 1393 | Ga0268265_10144192 | |||
| 1394 | Ga0268264_10027757 | |||
| 1395 | Ga0265319_1009630 | |||
| 1396 | Ga0265319_1018835 | |||
| 1397 | Ga0265319_1019652 | |||
| 1398 | Ga0265334_10042546 | |||
| 1399 | Ga0265322_10007725 | |||
| 1400 | Ga0265336_10008333 | |||
| 1401 | Ga0265338_10006251 | |||
| 1402 | Ga0265338_10008857 | |||
| 1403 | Ga0265338_10077537 | |||
| 1404 | Ga0265338_10147231 | |||
| 1405 | Ga0265330_10031876 | |||
| 1406 | Ga0265330_10035924 | |||
| 1407 | Ga0265320_10031846 | |||
| 1408 | Ga0265329_10010080 | |||
| 1409 | Ga0265340_10019740 | |||
| 1410 | Ga0265340_10022673 | |||
| 1411 | Ga0265339_10002054 | |||
| 1412 | Ga0265316_10019125 | |||
| 1413 | Ga0265316_10020308 | |||
| 1414 | Ga0265316_10087603 | |||
| 1415 | Ga0265316_10143485 | |||
| 1416 | Ga0307408_100006069 | |||
| 1417 | Ga0265313_10005116 | |||
| 1418 | Ga0265313_10027386 | |||
| 1419 | Ga0265314_10005028 | |||
| 1420 | Ga0265314_10007429 | |||
| 1421 | Ga0265342_10010488 | |||
| 1422 | Ga0307405_10004696 | |||
| 1423 | Ga0307406_10006630 | |||
| 1424 | Ga0307409_100085809 | |||
| 1425 | Ga0307416_100022597 | |||
| 1426 | Ga0307416_100056338 | |||
| 1427 | Ga0307416_100070320 | |||
| 1428 | Ga0307411_10016379 | |||
| 1429 | Ga0307415_100000242 | |||
| 1430 | Ga0307415_100000296 | |||
| 1431 | Ga0307415_100078049 | |||
| 1432 | Ga0373958_0003559 | |||
| 1433 | Ga0373959_0007324 | |||
| 1434 | Ga0373938_0001594 | |||
| 1435 | Ga0373932_0004267 | |||
| 1436 | Ga0373941_0001838 | |||
| 1437 | Ga0373945_0003703 | |||
| 1438 | Ga0373960_0000512 | |||
| 1439 | Ga0373943_0000299 | |||
| 1440 | Ga0373943_0026853 | |||
| 1441 | Ga0373946_0055940 | |||
| 1442 | Ga0373955_0072045 | |||
| 1443 | Ga0373942_0003061 | |||
| 1444 | Ga0373961_0005198 | |||
| 1445 | Ga0373962_0004247 | |||
| 1446 | Ga0373962_0005842 | |||
| 1447 | Ga0373931_0040054 | |||
| 1448 | Ga0373935_0012275 | |||
| 1449 | Ga0373927_0020520 | |||
| 1450 | Ga0373947_0003334 | |||
| 1451 | Ga0373947_0003997 | |||
| 1452 | Ga0373947_0014253 | |||
| 1453 | Ga0373925_0014062 | |||
| 1454 | Ga0395899_0001169 | |||
| 1455 | Ga0395899_0002224 | |||
| 1456 | Ga0395899_0004452 | |||
| 1457 | Ga0395899_0008461 | |||
| 1458 | Ga0395899_0009648 | |||
| 1459 | Ga0395899_0016439 | |||
| 1460 | Ga0395899_0028251 | |||
| 1461 | Ga0395899_0040607 | |||
| 1462 | Ga0395899_0047137 | |||
| 1463 | Ga0395899_0076678 | |||
| 1464 | Ga0395899_0153004 | |||
| 1465 | Ga0395900_0005122 | |||
| 1466 | Ga0395900_0005149 | |||
| 1467 | Ga0395900_0005255 | |||
| 1468 | Ga0395900_0006094 | |||
| 1469 | Ga0395900_0006594 | |||
| 1470 | Ga0395900_0009359 | |||
| 1471 | Ga0395900_0016810 | |||
| 1472 | Ga0395900_0036606 | |||
| 1473 | Ga0395900_0063720 | |||
| 1474 | Ga0395900_0064020 | |||
| 1475 | Ga0395900_0081145 | |||
| 1476 | Ga0395900_0088565 | |||
| 1477 | Ga0395900_0128124 | |||
| 1478 | Ga0395900_0158173 | |||
| 1479 | Ga0395900_0161847 | |||
| 1480 | Ga0395900_0238681 | |||
| 1481 | Ga0395900_0261847 | |||
| 1482 | Ga0395900_0278413 | |||
| 1483 | Ga0395898_0003908 | |||
| 1484 | Ga0395898_0005694 | |||
| 1485 | Ga0395898_0006540 | |||
| 1486 | Ga0395898_0007369 | |||
| 1487 | Ga0395898_0008036 | |||
| 1488 | Ga0395898_0010359 | |||
| 1489 | Ga0395898_0011736 | |||
| 1490 | Ga0395898_0012306 | |||
| 1491 | Ga0395898_0014022 | |||
| 1492 | Ga0395898_0014716 | |||
| 1493 | Ga0395898_0020301 | |||
| 1494 | Ga0395898_0020346 | |||
| 1495 | Ga0395898_0032145 | |||
| 1496 | Ga0395898_0058395 | |||
| 1497 | Ga0395898_0072492 | |||
| 1498 | Ga0395898_0090227 | |||
| 1499 | Ga0395898_0136526 | |||
| 1500 | Ga0395905_0005427 | |||
| 1501 | Ga0395905_0007309 | |||
| 1502 | Ga0395905_0007430 | |||
| 1503 | Ga0395905_0009544 | |||
| 1504 | Ga0395905_0018418 | |||
| 1505 | Ga0395905_0028812 | |||
| 1506 | Ga0395905_0033659 | |||
| 1507 | Ga0395905_0035066 | |||
| 1508 | Ga0395905_0038856 | |||
| 1509 | Ga0395905_0039367 | |||
| 1510 | Ga0395905_0053183 | |||
| 1511 | Ga0395905_0058225 | |||
| 1512 | Ga0395905_0062670 | |||
| 1513 | Ga0395905_0100291 | |||
| 1514 | Ga0395905_0103368 | |||
| 1515 | Ga0395905_0133502 | |||
| 1516 | Ga0395905_0154951 | |||
| 1517 | Ga0395905_0179054 | |||
| 1518 | Ga0395905_0231827 | |||
| 1519 | Ga0395901_0001057 | |||
| 1520 | Ga0395901_0001077 | |||
| 1521 | Ga0395901_0002248 | |||
| 1522 | Ga0395901_0003646 | |||
| 1523 | Ga0395901_0004617 | |||
| 1524 | Ga0395901_0005172 | |||
| 1525 | Ga0395901_0007398 | |||
| 1526 | Ga0395901_0012458 | |||
| 1527 | Ga0395901_0018337 | |||
| 1528 | Ga0395901_0019264 | |||
| 1529 | Ga0395901_0021879 | |||
| 1530 | Ga0395901_0028507 | |||
| 1531 | Ga0395901_0035315 | |||
| 1532 | Ga0395901_0036915 | |||
| 1533 | Ga0395901_0044519 | |||
| 1534 | Ga0395901_0143511 | |||
| 1535 | Ga0436360_0487569 | |||
| 1536 | Ga0436363_0891141 | |||
| 1537 | Ga0439438_012206 | |||
| 1538 | Ga0439439_0000991 | |||
| 1539 | Ga0439433_0000482 | |||
| 1540 | Ga0439446_0002523 | |||
| 1541 | Ga0439446_0006535 | |||
| 1542 | Ga0439458_0011982 | |||
| 1543 | Ga0439434_0022679 | |||
| 1544 | Ga0466969_0001126 | |||
| 1545 | Ga0466965_0046829 | |||
| 1546 | Ga0466966_0007848 | |||
| 1547 | Ga0466966_0015704 | |||
| 1548 | Ga0466966_0077835 | |||
| 1549 | Ga0466966_0113135 | |||
| 1550 | Ga0466961_0013305 | |||
| 1551 | Ga0466963_0000481 | |||
| 1552 | Ga0466963_0001325 | |||
| 1553 | Ga0466963_0001333 | |||
| 1554 | Ga0466963_0003978 | |||
| 1555 | Ga0466963_0026825 | |||
| 1556 | Ga0466963_0028114 | |||
| 1557 | Ga0466963_0029723 | |||
| 1558 | Ga0466963_0053674 | |||
| 1559 | Ga0466963_0071803 | |||
| 1560 | Ga0466964_0003730 | |||
| 1561 | Ga0466964_0010882 | |||
| 1562 | Ga0466964_0027735 | |||
| 1563 | Ga0466964_0048637 | |||
| 1564 | Ga0466971_0005631 | |||
| 1565 | Ga0466970_0002928 | |||
| 1566 | Ga0466970_0053697 | |||
| 1567 | Ga0466957_0000932 | |||
| 1568 | Ga0466957_0003321 | |||
| 1569 | Ga0466957_0004549 | |||
| 1570 | Ga0466957_0029409 | |||
| 1571 | Ga0466957_0029425 | |||
| 1572 | Ga0466960_0009316 | |||
| 1573 | Ga0466960_0015644 | |||
| 1574 | Ga0466960_0026689 | |||
| 1575 | Ga0466959_0003610 | |||
| 1576 | Ga0466959_0010632 | |||
| 1577 | Ga0466959_0045996 | |||
| 1578 | Ga0466958_0000447 | |||
| 1579 | Ga0466958_0002557 | |||
| 1580 | Ga0466958_0006920 | |||
| 1581 | Ga0466958_0009219 | |||
| 1582 | Ga0466967_0000291 | |||
| 1583 | Ga0466967_0002093 | |||
| 1584 | Ga0466967_0003596 | |||
| 1585 | Ga0466967_0003679 | |||
| 1586 | Ga0466967_0005179 | |||
| 1587 | Ga0466967_0006520 | |||
| 1588 | Ga0466967_0010493 | |||
| 1589 | Ga0466967_0012008 | |||
| 1590 | Ga0466967_0018485 | |||
| 1591 | Ga0466967_0048711 | |||
| 1592 | Ga0466967_0049464 | |||
| 1593 | Ga0466967_0064511 | |||
| 1594 | Ga0466967_0068375 | |||
| 1595 | Ga0466967_0070681 | |||
| 1596 | Ga0466967_0072929 | |||
| 1597 | Ga0466967_0100924 | |||
| 1598 | Ga0466967_0122896 | |||
| 1599 | Ga0466967_0133349 | |||
| 1600 | Ga0466967_0138592 | |||
| 1601 | Ga0466967_0191375 | |||
| 1602 | Ga0495592_0000989 | |||
| 1603 | Ga0495592_0027546 | |||
| 1604 | Ga0495592_0036920 | |||
| 1605 | Ga0495603_0011232 | |||
| 1606 | Ga0495629_0000403 | |||
| 1607 | Ga0495629_0008955 | |||
| 1608 | Ga0495629_0081982 | |||
| 1609 | Ga0495641_0000331 | |||
| 1610 | Ga0495641_0051979 | |||
| 1611 | Ga0495651_0000064 | |||
| 1612 | Ga0495651_0008032 | |||
| 1613 | Ga0495651_0069600 | |||
| 1614 | Ga0495651_0121885 | |||
| 1615 | Ga0495653_0000351 | |||
| 1616 | Ga0495653_0014756 | |||
| 1617 | Ga0495653_0040238 | |||
| 1618 | Ga0495653_0093272 | |||
| 1619 | Ga0495582_0000426 | |||
| 1620 | Ga0495582_0010215 | |||
| 1621 | Ga0495582_0035117 | |||
| 1622 | Ga0495582_0064436 | |||
| 1623 | Ga0495639_0000619 | |||
| 1624 | Ga0495662_0004650 | |||
| 1625 | Ga0495664_0040502 | |||
| 1626 | Ga0495664_0052194 | |||
| 1627 | Ga0495585_0029861 | |||
| 1628 | Ga0495608_0004037 | |||
| 1629 | Ga0495608_0006061 | |||
| 1630 | Ga0495608_0006677 | |||
| 1631 | Ga0495618_0000613 | |||
| 1632 | Ga0495618_0021181 | |||
| 1633 | Ga0495628_0000069 | |||
| 1634 | Ga0495628_0025798 | |||
| 1635 | Ga0495628_0055727 | |||
| 1636 | Ga0495630_0006653 | |||
| 1637 | Ga0495652_0011521 | |||
| 1638 | Ga0495652_0059185 | |||
| 1639 | Ga0495665_0007390 | |||
| 1640 | Ga0495665_0042941 | |||
| 1641 | Ga0495640_0024614 | |||
| 1642 | Ga0495640_0034641 | |||
| 1643 | Ga0495587_0004197 | |||
| 1644 | Ga0495645_0000085 | |||
| 1645 | Ga0495645_0033047 | |||
| 1646 | Ga0495667_0011723 | |||
| 1647 | Ga0495667_0032603 | |||
| 1648 | Ga0495667_0103416 | |||
| 1649 | Ga0495634_0021939 | |||
| 1650 | Ga0495634_0053894 | |||
| 1651 | Ga0495634_0073673 | |||
| 1652 | Ga0495635_0030960 | |||
| 1653 | Ga0495635_0040315 | |||
| 1654 | Ga0495635_0106595 | |||
| 1655 | Ga0495657_0003621 | |||
| 1656 | Ga0495657_0064673 | |||
| 1657 | Ga0495599_0000146 | |||
| 1658 | Ga0495599_0095665 | |||
| 1659 | Ga0495623_0000030 | |||
| 1660 | Ga0495623_0006977 | |||
| 1661 | Ga0495646_0001436 | |||
| 1662 | Ga0495658_0000302 | |||
| 1663 | Ga0495658_0004983 | |||
| 1664 | Ga0495669_0046726 | |||
| 1665 | Ga0495613_0005126 | |||
| 1666 | Ga0495613_0044632 | |||
| 1667 | Ga0495624_0001304 | |||
| 1668 | Ga0495624_0059108 | |||
| 1669 | Ga0495600_0089147 | |||
| 1670 | Ga0495581_0000117 | |||
| 1671 | Ga0495581_0000815 | |||
| 1672 | Ga0495581_0006138 | |||
| 1673 | Ga0495604_0000103 | |||
| 1674 | Ga0495604_0007052 | |||
| 1675 | Ga0495674_0041491 | |||
| 1676 | Ga0495674_0059974 | |||
| 1677 | Ga0495674_0078384 | |||
| 1678 | Ga0495674_0192630 | |||
| 1679 | Ga0495676_0000268 | |||
| 1680 | Ga0495676_0027491 | |||
| 1681 | Ga0495676_0037003 | |||
| 1682 | Ga0495676_0041028 | |||
| 1683 | Ga0495680_0006548 | |||
| 1684 | Ga0495680_0009114 | |||
| 1685 | Ga0495680_0021704 | |||
| 1686 | Ga0495680_0023092 | |||
| 1687 | Ga0495675_0000509 | |||
| 1688 | Ga0495677_0015913 | |||
| 1689 | Ga0495684_0029398 | |||
| 1690 | Ga0495684_0037130 | |||
| 1691 | Ga0495684_0042600 | |||
| 1692 | Ga0495684_0046375 | |||
| 1693 | Ga0495593_0024595 | |||
| 1694 | Ga0495602_0000080 | |||
| 1695 | Ga0495602_0067752 | |||
| 1696 | Ga0496100_0056841 | |||
| 1697 | Ga0496100_0066431 | |||
| 1698 | Ga0496101_0001887 | |||
| 1699 | Ga0496101_0002078 | |||
| 1700 | Ga0496101_0017603 | |||
| 1701 | Ga0496101_0037828 | |||
| 1702 | Ga0496101_0066151 | |||
| 1703 | Ga0496101_0084755 | |||
| 1704 | Ga0496101_0093921 | |||
| 1705 | Ga0496102_0000944 | |||
| 1706 | Ga0496102_0001216 | |||
| 1707 | Ga0496102_0004404 | |||
| 1708 | Ga0496102_0026332 | |||
| 1709 | Ga0496102_0177981 | |||
| 1710 | Ga0496102_0255133 | |||
| 1711 | Ga0496103_0000709 | |||
| 1712 | Ga0496103_0002863 | |||
| 1713 | Ga0496103_0009008 | |||
| 1714 | Ga0496103_0026438 | |||
| 1715 | Ga0496103_0044774 | |||
| 1716 | Ga0496103_0050733 | |||
| 1717 | Ga0496103_0079495 | |||
| 1718 | Ga0496104_0000557 | |||
| 1719 | Ga0496104_0000803 | |||
| 1720 | Ga0496104_0015511 | |||
| 1721 | Ga0496104_0048420 | |||
| 1722 | Ga0496104_0050879 | |||
| 1723 | Ga0496104_0054188 | |||
| 1724 | Ga0496104_0073981 | |||
| 1725 | Ga0496104_0077240 | |||
| 1726 | Ga0496104_0078219 | |||
| 1727 | Ga0496104_0122633 | |||
| 1728 | Ga0496104_0170603 | |||
| 1729 | Ga0496105_0000609 | |||
| 1730 | Ga0496105_0001118 | |||
| 1731 | Ga0496105_0001193 | |||
| 1732 | Ga0496105_0015049 | |||
| 1733 | Ga0496105_0112543 | |||
| 1734 | Ga0496105_0139676 | |||
| 1735 | Ga0496106_0002624 | |||
| 1736 | Ga0496106_0003561 | |||
| 1737 | Ga0496106_0005352 | |||
| 1738 | Ga0496106_0005639 | |||
| 1739 | Ga0496106_0008920 | |||
| 1740 | Ga0496106_0032617 | |||
| 1741 | Ga0496106_0039546 | |||
| 1742 | Ga0496106_0089814 | |||
| 1743 | Ga0496106_0091210 | |||
| 1744 | Ga0496107_0000316 | |||
| 1745 | Ga0496107_0003225 | |||
| 1746 | Ga0496107_0009186 | |||
| 1747 | Ga0496107_0009483 | |||
| 1748 | Ga0496107_0012003 | |||
| 1749 | Ga0496107_0069792 | |||
| 1750 | Ga0496108_0002980 | |||
| 1751 | Ga0496108_0004461 | |||
| 1752 | Ga0496108_0005258 | |||
| 1753 | Ga0496108_0009378 | |||
| 1754 | Ga0496108_0014225 | |||
| 1755 | Ga0496108_0015755 | |||
| 1756 | Ga0496108_0041165 | |||
| 1757 | Ga0496108_0084990 | |||
| 1758 | Ga0496109_0000533 | |||
| 1759 | Ga0496109_0005342 | |||
| 1760 | Ga0496109_0013614 | |||
| 1761 | Ga0496109_0018687 | |||
| 1762 | Ga0496109_0020769 | |||
| 1763 | Ga0496109_0027342 | |||
| 1764 | Ga0496109_0070927 | |||
| 1765 | Ga0496109_0075342 | |||
| 1766 | Ga0496109_0077438 | |||
| 1767 | Ga0496109_0126829 | |||
| 1768 | Ga0496110_0000411 | |||
| 1769 | Ga0496110_0000564 | |||
| 1770 | Ga0496110_0002200 | |||
| 1771 | Ga0496110_0006619 | |||
| 1772 | Ga0496110_0010041 | |||
| 1773 | Ga0496110_0010182 | |||
| 1774 | Ga0496110_0018708 | |||
| 1775 | Ga0496110_0035022 | |||
| 1776 | Ga0496110_0053588 | |||
| 1777 | Ga0496110_0055947 | |||
| 1778 | Ga0496110_0206876 | |||
| 1779 | Ga0496111_0000084 | |||
| 1780 | Ga0496111_0002152 | |||
| 1781 | Ga0496111_0002910 | |||
| 1782 | Ga0496111_0005171 | |||
| 1783 | Ga0496111_0011785 | |||
| 1784 | Ga0496111_0017815 | |||
| 1785 | Ga0496111_0049655 | |||
| 1786 | Ga0496112_0005317 | |||
| 1787 | Ga0496112_0010136 | |||
| 1788 | Ga0496112_0042540 | |||
| 1789 | Ga0496112_0058123 | |||
| 1790 | Ga0496112_0094135 | |||
| 1791 | Ga0496112_0112007 | |||
| 1792 | Ga0496112_0112008 | |||
| 1793 | Ga0496112_0169739 | |||
| 1794 | Ga0496112_0307529 | |||
| 1795 | Ga0496113_0002984 | |||
| 1796 | Ga0496113_0006885 | |||
| 1797 | Ga0496113_0032874 | |||
| 1798 | Ga0496113_0047449 | |||
| 1799 | Ga0496113_0157758 | |||
| 1800 | Ga0496114_0000177 | |||
| 1801 | Ga0496114_0002173 | |||
| 1802 | Ga0496114_0004084 | |||
| 1803 | Ga0496114_0004101 | |||
| 1804 | Ga0496114_0012037 | |||
| 1805 | Ga0496114_0013794 | |||
| 1806 | Ga0496114_0036190 | |||
| 1807 | Ga0496114_0051653 | |||
| 1808 | Ga0496114_0072300 | |||
| 1809 | Ga0496114_0075135 | |||
| 1810 | Ga0496114_0077140 | |||
| 1811 | Ga0496114_0153561 | |||
| 1812 | Ga0496115_0000276 | |||
| 1813 | Ga0496115_0000825 | |||
| 1814 | Ga0496115_0008631 | |||
| 1815 | Ga0496115_0013740 | |||
| 1816 | Ga0496115_0028657 | |||
| 1817 | Ga0501031_0000033 | |||
| 1818 | Ga0501031_0001619 | |||
| 1819 | Ga0501031_0001976 | |||
| 1820 | Ga0501031_0007791 | |||
| 1821 | Ga0501031_0010773 | |||
| 1822 | Ga0501031_0071414 | |||
| 1823 | Ga0501031_0087831 | |||
| 1824 | Ga0501032_0006726 | |||
| 1825 | Ga0501032_0018372 | |||
| 1826 | Ga0501032_0045697 | |||
| 1827 | Ga0501033_0000388 | |||
| 1828 | Ga0501033_0004305 | |||
| 1829 | Ga0501033_0008760 | |||
| 1830 | Ga0501034_0005985 | |||
| 1831 | Ga0501034_0043882 | |||
| 1832 | Ga0501034_0176971 | |||
| 1833 | Ga0501036_0000462 | |||
| 1834 | Ga0501036_0006015 | |||
| 1835 | Ga0501036_0014753 | |||
| 1836 | Ga0501036_0021834 | |||
| 1837 | Ga0501036_0033191 | |||
| 1838 | Ga0501036_0150469 | |||
| 1839 | Ga0501037_0050998 | |||
| 1840 | Ga0501037_0141543 | |||
| 1841 | Ga0501038_0001345 | |||
| 1842 | Ga0501038_0003559 | |||
| 1843 | Ga0501038_0003931 | |||
| 1844 | Ga0501038_0051955 | |||
| 1845 | Ga0501038_0063654 | |||
| 1846 | Ga0501038_0065149 | |||
| 1847 | Ga0501039_0000528 | |||
| 1848 | Ga0501039_0004944 | |||
| 1849 | Ga0501039_0005475 | |||
| 1850 | Ga0501039_0019537 | |||
| 1851 | Ga0501039_0062956 | |||
| 1852 | Ga0501039_0069825 | |||
| 1853 | Ga0501039_0102448 | |||
| 1854 | Ga0501040_0000234 | |||
| 1855 | Ga0501040_0000862 | |||
| 1856 | Ga0501040_0001857 | |||
| 1857 | Ga0501040_0023262 | |||
| 1858 | Ga0501040_0026007 | |||
| 1859 | Ga0501040_0057479 | |||
| 1860 | Ga0501040_0081988 | |||
| 1861 | Ga0501041_0000176 | |||
| 1862 | Ga0501041_0000463 | |||
| 1863 | Ga0501041_0001181 | |||
| 1864 | Ga0501041_0010616 | |||
| 1865 | Ga0501041_0020227 | |||
| 1866 | Ga0501041_0038298 | |||
| 1867 | Ga0501042_0000717 | |||
| 1868 | Ga0501042_0001430 | |||
| 1869 | Ga0501042_0002112 | |||
| 1870 | Ga0501042_0004174 | |||
| 1871 | Ga0501042_0006865 | |||
| 1872 | Ga0501042_0034503 | |||
| 1873 | Ga0501042_0037226 | |||
| 1874 | Ga0501042_0107991 | |||
| 1875 | Ga0501043_0000798 | |||
| 1876 | Ga0501043_0004708 | |||
| 1877 | Ga0501043_0009672 | |||
| 1878 | Ga0501043_0030381 | |||
| 1879 | Ga0501043_0039536 | |||
| 1880 | Ga0501043_0099439 | |||
| 1881 | Ga0501043_0146066 | |||
| 1882 | Ga0501046_0000577 | |||
| 1883 | Ga0501046_0001998 | |||
| 1884 | Ga0501046_0010127 | |||
| 1885 | Ga0501046_0016777 | |||
| 1886 | Ga0501046_0025265 | |||
| 1887 | Ga0501046_0080128 | |||
| 1888 | Ga0501047_0001088 | |||
| 1889 | Ga0501047_0049901 | |||
| 1890 | Ga0501048_0000440 | |||
| 1891 | Ga0501048_0001055 | |||
| 1892 | Ga0501048_0001065 | |||
| 1893 | Ga0501048_0008231 | |||
| 1894 | Ga0501048_0027709 | |||
| 1895 | Ga0501067_0001736 | |||
| 1896 | Ga0501067_0003340 | |||
| 1897 | Ga0501067_0010687 | |||
| 1898 | Ga0501067_0013198 | |||
| 1899 | Ga0501067_0021136 | |||
| 1900 | Ga0501067_0022424 | |||
| 1901 | Ga0501067_0052719 | |||
| 1902 | Ga0501067_0064032 | |||
| 1903 | Ga0501068_0003123 | |||
| 1904 | Ga0501068_0003454 | |||
| 1905 | Ga0501068_0004344 | |||
| 1906 | Ga0501068_0006523 | |||
| 1907 | Ga0501068_0043889 | |||
| 1908 | Ga0501068_0051652 | |||
| 1909 | Ga0501069_0000870 | |||
| 1910 | Ga0501069_0004128 | |||
| 1911 | Ga0501069_0018444 | |||
| 1912 | Ga0501069_0080936 | |||
| 1913 | Ga0501070_0001222 | |||
| 1914 | Ga0501070_0002078 | |||
| 1915 | Ga0501070_0002312 | |||
| 1916 | Ga0501070_0005213 | |||
| 1917 | Ga0501070_0015415 | |||
| 1918 | Ga0501070_0017574 | |||
| 1919 | Ga0501070_0052438 | |||
| 1920 | Ga0501070_0054578 | |||
| 1921 | Ga0501070_0087253 | |||
| 1922 | Ga0501071_0000054 | |||
| 1923 | Ga0501071_0000117 | |||
| 1924 | Ga0501071_0003445 | |||
| 1925 | Ga0501071_0008444 | |||
| 1926 | Ga0501071_0009697 | |||
| 1927 | Ga0501071_0027431 | |||
| 1928 | Ga0501072_0001204 | |||
| 1929 | Ga0501072_0003186 | |||
| 1930 | Ga0501072_0024167 | |||
| 1931 | Ga0501072_0061672 | |||
| 1932 | Ga0501072_0068909 | |||
| 1933 | Ga0501072_0075382 | |||
| 1934 | Ga0501072_0110584 | |||
| 1935 | Ga0501073_0004823 | |||
| 1936 | Ga0501073_0007092 | |||
| 1937 | Ga0501073_0010771 | |||
| 1938 | Ga0501073_0023451 | |||
| 1939 | Ga0501074_0000008 | |||
| 1940 | Ga0501074_0002914 | |||
| 1941 | Ga0501074_0019307 | |||
| 1942 | Ga0501074_0019904 | |||
| 1943 | Ga0501074_0020522 | |||
| 1944 | Ga0501074_0023533 | |||
| 1945 | Ga0501074_0078352 | |||
| 1946 | Ga0501075_0000096 | |||
| 1947 | Ga0501075_0000800 | |||
| 1948 | Ga0501075_0011467 | |||
| 1949 | Ga0501075_0029522 | |||
| 1950 | Ga0501075_0029926 | |||
| 1951 | Ga0501075_0032826 | |||
| 1952 | Ga0501075_0073051 | |||
| 1953 | Ga0501076_0000020 | |||
| 1954 | Ga0501076_0000459 | |||
| 1955 | Ga0501076_0000951 | |||
| 1956 | Ga0501076_0037309 | |||
| 1957 | Ga0501076_0040264 | |||
| 1958 | Ga0501076_0043060 | |||
| 1959 | Ga0501076_0064067 | |||
| 1960 | Ga0501077_0000624 | |||
| 1961 | Ga0501077_0003516 | |||
| 1962 | Ga0501077_0016052 | |||
| 1963 | Ga0501077_0022187 | |||
| 1964 | Ga0501079_0000001 | |||
| 1965 | Ga0501079_0005831 | |||
| 1966 | Ga0501079_0008513 | |||
| 1967 | Ga0501079_0016128 | |||
| 1968 | Ga0501079_0036694 | |||
| 1969 | Ga0501079_0135057 | |||
| 1970 | Ga0501080_0002158 | |||
| 1971 | Ga0501080_0013819 | |||
| 1972 | Ga0501080_0018882 | |||
| 1973 | Ga0501080_0028840 | |||
| 1974 | Ga0501080_0034259 | |||
| 1975 | Ga0501080_0046933 | |||
| 1976 | Ga0501080_0055987 | |||
| 1977 | Ga0501080_0169167 | |||
| 1978 | Ga0501081_0001766 | |||
| 1979 | Ga0501081_0004360 | |||
| 1980 | Ga0501081_0026249 | |||
| 1981 | Ga0501081_0026767 | |||
| 1982 | Ga0501081_0027159 | |||
| 1983 | Ga0501081_0039825 | |||
| 1984 | Ga0501081_0102380 | |||
| 1985 | Ga0501083_0000739 | |||
| 1986 | Ga0501083_0002179 | |||
| 1987 | Ga0501083_0002761 | |||
| 1988 | Ga0501083_0003927 | |||
| 1989 | Ga0501083_0058501 | |||
| 1990 | Ga0501035_0028764 | |||
| 1991 | Ga0501035_0029303 | |||
| 1992 | Ga0501035_0112285 | |||
| 1993 | Ga0501044_0014620 | |||
| 1994 | Ga0501044_0063936 | |||
| 1995 | Ga0501045_0000708 | |||
| 1996 | Ga0501045_0000755 | |||
| 1997 | Ga0501045_0008054 | |||
| 1998 | Ga0501045_0026513 | |||
| 1999 | Ga0501045_0030710 | |||
| 2000 | Ga0501045_0043394 | |||
| 2001 | Ga0501045_0060316 | |||
| 2002 | nmdc:mga05p37_2214_c1 | |||
| 2003 | nmdc:mga05p37_299697_c1 | |||
| 2004 | nmdc:mga05p37_38898_c1 | |||
| 2005 | nmdc:mga05p37_47650_c1 | |||
| 2006 | nmdc:mga05p37_5442_c1 | |||
| 2007 | nmdc:mga09592_16354_c1 | |||
| 2008 | nmdc:mga09592_176511_c1 | |||
| 2009 | nmdc:mga09592_26880_c1 | |||
| 2010 | nmdc:mga06r32_266104_c1 | |||
| 2011 | nmdc:mga06r32_30187_c1 | |||
| 2012 | nmdc:mga06r32_33245_c1 | |||
| 2013 | nmdc:mga08y16_11668_c1 | |||
| 2014 | nmdc:mga08y16_16997_c1 | |||
| 2015 | nmdc:mga08y16_22993_c1 | |||
| 2016 | nmdc:mga08y16_28182_c1 | |||
| 2017 | nmdc:mga08y16_5500_c1 | |||
| 2018 | nmdc:mga0n895_128789_c1 | |||
| 2019 | nmdc:mga0n895_19412_c1 | |||
| 2020 | nmdc:mga0n895_76270_c1 | |||
| 2021 | nmdc:mga0rr50_32967_c1 | |||
| 2022 | nmdc:mga0rr50_72255_c1 | |||
| 2023 | nmdc:mga08x19_5201_c1 | |||
| 2024 | nmdc:mga08x19_93237_c1 | |||
| 2025 | nmdc:mga0a205_172373_c1 | |||
| 2026 | nmdc:mga0a205_20523_c1 | |||
| 2027 | nmdc:mga0a205_41630_c1 | |||
| 2028 | nmdc:mga0a205_46359_c1 | |||
| 2029 | nmdc:mga0a205_48698_c1 | |||
| 2030 | nmdc:mga0a205_6767_c1 | |||
| 2031 | Ga0495601_0001431 | |||
| 2032 | Ga0495601_0005282 | |||
| 2033 | Ga0495601_0048569 | |||
| 2034 | Ga0495601_0054569 | |||
| 2035 | Ga0495612_0004034 | |||
| 2036 | Ga0495655_0009798 | |||
| 2037 | Ga0495595_0006334 | |||
| 2038 | Ga0495595_0013553 | |||
| 2039 | Ga0495619_0002382 | |||
| 2040 | Ga0495619_0017531 | |||
| 2041 | Ga0495619_0018337 | |||
| 2042 | Ga0501084_0000283 | |||
| 2043 | Ga0501084_0008666 | |||
| 2044 | Ga0501084_0013886 | |||
| 2045 | Ga0501084_0050558 | |||
| 2046 | Ga0501084_0050733 | |||
| 2047 | Ga0501084_0137099 | |||
| 2048 | Ga0501084_0179551 | |||
| 2049 | Ga0590075_007928 | |||
| 2050 | Ga0501082_0000620 | |||
| 2051 | Ga0501082_0002904 | |||
| 2052 | Ga0501082_0017448 | |||
| 2053 | Ga0501082_0038647 | |||
| 2054 | Ga0501082_0068574 | |||
| 2055 | Ga0501082_0113879 | |||
| 2056 | Ga0466962_0001376 | |||
| 2057 | Ga0466962_0003375 | |||
| 2058 | Ga0466962_0004440 | |||
| 2059 | Ga0466962_0011665 | |||
| 2060 | Ga0466962_0014473 | |||
| 2061 | Ga0466962_0024540 | |||
| 2062 | Ga0530510_0001002 | |||
| 2063 | Ga0530510_0001060 | |||
| 2064 | Ga0530510_0001361 | |||
| 2065 | Ga0530510_0014530 | |||
| 2066 | Ga0530510_0036421 | |||
| 2067 | Ga0530510_0038731 | |||
| 2068 | Ga0530510_0039015 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rnm-assembly1.cif.gz_E | the crystal structure of the subunit binding of human dihydrolipoamide transacylase (e2b) bound to human dihydrolipoamide dehydrogenase (e3) | 0.9194 | 84 | 126 |
| 1w88-assembly1.cif.gz_I | the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 | 0.919 | 83 | 121 |
| 2ejg-assembly1.cif.gz_C | crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 | 0.9148 | 9 | 74 |
| 1w85-assembly1.cif.gz_I | the crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 | 0.9119 | 83 | 122 |
| 3rnm-assembly2.cif.gz_F | the crystal structure of the subunit binding of human dihydrolipoamide transacylase (e2b) bound to human dihydrolipoamide dehydrogenase (e3) | 0.9087 | 85 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPQ1_4_71_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9299 | 20 | 75 | 2.40.50.100 |
| 3rnmE00 | Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain | 0.9195 | 84 | 126 | 4.10.320.10 |
| 1w88J00 | Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain | 0.9151 | 83 | 122 | 4.10.320.10 |
| 3rnmF00 | Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain | 0.9087 | 85 | 126 | 4.10.320.10 |
| 1w3dA00 | Few Secondary Structures;Irregular;Dihydrolipoamide Transferase;E3-binding domain | 0.9073 | 81 | 122 | 4.10.320.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S3IEW3-F1-model_v4 | dihydrolipoyllysine-residue succinyltransferase (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) | 0.9308 | 156 | 357 |
GO:0004149
GO:0005739 GO:0006099 |
| AF-A0A5N5T3V9-F1-model_v4 | Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (E2K) | 0.9289 | 156 | 357 |
GO:0004149
GO:0005739 GO:0006099 GO:0045252 |
| AF-A0A7C8GWK0-F1-model_v4 | Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61) (2-oxoglutarate dehydrogenase complex component E2) (Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex) | 0.927 | 160 | 357 |
GO:0004149
GO:0005829 GO:0006099 |
| AF-A0A3C1FGT1-F1-model_v4 | 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | 0.9254 | 158 | 362 |
GO:0005737
GO:0016407 GO:0031405 |
| AF-A0A7C5WM39-F1-model_v4 | 2-oxoacid dehydrogenase acyltransferase catalytic domain-containing protein | 0.9227 | 158 | 358 |
GO:0005737
GO:0016407 GO:0031405 |