F488682

General Info

Members Datasets Scaffolds Average Seq Length
1034 542 2068 233

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0000587|Ga0495584_0000587_21055_21900
Length 281
Sequence MRRQRTWLTQTFDFACGLSHCAVSLTGINFANFTQRPLTVPLELFVSMKPIQLPLGVRLRDDATFINYYPGANAAALGYVERLCEADAGWTESLIYLWGKDGVGRTHLLQAACLRFEQLGEPAVYLPLAELLDRGIEILDNLEQYELVCLDDLQAVAGKADWEEALFHLFNRLRDSGRRLLIAASTSPRELPVKLADLKSRLTLALIFQMRPLSDEDKLRALQLRASRRGLHLTDEVGHFILTRGTRSMSALFELLERLDQASLQAQRKLTIPFLKETLGW

Samples

Sample ID Description Type Environment
1 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
45 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
68 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
106 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
107 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
116 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
117 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
118 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
125 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
133 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
134 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
140 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
141 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
142 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
143 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
148 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
149 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
150 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
151 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
152 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
153 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
154 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
155 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
156 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
157 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
158 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
159 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
160 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
161 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
162 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
165 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
169 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
170 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
171 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
172 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
178 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
181 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
204 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
240 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
241 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
264 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
273 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
274 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
275 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
279 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
280 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
281 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
282 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
283 2511231004 Pseudomonas sp. GM102 Isolate Nodule
284 2511231006 Pseudomonas sp. GM17 Isolate Nodule
285 2511231007 Pseudomonas sp. GM18 Isolate Nodule
286 2511231008 Pseudomonas sp. GM21 Isolate Nodule
287 2511231010 Pseudomonas sp. GM25 Isolate Nodule
288 2511231011 Pseudomonas sp. GM30 Isolate Nodule
289 2511231012 Pseudomonas sp. GM33 Isolate Nodule
290 2511231014 Pseudomonas sp. GM48 Isolate Nodule
291 2511231015 Pseudomonas sp. GM49 Isolate Nodule
292 2511231016 Pseudomonas sp. GM50 Isolate Nodule
293 2511231017 Pseudomonas sp. GM55 Isolate Nodule
294 2511231018 Pseudomonas sp. GM60 Isolate Nodule
295 2511231019 Pseudomonas sp. GM67 Isolate Nodule
296 2511231020 Pseudomonas sp. GM74 Isolate Nodule
297 2511231021 Pseudomonas sp. GM78 Isolate Nodule
298 2511231022 Pseudomonas sp. GM79 Isolate Nodule
299 2511231023 Pseudomonas sp. GM80 Isolate Nodule
300 2511231024 Pseudomonas sp. GM84 Isolate Nodule
301 2511231031 Pseudomonas sp. GM16 Isolate Nodule
302 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
303 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
304 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
305 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
306 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
307 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
308 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
309 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
310 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
311 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
312 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
313 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
314 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
315 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
316 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
317 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
318 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
319 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
320 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
321 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
322 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
323 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
324 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
325 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
326 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
327 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
328 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
329 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
330 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
331 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
332 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
333 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
334 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
335 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
336 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
337 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
338 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
339 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
340 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
341 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
342 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
343 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
344 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
345 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
346 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
347 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
348 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
349 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
350 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
351 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
352 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
353 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
354 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
355 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
356 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
357 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
358 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
359 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
360 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
361 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
362 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
363 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
364 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
365 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
366 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
367 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
368 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
369 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
370 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
371 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
372 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
373 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
374 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
375 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
376 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
377 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
378 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
379 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
380 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
381 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
382 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
383 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
384 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
385 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
386 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
387 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
388 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
389 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
390 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
391 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
392 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
393 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
394 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
395 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
396 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
397 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
398 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
399 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
400 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
401 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
402 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
403 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
404 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
405 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
406 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
407 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
408 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
409 2765235841 Pseudomonas putida AA7 Isolate Unclassified
410 2773857670 Pseudomonas sp. 478 Isolate Unclassified
411 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
412 2773857673 Pseudomonas sp. 443 Isolate Unclassified
413 2784132063 Pseudomonas sp. 424 Isolate Unclassified
414 2784132072 Pseudomonas sp. 460 Isolate Unclassified
415 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
416 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
417 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
418 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
419 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
420 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
421 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
422 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
423 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
424 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
425 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
426 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
427 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
428 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
429 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
430 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
431 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
432 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
433 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
434 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
435 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
436 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
437 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
438 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
439 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
440 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
441 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
442 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
443 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
444 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
445 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
446 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
447 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
448 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
449 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
450 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
451 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
452 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
453 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
454 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
455 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
456 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
457 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
458 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
459 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
460 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
461 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
462 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
463 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
464 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
465 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
466 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
467 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
468 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
469 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
470 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
471 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
472 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
473 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
474 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
475 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
476 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
477 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
478 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
479 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
480 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
481 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
482 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
483 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
484 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
485 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
486 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
487 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
488 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
489 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
490 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
491 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
492 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
493 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
494 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
495 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
496 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
497 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
498 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
499 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
500 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
501 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
502 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
503 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
504 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
505 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
506 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
507 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
508 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
509 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
510 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
511 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
512 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
513 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
514 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
515 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
516 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
517 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
518 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
519 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
520 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
521 8052494512 Pseudomonas putida LD6 Isolate Unclassified
522 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
523 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
524 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
525 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
526 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
527 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
528 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
529 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
530 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
531 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
532 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
533 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
534 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
535 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
536 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
537 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
538 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
539 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
540 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
541 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
542 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.47
Metatranscriptomes 0.1
Isolates 25.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 7.06
Nodule 2.8
Rhizoplane 7.54
Rhizosphere 69.15
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495584_0000587 3300046491 Bacteria 24562
2 MRS2a_Contig_22 2124908027 Bacteria 54424
3 MRS2a_Contig_9332 2124908027 Bacteria 3981
4 JGI25162J39368_1000401 3300002737 Bacteria 36292
5 JGI25162J39368_1000412 3300002737 Bacteria 34976
6 JGI25164J39214_1000282 3300002772 Bacteria 36292
7 JGI25164J39214_1000291 3300002772 Bacteria 34976
8 JGI25165J46597_1000520 3300003214 Bacteria 36292
9 JGI25165J46597_1000538 3300003214 Bacteria 34976
10 rootH1_10070704 3300003323 Bacteria 2031
11 rootH1_10317933 3300003323 Bacteria 1934
12 Ga0055538_1000027 3300003751 Bacteria 216576
13 Ga0055539_1000036 3300003752 Bacteria 216576
14 Ga0055533_1000046 3300003756 Bacteria 216576
15 Ga0055532_1000032 3300003758 Bacteria 216568
16 Ga0055525_1000672 3300003759 Bacteria 13111
17 Ga0055525_1003345 3300003759 Bacteria 1449
18 Ga0055535_1004737 3300003761 Bacteria 3200
19 Ga0055536_1000111 3300003781 Bacteria 71634
20 Ga0055536_1035132 3300003781 Bacteria 1257
21 Ga0055530_10000146 3300003791 Bacteria 63397
22 Ga0055530_10000299 3300003791 Bacteria 45066
23 Ga0055530_10000634 3300003791 Bacteria 30257
24 Ga0055540_1000289 3300003792 Bacteria 45066
25 Ga0055540_1000390 3300003792 Bacteria 36134
26 Ga0055540_1003473 3300003792 Bacteria 7607
27 Ga0055531_10000546 3300003794 Bacteria 33355
28 Ga0055531_10000989 3300003794 Bacteria 22593
29 Ga0055531_10025010 3300003794 Bacteria 2183
30 Ga0055541_1000024 3300003841 Bacteria 216576
31 Ga0065714_10000385 3300005288 Bacteria 5464
32 Ga0065714_10003231 3300005288 Bacteria 8635
33 Ga0065714_10005446 3300005288 Bacteria 7235
34 Ga0065714_10074902 3300005288 Bacteria 2975
35 Ga0065714_10082186 3300005288 Bacteria 2323
36 Ga0065714_10095966 3300005288 Bacteria 1772
37 Ga0065704_10014521 3300005289 Bacteria 2088
38 Ga0065704_10072317 3300005289 Bacteria 8746
39 Ga0065704_10132815 3300005289 Bacteria 1608
40 Ga0065712_10067771 3300005290 Bacteria 44643
41 Ga0065712_10073907 3300005290 Bacteria 4245
42 Ga0070676_10460007 3300005328 Bacteria 896
43 Ga0070670_100002076 3300005331 Bacteria 16406
44 Ga0070670_100151425 3300005331 Bacteria 2007
45 Ga0068868_100284927 3300005338 Bacteria 1399
46 Ga0070661_100000008 3300005344 Bacteria 183494
47 Ga0070669_100011983 3300005353 Bacteria 6153
48 Ga0070669_100016636 3300005353 Bacteria 5249
49 Ga0070669_100119695 3300005353 Bacteria 2007
50 Ga0070675_100399340 3300005354 Bacteria 1226
51 Ga0070671_100264932 3300005355 Bacteria 1461
52 Ga0070674_100016977 3300005356 Bacteria 4569
53 Ga0070674_100160566 3300005356 Bacteria 1705
54 Ga0070667_100125540 3300005367 Bacteria 2236
55 Ga0070662_100000966 3300005457 Bacteria 17611
56 Ga0068867_100067897 3300005459 Bacteria 2660
57 Ga0068853_100092045 3300005539 Bacteria 2667
58 Ga0070672_100046923 3300005543 Bacteria 3349
59 Ga0070672_100079711 3300005543 Bacteria 2622
60 Ga0070665_100067353 3300005548 Bacteria 3590
61 Ga0070665_100155909 3300005548 Bacteria 2285
62 Ga0070664_100000075 3300005564 Bacteria 62615
63 Ga0070664_100404603 3300005564 Bacteria 1248
64 Ga0068854_100035560 3300005578 Bacteria 3487
65 Ga0068864_100353634 3300005618 Bacteria 1387
66 Ga0068851_10000090 3300005834 Bacteria 50197
67 Ga0075364_10069825 3300006051 Bacteria 2312
68 Ga0075364_10081757 3300006051 Bacteria 2136
69 Ga0075364_10140765 3300006051 Bacteria 1623
70 Ga0075364_10159829 3300006051 Bacteria 1521
71 Ga0075432_10010964 3300006058 Bacteria 3079
72 Ga0075432_10034024 3300006058 Bacteria 1769
73 Ga0075432_10073634 3300006058 Bacteria 1230
74 Ga0075432_10118770 3300006058 Bacteria 991
75 Ga0075432_10153822 3300006058 Bacteria 885
76 Ga0075362_10155142 3300006177 Bacteria 1100
77 Ga0075362_10185689 3300006177 Bacteria 1008
78 Ga0075369_10011644 3300006186 Bacteria 3462
79 Ga0075369_10052992 3300006186 Bacteria 1759
80 Ga0075436_100582101 3300006914 Bacteria 823
81 Ga0099823_1000246 3300006944 Bacteria 31501
82 Ga0099823_1036538 3300006944 Bacteria 3765
83 Ga0079104_1000433 3300006946 Bacteria 47726
84 Ga0079104_1000766 3300006946 Bacteria 27538
85 Ga0099826_10023740 3300006948 Bacteria 4565
86 Ga0105251_10000035 3300009011 Bacteria 117861
87 Ga0105251_10000092 3300009011 Bacteria 86905
88 Ga0105251_10002567 3300009011 Bacteria 14090
89 Ga0105251_10002666 3300009011 Bacteria 13754
90 Ga0105251_10014207 3300009011 Bacteria 4416
91 Ga0105251_10021031 3300009011 Bacteria 3415
92 Ga0105251_10022506 3300009011 Bacteria 3271
93 Ga0105251_10062640 3300009011 Bacteria 1746
94 Ga0105244_10001613 3300009036 Bacteria 17879
95 Ga0105244_10001867 3300009036 Bacteria 16371
96 Ga0105244_10007007 3300009036 Bacteria 7214
97 Ga0105244_10013839 3300009036 Bacteria 4691
98 Ga0105244_10034710 3300009036 Bacteria 2653
99 Ga0105244_10040447 3300009036 Bacteria 2420
100 Ga0105244_10083576 3300009036 Bacteria 1578
101 Ga0105244_10118600 3300009036 Bacteria 1282
102 Ga0105244_10157423 3300009036 Bacteria 1086
103 Ga0105250_10000261 3300009092 Bacteria 43192
104 Ga0105250_10000495 3300009092 Bacteria 27711
105 Ga0105250_10014884 3300009092 Bacteria 3190
106 Ga0105250_10027737 3300009092 Bacteria 2282
107 Ga0105250_10122912 3300009092 Bacteria 1068
108 Ga0105243_10000582 3300009148 Bacteria 36687
109 Ga0105243_10004457 3300009148 Bacteria 11067
110 Ga0105243_10045999 3300009148 Bacteria 3431
111 Ga0105243_10062778 3300009148 Bacteria 2975
112 Ga0105243_10656453 3300009148 Bacteria 1017
113 Ga0105242_10002684 3300009176 Bacteria 13916
114 Ga0105242_10471402 3300009176 Bacteria 1188
115 Ga0105237_10000856 3300009545 Bacteria 41326
116 Ga0105249_10035526 3300009553 Bacteria 4520
117 Ga0105246_10001063 3300011119 Bacteria 15870
118 Ga0105246_10001690 3300011119 Bacteria 13160
119 Ga0105246_10010360 3300011119 Bacteria 5766
120 Ga0105246_10023990 3300011119 Bacteria 3955
121 Ga0105246_10061949 3300011119 Bacteria 2604
122 Ga0105246_10535276 3300011119 Bacteria 1001
123 Ga0157373_10002237 3300013100 Bacteria 14656
124 Ga0157373_10008169 3300013100 Bacteria 7783
125 Ga0157373_10021495 3300013100 Bacteria 4686
126 Ga0157373_10094782 3300013100 Bacteria 2101
127 Ga0157371_10000301 3300013102 Bacteria 65021
128 Ga0157371_10000923 3300013102 Bacteria 32990
129 Ga0157371_10001330 3300013102 Bacteria 25968
130 Ga0157371_10015893 3300013102 Bacteria 5630
131 Ga0157371_10056663 3300013102 Bacteria 2780
132 Ga0157371_10097294 3300013102 Bacteria 2086
133 Ga0157371_10335232 3300013102 Bacteria 1099
134 Ga0157370_10013075 3300013104 Bacteria 8568
135 Ga0157370_10053960 3300013104 Bacteria 3832
136 Ga0157370_10056165 3300013104 Bacteria 3747
137 Ga0157370_10067552 3300013104 Bacteria 3379
138 Ga0157370_10216011 3300013104 Bacteria 1777
139 Ga0157370_10718564 3300013104 Bacteria 911
140 Ga0157369_10003346 3300013105 Bacteria 19046
141 Ga0157369_10732493 3300013105 Bacteria 1018
142 Ga0163162_10001480 3300013306 Bacteria 21867
143 Ga0163162_10107166 3300013306 Bacteria 2889
144 Ga0163162_10107641 3300013306 Bacteria 2883
145 Ga0157372_10001752 3300013307 Bacteria 23529
146 Ga0157372_10046108 3300013307 Bacteria 4838
147 Ga0157375_10046234 3300013308 Bacteria 4242
148 Ga0157375_10380650 3300013308 Bacteria 1578
149 Ga0182008_10005941 3300014497 Bacteria 6885
150 Ga0182008_10010767 3300014497 Bacteria 4887
151 Ga0182008_10014706 3300014497 Bacteria 4093
152 Ga0182008_10017069 3300014497 Bacteria 3767
153 Ga0182008_10022922 3300014497 Bacteria 3195
154 Ga0182006_1000844 3300015261 Bacteria 20589
155 Ga0182006_1006672 3300015261 Bacteria 5344
156 Ga0182006_1007773 3300015261 Bacteria 4889
157 Ga0182006_1018323 3300015261 Bacteria 2960
158 Ga0182006_1029395 3300015261 Bacteria 2227
159 Ga0182006_1031524 3300015261 Bacteria 2135
160 Ga0182006_1050415 3300015261 Bacteria 1603
161 Ga0182007_10003640 3300015262 Bacteria 7221
162 Ga0182005_1000309 3300015265 Bacteria 29451
163 Ga0182005_1026069 3300015265 Bacteria 1595
164 Ga0163161_10115517 3300017792 Bacteria 2012
165 Ga0163161_10220558 3300017792 Bacteria 1468
166 Ga0209435_101639 3300025206 Bacteria 2748
167 Ga0209760_100028 3300025207 Bacteria 153020
168 Ga0209760_100163 3300025207 Bacteria 39216
169 Ga0209784_100017 3300025224 Bacteria 472003
170 Ga0209566_100014 3300025225 Bacteria 472003
171 Ga0209674_100028 3300025226 Bacteria 472003
172 Ga0209147_100038 3300025229 Bacteria 314497
173 Ga0209563_100032 3300025230 Bacteria 472003
174 Ga0209563_101192 3300025230 Bacteria 7278
175 Ga0207427_100007 3300025231 Bacteria 746220
176 Ga0207427_100008 3300025231 Bacteria 740731
177 Ga0209437_100006 3300025233 Bacteria 1042724
178 Ga0209437_100014 3300025233 Bacteria 740714
179 Ga0209437_107564 3300025233 Bacteria 1762
180 Ga0209258_100197 3300025242 Bacteria 124028
181 Ga0207425_1024826 3300025245 Bacteria 1241
182 Ga0209646_1000171 3300025246 Bacteria 84951
183 Ga0209677_100018 3300025253 Bacteria 472003
184 Ga0209759_1005069 3300025256 Bacteria 4717
185 Ga0209233_1000008 3300025261 Bacteria 1356712
186 Ga0209233_1000086 3300025261 Bacteria 331687
187 Ga0209675_1012545 3300025291 Bacteria 2719
188 Ga0209676_1000006 3300025292 Bacteria 1039588
189 Ga0209676_1000016 3300025292 Bacteria 655561
190 Ga0209676_1000033 3300025292 Bacteria 463236
191 Ga0209676_1000973 3300025292 Bacteria 34485
192 Ga0209676_1002053 3300025292 Bacteria 15749
193 Ga0209676_1008338 3300025292 Bacteria 4637
194 Ga0209050_1000070 3300025298 Bacteria 296366
195 Ga0209050_1000399 3300025298 Bacteria 81236
196 Ga0209050_1000477 3300025298 Bacteria 70798
197 Ga0209051_1000043 3300025303 Bacteria 305473
198 Ga0209051_1000086 3300025303 Bacteria 183550
199 Ga0209051_1000106 3300025303 Bacteria 159222
200 Ga0209051_1005825 3300025303 Bacteria 7092
201 Ga0209257_1000604 3300025304 Bacteria 59301
202 Ga0209257_1000623 3300025304 Bacteria 57092
203 Ga0207656_10000066 3300025321 Bacteria 39833
204 Ga0207696_1000025 3300025711 Bacteria 418650
205 Ga0207696_1000034 3300025711 Bacteria 350426
206 Ga0207696_1000043 3300025711 Bacteria 307112
207 Ga0207696_1000144 3300025711 Bacteria 122345
208 Ga0207696_1001836 3300025711 Bacteria 10916
209 Ga0207696_1005655 3300025711 Bacteria 5152
210 Ga0207655_1000095 3300025728 Bacteria 195899
211 Ga0207655_1000113 3300025728 Bacteria 167376
212 Ga0207655_1000448 3300025728 Bacteria 54335
213 Ga0207655_1000501 3300025728 Bacteria 50226
214 Ga0207655_1000610 3300025728 Bacteria 43238
215 Ga0207655_1001799 3300025728 Bacteria 18594
216 Ga0207655_1005111 3300025728 Bacteria 9044
217 Ga0207655_1005591 3300025728 Bacteria 8509
218 Ga0207655_1008966 3300025728 Bacteria 6273
219 Ga0207655_1026020 3300025728 Bacteria 2821
220 Ga0207655_1068839 3300025728 Bacteria 1326
221 Ga0207655_1074944 3300025728 Bacteria 1243
222 Ga0207655_1081629 3300025728 Bacteria 1165
223 Ga0207713_1000014 3300025735 Bacteria 432450
224 Ga0207713_1000074 3300025735 Bacteria 181376
225 Ga0207713_1000471 3300025735 Bacteria 41932
226 Ga0207713_1000618 3300025735 Bacteria 34875
227 Ga0207713_1000900 3300025735 Bacteria 26916
228 Ga0207713_1003229 3300025735 Bacteria 11252
229 Ga0207713_1003963 3300025735 Bacteria 9819
230 Ga0207713_1008642 3300025735 Bacteria 5831
231 Ga0207713_1011158 3300025735 Bacteria 4912
232 Ga0207713_1014993 3300025735 Bacteria 3996
233 Ga0207713_1016408 3300025735 Bacteria 3758
234 Ga0207713_1017297 3300025735 Bacteria 3624
235 Ga0207713_1017979 3300025735 Bacteria 3517
236 Ga0207713_1019013 3300025735 Bacteria 3379
237 Ga0207671_10000035 3300025914 Bacteria 237603
238 Ga0207649_10000017 3300025920 Bacteria 225193
239 Ga0207681_10000601 3300025923 Bacteria 24426
240 Ga0207681_10007857 3300025923 Bacteria 6529
241 Ga0207681_10048593 3300025923 Bacteria 2864
242 Ga0207650_10000212 3300025925 Bacteria 66326
243 Ga0207650_10006176 3300025925 Bacteria 8166
244 Ga0207650_10116440 3300025925 Bacteria 2075
245 Ga0207659_10164787 3300025926 Bacteria 1744
246 Ga0207706_10000796 3300025933 Bacteria 32646
247 Ga0207686_10011981 3300025934 Bacteria 4760
248 Ga0207709_10000053 3300025935 Bacteria 225514
249 Ga0207709_10011611 3300025935 Bacteria 4856
250 Ga0207709_10066666 3300025935 Bacteria 2269
251 Ga0207691_10009671 3300025940 Bacteria 9248
252 Ga0207679_10000005 3300025945 Bacteria 525011
253 Ga0207712_10128195 3300025961 Bacteria 1929
254 Ga0207639_10086856 3300026041 Bacteria 2492
255 Ga0207648_10090819 3300026089 Bacteria 2669
256 Ga0207676_10588862 3300026095 Bacteria 1067
257 Ga0209281_1000010 3300027111 Bacteria 726106
258 Ga0209281_1000331 3300027111 Bacteria 81645
259 Ga0209281_1010855 3300027111 Bacteria 2061
260 Ga0209389_1000031 3300027296 Bacteria 138036
261 Ga0209371_1001358 3300027312 Bacteria 16941
262 Ga0209371_1005354 3300027312 Bacteria 5135
263 Ga0209371_1009851 3300027312 Bacteria 3000
264 Ga0209984_1000700 3300027424 Bacteria 3571
265 Ga0209999_1008843 3300027543 Bacteria 1822
266 Ga0209999_1025509 3300027543 Bacteria 1092
267 Ga0209983_1002353 3300027665 Bacteria 4148
268 Ga0209971_1000648 3300027682 Bacteria 9081
269 Ga0209974_10020136 3300027876 Bacteria 2212
270 Ga0209974_10033019 3300027876 Bacteria 1716
271 Ga0207428_10049694 3300027907 Bacteria 3359
272 Ga0207428_10065873 3300027907 Bacteria 2856
273 Ga0207428_10579528 3300027907 Bacteria 810
274 Ga0268266_10139563 3300028379 Bacteria 2174
275 Ga0268266_10143672 3300028379 Bacteria 2143
276 Ga0268256_1001168 3300030500 Bacteria 16941
277 Ga0268256_1005256 3300030500 Bacteria 5135
278 Ga0314311_1178492 3300030733 Bacteria 4187
279 Ga0316178_1127053 3300030735 Bacteria 33158
280 Ga0316181_1093196 3300030744 Bacteria 1892
281 Ga0265328_10132599 3300031239 Unclassified 933
282 Ga0265327_10000712 3300031251 Bacteria 52529
283 Ga0265327_10001471 3300031251 Bacteria 29522
284 Ga0265327_10284167 3300031251 Unclassified 731
285 Ga0265316_10000461 3300031344 Bacteria 46248
286 Ga0265316_10458131 3300031344 Bacteria 914
287 Ga0307408_100000042 3300031548 Bacteria 172505
288 Ga0307408_100001335 3300031548 Bacteria 18502
289 Ga0307408_100031564 3300031548 Bacteria 3690
290 Ga0307408_100534977 3300031548 Bacteria 1031
291 Ga0307408_100786731 3300031548 Bacteria 862
292 Ga0316576_10009311 3300031727 Bacteria 6332
293 Ga0316576_10084591 3300031727 Bacteria 2357
294 Ga0316576_10218804 3300031727 Bacteria 1433
295 Ga0316578_10021793 3300031728 Unclassified 3561
296 Ga0316578_10055792 3300031728 Bacteria 2319
297 Ga0316578_10120483 3300031728 Bacteria 1577
298 Ga0316577_10039458 3300031733 Bacteria 2641
299 Ga0316577_10296749 3300031733 Bacteria 915
300 Ga0307413_10018772 3300031824 Bacteria 3636
301 Ga0307413_10137062 3300031824 Bacteria 1685
302 Ga0307406_10024656 3300031901 Bacteria 3594
303 Ga0307412_10026682 3300031911 Bacteria 3593
304 Ga0307412_10026786 3300031911 Bacteria 3587
305 Ga0307412_10149055 3300031911 Bacteria 1723
306 Ga0307412_10412625 3300031911 Bacteria 1102
307 Ga0307409_100117900 3300031995 Bacteria 2241
308 Ga0307414_10018889 3300032004 Bacteria 4258
309 Ga0307414_10396483 3300032004 Bacteria 1197
310 Ga0307411_10031489 3300032005 Bacteria 3264
311 Ga0307411_10061793 3300032005 Bacteria 2495
312 Ga0307411_10123255 3300032005 Bacteria 1879
313 Ga0316585_10012662 3300032137 Bacteria 2502
314 Ga0316580_10018135 3300032139 Bacteria 2166
315 Ga0316593_10088147 3300032168 Unclassified 1090
316 Ga0307510_10025016 3300033180 Bacteria 6893
317 Ga0316574_0001096 3300035398 Bacteria 12390
318 Ga0316574_0011291 3300035398 Bacteria 5073
319 Ga0316574_0017186 3300035398 Bacteria 4228
320 Ga0316574_0195055 3300035398 Unclassified 1302
321 Ga0316582_0010077 3300036647 Bacteria 5162
322 Ga0316582_0043354 3300036647 Bacteria 2822
323 Ga0316582_0048330 3300036647 Bacteria 2690
324 Ga0316582_0119519 3300036647 Unclassified 1762
325 Ga0316582_0146556 3300036647 Bacteria 1594
326 Ga0316582_0286983 3300036647 Bacteria 1130
327 Ga0316582_0428045 3300036647 Unclassified 912
328 Ga0316584_0011224 3300036712 Bacteria 6290
329 Ga0316584_0018008 3300036712 Bacteria 5090
330 Ga0316584_0049469 3300036712 Bacteria 3142
331 Ga0316584_0460790 3300036712 Bacteria 898
332 Ga0237819_02422 3300038705 Bacteria 3773
333 Ga0439436_0000465 3300041404 Bacteria 10411
334 Ga0439438_000136 3300041405 Bacteria 33194
335 Ga0439438_002815 3300041405 Bacteria 7267
336 Ga0439438_005069 3300041405 Bacteria 4911
337 Ga0439438_010637 3300041405 Bacteria 2898
338 Ga0439438_013860 3300041405 Bacteria 2415
339 Ga0439447_001185 3300041407 Bacteria 9504
340 Ga0439447_002289 3300041407 Bacteria 7019
341 Ga0439447_002435 3300041407 Bacteria 6789
342 Ga0439447_018238 3300041407 Bacteria 1896
343 Ga0439466_0000828 3300041411 Bacteria 11773
344 Ga0439466_0001731 3300041411 Bacteria 8525
345 Ga0439466_0005326 3300041411 Bacteria 4919
346 Ga0439466_0005858 3300041411 Bacteria 4680
347 Ga0439466_0007222 3300041411 Bacteria 4204
348 Ga0439466_0007532 3300041411 Bacteria 4116
349 Ga0439466_0023166 3300041411 Bacteria 2186
350 Ga0451807_0563555 3300041486 Bacteria 1183
351 Ga0439437_001430 3300042000 Bacteria 2515
352 Ga0439432_000121 3300042006 Bacteria 25700
353 Ga0439432_004055 3300042006 Bacteria 5370
354 Ga0439432_005544 3300042006 Bacteria 4539
355 Ga0439432_008146 3300042006 Bacteria 3688
356 Ga0439432_030688 3300042006 Bacteria 1742
357 Ga0439432_077276 3300042006 Bacteria 1010
358 Ga0439451_008221 3300042009 Bacteria 2118
359 Ga0439451_018163 3300042009 Bacteria 1418
360 Ga0439452_000244 3300042010 Bacteria 37543
361 Ga0439452_001133 3300042010 Bacteria 11647
362 Ga0439452_002100 3300042010 Bacteria 7549
363 Ga0439452_006702 3300042010 Bacteria 3586
364 Ga0439452_008746 3300042010 Bacteria 3025
365 Ga0439452_011698 3300042010 Bacteria 2513
366 Ga0439452_014917 3300042010 Bacteria 2145
367 Ga0439456_000089 3300042013 Bacteria 31822
368 Ga0439456_005136 3300042013 Bacteria 2657
369 Ga0439456_005403 3300042013 Bacteria 2591
370 Ga0439456_008178 3300042013 Bacteria 2159
371 Ga0439456_019789 3300042013 Bacteria 1417
372 Ga0439463_000778 3300042016 Bacteria 8807
373 Ga0439463_005465 3300042016 Bacteria 3155
374 Ga0450911_000017 3300042115 Bacteria 104823
375 Ga0450911_000237 3300042115 Bacteria 20957
376 Ga0450919_005421 3300042121 Bacteria 1533
377 Ga0450920_022524 3300042122 Bacteria 1220
378 Ga0450922_003536 3300042124 Bacteria 1438
379 Ga0450923_000184 3300042125 Bacteria 5914
380 Ga0450900_000340 3300042136 Bacteria 3454
381 Ga0450902_000757 3300042137 Bacteria 4155
382 Ga0450902_002353 3300042137 Bacteria 2676
383 Ga0450902_014286 3300042137 Bacteria 1284
384 Ga0450904_000260 3300042139 Bacteria 11390
385 Ga0450904_002736 3300042139 Bacteria 2022
386 Ga0450905_005405 3300042142 Bacteria 1715
387 Ga0450905_028655 3300042142 Bacteria 850
388 Ga0450905_029684 3300042142 Bacteria 839
389 Ga0450906_002445 3300042145 Bacteria 4059
390 Ga0450907_000076 3300042146 Bacteria 37520
391 Ga0450907_001352 3300042146 Bacteria 5406
392 Ga0450907_010405 3300042146 Bacteria 1544
393 Ga0450910_000679 3300042147 Bacteria 4078
394 Ga0439446_0000604 3300042156 Bacteria 7379
395 Ga0439446_0003340 3300042156 Bacteria 3970
396 Ga0439446_0004459 3300042156 Bacteria 3549
397 Ga0439446_0015788 3300042156 Bacteria 2097
398 Ga0439446_0023590 3300042156 Bacteria 1751
399 Ga0450908_000501 3300042184 Bacteria 7537
400 Ga0450909_000096 3300042185 Bacteria 8526
401 Ga0450909_007833 3300042185 Bacteria 1548
402 Ga0439434_0000804 3300042435 Bacteria 9058
403 Ga0439434_0014404 3300042435 Bacteria 2352
404 Ga0439434_0016910 3300042435 Bacteria 2180
405 Ga0439459_0022850 3300042438 Bacteria 1213
406 Ga0439464_0003363 3300042439 Bacteria 4028
407 Ga0439464_0004738 3300042439 Bacteria 3484
408 Ga0439464_0009195 3300042439 Bacteria 2599
409 Ga0439460_0003586 3300042461 Bacteria 3752
410 Ga0439460_0007704 3300042461 Bacteria 2700
411 Ga0450916_000440 3300042530 Bacteria 3566
412 Ga0450918_011503 3300042531 Bacteria 1542
413 Ga0450901_000007 3300042533 Bacteria 23102
414 Ga0451577_0000105 3300042876 Bacteria 184360
415 Ga0451577_0009916 3300042876 Bacteria 9131
416 Ga0451577_0253980 3300042876 Bacteria 1591
417 Ga0451577_0275370 3300042876 Bacteria 1524
418 Ga0439440_0000185 3300042993 Bacteria 9512
419 Ga0453684_0003537 3300044712 Bacteria 34947
420 Ga0453684_0055976 3300044712 Bacteria 5121
421 Ga0453684_0195291 3300044712 Bacteria 2364
422 Ga0451576_0000217 3300045051 Bacteria 142222
423 Ga0495617_000141 3300046452 Bacteria 47430
424 Ga0495617_029541 3300046452 Bacteria 1843
425 Ga0495617_036883 3300046452 Bacteria 1638
426 Ga0495617_041150 3300046452 Bacteria 1545
427 Ga0495627_000130 3300046453 Bacteria 91090
428 Ga0495627_000888 3300046453 Bacteria 20978
429 Ga0495627_003846 3300046453 Bacteria 6444
430 Ga0495627_004631 3300046453 Bacteria 5703
431 Ga0495627_007148 3300046453 Bacteria 4313
432 Ga0495627_008463 3300046453 Bacteria 3855
433 Ga0495603_0013079 3300046455 Bacteria 5017
434 Ga0495603_0104211 3300046455 Bacteria 1655
435 Ga0495590_0003790 3300046457 Bacteria 6157
436 Ga0495590_0102102 3300046457 Bacteria 1019
437 Ga0495591_000119 3300046458 Bacteria 87324
438 Ga0495591_001004 3300046458 Bacteria 19076
439 Ga0495591_001781 3300046458 Bacteria 12749
440 Ga0495591_002890 3300046458 Bacteria 9214
441 Ga0495591_003252 3300046458 Bacteria 8535
442 Ga0495591_004111 3300046458 Bacteria 7238
443 Ga0495591_007995 3300046458 Bacteria 4396
444 Ga0495629_0073034 3300046459 Bacteria 2395
445 Ga0495638_0014555 3300046460 Bacteria 5311
446 Ga0495638_0022681 3300046460 Bacteria 4118
447 Ga0495638_0033967 3300046460 Bacteria 3258
448 Ga0495638_0113968 3300046460 Bacteria 1603
449 Ga0495653_0009457 3300046463 Bacteria 7975
450 Ga0495653_0016863 3300046463 Bacteria 5944
451 Ga0495653_0020041 3300046463 Bacteria 5419
452 Ga0495650_0003122 3300046471 Bacteria 12416
453 Ga0495650_0005077 3300046471 Bacteria 8710
454 Ga0495650_0016467 3300046471 Bacteria 3743
455 Ga0495582_0002605 3300046473 Bacteria 10035
456 Ga0495605_0000125 3300046474 Bacteria 101414
457 Ga0495605_0000149 3300046474 Bacteria 90748
458 Ga0495605_0000429 3300046474 Bacteria 38029
459 Ga0495605_0000503 3300046474 Bacteria 33522
460 Ga0495605_0001674 3300046474 Bacteria 14250
461 Ga0495605_0004647 3300046474 Bacteria 8028
462 Ga0495605_0009525 3300046474 Bacteria 5454
463 Ga0495605_0018078 3300046474 Bacteria 3785
464 Ga0495639_0000065 3300046475 Bacteria 48194
465 Ga0495639_0003249 3300046475 Bacteria 7058
466 Ga0495584_0003676 3300046491 Bacteria 8351
467 Ga0495584_0004945 3300046491 Bacteria 7106
468 Ga0495584_0020919 3300046491 Bacteria 3321
469 Ga0495584_0030366 3300046491 Bacteria 2737
470 Ga0495584_0055031 3300046491 Bacteria 2002
471 Ga0495585_0001301 3300046492 Bacteria 19906
472 Ga0495585_0001381 3300046492 Bacteria 19179
473 Ga0495585_0310296 3300046492 Bacteria 773
474 Ga0495594_0003413 3300046499 Bacteria 8204
475 Ga0495596_0000636 3300046500 Bacteria 22084
476 Ga0495607_0000312 3300046501 Bacteria 50602
477 Ga0495607_0000379 3300046501 Bacteria 45776
478 Ga0495607_0000455 3300046501 Bacteria 40967
479 Ga0495607_0000464 3300046501 Bacteria 40712
480 Ga0495607_0004399 3300046501 Bacteria 10382
481 Ga0495607_0006401 3300046501 Bacteria 8293
482 Ga0495607_0007164 3300046501 Bacteria 7750
483 Ga0495607_0008736 3300046501 Bacteria 6903
484 Ga0495607_0011380 3300046501 Bacteria 5925
485 Ga0495607_0026447 3300046501 Bacteria 3601
486 Ga0495607_0064900 3300046501 Bacteria 2060
487 Ga0495607_0087953 3300046501 Bacteria 1689
488 Ga0495607_0099717 3300046501 Bacteria 1557
489 Ga0495607_0278997 3300046501 Bacteria 793
490 Ga0495583_0000196 3300046506 Bacteria 101268
491 Ga0495583_0001527 3300046506 Bacteria 22952
492 Ga0495583_0004118 3300046506 Bacteria 10657
493 Ga0495583_0007950 3300046506 Bacteria 6567
494 Ga0495583_0009084 3300046506 Bacteria 5979
495 Ga0495606_0000712 3300046507 Bacteria 51489
496 Ga0495606_0001438 3300046507 Bacteria 31937
497 Ga0495606_0009506 3300046507 Bacteria 8212
498 Ga0495606_0016921 3300046507 Bacteria 5535
499 Ga0495606_0022904 3300046507 Bacteria 4538
500 Ga0495606_0029764 3300046507 Bacteria 3826
501 Ga0495610_0007081 3300046512 Bacteria 7567
502 Ga0495610_0027192 3300046512 Bacteria 3044
503 Ga0495610_0031604 3300046512 Bacteria 2760
504 Ga0495610_0077190 3300046512 Bacteria 1539
505 Ga0495610_0150084 3300046512 Bacteria 995
506 Ga0495616_0019099 3300046513 Bacteria 3745
507 Ga0495616_0028518 3300046513 Bacteria 2955
508 Ga0495616_0038987 3300046513 Bacteria 2436
509 Ga0495620_0000003 3300046515 Bacteria 345923
510 Ga0495620_0000055 3300046515 Bacteria 99544
511 Ga0495620_0000584 3300046515 Bacteria 22805
512 Ga0495620_0001229 3300046515 Bacteria 15659
513 Ga0495620_0004454 3300046515 Bacteria 7894
514 Ga0495620_0010025 3300046515 Bacteria 5011
515 Ga0495630_0027786 3300046517 Bacteria 4201
516 Ga0495630_0131962 3300046517 Bacteria 1897
517 Ga0495631_0002696 3300046518 Bacteria 9861
518 Ga0495631_0006268 3300046518 Bacteria 6158
519 Ga0495632_0000186 3300046519 Bacteria 63352
520 Ga0495632_0000432 3300046519 Bacteria 39892
521 Ga0495632_0000608 3300046519 Bacteria 33143
522 Ga0495632_0003902 3300046519 Bacteria 10361
523 Ga0495632_0005207 3300046519 Bacteria 8669
524 Ga0495632_0006116 3300046519 Bacteria 7803
525 Ga0495632_0006199 3300046519 Bacteria 7741
526 Ga0495632_0008775 3300046519 Bacteria 6159
527 Ga0495632_0014616 3300046519 Bacteria 4434
528 Ga0495632_0019199 3300046519 Bacteria 3730
529 Ga0495632_0063758 3300046519 Bacteria 1783
530 Ga0495637_0000162 3300046520 Bacteria 50983
531 Ga0495637_0000231 3300046520 Bacteria 43247
532 Ga0495637_0002146 3300046520 Bacteria 11045
533 Ga0495637_0003708 3300046520 Bacteria 8071
534 Ga0495637_0005206 3300046520 Bacteria 6661
535 Ga0495637_0005703 3300046520 Bacteria 6314
536 Ga0495637_0007586 3300046520 Bacteria 5367
537 Ga0495637_0008547 3300046520 Bacteria 5026
538 Ga0495637_0013132 3300046520 Bacteria 3938
539 Ga0495637_0014081 3300046520 Bacteria 3780
540 Ga0495637_0060989 3300046520 Bacteria 1547
541 Ga0495643_0000319 3300046522 Bacteria 66471
542 Ga0495643_0001060 3300046522 Bacteria 27491
543 Ga0495643_0008410 3300046522 Bacteria 6536
544 Ga0495643_0037205 3300046522 Bacteria 2671
545 Ga0495643_0047794 3300046522 Bacteria 2315
546 Ga0495643_0201330 3300046522 Bacteria 955
547 Ga0495644_0003627 3300046523 Bacteria 6081
548 Ga0495644_0024090 3300046523 Bacteria 2315
549 Ga0495648_0000676 3300046524 Bacteria 36436
550 Ga0495648_0000755 3300046524 Bacteria 34528
551 Ga0495648_0001144 3300046524 Bacteria 26818
552 Ga0495648_0003719 3300046524 Bacteria 13326
553 Ga0495648_0006841 3300046524 Bacteria 9207
554 Ga0495648_0007126 3300046524 Bacteria 8995
555 Ga0495648_0039231 3300046524 Bacteria 3015
556 Ga0495648_0134382 3300046524 Bacteria 1310
557 Ga0495666_0003285 3300046526 Bacteria 8162
558 Ga0495642_0000172 3300046528 Bacteria 37956
559 Ga0495642_0000431 3300046528 Bacteria 22121
560 Ga0495654_0001418 3300046530 Bacteria 16564
561 Ga0495654_0002234 3300046530 Bacteria 12546
562 Ga0495654_0003745 3300046530 Bacteria 9206
563 Ga0495654_0005234 3300046530 Bacteria 7567
564 Ga0495654_0006557 3300046530 Bacteria 6595
565 Ga0495654_0018618 3300046530 Bacteria 3636
566 Ga0495654_0027116 3300046530 Bacteria 2939
567 Ga0495654_0039060 3300046530 Bacteria 2371
568 Ga0495654_0143301 3300046530 Bacteria 1063
569 Ga0495586_0148424 3300046535 Bacteria 1318
570 Ga0495587_0001431 3300046536 Bacteria 15880
571 Ga0495587_0010525 3300046536 Bacteria 5882
572 Ga0495598_0002453 3300046537 Bacteria 3836
573 Ga0495609_0000087 3300046538 Bacteria 110204
574 Ga0495609_0000174 3300046538 Bacteria 65959
575 Ga0495609_0000213 3300046538 Bacteria 57790
576 Ga0495609_0001854 3300046538 Bacteria 13504
577 Ga0495609_0032377 3300046538 Bacteria 2374
578 Ga0495609_0051850 3300046538 Bacteria 1826
579 Ga0495609_0089699 3300046538 Bacteria 1337
580 Ga0495597_0000097 3300046542 Bacteria 78347
581 Ga0495597_0008719 3300046542 Bacteria 5065
582 Ga0495597_0011290 3300046542 Bacteria 4335
583 Ga0495597_0023634 3300046542 Bacteria 2842
584 Ga0495597_0166931 3300046542 Bacteria 895
585 Ga0495622_0000688 3300046557 Bacteria 19228
586 Ga0495622_0002891 3300046557 Bacteria 8192
587 Ga0495622_0186812 3300046557 Bacteria 927
588 Ga0495633_0000134 3300046558 Bacteria 98658
589 Ga0495633_0007571 3300046558 Bacteria 6230
590 Ga0495656_0006258 3300046615 Bacteria 4167
591 Ga0495668_0017196 3300046616 Bacteria 4199
592 Ga0495668_0246155 3300046616 Bacteria 979
593 Ga0495634_0027922 3300046642 Bacteria 3922
594 Ga0495611_0002038 3300046648 Bacteria 9538
595 Ga0495611_0003476 3300046648 Bacteria 6941
596 Ga0495625_0000145 3300046660 Bacteria 108480
597 Ga0495625_0022895 3300046660 Bacteria 4780
598 Ga0495635_0003568 3300046663 Bacteria 10769
599 Ga0495635_0005207 3300046663 Bacteria 9048
600 Ga0495659_0003223 3300046664 Bacteria 5227
601 Ga0495659_0024669 3300046664 Bacteria 2052
602 Ga0495661_0000150 3300046665 Bacteria 81419
603 Ga0495661_0000193 3300046665 Bacteria 70300
604 Ga0495661_0000306 3300046665 Bacteria 55899
605 Ga0495661_0000332 3300046665 Bacteria 51357
606 Ga0495661_0000644 3300046665 Bacteria 35320
607 Ga0495661_0007217 3300046665 Bacteria 7747
608 Ga0495588_0005283 3300046674 Bacteria 5742
609 Ga0495646_0004182 3300046680 Bacteria 9070
610 Ga0495646_0007936 3300046680 Bacteria 6743
611 Ga0495669_0001041 3300046684 Bacteria 11559
612 Ga0495613_0073554 3300046689 Bacteria 2490
613 Ga0495624_0001547 3300046690 Bacteria 17769
614 Ga0495670_0014020 3300046691 Bacteria 3943
615 Ga0495670_0031504 3300046691 Bacteria 2635
616 Ga0495670_0048498 3300046691 Bacteria 2124
617 Ga0495671_0000813 3300046692 Bacteria 22300
618 Ga0495671_0002178 3300046692 Bacteria 12484
619 Ga0495671_0010354 3300046692 Bacteria 5170
620 Ga0495671_0011743 3300046692 Bacteria 4802
621 Ga0495671_0020192 3300046692 Bacteria 3512
622 Ga0495671_0036459 3300046692 Bacteria 2490
623 Ga0495671_0052705 3300046692 Bacteria 2021
624 Ga0495649_0000362 3300046694 Bacteria 39295
625 Ga0495649_0001373 3300046694 Bacteria 18445
626 Ga0495649_0003896 3300046694 Bacteria 9870
627 Ga0495649_0029860 3300046694 Bacteria 3012
628 Ga0495649_0049052 3300046694 Bacteria 2293
629 Ga0495589_0000228 3300046794 Bacteria 47419
630 Ga0495589_0004887 3300046794 Bacteria 7111
631 Ga0495589_0013783 3300046794 Bacteria 4169
632 Ga0495660_0004242 3300046810 Bacteria 8701
633 Ga0495660_0005442 3300046810 Bacteria 7621
634 Ga0495660_0005476 3300046810 Bacteria 7604
635 Ga0495660_0034816 3300046810 Bacteria 2816
636 Ga0495660_0035397 3300046810 Bacteria 2789
637 Ga0495660_0072027 3300046810 Bacteria 1831
638 Ga0495660_0073341 3300046810 Bacteria 1810
639 Ga0495604_0020674 3300047317 Bacteria 5255
640 Ga0495672_0000961 3300047320 Bacteria 29956
641 Ga0495672_0014074 3300047320 Bacteria 5493
642 Ga0495672_0019259 3300047320 Bacteria 4506
643 Ga0495672_0023652 3300047320 Bacteria 3972
644 Ga0495672_0032335 3300047320 Bacteria 3256
645 Ga0495672_0046547 3300047320 Bacteria 2586
646 Ga0495672_0233142 3300047320 Bacteria 902
647 Ga0495676_0000119 3300047321 Bacteria 60424
648 Ga0495676_0016179 3300047321 Bacteria 6625
649 Ga0495680_0022050 3300047322 Bacteria 5319
650 Ga0495680_0048725 3300047322 Bacteria 3325
651 Ga0495683_0000059 3300047323 Bacteria 116530
652 Ga0495683_0000095 3300047323 Bacteria 89824
653 Ga0495683_0002437 3300047323 Bacteria 11249
654 Ga0495683_0042946 3300047323 Bacteria 2277
655 Ga0495687_003858 3300047443 Bacteria 10544
656 Ga0495687_007887 3300047443 Bacteria 6190
657 Ga0495687_009404 3300047443 Bacteria 5466
658 Ga0495677_0001027 3300047445 Bacteria 11222
659 Ga0495679_000267 3300047446 Bacteria 43569
660 Ga0495679_000554 3300047446 Bacteria 26315
661 Ga0495685_030284 3300047447 Bacteria 1861
662 Ga0495673_0001692 3300047469 Bacteria 16928
663 Ga0495673_0002018 3300047469 Bacteria 14927
664 Ga0495673_0002336 3300047469 Bacteria 13493
665 Ga0495673_0005312 3300047469 Bacteria 7815
666 Ga0495673_0006440 3300047469 Bacteria 6900
667 Ga0495673_0007434 3300047469 Bacteria 6299
668 Ga0495673_0008495 3300047469 Bacteria 5769
669 Ga0495673_0026708 3300047469 Bacteria 2756
670 Ga0495673_0102262 3300047469 Bacteria 1156
671 Ga0495681_0000690 3300047470 Bacteria 25744
672 Ga0495681_0001877 3300047470 Bacteria 15443
673 Ga0495681_0006727 3300047470 Bacteria 7499
674 Ga0495681_0026634 3300047470 Bacteria 3005
675 Ga0495681_0148645 3300047470 Bacteria 984
676 Ga0495686_0123668 3300047472 Bacteria 1539
677 Ga0495626_0000259 3300048091 Bacteria 60592
678 Ga0495626_0000625 3300048091 Bacteria 34456
679 Ga0495626_0003715 3300048091 Bacteria 9641
680 Ga0495626_0004053 3300048091 Bacteria 9130
681 Ga0495626_0008942 3300048091 Bacteria 5435
682 Ga0495626_0010349 3300048091 Bacteria 4981
683 Ga0496102_0009345 3300048905 Bacteria 8423
684 Ga0496103_0002700 3300048906 Bacteria 11067
685 Ga0496110_0022963 3300048913 Bacteria 5302
686 Ga0496112_0453820 3300048915 Bacteria 1219
687 Ga0496114_0004116 3300048917 Bacteria 11251
688 Ga0496114_0007099 3300048917 Bacteria 8836
689 Ga0496115_0014315 3300048918 Bacteria 6005
690 Ga0496115_0035754 3300048918 Bacteria 3932
691 Ga0496116_0000792 3300048919 Bacteria 40176
692 Ga0496116_0009449 3300048919 Bacteria 8306
693 Ga0496116_0037374 3300048919 Bacteria 3387
694 Ga0496116_0045813 3300048919 Bacteria 2957
695 Ga0496117_0001008 3300048920 Bacteria 43122
696 Ga0496117_0002238 3300048920 Bacteria 24976
697 Ga0496117_0002244 3300048920 Bacteria 24928
698 Ga0496117_0002790 3300048920 Bacteria 21334
699 Ga0496117_0008345 3300048920 Bacteria 9848
700 Ga0496117_0106787 3300048920 Bacteria 1756
701 Ga0496117_0153824 3300048920 Bacteria 1357
702 Ga0496118_0003309 3300048921 Bacteria 20446
703 Ga0496118_0010322 3300048921 Bacteria 9261
704 Ga0496118_0035214 3300048921 Bacteria 4070
705 Ga0496118_0035375 3300048921 Bacteria 4056
706 Ga0496118_0109414 3300048921 Bacteria 1839
707 Ga0496118_0180193 3300048921 Bacteria 1277
708 Ga0496119_0000380 3300048922 Bacteria 61208
709 Ga0496120_0002903 3300048923 Bacteria 16379
710 Ga0496121_0000858 3300048924 Bacteria 55007
711 Ga0496121_0001360 3300048924 Bacteria 41696
712 Ga0496121_0002590 3300048924 Bacteria 27310
713 Ga0496121_0044902 3300048924 Bacteria 3804
714 Ga0496121_0066311 3300048924 Bacteria 2932
715 Ga0496121_0136226 3300048924 Bacteria 1829
716 Ga0496122_0001237 3300048925 Bacteria 43156
717 Ga0496122_0002322 3300048925 Bacteria 27452
718 Ga0496122_0004088 3300048925 Bacteria 18485
719 Ga0496122_0036831 3300048925 Bacteria 3948
720 Ga0496122_0042793 3300048925 Bacteria 3557
721 Ga0496123_0000550 3300048926 Bacteria 64267
722 Ga0496123_0006040 3300048926 Bacteria 11894
723 Ga0496123_0008088 3300048926 Bacteria 9726
724 Ga0496123_0035674 3300048926 Bacteria 3540
725 Ga0496123_0054043 3300048926 Bacteria 2648
726 Ga0496123_0142438 3300048926 Bacteria 1308
727 Ga0496124_0000355 3300048927 Bacteria 83748
728 Ga0496124_0001100 3300048927 Bacteria 42478
729 Ga0496124_0002102 3300048927 Bacteria 26896
730 Ga0496124_0007094 3300048927 Bacteria 12006
731 Ga0496124_0010243 3300048927 Bacteria 9520
732 Ga0496124_0010329 3300048927 Bacteria 9471
733 Ga0496124_0030407 3300048927 Bacteria 4794
734 Ga0496124_0092665 3300048927 Bacteria 2461
735 Ga0496124_0174691 3300048927 Bacteria 1659
736 Ga0496124_0334014 3300048927 Bacteria 1079
737 Ga0496125_0002991 3300048928 Bacteria 21184
738 Ga0496125_0037792 3300048928 Bacteria 4192
739 Ga0496125_0049985 3300048928 Bacteria 3467
740 Ga0496126_0029684 3300048929 Bacteria 5191
741 Ga0496126_0128833 3300048929 Bacteria 2188
742 Ga0495678_000108 3300049459 Bacteria 99839
743 Ga0495678_003989 3300049459 Bacteria 8819
744 Ga0495678_005172 3300049459 Bacteria 7306
745 Ga0495678_019211 3300049459 Bacteria 3053
746 Ga0495678_027046 3300049459 Bacteria 2438
747 Ga0495682_0000170 3300049460 Bacteria 55005
748 Ga0495682_0000234 3300049460 Bacteria 43711
749 Ga0495682_0002853 3300049460 Bacteria 7955
750 Ga0495682_0005115 3300049460 Bacteria 5491
751 Ga0495682_0019452 3300049460 Bacteria 2553
752 Ga0495682_0109646 3300049460 Bacteria 989
753 Ga0495682_0126512 3300049460 Bacteria 914
754 Ga0501032_0102910 3300049569 Bacteria 1892
755 Ga0501032_0416826 3300049569 Bacteria 862
756 Ga0501034_0000150 3300049571 Bacteria 131760
757 Ga0501034_0911783 3300049571 Bacteria 766
758 Ga0501037_0097933 3300049573 Bacteria 2119
759 Ga0501039_0106675 3300049575 Bacteria 2188
760 Ga0501070_0036722 3300049586 Bacteria 4092
761 Ga0501072_0465159 3300049588 Bacteria 1001
762 Ga0501080_0473695 3300049742 Bacteria 1121
763 Ga0501241_008863 3300049758 Bacteria 1833
764 Ga0501275_000036 3300049772 Bacteria 13943
765 Ga0501226_000028 3300049853 Bacteria 88553
766 nmdc:mga03683_127151_c1 3300050489 Bacteria 1138
767 nmdc:mga00v17_45138_c1 3300050491 Bacteria 2661
768 nmdc:mga00v17_70159_c1 3300050491 Bacteria 2170
769 nmdc:mga0sz30_7332_c1 3300050516 Bacteria 4130
770 Ga0500618_001241 3300053125 Bacteria 11932
771 Ga0500573_0125367 3300053140 Bacteria 1426
772 2510283551 2510065053 Bacteria 5005518
773 2510292621 2510065055 Bacteria 5037935
774 2510311713 2510065058 Bacteria 5005894
775 2511254626 2511231004 Bacteria 6669789
776 2511266576 2511231006 Bacteria 6794709
777 2511270707 2511231007 Bacteria 6306603
778 2511277288 2511231008 Bacteria 6624100
779 2511287314 2511231010 Bacteria 6373152
780 2511294727 2511231011 Bacteria 6149768
781 2511303398 2511231012 Bacteria 6738011
782 2511312798 2511231014 Bacteria 6462302
783 2511320269 2511231015 Bacteria 6598026
784 2511328767 2511231016 Bacteria 6704427
785 2511331717 2511231017 Bacteria 6503007
786 2511340701 2511231018 Bacteria 6436256
787 2511343871 2511231019 Bacteria 6520662
788 2511350216 2511231020 Bacteria 6115223
789 2511358543 2511231021 Bacteria 7302637
790 2511362853 2511231022 Bacteria 6719296
791 2511369823 2511231023 Bacteria 6808468
792 2511374185 2511231024 Bacteria 5835885
793 2511416239 2511231031 Bacteria 6558529
794 2512328473 2512047018 Bacteria 6663241
795 2554816809 2554235132 Bacteria 6772433
796 2555249255 2554235231 Bacteria 5215788
797 2555671454 2554235341 Bacteria 6867980
798 2583793916 2582580891 Bacteria 6800976
799 2597859538 2597489887 Bacteria 6666321
800 2597865185 2597489888 Bacteria 6179543
801 2597871048 2597489889 Bacteria 6297495
802 2599326979 2599185155 Bacteria 5827168
803 2599354389 2599185160 Bacteria 6844013
804 2599359897 2599185161 Bacteria 6960462
805 2599366219 2599185162 Bacteria 6957254
806 2599373009 2599185163 Bacteria 6995158
807 2599379497 2599185164 Bacteria 6841688
808 2599385525 2599185165 Bacteria 6843250
809 2599391868 2599185166 Bacteria 6959206
810 2599400316 2599185167 Bacteria 6353609
811 2599403634 2599185168 Bacteria 6997636
812 2599451353 2599185179 Bacteria 6611171
813 2599461223 2599185181 Bacteria 6844519
814 2599469765 2599185182 Bacteria 6883168
815 2599482368 2599185185 Bacteria 6652270
816 2599490243 2599185186 Bacteria 6831633
817 2599503361 2599185188 Bacteria 6164180
818 2599508667 2599185189 Bacteria 5862825
819 2599512527 2599185190 Bacteria 6285678
820 2599519876 2599185191 Bacteria 6297582
821 2599614988 2599185212 Bacteria 6765997
822 2599771160 2599185248 Bacteria 6696816
823 2599803912 2599185257 Bacteria 6492581
824 2599878527 2599185288 Bacteria 6666191
825 2599886309 2599185289 Bacteria 6778765
826 2599891203 2599185290 Bacteria 6289611
827 2599898023 2599185291 Bacteria 6775623
828 2599934756 2599185300 Bacteria 6062622
829 2599943915 2599185302 Bacteria 5954930
830 2599947730 2599185303 Bacteria 6512725
831 2599955871 2599185304 Bacteria 5951361
832 2599960336 2599185305 Bacteria 6748700
833 2599967896 2599185306 Bacteria 6637356
834 2599972861 2599185307 Bacteria 6194719
835 2599979102 2599185308 Bacteria 6621546
836 2599986588 2599185309 Bacteria 5969593
837 2599989597 2599185310 Bacteria 6014457
838 2599997629 2599185311 Bacteria 6354990
839 2600000056 2599185312 Bacteria 5912071
840 2600005009 2599185313 Bacteria 6658188
841 2600013061 2599185314 Bacteria 6621749
842 2600017837 2599185315 Bacteria 6771107
843 2600024728 2599185316 Bacteria 6320029
844 2600030562 2599185317 Bacteria 6435722
845 2600038175 2599185318 Bacteria 6961590
846 2600044489 2599185319 Bacteria 6637840
847 2600048312 2599185320 Bacteria 5963263
848 2600055399 2599185321 Bacteria 6764560
849 2600061517 2599185322 Bacteria 6763055
850 2600066191 2599185323 Bacteria 6688755
851 2600070080 2599185324 Bacteria 6590677
852 2600077971 2599185325 Bacteria 6324919
853 2600213838 2599185356 Bacteria 6843884
854 2600360006 2600254930 Bacteria 6431253
855 2600364442 2600254931 Bacteria 6734225
856 2600446444 2600254954 Bacteria 5100516
857 2601625505 2600255283 Bacteria 6061572
858 2601689558 2600255296 Bacteria 5784754
859 2601774006 2600255313 Bacteria 6842543
860 2601795547 2600255318 Bacteria 6383414
861 2602010493 2600255389 Bacteria 5275336
862 2606075617 2603880185 Bacteria 6379190
863 2606128472 2603880199 Bacteria 6377649
864 2608379893 2606217733 Bacteria 6360972
865 2621298257 2619619299 Bacteria 6649820
866 2624479484 2623620443 Bacteria 6427864
867 2624493520 2623620446 Bacteria 6500345
868 2643841709 2643221565 Bacteria 6216018
869 2643869302 2643221571 Bacteria 6228673
870 2643952617 2643221589 Bacteria 6250934
871 2644022379 2643221602 Bacteria 6249926
872 2644188585 2643221633 Bacteria 6733554
873 2644281879 2643221650 Bacteria 7029547
874 2644622018 2643221713 Bacteria 6554480
875 2652544079 2651869719 Bacteria 6047974
876 2671090117 2667528170 Bacteria 6786960
877 2671096970 2667528171 Bacteria 6900659
878 2671125243 2667528176 Bacteria 6724917
879 2671770519 2671180172 Bacteria 6495783
880 2677899968 2675903420 Bacteria 6247433
881 2678264747 2675903515 Bacteria 6580491
882 2715753877 2713897148 Bacteria 5883533
883 2715757751 2713897149 Bacteria 6506249
884 2718633332 2718217725 Bacteria 5758958
885 2723249938 2721755607 Bacteria 5841722
886 2729146926 2728369097 Bacteria 4333476
887 2738671358 2738541265 Bacteria 6594665
888 2738689151 2738541271 Bacteria 5657310
889 2738749752 2738541282 Bacteria 6593925
890 2738808388 2738541294 Bacteria 6925949
891 2738858792 2738541303 Bacteria 6591772
892 2738895748 2738541309 Bacteria 6926455
893 2739201281 2738543004 Bacteria 6381073
894 2739261155 2738543015 Bacteria 6750701
895 2739264538 2738543016 Bacteria 5657564
896 2739286348 2738543020 Bacteria 5718238
897 2739291661 2738543021 Bacteria 5718241
898 2739316714 2738543025 Bacteria 6600348
899 2743739069 2740892503 Bacteria 6855563
900 2745005201 2744054620 Bacteria 6551379
901 2765585520 2765235841 Bacteria 6137024
902 2774121295 2773857670 Bacteria 6407454
903 2774128677 2773857672 Bacteria 4993178
904 2774137641 2773857673 Bacteria 6513460
905 2784265606 2784132063 Bacteria 6262788
906 2784317411 2784132072 Bacteria 6596533
907 2794594982 2791355520 Bacteria 5948615
908 2807407091 2806310737 Bacteria 5751088
909 2807455422 2806310745 Bacteria 5742165
910 2808858406 2808606361 Bacteria 6136259
911 2808907135 2808606373 Bacteria 4423627
912 2808926264 2808606376 Bacteria 6248667
913 2808927413 2808606377 Bacteria 6646337
914 2808938539 2808606378 Bacteria 6177535
915 2808940797 2808606379 Bacteria 5022697
916 2808948363 2808606380 Bacteria 6248705
917 2808950048 2808606381 Bacteria 6646461
918 2808961547 2808606382 Bacteria 6841132
919 2808966891 2808606383 Bacteria 6138645
920 2808977894 2808606385 Bacteria 6711065
921 2808993374 2808606388 Bacteria 6706662
922 2809001721 2808606389 Bacteria 6138126
923 2809216419 2808606445 Bacteria 6057339
924 2812371105 2811994881 Bacteria 6298475
925 2817492598 2816332298 Bacteria 6852809
926 2819654748 2818991456 Bacteria 6123676
927 2819702063 2818991464 Bacteria 6907494
928 2823423035 2823421272 Bacteria 5372474
929 2825656364 2825651385 Bacteria 6715909
930 2826585967 2826581358 Bacteria 5963467
931 2834031810 2834028612 Bacteria 6354979
932 2842805479 2842805378 Bacteria 5385175
933 2842818998 2842815866 Bacteria 5947510
934 2842827589 2842826826 Bacteria 5974129
935 2842832645 2842832357 Bacteria 5959113
936 2842841303 2842837860 Bacteria 6066181
937 2842848269 2842843487 Bacteria 6004777
938 2842853845 2842849001 Bacteria 5924277
939 2842856751 2842854478 Bacteria 6143501
940 2844671977 2844665904 Bacteria 6817974
941 2852613034 2852612431 Bacteria 6885235
942 2852658967 2852657418 Bacteria 6472974
943 2852669231 2852667396 Bacteria 6885555
944 2860339972 2860339153 Bacteria 6846989
945 2860871688 2860867994 Bacteria 5645326
946 2878031487 2878029506 Bacteria 6418441
947 2880232357 2880230671 Bacteria 6140320
948 2894417246 2894414249 Bacteria 4405451
949 2894515149 2894510363 Bacteria 5121143
950 2904521752 2904518522 Bacteria 6068986
951 2904553150 2904550169 Bacteria 6221258
952 2908451097 2908446538 Bacteria 6829095
953 2912967760 2912963787 Bacteria 5646108
954 2913041356 2913036834 Bacteria 6704877
955 2917075322 2917070673 Bacteria 6868303
956 2917837286 2917832318 Bacteria 5346010
957 2919064042 2919063839 Bacteria 6302690
958 2919126713 2919125081 Bacteria 5385106
959 2919158738 2919155634 Bacteria 4860545
960 2919386451 2919385768 Bacteria 5897293
961 2919457066 2919456309 Bacteria 6586567
962 2919484277 2919481497 Bacteria 6907839
963 2919491267 2919487758 Bacteria 5929766
964 2919505573 2919501602 Bacteria 5286340
965 2919702822 2919697872 Bacteria 6553725
966 2923158150 2923153595 Bacteria 6870622
967 2923525213 2923519811 Bacteria 6298479
968 2923590215 2923586266 Bacteria 6565975
969 2926067250 2926063275 Bacteria 5285848
970 2929148681 2929144301 Bacteria 6622272
971 2929193727 2929189879 Bacteria 5930554
972 2931373887 2931369376 Bacteria 6847892
973 2931395050 2931390751 Bacteria 6273349
974 2931400136 2931396565 Bacteria 7251677
975 2935356309 2935353572 Unclassified 6955622
976 2939639693 2939636861 Bacteria 6297853
977 2939655786 2939651529 Bacteria 5895393
978 2945932253 2945928738 Bacteria 6053221
979 2945961875 2945961074 Bacteria 7342064
980 2946008446 2946006987 Bacteria 6705746
981 2946032193 2946027586 Bacteria 6049274
982 2947239027 2947233263 Bacteria 6439278
983 2969306270 2969304461 Bacteria 6601805
984 2974299194 2974298342 Bacteria 4840922
985 2984288027 2984286254 Bacteria 6702062
986 2984501513 2984499530 Bacteria 5020881
987 2984505088 2984504281 Bacteria 5262371
988 2988730264 2988728565 Bacteria 6124362
989 2990199962 2990196909 Bacteria 4054280
990 2998141665 2998139840 Bacteria 6073514
991 3007256340 3007252601 Bacteria 4559114
992 3007319444 3007315729 Bacteria 5076637
993 3007397451 3007395558 Bacteria 6755444
994 3007424617 3007419365 Bacteria 7026924
995 3007513060 3007511990 Bacteria 6481491
996 3007615879 3007614139 Bacteria 6053559
997 3007621914 3007619802 Bacteria 6411688
998 3007722466 3007718800 Bacteria 5971527
999 3007803795 3007803356 Bacteria 5931491
1000 3007856255 3007855910 Bacteria 5637581
1001 3007863096 3007861166 Bacteria 6045338
1002 3007870604 3007866637 Bacteria 5899198
1003 3007874118 3007872151 Bacteria 5268868
1004 637321774 637000220 Bacteria 7074893
1005 8001523344 8001522603 Bacteria 4726425
1006 8011356408 8011350971 Bacteria 6158957
1007 8015692246 8015687852 Bacteria 6613826
1008 8016733056 8016728285 Bacteria 5263933
1009 8019772969 8019769354 Bacteria 6924660
1010 8019780297 8019775933 Bacteria 6858656
1011 8029999091 8029995093 Bacteria 5990776
1012 8034964036 8034962539 Bacteria 4884839
1013 8052495849 8052494512 Bacteria 5765634
1014 8054285782 8054285046 Bacteria 6919322
1015 8054350689 8054347763 Bacteria 5901107
1016 8054507559 8054503363 Bacteria 6101651
1017 8054929919 8054929484 Bacteria 5599761
1018 8055775456 8055770955 Bacteria 6827675
1019 8055822501 8055817908 Bacteria 6609162
1020 8055881306 8055878733 Bacteria 5907058
1021 8056117602 8056115690 Bacteria 5527654
1022 8056122135 8056120720 Bacteria 5758328
1023 8056130138 8056125926 Bacteria 6228218
1024 8056135954 8056131705 Bacteria 6107031
1025 8056138756 8056137416 Bacteria 6147080
1026 8056144708 8056143049 Bacteria 6307666
1027 8056153284 8056148874 Bacteria 6479865
1028 8056156183 8056155041 Bacteria 6486948
1029 8056162168 8056161164 Bacteria 6106669
1030 8056169326 8056166840 Bacteria 5820959
1031 8056175512 8056172158 Bacteria 6133900
1032 8056181191 8056177738 Bacteria 6748268
1033 8056573179 8056569372 Bacteria 5997322
1034 8057804271 8057798959 Bacteria 6713499
1035 Ga0495584_0000587
1036 MRS2a_Contig_22
1037 MRS2a_Contig_9332
1038 JGI25162J39368_1000401
1039 JGI25162J39368_1000412
1040 JGI25164J39214_1000282
1041 JGI25164J39214_1000291
1042 JGI25165J46597_1000520
1043 JGI25165J46597_1000538
1044 rootH1_10070704
1045 rootH1_10317933
1046 Ga0055538_1000027
1047 Ga0055539_1000036
1048 Ga0055533_1000046
1049 Ga0055532_1000032
1050 Ga0055525_1000672
1051 Ga0055525_1003345
1052 Ga0055535_1004737
1053 Ga0055536_1000111
1054 Ga0055536_1035132
1055 Ga0055530_10000146
1056 Ga0055530_10000299
1057 Ga0055530_10000634
1058 Ga0055540_1000289
1059 Ga0055540_1000390
1060 Ga0055540_1003473
1061 Ga0055531_10000546
1062 Ga0055531_10000989
1063 Ga0055531_10025010
1064 Ga0055541_1000024
1065 Ga0065714_10000385
1066 Ga0065714_10003231
1067 Ga0065714_10005446
1068 Ga0065714_10074902
1069 Ga0065714_10082186
1070 Ga0065714_10095966
1071 Ga0065704_10014521
1072 Ga0065704_10072317
1073 Ga0065704_10132815
1074 Ga0065712_10067771
1075 Ga0065712_10073907
1076 Ga0070676_10460007
1077 Ga0070670_100002076
1078 Ga0070670_100151425
1079 Ga0068868_100284927
1080 Ga0070661_100000008
1081 Ga0070669_100011983
1082 Ga0070669_100016636
1083 Ga0070669_100119695
1084 Ga0070675_100399340
1085 Ga0070671_100264932
1086 Ga0070674_100016977
1087 Ga0070674_100160566
1088 Ga0070667_100125540
1089 Ga0070662_100000966
1090 Ga0068867_100067897
1091 Ga0068853_100092045
1092 Ga0070672_100046923
1093 Ga0070672_100079711
1094 Ga0070665_100067353
1095 Ga0070665_100155909
1096 Ga0070664_100000075
1097 Ga0070664_100404603
1098 Ga0068854_100035560
1099 Ga0068864_100353634
1100 Ga0068851_10000090
1101 Ga0075364_10069825
1102 Ga0075364_10081757
1103 Ga0075364_10140765
1104 Ga0075364_10159829
1105 Ga0075432_10010964
1106 Ga0075432_10034024
1107 Ga0075432_10073634
1108 Ga0075432_10118770
1109 Ga0075432_10153822
1110 Ga0075362_10155142
1111 Ga0075362_10185689
1112 Ga0075369_10011644
1113 Ga0075369_10052992
1114 Ga0075436_100582101
1115 Ga0099823_1000246
1116 Ga0099823_1036538
1117 Ga0079104_1000433
1118 Ga0079104_1000766
1119 Ga0099826_10023740
1120 Ga0105251_10000035
1121 Ga0105251_10000092
1122 Ga0105251_10002567
1123 Ga0105251_10002666
1124 Ga0105251_10014207
1125 Ga0105251_10021031
1126 Ga0105251_10022506
1127 Ga0105251_10062640
1128 Ga0105244_10001613
1129 Ga0105244_10001867
1130 Ga0105244_10007007
1131 Ga0105244_10013839
1132 Ga0105244_10034710
1133 Ga0105244_10040447
1134 Ga0105244_10083576
1135 Ga0105244_10118600
1136 Ga0105244_10157423
1137 Ga0105250_10000261
1138 Ga0105250_10000495
1139 Ga0105250_10014884
1140 Ga0105250_10027737
1141 Ga0105250_10122912
1142 Ga0105243_10000582
1143 Ga0105243_10004457
1144 Ga0105243_10045999
1145 Ga0105243_10062778
1146 Ga0105243_10656453
1147 Ga0105242_10002684
1148 Ga0105242_10471402
1149 Ga0105237_10000856
1150 Ga0105249_10035526
1151 Ga0105246_10001063
1152 Ga0105246_10001690
1153 Ga0105246_10010360
1154 Ga0105246_10023990
1155 Ga0105246_10061949
1156 Ga0105246_10535276
1157 Ga0157373_10002237
1158 Ga0157373_10008169
1159 Ga0157373_10021495
1160 Ga0157373_10094782
1161 Ga0157371_10000301
1162 Ga0157371_10000923
1163 Ga0157371_10001330
1164 Ga0157371_10015893
1165 Ga0157371_10056663
1166 Ga0157371_10097294
1167 Ga0157371_10335232
1168 Ga0157370_10013075
1169 Ga0157370_10053960
1170 Ga0157370_10056165
1171 Ga0157370_10067552
1172 Ga0157370_10216011
1173 Ga0157370_10718564
1174 Ga0157369_10003346
1175 Ga0157369_10732493
1176 Ga0163162_10001480
1177 Ga0163162_10107166
1178 Ga0163162_10107641
1179 Ga0157372_10001752
1180 Ga0157372_10046108
1181 Ga0157375_10046234
1182 Ga0157375_10380650
1183 Ga0182008_10005941
1184 Ga0182008_10010767
1185 Ga0182008_10014706
1186 Ga0182008_10017069
1187 Ga0182008_10022922
1188 Ga0182006_1000844
1189 Ga0182006_1006672
1190 Ga0182006_1007773
1191 Ga0182006_1018323
1192 Ga0182006_1029395
1193 Ga0182006_1031524
1194 Ga0182006_1050415
1195 Ga0182007_10003640
1196 Ga0182005_1000309
1197 Ga0182005_1026069
1198 Ga0163161_10115517
1199 Ga0163161_10220558
1200 Ga0209435_101639
1201 Ga0209760_100028
1202 Ga0209760_100163
1203 Ga0209784_100017
1204 Ga0209566_100014
1205 Ga0209674_100028
1206 Ga0209147_100038
1207 Ga0209563_100032
1208 Ga0209563_101192
1209 Ga0207427_100007
1210 Ga0207427_100008
1211 Ga0209437_100006
1212 Ga0209437_100014
1213 Ga0209437_107564
1214 Ga0209258_100197
1215 Ga0207425_1024826
1216 Ga0209646_1000171
1217 Ga0209677_100018
1218 Ga0209759_1005069
1219 Ga0209233_1000008
1220 Ga0209233_1000086
1221 Ga0209675_1012545
1222 Ga0209676_1000006
1223 Ga0209676_1000016
1224 Ga0209676_1000033
1225 Ga0209676_1000973
1226 Ga0209676_1002053
1227 Ga0209676_1008338
1228 Ga0209050_1000070
1229 Ga0209050_1000399
1230 Ga0209050_1000477
1231 Ga0209051_1000043
1232 Ga0209051_1000086
1233 Ga0209051_1000106
1234 Ga0209051_1005825
1235 Ga0209257_1000604
1236 Ga0209257_1000623
1237 Ga0207656_10000066
1238 Ga0207696_1000025
1239 Ga0207696_1000034
1240 Ga0207696_1000043
1241 Ga0207696_1000144
1242 Ga0207696_1001836
1243 Ga0207696_1005655
1244 Ga0207655_1000095
1245 Ga0207655_1000113
1246 Ga0207655_1000448
1247 Ga0207655_1000501
1248 Ga0207655_1000610
1249 Ga0207655_1001799
1250 Ga0207655_1005111
1251 Ga0207655_1005591
1252 Ga0207655_1008966
1253 Ga0207655_1026020
1254 Ga0207655_1068839
1255 Ga0207655_1074944
1256 Ga0207655_1081629
1257 Ga0207713_1000014
1258 Ga0207713_1000074
1259 Ga0207713_1000471
1260 Ga0207713_1000618
1261 Ga0207713_1000900
1262 Ga0207713_1003229
1263 Ga0207713_1003963
1264 Ga0207713_1008642
1265 Ga0207713_1011158
1266 Ga0207713_1014993
1267 Ga0207713_1016408
1268 Ga0207713_1017297
1269 Ga0207713_1017979
1270 Ga0207713_1019013
1271 Ga0207671_10000035
1272 Ga0207649_10000017
1273 Ga0207681_10000601
1274 Ga0207681_10007857
1275 Ga0207681_10048593
1276 Ga0207650_10000212
1277 Ga0207650_10006176
1278 Ga0207650_10116440
1279 Ga0207659_10164787
1280 Ga0207706_10000796
1281 Ga0207686_10011981
1282 Ga0207709_10000053
1283 Ga0207709_10011611
1284 Ga0207709_10066666
1285 Ga0207691_10009671
1286 Ga0207679_10000005
1287 Ga0207712_10128195
1288 Ga0207639_10086856
1289 Ga0207648_10090819
1290 Ga0207676_10588862
1291 Ga0209281_1000010
1292 Ga0209281_1000331
1293 Ga0209281_1010855
1294 Ga0209389_1000031
1295 Ga0209371_1001358
1296 Ga0209371_1005354
1297 Ga0209371_1009851
1298 Ga0209984_1000700
1299 Ga0209999_1008843
1300 Ga0209999_1025509
1301 Ga0209983_1002353
1302 Ga0209971_1000648
1303 Ga0209974_10020136
1304 Ga0209974_10033019
1305 Ga0207428_10049694
1306 Ga0207428_10065873
1307 Ga0207428_10579528
1308 Ga0268266_10139563
1309 Ga0268266_10143672
1310 Ga0268256_1001168
1311 Ga0268256_1005256
1312 Ga0314311_1178492
1313 Ga0316178_1127053
1314 Ga0316181_1093196
1315 Ga0265328_10132599
1316 Ga0265327_10000712
1317 Ga0265327_10001471
1318 Ga0265327_10284167
1319 Ga0265316_10000461
1320 Ga0265316_10458131
1321 Ga0307408_100000042
1322 Ga0307408_100001335
1323 Ga0307408_100031564
1324 Ga0307408_100534977
1325 Ga0307408_100786731
1326 Ga0316576_10009311
1327 Ga0316576_10084591
1328 Ga0316576_10218804
1329 Ga0316578_10021793
1330 Ga0316578_10055792
1331 Ga0316578_10120483
1332 Ga0316577_10039458
1333 Ga0316577_10296749
1334 Ga0307413_10018772
1335 Ga0307413_10137062
1336 Ga0307406_10024656
1337 Ga0307412_10026682
1338 Ga0307412_10026786
1339 Ga0307412_10149055
1340 Ga0307412_10412625
1341 Ga0307409_100117900
1342 Ga0307414_10018889
1343 Ga0307414_10396483
1344 Ga0307411_10031489
1345 Ga0307411_10061793
1346 Ga0307411_10123255
1347 Ga0316585_10012662
1348 Ga0316580_10018135
1349 Ga0316593_10088147
1350 Ga0307510_10025016
1351 Ga0316574_0001096
1352 Ga0316574_0011291
1353 Ga0316574_0017186
1354 Ga0316574_0195055
1355 Ga0316582_0010077
1356 Ga0316582_0043354
1357 Ga0316582_0048330
1358 Ga0316582_0119519
1359 Ga0316582_0146556
1360 Ga0316582_0286983
1361 Ga0316582_0428045
1362 Ga0316584_0011224
1363 Ga0316584_0018008
1364 Ga0316584_0049469
1365 Ga0316584_0460790
1366 Ga0237819_02422
1367 Ga0439436_0000465
1368 Ga0439438_000136
1369 Ga0439438_002815
1370 Ga0439438_005069
1371 Ga0439438_010637
1372 Ga0439438_013860
1373 Ga0439447_001185
1374 Ga0439447_002289
1375 Ga0439447_002435
1376 Ga0439447_018238
1377 Ga0439466_0000828
1378 Ga0439466_0001731
1379 Ga0439466_0005326
1380 Ga0439466_0005858
1381 Ga0439466_0007222
1382 Ga0439466_0007532
1383 Ga0439466_0023166
1384 Ga0451807_0563555
1385 Ga0439437_001430
1386 Ga0439432_000121
1387 Ga0439432_004055
1388 Ga0439432_005544
1389 Ga0439432_008146
1390 Ga0439432_030688
1391 Ga0439432_077276
1392 Ga0439451_008221
1393 Ga0439451_018163
1394 Ga0439452_000244
1395 Ga0439452_001133
1396 Ga0439452_002100
1397 Ga0439452_006702
1398 Ga0439452_008746
1399 Ga0439452_011698
1400 Ga0439452_014917
1401 Ga0439456_000089
1402 Ga0439456_005136
1403 Ga0439456_005403
1404 Ga0439456_008178
1405 Ga0439456_019789
1406 Ga0439463_000778
1407 Ga0439463_005465
1408 Ga0450911_000017
1409 Ga0450911_000237
1410 Ga0450919_005421
1411 Ga0450920_022524
1412 Ga0450922_003536
1413 Ga0450923_000184
1414 Ga0450900_000340
1415 Ga0450902_000757
1416 Ga0450902_002353
1417 Ga0450902_014286
1418 Ga0450904_000260
1419 Ga0450904_002736
1420 Ga0450905_005405
1421 Ga0450905_028655
1422 Ga0450905_029684
1423 Ga0450906_002445
1424 Ga0450907_000076
1425 Ga0450907_001352
1426 Ga0450907_010405
1427 Ga0450910_000679
1428 Ga0439446_0000604
1429 Ga0439446_0003340
1430 Ga0439446_0004459
1431 Ga0439446_0015788
1432 Ga0439446_0023590
1433 Ga0450908_000501
1434 Ga0450909_000096
1435 Ga0450909_007833
1436 Ga0439434_0000804
1437 Ga0439434_0014404
1438 Ga0439434_0016910
1439 Ga0439459_0022850
1440 Ga0439464_0003363
1441 Ga0439464_0004738
1442 Ga0439464_0009195
1443 Ga0439460_0003586
1444 Ga0439460_0007704
1445 Ga0450916_000440
1446 Ga0450918_011503
1447 Ga0450901_000007
1448 Ga0451577_0000105
1449 Ga0451577_0009916
1450 Ga0451577_0253980
1451 Ga0451577_0275370
1452 Ga0439440_0000185
1453 Ga0453684_0003537
1454 Ga0453684_0055976
1455 Ga0453684_0195291
1456 Ga0451576_0000217
1457 Ga0495617_000141
1458 Ga0495617_029541
1459 Ga0495617_036883
1460 Ga0495617_041150
1461 Ga0495627_000130
1462 Ga0495627_000888
1463 Ga0495627_003846
1464 Ga0495627_004631
1465 Ga0495627_007148
1466 Ga0495627_008463
1467 Ga0495603_0013079
1468 Ga0495603_0104211
1469 Ga0495590_0003790
1470 Ga0495590_0102102
1471 Ga0495591_000119
1472 Ga0495591_001004
1473 Ga0495591_001781
1474 Ga0495591_002890
1475 Ga0495591_003252
1476 Ga0495591_004111
1477 Ga0495591_007995
1478 Ga0495629_0073034
1479 Ga0495638_0014555
1480 Ga0495638_0022681
1481 Ga0495638_0033967
1482 Ga0495638_0113968
1483 Ga0495653_0009457
1484 Ga0495653_0016863
1485 Ga0495653_0020041
1486 Ga0495650_0003122
1487 Ga0495650_0005077
1488 Ga0495650_0016467
1489 Ga0495582_0002605
1490 Ga0495605_0000125
1491 Ga0495605_0000149
1492 Ga0495605_0000429
1493 Ga0495605_0000503
1494 Ga0495605_0001674
1495 Ga0495605_0004647
1496 Ga0495605_0009525
1497 Ga0495605_0018078
1498 Ga0495639_0000065
1499 Ga0495639_0003249
1500 Ga0495584_0003676
1501 Ga0495584_0004945
1502 Ga0495584_0020919
1503 Ga0495584_0030366
1504 Ga0495584_0055031
1505 Ga0495585_0001301
1506 Ga0495585_0001381
1507 Ga0495585_0310296
1508 Ga0495594_0003413
1509 Ga0495596_0000636
1510 Ga0495607_0000312
1511 Ga0495607_0000379
1512 Ga0495607_0000455
1513 Ga0495607_0000464
1514 Ga0495607_0004399
1515 Ga0495607_0006401
1516 Ga0495607_0007164
1517 Ga0495607_0008736
1518 Ga0495607_0011380
1519 Ga0495607_0026447
1520 Ga0495607_0064900
1521 Ga0495607_0087953
1522 Ga0495607_0099717
1523 Ga0495607_0278997
1524 Ga0495583_0000196
1525 Ga0495583_0001527
1526 Ga0495583_0004118
1527 Ga0495583_0007950
1528 Ga0495583_0009084
1529 Ga0495606_0000712
1530 Ga0495606_0001438
1531 Ga0495606_0009506
1532 Ga0495606_0016921
1533 Ga0495606_0022904
1534 Ga0495606_0029764
1535 Ga0495610_0007081
1536 Ga0495610_0027192
1537 Ga0495610_0031604
1538 Ga0495610_0077190
1539 Ga0495610_0150084
1540 Ga0495616_0019099
1541 Ga0495616_0028518
1542 Ga0495616_0038987
1543 Ga0495620_0000003
1544 Ga0495620_0000055
1545 Ga0495620_0000584
1546 Ga0495620_0001229
1547 Ga0495620_0004454
1548 Ga0495620_0010025
1549 Ga0495630_0027786
1550 Ga0495630_0131962
1551 Ga0495631_0002696
1552 Ga0495631_0006268
1553 Ga0495632_0000186
1554 Ga0495632_0000432
1555 Ga0495632_0000608
1556 Ga0495632_0003902
1557 Ga0495632_0005207
1558 Ga0495632_0006116
1559 Ga0495632_0006199
1560 Ga0495632_0008775
1561 Ga0495632_0014616
1562 Ga0495632_0019199
1563 Ga0495632_0063758
1564 Ga0495637_0000162
1565 Ga0495637_0000231
1566 Ga0495637_0002146
1567 Ga0495637_0003708
1568 Ga0495637_0005206
1569 Ga0495637_0005703
1570 Ga0495637_0007586
1571 Ga0495637_0008547
1572 Ga0495637_0013132
1573 Ga0495637_0014081
1574 Ga0495637_0060989
1575 Ga0495643_0000319
1576 Ga0495643_0001060
1577 Ga0495643_0008410
1578 Ga0495643_0037205
1579 Ga0495643_0047794
1580 Ga0495643_0201330
1581 Ga0495644_0003627
1582 Ga0495644_0024090
1583 Ga0495648_0000676
1584 Ga0495648_0000755
1585 Ga0495648_0001144
1586 Ga0495648_0003719
1587 Ga0495648_0006841
1588 Ga0495648_0007126
1589 Ga0495648_0039231
1590 Ga0495648_0134382
1591 Ga0495666_0003285
1592 Ga0495642_0000172
1593 Ga0495642_0000431
1594 Ga0495654_0001418
1595 Ga0495654_0002234
1596 Ga0495654_0003745
1597 Ga0495654_0005234
1598 Ga0495654_0006557
1599 Ga0495654_0018618
1600 Ga0495654_0027116
1601 Ga0495654_0039060
1602 Ga0495654_0143301
1603 Ga0495586_0148424
1604 Ga0495587_0001431
1605 Ga0495587_0010525
1606 Ga0495598_0002453
1607 Ga0495609_0000087
1608 Ga0495609_0000174
1609 Ga0495609_0000213
1610 Ga0495609_0001854
1611 Ga0495609_0032377
1612 Ga0495609_0051850
1613 Ga0495609_0089699
1614 Ga0495597_0000097
1615 Ga0495597_0008719
1616 Ga0495597_0011290
1617 Ga0495597_0023634
1618 Ga0495597_0166931
1619 Ga0495622_0000688
1620 Ga0495622_0002891
1621 Ga0495622_0186812
1622 Ga0495633_0000134
1623 Ga0495633_0007571
1624 Ga0495656_0006258
1625 Ga0495668_0017196
1626 Ga0495668_0246155
1627 Ga0495634_0027922
1628 Ga0495611_0002038
1629 Ga0495611_0003476
1630 Ga0495625_0000145
1631 Ga0495625_0022895
1632 Ga0495635_0003568
1633 Ga0495635_0005207
1634 Ga0495659_0003223
1635 Ga0495659_0024669
1636 Ga0495661_0000150
1637 Ga0495661_0000193
1638 Ga0495661_0000306
1639 Ga0495661_0000332
1640 Ga0495661_0000644
1641 Ga0495661_0007217
1642 Ga0495588_0005283
1643 Ga0495646_0004182
1644 Ga0495646_0007936
1645 Ga0495669_0001041
1646 Ga0495613_0073554
1647 Ga0495624_0001547
1648 Ga0495670_0014020
1649 Ga0495670_0031504
1650 Ga0495670_0048498
1651 Ga0495671_0000813
1652 Ga0495671_0002178
1653 Ga0495671_0010354
1654 Ga0495671_0011743
1655 Ga0495671_0020192
1656 Ga0495671_0036459
1657 Ga0495671_0052705
1658 Ga0495649_0000362
1659 Ga0495649_0001373
1660 Ga0495649_0003896
1661 Ga0495649_0029860
1662 Ga0495649_0049052
1663 Ga0495589_0000228
1664 Ga0495589_0004887
1665 Ga0495589_0013783
1666 Ga0495660_0004242
1667 Ga0495660_0005442
1668 Ga0495660_0005476
1669 Ga0495660_0034816
1670 Ga0495660_0035397
1671 Ga0495660_0072027
1672 Ga0495660_0073341
1673 Ga0495604_0020674
1674 Ga0495672_0000961
1675 Ga0495672_0014074
1676 Ga0495672_0019259
1677 Ga0495672_0023652
1678 Ga0495672_0032335
1679 Ga0495672_0046547
1680 Ga0495672_0233142
1681 Ga0495676_0000119
1682 Ga0495676_0016179
1683 Ga0495680_0022050
1684 Ga0495680_0048725
1685 Ga0495683_0000059
1686 Ga0495683_0000095
1687 Ga0495683_0002437
1688 Ga0495683_0042946
1689 Ga0495687_003858
1690 Ga0495687_007887
1691 Ga0495687_009404
1692 Ga0495677_0001027
1693 Ga0495679_000267
1694 Ga0495679_000554
1695 Ga0495685_030284
1696 Ga0495673_0001692
1697 Ga0495673_0002018
1698 Ga0495673_0002336
1699 Ga0495673_0005312
1700 Ga0495673_0006440
1701 Ga0495673_0007434
1702 Ga0495673_0008495
1703 Ga0495673_0026708
1704 Ga0495673_0102262
1705 Ga0495681_0000690
1706 Ga0495681_0001877
1707 Ga0495681_0006727
1708 Ga0495681_0026634
1709 Ga0495681_0148645
1710 Ga0495686_0123668
1711 Ga0495626_0000259
1712 Ga0495626_0000625
1713 Ga0495626_0003715
1714 Ga0495626_0004053
1715 Ga0495626_0008942
1716 Ga0495626_0010349
1717 Ga0496102_0009345
1718 Ga0496103_0002700
1719 Ga0496110_0022963
1720 Ga0496112_0453820
1721 Ga0496114_0004116
1722 Ga0496114_0007099
1723 Ga0496115_0014315
1724 Ga0496115_0035754
1725 Ga0496116_0000792
1726 Ga0496116_0009449
1727 Ga0496116_0037374
1728 Ga0496116_0045813
1729 Ga0496117_0001008
1730 Ga0496117_0002238
1731 Ga0496117_0002244
1732 Ga0496117_0002790
1733 Ga0496117_0008345
1734 Ga0496117_0106787
1735 Ga0496117_0153824
1736 Ga0496118_0003309
1737 Ga0496118_0010322
1738 Ga0496118_0035214
1739 Ga0496118_0035375
1740 Ga0496118_0109414
1741 Ga0496118_0180193
1742 Ga0496119_0000380
1743 Ga0496120_0002903
1744 Ga0496121_0000858
1745 Ga0496121_0001360
1746 Ga0496121_0002590
1747 Ga0496121_0044902
1748 Ga0496121_0066311
1749 Ga0496121_0136226
1750 Ga0496122_0001237
1751 Ga0496122_0002322
1752 Ga0496122_0004088
1753 Ga0496122_0036831
1754 Ga0496122_0042793
1755 Ga0496123_0000550
1756 Ga0496123_0006040
1757 Ga0496123_0008088
1758 Ga0496123_0035674
1759 Ga0496123_0054043
1760 Ga0496123_0142438
1761 Ga0496124_0000355
1762 Ga0496124_0001100
1763 Ga0496124_0002102
1764 Ga0496124_0007094
1765 Ga0496124_0010243
1766 Ga0496124_0010329
1767 Ga0496124_0030407
1768 Ga0496124_0092665
1769 Ga0496124_0174691
1770 Ga0496124_0334014
1771 Ga0496125_0002991
1772 Ga0496125_0037792
1773 Ga0496125_0049985
1774 Ga0496126_0029684
1775 Ga0496126_0128833
1776 Ga0495678_000108
1777 Ga0495678_003989
1778 Ga0495678_005172
1779 Ga0495678_019211
1780 Ga0495678_027046
1781 Ga0495682_0000170
1782 Ga0495682_0000234
1783 Ga0495682_0002853
1784 Ga0495682_0005115
1785 Ga0495682_0019452
1786 Ga0495682_0109646
1787 Ga0495682_0126512
1788 Ga0501032_0102910
1789 Ga0501032_0416826
1790 Ga0501034_0000150
1791 Ga0501034_0911783
1792 Ga0501037_0097933
1793 Ga0501039_0106675
1794 Ga0501070_0036722
1795 Ga0501072_0465159
1796 Ga0501080_0473695
1797 Ga0501241_008863
1798 Ga0501275_000036
1799 Ga0501226_000028
1800 nmdc:mga03683_127151_c1
1801 nmdc:mga00v17_45138_c1
1802 nmdc:mga00v17_70159_c1
1803 nmdc:mga0sz30_7332_c1
1804 Ga0500618_001241
1805 Ga0500573_0125367
1806 2510283551
1807 2510292621
1808 2510311713
1809 2511254626
1810 2511266576
1811 2511270707
1812 2511277288
1813 2511287314
1814 2511294727
1815 2511303398
1816 2511312798
1817 2511320269
1818 2511328767
1819 2511331717
1820 2511340701
1821 2511343871
1822 2511350216
1823 2511358543
1824 2511362853
1825 2511369823
1826 2511374185
1827 2511416239
1828 2512328473
1829 2554816809
1830 2555249255
1831 2555671454
1832 2583793916
1833 2597859538
1834 2597865185
1835 2597871048
1836 2599326979
1837 2599354389
1838 2599359897
1839 2599366219
1840 2599373009
1841 2599379497
1842 2599385525
1843 2599391868
1844 2599400316
1845 2599403634
1846 2599451353
1847 2599461223
1848 2599469765
1849 2599482368
1850 2599490243
1851 2599503361
1852 2599508667
1853 2599512527
1854 2599519876
1855 2599614988
1856 2599771160
1857 2599803912
1858 2599878527
1859 2599886309
1860 2599891203
1861 2599898023
1862 2599934756
1863 2599943915
1864 2599947730
1865 2599955871
1866 2599960336
1867 2599967896
1868 2599972861
1869 2599979102
1870 2599986588
1871 2599989597
1872 2599997629
1873 2600000056
1874 2600005009
1875 2600013061
1876 2600017837
1877 2600024728
1878 2600030562
1879 2600038175
1880 2600044489
1881 2600048312
1882 2600055399
1883 2600061517
1884 2600066191
1885 2600070080
1886 2600077971
1887 2600213838
1888 2600360006
1889 2600364442
1890 2600446444
1891 2601625505
1892 2601689558
1893 2601774006
1894 2601795547
1895 2602010493
1896 2606075617
1897 2606128472
1898 2608379893
1899 2621298257
1900 2624479484
1901 2624493520
1902 2643841709
1903 2643869302
1904 2643952617
1905 2644022379
1906 2644188585
1907 2644281879
1908 2644622018
1909 2652544079
1910 2671090117
1911 2671096970
1912 2671125243
1913 2671770519
1914 2677899968
1915 2678264747
1916 2715753877
1917 2715757751
1918 2718633332
1919 2723249938
1920 2729146926
1921 2738671358
1922 2738689151
1923 2738749752
1924 2738808388
1925 2738858792
1926 2738895748
1927 2739201281
1928 2739261155
1929 2739264538
1930 2739286348
1931 2739291661
1932 2739316714
1933 2743739069
1934 2745005201
1935 2765585520
1936 2774121295
1937 2774128677
1938 2774137641
1939 2784265606
1940 2784317411
1941 2794594982
1942 2807407091
1943 2807455422
1944 2808858406
1945 2808907135
1946 2808926264
1947 2808927413
1948 2808938539
1949 2808940797
1950 2808948363
1951 2808950048
1952 2808961547
1953 2808966891
1954 2808977894
1955 2808993374
1956 2809001721
1957 2809216419
1958 2812371105
1959 2817492598
1960 2819654748
1961 2819702063
1962 2823423035
1963 2825656364
1964 2826585967
1965 2834031810
1966 2842805479
1967 2842818998
1968 2842827589
1969 2842832645
1970 2842841303
1971 2842848269
1972 2842853845
1973 2842856751
1974 2844671977
1975 2852613034
1976 2852658967
1977 2852669231
1978 2860339972
1979 2860871688
1980 2878031487
1981 2880232357
1982 2894417246
1983 2894515149
1984 2904521752
1985 2904553150
1986 2908451097
1987 2912967760
1988 2913041356
1989 2917075322
1990 2917837286
1991 2919064042
1992 2919126713
1993 2919158738
1994 2919386451
1995 2919457066
1996 2919484277
1997 2919491267
1998 2919505573
1999 2919702822
2000 2923158150
2001 2923525213
2002 2923590215
2003 2926067250
2004 2929148681
2005 2929193727
2006 2931373887
2007 2931395050
2008 2931400136
2009 2935356309
2010 2939639693
2011 2939655786
2012 2945932253
2013 2945961875
2014 2946008446
2015 2946032193
2016 2947239027
2017 2969306270
2018 2974299194
2019 2984288027
2020 2984501513
2021 2984505088
2022 2988730264
2023 2990199962
2024 2998141665
2025 3007256340
2026 3007319444
2027 3007397451
2028 3007424617
2029 3007513060
2030 3007615879
2031 3007621914
2032 3007722466
2033 3007803795
2034 3007856255
2035 3007863096
2036 3007870604
2037 3007874118
2038 637321774
2039 8001523344
2040 8011356408
2041 8015692246
2042 8016733056
2043 8019772969
2044 8019780297
2045 8029999091
2046 8034964036
2047 8052495849
2048 8054285782
2049 8054350689
2050 8054507559
2051 8054929919
2052 8055775456
2053 8055822501
2054 8055881306
2055 8056117602
2056 8056122135
2057 8056130138
2058 8056135954
2059 8056138756
2060 8056144708
2061 8056153284
2062 8056156183
2063 8056162168
2064 8056169326
2065 8056175512
2066 8056181191
2067 8056573179
2068 8057804271

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22688

Hda_lid

Hda, lid domain

215

279

0.99

PF00308

Bac_DnaA

Bacterial DnaA ATPAse domain

59

209

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x06-assembly1.cif.gz_E dna replication regulation protein 0.9122 5 229
5x06-assembly1.cif.gz_F dna replication regulation protein 0.9047 3 230
5x06-assembly1.cif.gz_F dna replication regulation protein 0.8971 3 230
5x06-assembly1.cif.gz_H dna replication regulation protein 0.8964 5 207
5x06-assembly1.cif.gz_E dna replication regulation protein 0.8963 5 229
ID Description Score Start End Superfamily
af_P69931_1_164_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9013 1 164 3.40.50.300
3sc3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8927 23 164 3.40.50.300
af_P69931_1_164_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8907 1 164 3.40.50.300
3bosA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8829 4 164 3.40.50.300
3sc3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8813 23 164 3.40.50.300
ID Description Score Start End GO Terms
AF-F3FTU9-F1-model_v4 DNA replication initiation factor 0.9912 29 233 GO:0003743
GO:0006270
GO:0032297
AF-A0A0P9J3K0-F1-model_v4 deleted 0.9872 1 233
AF-A4NXM4-F1-model_v4 Chromosomal replication initiator protein DnaA ATPAse domain-containing protein 0.9831 52 160 GO:0006270
GO:0032297
AF-A0A0P9J3K0-F1-model_v4 deleted 0.983 1 233
AF-A0A3M4R106-F1-model_v4 deleted 0.9776 1 233

Map