F488688

General Info

Members Datasets Scaffolds Average Seq Length
1034 587 2068 330

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0009351|Ga0501084_0009351_6938_8020
Length 360
Sequence MVARPPPVGSGTPAKLLNPSRNKQGQPVAASPKPAGRPADGAVASALRTITTERTGLDALAAALAGALAEPFAATVKVIRQARGRVIVSGVGKSGHVARKIASTLASTGTPAFFVHPAEASHGDLGMVTPDDVIVALSWSGESAELRSVVEHSRRFRIPLVAFTSAPDSTLARKSDHVLLLPRADEACPHGLSPTTSALMQLALGDALAIALLEDRGFSAEDFHVLHPGGKLGASLHFVRDVMHQDAAVPLIGPGATLGEAILTIGEKRLGCVGVVDDGGKLIGIITDGDVRRHLTGDDPLAAPVQAVMTRTPKTIAPDALVGTALDLLNKTKITALFVVDAGKPLGVVHMHDLLRIGVA

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
120 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
121 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
122 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
126 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
127 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
188 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
210 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
211 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
218 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
232 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
235 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
237 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
238 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
245 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
246 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
247 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
248 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
249 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
250 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
251 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
252 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
255 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
264 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
265 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
282 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
283 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
296 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
301 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
302 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
309 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
310 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
314 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
315 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
316 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
327 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
328 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
329 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
330 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
332 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
333 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
335 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
338 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
346 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
366 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
367 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
370 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
373 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
374 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
379 2506520008 Serratia plymuthica AS12 Isolate Unclassified
380 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
381 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
382 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
383 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
384 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
385 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
386 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
387 2534681786 Brucella suis 92/29 Isolate Unclassified
388 2547132181 Kosakonia sacchari SP1 Isolate Stem
389 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
390 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
391 2561511199 Enterobacter sp. R4-368 Isolate Nodule
392 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
393 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
394 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
395 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
396 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
397 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
398 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
399 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
400 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
401 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
402 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
403 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
404 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
405 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
406 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
407 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
408 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
409 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
410 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
411 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
412 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
413 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
414 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
415 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
416 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
417 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
418 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
419 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
420 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
421 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
422 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
423 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
424 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
425 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
426 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
427 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
428 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
429 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
430 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
431 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
432 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
433 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
434 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
435 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
436 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
437 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
438 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
439 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
440 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
441 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
442 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
443 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
444 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
445 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
446 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
447 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
448 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
449 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
450 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
451 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
452 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
453 2636415599 Klebsiella variicola DX120E Isolate Unclassified
454 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
455 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
456 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
457 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
458 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
459 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
460 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
461 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
462 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
463 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
464 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
465 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
466 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
467 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
468 2738543024 Aminobacter sp. AP02 Isolate Unclassified
469 2751185800 Brucella pituitosa AA2 Isolate Unclassified
470 2751185917 Enterobacter sp. HK169 Isolate Unclassified
471 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
472 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
473 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
474 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
475 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
476 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
477 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
478 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
479 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
480 2775507074 Klebsiella sp. D5A Isolate Unclassified
481 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
482 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
483 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
484 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
485 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
486 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
487 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
488 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
489 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
490 2821118458 Enterobacter asburiae 609 Isolate Unclassified
491 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
492 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
493 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
494 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
495 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
496 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
497 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
498 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
499 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
500 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
501 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
502 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
503 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
504 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
505 2847085930 Erwinia persicina B64 Isolate Bulb
506 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
507 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
508 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
509 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
510 2854911287 Brucella lupini LUP21 Isolate Unclassified
511 2865014394 Pantoea sp. R-71966 Isolate Unclassified
512 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
513 2876601092 Pantoea endophytica 596 Isolate Unclassified
514 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
515 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
516 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
517 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
518 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
519 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
520 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
521 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
522 2904504865 Serratia marcescens 1822 Isolate Unclassified
523 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
524 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
525 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
526 2909042592 Labrys sp. LIt4 Isolate Nodule
527 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
528 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
529 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
530 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
531 2919150387 Rahnella aceris 1817 Isolate Unclassified
532 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
533 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
534 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
535 2927143783 Rahnella sp. 2050 Isolate Unclassified
536 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
537 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
538 2932406140 Serratia sp. 2723 Isolate Rhizosphere
539 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
540 2937539931 Pantoea sp. LS15 Isolate Unclassified
541 2937967321 Serratia sp. YC16 Isolate Unclassified
542 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
543 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
544 2939577877 Serratia sp. 509 Isolate Rhizosphere
545 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
546 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
547 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
548 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
549 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
550 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
551 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
552 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
553 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
554 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
555 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
556 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
557 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
558 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
559 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
560 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
561 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
562 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
563 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
564 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
565 640753048 Serratia proteamaculans 568 Isolate Endosphere
566 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
567 8004592986 Serratia sp. S119 Isolate Unclassified
568 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
569 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
570 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
571 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
572 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
573 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
574 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
575 8018221730 Enterobacter sp. CM29 Isolate Unclassified
576 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
577 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
578 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
579 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
580 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
581 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
582 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
583 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
584 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
585 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
586 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
587 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.59
Metatranscriptomes 0.1
Isolates 20.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0.1
Endosphere 5.61
Nodule 3.68
Rhizoplane 7.83
Rhizosphere 63.06
Stem 0.1
Stem Tuber 0.1
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0009351 3300054114 Bacteria 8112
2 SwRhRL2b_contig_2229515 2162886007 Bacteria 1041
3 JGI24740J21852_10000449 3300001979 Bacteria 17614
4 JGI25156J39149_1000215 3300002705 Bacteria 40194
5 JGI25162J39368_1000031 3300002737 Bacteria 210480
6 JGI25162J39368_1000449 3300002737 Bacteria 32568
7 JGI25162J39368_1000471 3300002737 Bacteria 31064
8 JGI25154J39366_1000169 3300002738 Bacteria 50665
9 JGI25157J39369_1000226 3300002741 Bacteria 44207
10 JGI25163J39215_1000261 3300002771 Bacteria 18973
11 JGI25164J39214_1000001 3300002772 Bacteria 477015
12 JGI25152J39213_1000063 3300002773 Bacteria 71659
13 JGI25159J45721_1000718 3300002987 Bacteria 14447
14 JGI25165J46597_1000443 3300003214 Bacteria 41663
15 JGI25165J46597_1001071 3300003214 Bacteria 17571
16 JGI25165J46597_1006237 3300003214 Bacteria 2140
17 rootH2_10324399 3300003320 Bacteria 1632
18 JGI25160J50197_1000114 3300003354 Bacteria 75947
19 JGI26145J50221_1000724 3300003371 Bacteria 2707
20 JGI25161J50226_1000089 3300003374 Bacteria 73775
21 Ga0055538_1000004 3300003751 Bacteria 615646
22 Ga0055539_1000004 3300003752 Bacteria 615646
23 Ga0055533_1000007 3300003756 Bacteria 615646
24 Ga0055525_1000007 3300003759 Bacteria 615646
25 Ga0055531_10013484 3300003794 Bacteria 3762
26 Ga0055541_1000004 3300003841 Bacteria 615646
27 Ga0058692_1001387 3300003856 Bacteria 8962
28 Ga0058692_1002827 3300003856 Bacteria 5690
29 Ga0058692_1008101 3300003856 Bacteria 2726
30 Ga0058692_1009185 3300003856 Bacteria 2506
31 Ga0058692_1016402 3300003856 Bacteria 1646
32 Ga0058692_1028962 3300003856 Bacteria 1064
33 Ga0055543_1000002 3300004625 Bacteria 390020
34 Ga0065165_1000537 3300005262 Bacteria 57544
35 Ga0065703_1018907 3300005272 Bacteria 5240
36 Ga0065704_10001070 3300005289 Bacteria 9761
37 Ga0065704_10001534 3300005289 Bacteria 24742
38 Ga0065704_10001858 3300005289 Bacteria 23782
39 Ga0065704_10002429 3300005289 Bacteria 11867
40 Ga0065704_10006610 3300005289 Bacteria 4362
41 Ga0065704_10013586 3300005289 Bacteria 1491
42 Ga0065704_10093217 3300005289 Bacteria 2610
43 Ga0065707_10108180 3300005295 Bacteria 2521
44 Ga0070676_10027376 3300005328 Bacteria 3232
45 Ga0070676_10140843 3300005328 Bacteria 1535
46 Ga0070683_100027190 3300005329 Bacteria 5159
47 Ga0070690_100000539 3300005330 Bacteria 18931
48 Ga0070690_100010622 3300005330 Bacteria 5362
49 Ga0070670_100017812 3300005331 Bacteria 6095
50 Ga0070677_10014550 3300005333 Bacteria 2771
51 Ga0068869_100044440 3300005334 Bacteria 3195
52 Ga0068869_100347549 3300005334 Bacteria 1208
53 Ga0070666_10027773 3300005335 Bacteria 3708
54 Ga0070666_10155230 3300005335 Bacteria 1598
55 Ga0070680_100040696 3300005336 Bacteria 3765
56 Ga0068868_100016978 3300005338 Bacteria 5416
57 Ga0070660_100019059 3300005339 Bacteria 5024
58 Ga0070689_100016769 3300005340 Bacteria 5366
59 Ga0070689_100021941 3300005340 Bacteria 4761
60 Ga0070689_100031840 3300005340 Bacteria 4008
61 Ga0070687_100000401 3300005343 Bacteria 14719
62 Ga0070687_100042289 3300005343 Bacteria 2308
63 Ga0070661_100012095 3300005344 Bacteria 6032
64 Ga0070668_100022105 3300005347 Bacteria 4808
65 Ga0070671_100004342 3300005355 Bacteria 11219
66 Ga0070674_100001020 3300005356 Bacteria 14599
67 Ga0070673_100002768 3300005364 Bacteria 10780
68 Ga0070673_100036202 3300005364 Bacteria 3749
69 Ga0070673_100067045 3300005364 Bacteria 2869
70 Ga0070688_100108415 3300005365 Bacteria 1843
71 Ga0070688_100129114 3300005365 Bacteria 1703
72 Ga0070659_100011884 3300005366 Bacteria 6445
73 Ga0070714_100023128 3300005435 Bacteria 5102
74 Ga0070713_100066546 3300005436 Bacteria 3031
75 Ga0070713_100156809 3300005436 Bacteria 2029
76 Ga0070701_10083355 3300005438 Bacteria 1736
77 Ga0070711_100009650 3300005439 Bacteria 5948
78 Ga0070705_100005704 3300005440 Bacteria 6080
79 Ga0070700_100007133 3300005441 Bacteria 6015
80 Ga0070694_100024935 3300005444 Bacteria 3864
81 Ga0070678_100015341 3300005456 Bacteria 4867
82 Ga0070678_100015570 3300005456 Bacteria 4836
83 Ga0070678_100020438 3300005456 Bacteria 4344
84 Ga0070662_100002557 3300005457 Bacteria 11203
85 Ga0070662_100004962 3300005457 Bacteria 8453
86 Ga0070681_10009409 3300005458 Bacteria 9616
87 Ga0068867_100002693 3300005459 Bacteria 12530
88 Ga0070679_100021719 3300005530 Bacteria 6269
89 Ga0070672_100006520 3300005543 Bacteria 7846
90 Ga0070672_100056029 3300005543 Bacteria 3090
91 Ga0070686_100002070 3300005544 Bacteria 11080
92 Ga0070695_100056780 3300005545 Bacteria 2527
93 Ga0070693_100070556 3300005547 Bacteria 2056
94 Ga0070665_100002206 3300005548 Bacteria 21732
95 Ga0070665_100010158 3300005548 Bacteria 9520
96 Ga0070665_100031391 3300005548 Bacteria 5348
97 Ga0070665_100048948 3300005548 Bacteria 4242
98 Ga0070665_100178171 3300005548 Bacteria 2126
99 Ga0070664_100001498 3300005564 Bacteria 18609
100 Ga0070664_100017690 3300005564 Bacteria 5854
101 Ga0068857_100000020 3300005577 Bacteria 89305
102 Ga0068857_100030667 3300005577 Bacteria 4749
103 Ga0070702_100053943 3300005615 Bacteria 2311
104 Ga0068852_100014145 3300005616 Bacteria 6129
105 Ga0068852_100049144 3300005616 Bacteria 3607
106 Ga0068851_10000221 3300005834 Bacteria 27516
107 Ga0068870_10005500 3300005840 Bacteria 5534
108 Ga0068858_100033841 3300005842 Bacteria 4740
109 Ga0068862_100180184 3300005844 Bacteria 1896
110 Ga0081455_10030083 3300005937 Bacteria 4939
111 Ga0070717_10181562 3300006028 Bacteria 1835
112 Ga0075363_100106950 3300006048 Bacteria 1552
113 Ga0075364_10021925 3300006051 Bacteria 4029
114 Ga0070712_100004848 3300006175 Bacteria 8318
115 Ga0075367_10151258 3300006178 Bacteria 1440
116 Ga0075366_10002364 3300006195 Bacteria 9662
117 Ga0097621_100022779 3300006237 Bacteria 4867
118 Ga0068871_100306038 3300006358 Bacteria 1396
119 Ga0075428_100323363 3300006844 Bacteria 1657
120 Ga0075430_100123490 3300006846 Bacteria 2158
121 Ga0075431_100041363 3300006847 Bacteria 4751
122 Ga0075431_100070799 3300006847 Bacteria 3598
123 Ga0075431_100198596 3300006847 Bacteria 2053
124 Ga0075433_10014754 3300006852 Bacteria 6395
125 Ga0075429_100005400 3300006880 Bacteria 10997
126 Ga0075429_100014404 3300006880 Bacteria 6853
127 Ga0075429_100444970 3300006880 Bacteria 1135
128 Ga0068865_100002426 3300006881 Bacteria 11015
129 Ga0068865_100154924 3300006881 Bacteria 1742
130 Ga0079104_1000485 3300006946 Bacteria 43922
131 Ga0079104_1000490 3300006946 Bacteria 42967
132 Ga0079104_1000624 3300006946 Bacteria 34658
133 Ga0079104_1000660 3300006946 Bacteria 32875
134 Ga0079104_1001897 3300006946 Bacteria 12619
135 Ga0079104_1002516 3300006946 Bacteria 9735
136 Ga0079104_1002794 3300006946 Bacteria 8797
137 Ga0079104_1006842 3300006946 Bacteria 4227
138 Ga0079104_1014417 3300006946 Bacteria 2384
139 Ga0075435_100162880 3300007076 Bacteria 1879
140 Ga0105251_10001425 3300009011 Bacteria 20604
141 Ga0105251_10002220 3300009011 Bacteria 15494
142 Ga0105251_10002228 3300009011 Bacteria 15467
143 Ga0105251_10002491 3300009011 Bacteria 14415
144 Ga0105251_10002841 3300009011 Bacteria 13080
145 Ga0105251_10005427 3300009011 Bacteria 8332
146 Ga0105251_10008910 3300009011 Bacteria 6001
147 Ga0105251_10011814 3300009011 Bacteria 4970
148 Ga0105251_10015900 3300009011 Bacteria 4092
149 Ga0105251_10088147 3300009011 Bacteria 1428
150 Ga0105251_10101907 3300009011 Bacteria 1312
151 Ga0105244_10000033 3300009036 Bacteria 172219
152 Ga0105244_10000505 3300009036 Bacteria 34917
153 Ga0105244_10000565 3300009036 Bacteria 33084
154 Ga0105244_10000822 3300009036 Bacteria 26216
155 Ga0105244_10001412 3300009036 Bacteria 19445
156 Ga0105244_10002138 3300009036 Bacteria 15170
157 Ga0105244_10002840 3300009036 Bacteria 12855
158 Ga0105244_10004471 3300009036 Bacteria 9606
159 Ga0105244_10005243 3300009036 Bacteria 8658
160 Ga0105244_10018339 3300009036 Bacteria 3928
161 Ga0105244_10076228 3300009036 Bacteria 1665
162 Ga0105244_10099818 3300009036 Bacteria 1421
163 Ga0105244_10156267 3300009036 Bacteria 1091
164 Ga0105250_10000098 3300009092 Bacteria 78269
165 Ga0105250_10000165 3300009092 Bacteria 57113
166 Ga0105250_10000321 3300009092 Bacteria 36864
167 Ga0105250_10000351 3300009092 Bacteria 35223
168 Ga0105250_10001790 3300009092 Bacteria 11256
169 Ga0105250_10004800 3300009092 Bacteria 6158
170 Ga0105250_10006878 3300009092 Bacteria 4932
171 Ga0105250_10015710 3300009092 Bacteria 3099
172 Ga0105240_10000019 3300009093 Bacteria 406211
173 Ga0105245_10007384 3300009098 Bacteria 9623
174 Ga0105247_10000027 3300009101 Bacteria 201966
175 Ga0114129_10063906 3300009147 Bacteria 5136
176 Ga0105243_10001901 3300009148 Bacteria 17803
177 Ga0105243_10003148 3300009148 Bacteria 13544
178 Ga0105243_10003945 3300009148 Bacteria 11845
179 Ga0105243_10157788 3300009148 Bacteria 1953
180 Ga0105243_10267977 3300009148 Bacteria 1532
181 Ga0105241_10000006 3300009174 Bacteria 373608
182 Ga0105241_10017641 3300009174 Bacteria 5248
183 Ga0105242_10003004 3300009176 Bacteria 13183
184 Ga0105248_10444841 3300009177 Bacteria 1460
185 Ga0105237_10002680 3300009545 Bacteria 21825
186 Ga0105239_10002581 3300010375 Bacteria 22935
187 Ga0105246_10004374 3300011119 Bacteria 8595
188 Ga0105246_10122072 3300011119 Bacteria 1932
189 Ga0105246_10172746 3300011119 Bacteria 1657
190 Ga0157373_10000301 3300013100 Bacteria 40059
191 Ga0157373_10002114 3300013100 Bacteria 15036
192 Ga0157373_10014332 3300013100 Bacteria 5810
193 Ga0157373_10016018 3300013100 Bacteria 5472
194 Ga0157371_10000159 3300013102 Bacteria 98984
195 Ga0157371_10000349 3300013102 Bacteria 59337
196 Ga0157371_10001320 3300013102 Bacteria 26053
197 Ga0157371_10001630 3300013102 Bacteria 22978
198 Ga0157371_10020620 3300013102 Bacteria 4850
199 Ga0157371_10022635 3300013102 Bacteria 4600
200 Ga0157371_10110400 3300013102 Bacteria 1952
201 Ga0157370_10001424 3300013104 Bacteria 29698
202 Ga0157370_10003061 3300013104 Bacteria 19833
203 Ga0157369_10024732 3300013105 Bacteria 6674
204 Ga0157374_10010962 3300013296 Bacteria 7827
205 Ga0157378_10016174 3300013297 Bacteria 6532
206 Ga0163162_10008063 3300013306 Bacteria 10277
207 Ga0157372_10000517 3300013307 Bacteria 42523
208 Ga0157372_10008131 3300013307 Bacteria 11154
209 Ga0157372_10165155 3300013307 Bacteria 2560
210 Ga0157372_10183821 3300013307 Bacteria 2420
211 Ga0157372_10207861 3300013307 Bacteria 2268
212 Ga0157372_10273027 3300013307 Bacteria 1965
213 Ga0157372_10275848 3300013307 Bacteria 1954
214 Ga0157372_10472686 3300013307 Bacteria 1461
215 Ga0157375_10211095 3300013308 Bacteria 2099
216 Ga0163163_10041019 3300014325 Bacteria 4524
217 Ga0163163_10165435 3300014325 Bacteria 2258
218 Ga0157380_10099016 3300014326 Bacteria 2424
219 Ga0182008_10021763 3300014497 Bacteria 3292
220 Ga0182008_10025779 3300014497 Bacteria 2985
221 Ga0182008_10058683 3300014497 Bacteria 1899
222 Ga0182006_1000376 3300015261 Bacteria 37065
223 Ga0182006_1000652 3300015261 Bacteria 24669
224 Ga0182007_10032719 3300015262 Bacteria 1765
225 Ga0182005_1002849 3300015265 Bacteria 6017
226 Ga0183366_1002 3300015679 Bacteria 791639
227 Ga0183370_1002 3300015680 Bacteria 791639
228 Ga0183369_1002 3300015685 Bacteria 791621
229 Ga0183368_1005 3300015687 Bacteria 791621
230 Ga0163161_10000036 3300017792 Bacteria 153121
231 Ga0163161_10143786 3300017792 Bacteria 1808
232 Ga0163161_10151804 3300017792 Bacteria 1761
233 Ga0163161_10157119 3300017792 Bacteria 1732
234 Ga0213876_10000013 3300021384 Bacteria 342052
235 Ga0228598_1000779 3300024227 Bacteria 6844
236 Ga0209435_100005 3300025206 Bacteria 573745
237 Ga0209760_100006 3300025207 Bacteria 224535
238 Ga0209784_100001 3300025224 Bacteria 3600592
239 Ga0209566_100001 3300025225 Bacteria 3600765
240 Ga0209674_100002 3300025226 Bacteria 3600592
241 Ga0209563_100008 3300025230 Bacteria 1554545
242 Ga0207427_100002 3300025231 Bacteria 1355321
243 Ga0209437_100078 3300025233 Bacteria 278088
244 Ga0209437_100114 3300025233 Bacteria 210697
245 Ga0209437_100291 3300025233 Bacteria 72764
246 Ga0209646_1000011 3300025246 Bacteria 573745
247 Ga0209026_1000008 3300025250 Bacteria 573745
248 Ga0209677_100004 3300025253 Bacteria 1554545
249 Ga0209677_100524 3300025253 Bacteria 21308
250 Ga0209759_1000004 3300025256 Bacteria 573745
251 Ga0209129_1000010 3300025258 Bacteria 583357
252 Ga0209233_1000157 3300025261 Bacteria 164269
253 Ga0209233_1000192 3300025261 Bacteria 127171
254 Ga0209233_1000194 3300025261 Bacteria 126185
255 Ga0209233_1001399 3300025261 Bacteria 9542
256 Ga0209130_1000083 3300025284 Bacteria 162582
257 Ga0209676_1020610 3300025292 Bacteria 2234
258 Ga0209025_1024737 3300025294 Bacteria 3088
259 Ga0209758_1000657 3300025297 Bacteria 51923
260 Ga0209050_1030485 3300025298 Bacteria 1702
261 Ga0207426_1000173 3300025302 Bacteria 162697
262 Ga0209051_1017207 3300025303 Bacteria 3236
263 Ga0209257_1005500 3300025304 Bacteria 8851
264 Ga0207697_10106612 3300025315 Bacteria 1198
265 Ga0207656_10015155 3300025321 Bacteria 2980
266 Ga0207696_1000014 3300025711 Bacteria 517939
267 Ga0207696_1000027 3300025711 Bacteria 412783
268 Ga0207696_1000137 3300025711 Bacteria 127683
269 Ga0207696_1000188 3300025711 Bacteria 95866
270 Ga0207696_1000272 3300025711 Bacteria 62222
271 Ga0207696_1000356 3300025711 Bacteria 46221
272 Ga0207696_1000466 3300025711 Bacteria 35122
273 Ga0207696_1000800 3300025711 Bacteria 20360
274 Ga0207696_1007349 3300025711 Bacteria 4324
275 Ga0207696_1023980 3300025711 Bacteria 1917
276 Ga0207696_1035017 3300025711 Bacteria 1497
277 Ga0207655_1000024 3300025728 Bacteria 459774
278 Ga0207655_1000028 3300025728 Bacteria 437324
279 Ga0207655_1000065 3300025728 Bacteria 252767
280 Ga0207655_1000072 3300025728 Bacteria 236536
281 Ga0207655_1000186 3300025728 Bacteria 110125
282 Ga0207655_1000397 3300025728 Bacteria 60486
283 Ga0207655_1001028 3300025728 Bacteria 28168
284 Ga0207655_1001295 3300025728 Bacteria 23673
285 Ga0207655_1001763 3300025728 Bacteria 18919
286 Ga0207655_1003209 3300025728 Bacteria 12295
287 Ga0207655_1003378 3300025728 Bacteria 11924
288 Ga0207655_1005165 3300025728 Bacteria 8983
289 Ga0207655_1008316 3300025728 Bacteria 6601
290 Ga0207655_1011918 3300025728 Bacteria 5129
291 Ga0207655_1032714 3300025728 Bacteria 2371
292 Ga0207655_1068907 3300025728 Bacteria 1325
293 Ga0207713_1000019 3300025735 Bacteria 361225
294 Ga0207713_1000157 3300025735 Bacteria 102471
295 Ga0207713_1000181 3300025735 Bacteria 90733
296 Ga0207713_1000272 3300025735 Bacteria 63323
297 Ga0207713_1000300 3300025735 Bacteria 56459
298 Ga0207713_1000672 3300025735 Bacteria 32332
299 Ga0207713_1004072 3300025735 Bacteria 9639
300 Ga0207713_1007104 3300025735 Bacteria 6697
301 Ga0207713_1009166 3300025735 Bacteria 5607
302 Ga0207713_1030551 3300025735 Bacteria 2397
303 Ga0207713_1034504 3300025735 Bacteria 2197
304 Ga0207713_1090723 3300025735 Bacteria 1074
305 Ga0207682_10004305 3300025893 Bacteria 5983
306 Ga0207682_10048308 3300025893 Bacteria 1754
307 Ga0207642_10052739 3300025899 Bacteria 1847
308 Ga0207710_10000007 3300025900 Bacteria 488292
309 Ga0207688_10019282 3300025901 Bacteria 3714
310 Ga0207645_10000491 3300025907 Bacteria 32560
311 Ga0207654_10000008 3300025911 Bacteria 375871
312 Ga0207695_10000049 3300025913 Bacteria 406233
313 Ga0207671_10000860 3300025914 Bacteria 38458
314 Ga0207693_10001110 3300025915 Bacteria 24219
315 Ga0207693_10003425 3300025915 Bacteria 13537
316 Ga0207660_10196631 3300025917 Bacteria 1573
317 Ga0207662_10001193 3300025918 Bacteria 12379
318 Ga0207657_10001426 3300025919 Bacteria 25509
319 Ga0207652_10022607 3300025921 Bacteria 5204
320 Ga0207650_10026935 3300025925 Bacteria 4108
321 Ga0207659_10012807 3300025926 Bacteria 5355
322 Ga0207644_10052478 3300025931 Bacteria 2930
323 Ga0207706_10000793 3300025933 Bacteria 32687
324 Ga0207706_10005929 3300025933 Bacteria 11363
325 Ga0207686_10029851 3300025934 Bacteria 3221
326 Ga0207709_10000726 3300025935 Bacteria 26397
327 Ga0207709_10138551 3300025935 Bacteria 1669
328 Ga0207670_10006332 3300025936 Bacteria 6556
329 Ga0207670_10039355 3300025936 Bacteria 3096
330 Ga0207669_10002032 3300025937 Bacteria 8576
331 Ga0207691_10000089 3300025940 Bacteria 77701
332 Ga0207691_10032395 3300025940 Bacteria 4872
333 Ga0207691_10224603 3300025940 Bacteria 1627
334 Ga0207689_10005053 3300025942 Bacteria 11892
335 Ga0207661_10036398 3300025944 Bacteria 3842
336 Ga0207679_10005736 3300025945 Bacteria 7790
337 Ga0207679_10099840 3300025945 Bacteria 2267
338 Ga0207651_10020956 3300025960 Bacteria 3959
339 Ga0207651_10152589 3300025960 Bacteria 1800
340 Ga0207712_10140188 3300025961 Bacteria 1854
341 Ga0207668_10005034 3300025972 Bacteria 7779
342 Ga0207640_10059442 3300025981 Bacteria 2523
343 Ga0207708_10000969 3300026075 Bacteria 21528
344 Ga0207648_10006014 3300026089 Bacteria 12109
345 Ga0207674_10000119 3300026116 Bacteria 91959
346 Ga0207675_100025761 3300026118 Bacteria 5473
347 Ga0207683_10000118 3300026121 Bacteria 64632
348 Ga0207683_10369831 3300026121 Bacteria 1317
349 Ga0209281_1000025 3300027111 Bacteria 488275
350 Ga0209281_1000096 3300027111 Bacteria 236276
351 Ga0209281_1000279 3300027111 Bacteria 96898
352 Ga0209281_1000281 3300027111 Bacteria 96061
353 Ga0209281_1000328 3300027111 Bacteria 82899
354 Ga0209281_1000369 3300027111 Bacteria 73041
355 Ga0209281_1000558 3300027111 Bacteria 45216
356 Ga0209281_1000723 3300027111 Bacteria 32737
357 Ga0209281_1000953 3300027111 Bacteria 23576
358 Ga0209281_1001042 3300027111 Bacteria 21087
359 Ga0209281_1002724 3300027111 Bacteria 6629
360 Ga0209973_1000528 3300027252 Bacteria 2921
361 Ga0209371_1000013 3300027312 Bacteria 691516
362 Ga0209371_1000019 3300027312 Bacteria 583561
363 Ga0209371_1000069 3300027312 Bacteria 207967
364 Ga0209371_1000083 3300027312 Bacteria 184176
365 Ga0209371_1000149 3300027312 Bacteria 110455
366 Ga0209371_1000346 3300027312 Bacteria 50802
367 Ga0209371_1000351 3300027312 Bacteria 50314
368 Ga0209371_1000509 3300027312 Bacteria 37163
369 Ga0209371_1000663 3300027312 Bacteria 30042
370 Ga0209371_1000759 3300027312 Bacteria 26909
371 Ga0209371_1000804 3300027312 Bacteria 25939
372 Ga0209371_1002463 3300027312 Bacteria 10317
373 Ga0209371_1002564 3300027312 Bacteria 10026
374 Ga0209371_1002905 3300027312 Bacteria 8968
375 Ga0209371_1004479 3300027312 Bacteria 6038
376 Ga0209371_1005492 3300027312 Bacteria 5018
377 Ga0209371_1005938 3300027312 Bacteria 4689
378 Ga0209371_1010862 3300027312 Bacteria 2756
379 Ga0209969_1000081 3300027360 Bacteria 11756
380 Ga0209967_1001071 3300027364 Bacteria 3493
381 Ga0209996_1000001 3300027395 Bacteria 64824
382 Ga0209984_1002511 3300027424 Bacteria 2055
383 Ga0210000_1000003 3300027462 Bacteria 41189
384 Ga0209995_1000345 3300027471 Bacteria 7242
385 Ga0209968_1000643 3300027526 Bacteria 5392
386 Ga0209999_1000262 3300027543 Bacteria 7684
387 Ga0209982_1001101 3300027552 Bacteria 3614
388 Ga0209970_1008147 3300027614 Bacteria 1721
389 Ga0210002_1000075 3300027617 Bacteria 15616
390 Ga0209983_1001181 3300027665 Bacteria 5769
391 Ga0209971_1000339 3300027682 Bacteria 12903
392 Ga0209966_1000425 3300027695 Bacteria 12073
393 Ga0209998_10000165 3300027717 Bacteria 24428
394 Ga0209974_10002753 3300027876 Bacteria 6375
395 Ga0207428_10003400 3300027907 Bacteria 15468
396 Ga0268266_10000142 3300028379 Bacteria 138183
397 Ga0268266_10019945 3300028379 Bacteria 5713
398 Ga0268266_10032511 3300028379 Bacteria 4432
399 Ga0268266_10409747 3300028379 Bacteria 1283
400 Ga0268264_10045271 3300028381 Bacteria 3653
401 Ga0268264_10174290 3300028381 Bacteria 1948
402 Ga0265318_10047325 3300028577 Bacteria 1622
403 Ga0268256_1000014 3300030500 Bacteria 691435
404 Ga0268256_1000024 3300030500 Bacteria 488637
405 Ga0268256_1000066 3300030500 Bacteria 199115
406 Ga0268256_1000074 3300030500 Bacteria 184102
407 Ga0268256_1000293 3300030500 Bacteria 50802
408 Ga0268256_1000294 3300030500 Bacteria 50324
409 Ga0268256_1000734 3300030500 Bacteria 24107
410 Ga0268256_1000918 3300030500 Bacteria 20350
411 Ga0268256_1002265 3300030500 Bacteria 10026
412 Ga0268256_1002344 3300030500 Bacteria 9763
413 Ga0268256_1002373 3300030500 Bacteria 9687
414 Ga0268256_1002611 3300030500 Bacteria 8968
415 Ga0268256_1002616 3300030500 Bacteria 8950
416 Ga0268256_1004231 3300030500 Bacteria 6039
417 Ga0268256_1005400 3300030500 Bacteria 5018
418 Ga0268256_1010019 3300030500 Bacteria 3096
419 Ga0268256_1016374 3300030500 Bacteria 2128
420 Ga0265773_1002260 3300031018 Bacteria 1150
421 Ga0265330_10061813 3300031235 Bacteria 1629
422 Ga0265325_10008951 3300031241 Bacteria 5879
423 Ga0265325_10152706 3300031241 Bacteria 1091
424 Ga0265340_10001019 3300031247 Bacteria 15981
425 Ga0265340_10012971 3300031247 Bacteria 4391
426 Ga0265340_10078344 3300031247 Bacteria 1558
427 Ga0265339_10023636 3300031249 Bacteria 3551
428 Ga0307408_100135071 3300031548 Unclassified 1929
429 Ga0265313_10000522 3300031595 Bacteria 40272
430 Ga0265313_10013071 3300031595 Bacteria 5014
431 Ga0265313_10061307 3300031595 Bacteria 1761
432 Ga0307508_10056023 3300031616 Bacteria 3492
433 Ga0265314_10063845 3300031711 Bacteria 2496
434 Ga0265342_10006229 3300031712 Bacteria 8913
435 Ga0265342_10049960 3300031712 Bacteria 2500
436 Ga0307413_10118695 3300031824 Unclassified 1786
437 Ga0307410_10001871 3300031852 Bacteria 9814
438 Ga0307407_10084677 3300031903 Unclassified 1927
439 Ga0307409_100005707 3300031995 Bacteria 7213
440 Ga0307416_100001523 3300032002 Bacteria 12653
441 Ga0307416_100301569 3300032002 Bacteria 1593
442 Ga0307510_10159259 3300033180 Bacteria 1858
443 Ga0373948_0013266 3300034817 Bacteria 1485
444 Ga0373934_0021830 3300035086 Bacteria 2468
445 Ga0373940_0008837 3300035088 Bacteria 2325
446 Ga0373945_0002178 3300035116 Bacteria 6117
447 Ga0373954_0009647 3300035118 Bacteria 4249
448 Ga0373956_0000993 3300035119 Bacteria 11739
449 Ga0373956_0013098 3300035119 Bacteria 3448
450 Ga0373943_0065487 3300035170 Bacteria 1827
451 Ga0373943_0082662 3300035170 Bacteria 1649
452 Ga0373955_0016851 3300035172 Bacteria 3604
453 Ga0373955_0121647 3300035172 Bacteria 1518
454 Ga0373924_0006435 3300035410 Bacteria 4210
455 Ga0373931_0087138 3300035691 Bacteria 1734
456 Ga0373931_0102005 3300035691 Bacteria 1615
457 Ga0373935_0026077 3300035692 Bacteria 3604
458 Ga0373935_0063286 3300035692 Bacteria 2371
459 Ga0373927_0011124 3300035695 Bacteria 5993
460 Ga0373933_0004893 3300035724 Bacteria 7309
461 Ga0373933_0119911 3300035724 Bacteria 1647
462 Ga0373937_0000917 3300036401 Bacteria 24992
463 Ga0373925_0017742 3300037068 Bacteria 5165
464 Ga0373925_0046105 3300037068 Bacteria 3240
465 Ga0373925_0139808 3300037068 Bacteria 1894
466 Ga0400487_22513 3300039110 Bacteria 4494
467 Ga0436365_0471682 3300039437 Bacteria 352256
468 Ga0439438_000003 3300041405 Bacteria 464587
469 Ga0439438_000282 3300041405 Bacteria 22830
470 Ga0439438_000434 3300041405 Bacteria 19009
471 Ga0439447_000460 3300041407 Bacteria 15181
472 Ga0439447_001914 3300041407 Bacteria 7611
473 Ga0439447_002846 3300041407 Bacteria 6215
474 Ga0439466_0000002 3300041411 Bacteria 494198
475 Ga0439432_000566 3300042006 Bacteria 13854
476 Ga0439432_001003 3300042006 Bacteria 10667
477 Ga0439432_001530 3300042006 Bacteria 8686
478 Ga0439432_006918 3300042006 Bacteria 4035
479 Ga0439432_011946 3300042006 Bacteria 2983
480 Ga0439432_050471 3300042006 Bacteria 1298
481 Ga0439452_000004 3300042010 Bacteria 764268
482 Ga0439452_000011 3300042010 Bacteria 428451
483 Ga0439452_000078 3300042010 Bacteria 83572
484 Ga0439452_000079 3300042010 Bacteria 83084
485 Ga0439452_000498 3300042010 Bacteria 21480
486 Ga0439452_001372 3300042010 Bacteria 10056
487 Ga0439452_005027 3300042010 Bacteria 4320
488 Ga0439463_001405 3300042016 Bacteria 6397
489 Ga0450907_000011 3300042146 Bacteria 90100
490 Ga0439464_0000480 3300042439 Bacteria 8070
491 Ga0439464_0000835 3300042439 Bacteria 6808
492 Ga0439464_0002919 3300042439 Bacteria 4258
493 Ga0439464_0037258 3300042439 Bacteria 1379
494 Ga0466981_0000050 3300044669 Bacteria 33071
495 Ga0453683_0002183 3300044673 Bacteria 15564
496 Ga0495627_000017 3300046453 Bacteria 317280
497 Ga0495627_039039 3300046453 Bacteria 1466
498 Ga0495591_000010 3300046458 Bacteria 327794
499 Ga0495591_000090 3300046458 Bacteria 101695
500 Ga0495591_008692 3300046458 Bacteria 4131
501 Ga0495629_0004045 3300046459 Bacteria 11023
502 Ga0495629_0110851 3300046459 Bacteria 1913
503 Ga0495638_0009212 3300046460 Bacteria 6940
504 Ga0495651_0003405 3300046462 Bacteria 12195
505 Ga0495651_0108448 3300046462 Bacteria 2056
506 Ga0495653_0010771 3300046463 Bacteria 7488
507 Ga0495653_0076265 3300046463 Bacteria 2492
508 Ga0495653_0141771 3300046463 Bacteria 1689
509 Ga0495650_0000004 3300046471 Bacteria 779487
510 Ga0495650_0000040 3300046471 Bacteria 366254
511 Ga0495662_0000962 3300046476 Bacteria 14098
512 Ga0495662_0092255 3300046476 Bacteria 1477
513 Ga0495662_0145934 3300046476 Bacteria 1165
514 Ga0495664_0000189 3300046477 Bacteria 30129
515 Ga0495664_0057002 3300046477 Bacteria 2324
516 Ga0495664_0060025 3300046477 Bacteria 2264
517 Ga0495585_0003087 3300046492 Bacteria 11456
518 Ga0495607_0007704 3300046501 Bacteria 7417
519 Ga0495606_0000399 3300046507 Bacteria 73352
520 Ga0495608_0003600 3300046511 Bacteria 11116
521 Ga0495608_0074309 3300046511 Bacteria 2215
522 Ga0495616_0036251 3300046513 Bacteria 2546
523 Ga0495618_0005858 3300046514 Bacteria 7470
524 Ga0495618_0013451 3300046514 Bacteria 4976
525 Ga0495618_0113179 3300046514 Bacteria 1737
526 Ga0495620_0004428 3300046515 Bacteria 7923
527 Ga0495628_0064866 3300046516 Bacteria 2858
528 Ga0495630_0010043 3300046517 Bacteria 6817
529 Ga0495630_0062397 3300046517 Bacteria 2800
530 Ga0495637_0076767 3300046520 Bacteria 1338
531 Ga0495643_0009513 3300046522 Bacteria 6039
532 Ga0495643_0012022 3300046522 Bacteria 5239
533 Ga0495644_0001240 3300046523 Bacteria 10444
534 Ga0495648_0025365 3300046524 Bacteria 4015
535 Ga0495666_0130454 3300046526 Bacteria 1175
536 Ga0495652_0062255 3300046529 Bacteria 3146
537 Ga0495652_0156266 3300046529 Bacteria 1776
538 Ga0495654_0000036 3300046530 Bacteria 191434
539 Ga0495654_0000089 3300046530 Bacteria 102765
540 Ga0495654_0001414 3300046530 Bacteria 16623
541 Ga0495654_0006656 3300046530 Bacteria 6539
542 Ga0495654_0007828 3300046530 Bacteria 5941
543 Ga0495654_0011543 3300046530 Bacteria 4777
544 Ga0495665_0036818 3300046531 Bacteria 2611
545 Ga0495640_0017827 3300046533 Bacteria 5281
546 Ga0495640_0022695 3300046533 Bacteria 4582
547 Ga0495640_0047158 3300046533 Bacteria 2982
548 Ga0495586_0005750 3300046535 Bacteria 6630
549 Ga0495587_0002660 3300046536 Bacteria 11930
550 Ga0495587_0180924 3300046536 Bacteria 1195
551 Ga0495597_0001169 3300046542 Bacteria 19719
552 Ga0495645_0013174 3300046543 Bacteria 5845
553 Ga0495645_0084923 3300046543 Bacteria 2266
554 Ga0495667_0002184 3300046559 Bacteria 13079
555 Ga0495667_0031709 3300046559 Bacteria 3544
556 Ga0495668_0018313 3300046616 Bacteria 4047
557 Ga0495634_0030542 3300046642 Bacteria 3720
558 Ga0495625_0026706 3300046660 Bacteria 4357
559 Ga0495635_0005714 3300046663 Bacteria 8666
560 Ga0495588_0008161 3300046674 Bacteria 4793
561 Ga0495599_0010386 3300046678 Bacteria 5696
562 Ga0495599_0019612 3300046678 Bacteria 4215
563 Ga0495623_0001753 3300046679 Bacteria 14560
564 Ga0495646_0009424 3300046680 Bacteria 6195
565 Ga0495646_0129277 3300046680 Bacteria 1423
566 Ga0495658_0113114 3300046683 Bacteria 1634
567 Ga0495613_0015542 3300046689 Bacteria 5661
568 Ga0495613_0084733 3300046689 Bacteria 2301
569 Ga0495671_0001824 3300046692 Bacteria 13726
570 Ga0495649_0015867 3300046694 Bacteria 4279
571 Ga0495649_0085897 3300046694 Bacteria 1679
572 Ga0495589_0000013 3300046794 Bacteria 248616
573 Ga0495589_0001531 3300046794 Bacteria 13310
574 Ga0495600_0003284 3300046809 Bacteria 9481
575 Ga0495600_0222713 3300046809 Bacteria 1206
576 Ga0495660_0000022 3300046810 Bacteria 284337
577 Ga0495660_0000184 3300046810 Bacteria 67383
578 Ga0495660_0009386 3300046810 Bacteria 5705
579 Ga0495604_0001751 3300047317 Bacteria 17746
580 Ga0495636_0038768 3300047318 Bacteria 1972
581 Ga0495674_0010400 3300047319 Bacteria 8809
582 Ga0495674_0029546 3300047319 Bacteria 4989
583 Ga0495672_0000003 3300047320 Bacteria 728845
584 Ga0495672_0000082 3300047320 Bacteria 159422
585 Ga0495672_0000103 3300047320 Bacteria 136164
586 Ga0495676_0123587 3300047321 Bacteria 1879
587 Ga0495680_0001204 3300047322 Bacteria 28378
588 Ga0495675_0008632 3300047444 Bacteria 6317
589 Ga0495675_0017704 3300047444 Bacteria 4517
590 Ga0495679_000059 3300047446 Bacteria 109922
591 Ga0495679_001176 3300047446 Bacteria 15545
592 Ga0495673_0000011 3300047469 Bacteria 674140
593 Ga0495673_0000117 3300047469 Bacteria 148662
594 Ga0495681_0063598 3300047470 Bacteria 1693
595 Ga0495684_0027627 3300047471 Bacteria 4356
596 Ga0495684_0046434 3300047471 Bacteria 3322
597 Ga0495684_0196146 3300047471 Bacteria 1490
598 Ga0495686_0023082 3300047472 Bacteria 4110
599 Ga0495602_0054974 3300048088 Bacteria 3509
600 Ga0496100_0020046 3300048903 Bacteria 4002
601 Ga0496100_0021063 3300048903 Bacteria 3920
602 Ga0496100_0327114 3300048903 Bacteria 1153
603 Ga0496101_0000144 3300048904 Bacteria 63019
604 Ga0496102_0007586 3300048905 Bacteria 9267
605 Ga0496102_0124521 3300048905 Bacteria 2409
606 Ga0496102_0243430 3300048905 Bacteria 1696
607 Ga0496104_0000153 3300048907 Bacteria 63666
608 Ga0496104_0001602 3300048907 Bacteria 19480
609 Ga0496104_0072416 3300048907 Bacteria 3277
610 Ga0496104_0396721 3300048907 Bacteria 1292
611 Ga0496105_0008262 3300048908 Bacteria 8095
612 Ga0496105_0266126 3300048908 Bacteria 1385
613 Ga0496105_0364291 3300048908 Bacteria 1152
614 Ga0496107_0091072 3300048910 Bacteria 2229
615 Ga0496110_0070201 3300048913 Bacteria 3103
616 Ga0496111_0026200 3300048914 Bacteria 4117
617 Ga0496111_0170038 3300048914 Bacteria 1619
618 Ga0496111_0351684 3300048914 Bacteria 1091
619 Ga0496112_0072822 3300048915 Bacteria 3396
620 Ga0496113_0258725 3300048916 Bacteria 1390
621 Ga0496113_0276204 3300048916 Bacteria 1343
622 Ga0496114_0335312 3300048917 Bacteria 1337
623 Ga0496115_0041888 3300048918 Bacteria 3647
624 Ga0496116_0000009 3300048919 Bacteria 716119
625 Ga0496116_0000016 3300048919 Bacteria 555146
626 Ga0496116_0000148 3300048919 Bacteria 142458
627 Ga0496116_0000777 3300048919 Bacteria 40580
628 Ga0496116_0001014 3300048919 Bacteria 34246
629 Ga0496116_0002172 3300048919 Bacteria 20890
630 Ga0496116_0013724 3300048919 Bacteria 6513
631 Ga0496116_0086262 3300048919 Bacteria 1926
632 Ga0496116_0098066 3300048919 Bacteria 1759
633 Ga0496116_0129522 3300048919 Bacteria 1441
634 Ga0496116_0196610 3300048919 Bacteria 1060
635 Ga0496117_0000116 3300048920 Bacteria 178919
636 Ga0496117_0002487 3300048920 Bacteria 23118
637 Ga0496117_0005006 3300048920 Bacteria 14211
638 Ga0496117_0005369 3300048920 Bacteria 13499
639 Ga0496117_0005435 3300048920 Bacteria 13378
640 Ga0496117_0006918 3300048920 Bacteria 11245
641 Ga0496117_0035041 3300048920 Bacteria 3773
642 Ga0496117_0042050 3300048920 Bacteria 3340
643 Ga0496117_0052762 3300048920 Bacteria 2861
644 Ga0496117_0110532 3300048920 Bacteria 1713
645 Ga0496117_0115120 3300048920 Bacteria 1665
646 Ga0496117_0131419 3300048920 Bacteria 1516
647 Ga0496117_0175935 3300048920 Bacteria 1236
648 Ga0496117_0261191 3300048920 Bacteria 938
649 Ga0496118_0000906 3300048921 Bacteria 46311
650 Ga0496118_0001701 3300048921 Bacteria 32176
651 Ga0496118_0004732 3300048921 Bacteria 15930
652 Ga0496118_0004852 3300048921 Bacteria 15658
653 Ga0496118_0007265 3300048921 Bacteria 11805
654 Ga0496118_0007795 3300048921 Bacteria 11237
655 Ga0496118_0007826 3300048921 Bacteria 11209
656 Ga0496118_0013851 3300048921 Bacteria 7592
657 Ga0496118_0014265 3300048921 Bacteria 7452
658 Ga0496118_0015913 3300048921 Bacteria 6931
659 Ga0496118_0063118 3300048921 Bacteria 2728
660 Ga0496118_0131896 3300048921 Bacteria 1603
661 Ga0496119_0000096 3300048922 Bacteria 129464
662 Ga0496119_0000472 3300048922 Bacteria 54962
663 Ga0496119_0000586 3300048922 Bacteria 49220
664 Ga0496119_0002196 3300048922 Bacteria 21812
665 Ga0496119_0002287 3300048922 Bacteria 21206
666 Ga0496119_0002663 3300048922 Bacteria 19316
667 Ga0496119_0002975 3300048922 Bacteria 18006
668 Ga0496119_0003291 3300048922 Bacteria 16893
669 Ga0496119_0018393 3300048922 Bacteria 5202
670 Ga0496119_0019571 3300048922 Bacteria 4977
671 Ga0496119_0023595 3300048922 Bacteria 4355
672 Ga0496119_0046692 3300048922 Bacteria 2702
673 Ga0496119_0059638 3300048922 Bacteria 2290
674 Ga0496119_0152323 3300048922 Bacteria 1237
675 Ga0496120_0000068 3300048923 Bacteria 166108
676 Ga0496120_0000166 3300048923 Bacteria 111571
677 Ga0496120_0000389 3300048923 Bacteria 70922
678 Ga0496120_0000572 3300048923 Bacteria 56188
679 Ga0496120_0000602 3300048923 Bacteria 54478
680 Ga0496120_0001236 3300048923 Bacteria 32273
681 Ga0496120_0001364 3300048923 Bacteria 29931
682 Ga0496120_0001521 3300048923 Bacteria 27309
683 Ga0496120_0002363 3300048923 Bacteria 19342
684 Ga0496120_0006318 3300048923 Bacteria 9121
685 Ga0496120_0009015 3300048923 Bacteria 7131
686 Ga0496120_0024995 3300048923 Bacteria 3715
687 Ga0496120_0029973 3300048923 Bacteria 3315
688 Ga0496120_0045608 3300048923 Bacteria 2538
689 Ga0496120_0052555 3300048923 Bacteria 2319
690 Ga0496120_0075730 3300048923 Bacteria 1836
691 Ga0496120_0165239 3300048923 Bacteria 1099
692 Ga0496121_0000052 3300048924 Bacteria 313410
693 Ga0496121_0001407 3300048924 Bacteria 40738
694 Ga0496121_0003985 3300048924 Bacteria 20369
695 Ga0496121_0007946 3300048924 Bacteria 12678
696 Ga0496121_0010723 3300048924 Bacteria 10279
697 Ga0496121_0031562 3300048924 Bacteria 4836
698 Ga0496121_0091888 3300048924 Bacteria 2367
699 Ga0496121_0127925 3300048924 Bacteria 1906
700 Ga0496122_0000070 3300048925 Bacteria 223198
701 Ga0496122_0000392 3300048925 Bacteria 93045
702 Ga0496122_0002311 3300048925 Bacteria 27505
703 Ga0496122_0003665 3300048925 Bacteria 19943
704 Ga0496122_0008374 3300048925 Bacteria 11180
705 Ga0496122_0010138 3300048925 Bacteria 9768
706 Ga0496122_0012297 3300048925 Bacteria 8548
707 Ga0496122_0015706 3300048925 Bacteria 7220
708 Ga0496122_0024217 3300048925 Bacteria 5318
709 Ga0496122_0025645 3300048925 Bacteria 5112
710 Ga0496122_0078133 3300048925 Bacteria 2319
711 Ga0496123_0000017 3300048926 Bacteria 415261
712 Ga0496123_0000131 3300048926 Bacteria 153642
713 Ga0496123_0001554 3300048926 Bacteria 31553
714 Ga0496123_0001924 3300048926 Bacteria 27116
715 Ga0496123_0004679 3300048926 Bacteria 14185
716 Ga0496123_0006706 3300048926 Bacteria 11090
717 Ga0496123_0007192 3300048926 Bacteria 10563
718 Ga0496123_0052895 3300048926 Bacteria 2688
719 Ga0496123_0053471 3300048926 Bacteria 2668
720 Ga0496123_0073406 3300048926 Bacteria 2122
721 Ga0496123_0075724 3300048926 Bacteria 2075
722 Ga0496123_0098954 3300048926 Bacteria 1703
723 Ga0496124_0000053 3300048927 Bacteria 252285
724 Ga0496124_0000303 3300048927 Bacteria 91070
725 Ga0496124_0000630 3300048927 Bacteria 58501
726 Ga0496124_0001210 3300048927 Bacteria 39962
727 Ga0496124_0001921 3300048927 Bacteria 28471
728 Ga0496124_0002062 3300048927 Bacteria 27252
729 Ga0496124_0003880 3300048927 Bacteria 17881
730 Ga0496124_0004583 3300048927 Bacteria 16033
731 Ga0496124_0009686 3300048927 Bacteria 9864
732 Ga0496124_0011012 3300048927 Bacteria 9083
733 Ga0496124_0030577 3300048927 Bacteria 4777
734 Ga0496124_0031483 3300048927 Bacteria 4695
735 Ga0496124_0038930 3300048927 Bacteria 4124
736 Ga0496124_0040972 3300048927 Bacteria 4001
737 Ga0496124_0124721 3300048927 Bacteria 2053
738 Ga0496124_0127223 3300048927 Bacteria 2028
739 Ga0496125_0000056 3300048928 Bacteria 271016
740 Ga0496125_0000329 3300048928 Bacteria 91776
741 Ga0496125_0002880 3300048928 Bacteria 21658
742 Ga0496125_0008126 3300048928 Bacteria 11051
743 Ga0496125_0008724 3300048928 Bacteria 10549
744 Ga0496125_0014954 3300048928 Bacteria 7536
745 Ga0496126_0000137 3300048929 Bacteria 167415
746 Ga0496126_0000818 3300048929 Bacteria 55553
747 Ga0496126_0025978 3300048929 Bacteria 5622
748 Ga0496126_0035995 3300048929 Bacteria 4633
749 Ga0496126_0037205 3300048929 Bacteria 4543
750 Ga0496126_0039024 3300048929 Bacteria 4411
751 Ga0496126_0071555 3300048929 Bacteria 3086
752 Ga0495678_000142 3300049459 Bacteria 86788
753 Ga0495678_037537 3300049459 Bacteria 1967
754 Ga0495682_0000034 3300049460 Bacteria 131806
755 Ga0501033_0080497 3300049570 Bacteria 2390
756 Ga0501034_0050830 3300049571 Bacteria 4180
757 Ga0501034_0109009 3300049571 Bacteria 2760
758 Ga0501038_0211111 3300049574 Bacteria 1553
759 Ga0501046_0121964 3300049580 Bacteria 1983
760 Ga0501047_0013360 3300049581 Bacteria 7782
761 Ga0501047_0040203 3300049581 Bacteria 4523
762 Ga0501047_0052523 3300049581 Bacteria 3939
763 Ga0501047_0270655 3300049581 Bacteria 1545
764 Ga0501067_0008176 3300049583 Bacteria 5811
765 Ga0501067_0014574 3300049583 Bacteria 4352
766 Ga0501067_0026561 3300049583 Bacteria 3207
767 Ga0501068_0081154 3300049584 Bacteria 1991
768 Ga0501069_0022611 3300049585 Bacteria 3422
769 Ga0501069_0037274 3300049585 Bacteria 2683
770 Ga0501070_0007890 3300049586 Bacteria 9018
771 Ga0501070_0077636 3300049586 Bacteria 2748
772 Ga0501070_0252744 3300049586 Bacteria 1441
773 Ga0501072_0017632 3300049588 Bacteria 5491
774 Ga0501073_0032601 3300049589 Bacteria 3714
775 Ga0501074_0095267 3300049590 Bacteria 2132
776 Ga0501074_0216356 3300049590 Bacteria 1364
777 Ga0501076_0157277 3300049592 Bacteria 1851
778 Ga0501077_0029901 3300049593 Bacteria 3465
779 Ga0501233_018062 3300049668 Unclassified 1479
780 Ga0501079_0061509 3300049741 Bacteria 2897
781 Ga0501080_0072661 3300049742 Bacteria 3200
782 Ga0501080_0074653 3300049742 Bacteria 3154
783 Ga0501080_0105338 3300049742 Bacteria 2615
784 Ga0501083_0004742 3300049744 Bacteria 9604
785 Ga0501083_0018349 3300049744 Bacteria 4876
786 Ga0501083_0112220 3300049744 Bacteria 1791
787 Ga0501035_0003726 3300049822 Bacteria 14536
788 Ga0501035_0051407 3300049822 Bacteria 3690
789 Ga0501044_0034569 3300049823 Bacteria 5299
790 Ga0501044_0098397 3300049823 Bacteria 2945
791 Ga0501044_0245234 3300049823 Bacteria 1734
792 nmdc:mga00v17_12262_c1 3300050491 Bacteria 4728
793 nmdc:mga00v17_26883_c1 3300050491 Bacteria 3356
794 nmdc:mga00v17_37338_c1 3300050491 Bacteria 2900
795 nmdc:mga0k408_5714_c2 3300050493 Bacteria 4889
796 nmdc:mga05p37_72861_c1 3300050507 Bacteria 4227
797 nmdc:mga09592_14738_c1 3300050508 Bacteria 6378
798 nmdc:mga0qj67_41057_c1 3300050509 Bacteria 3638
799 nmdc:mga06r32_285292_c1 3300050510 Bacteria 1638
800 nmdc:mga0rr50_616455_c1 3300050513 Bacteria 925
801 nmdc:mga08x19_112405_c1 3300050514 Bacteria 1818
802 nmdc:mga08x19_145376_c1 3300050514 Bacteria 1603
803 nmdc:mga0a205_105968_c1 3300050515 Bacteria 2710
804 Ga0495601_0023347 3300053077 Bacteria 3799
805 Ga0495601_0026298 3300053077 Bacteria 3592
806 Ga0495601_0043811 3300053077 Bacteria 2811
807 Ga0495612_0000213 3300053078 Bacteria 24541
808 Ga0495595_0001849 3300053084 Bacteria 8223
809 Ga0495619_0000666 3300053085 Bacteria 22530
810 Ga0495619_0002522 3300053085 Bacteria 11978
811 Ga0500593_037334 3300053117 Bacteria 2176
812 Ga0500618_000706 3300053125 Bacteria 19584
813 Ga0500621_000010 3300053126 Bacteria 169537
814 Ga0500616_0002271 3300053153 Bacteria 16324
815 Ga0500627_0031176 3300053158 Bacteria 2238
816 Ga0501084_0052721 3300054114 Bacteria 3402
817 Ga0501084_0158231 3300054114 Bacteria 1911
818 Ga0501084_0200950 3300054114 Bacteria 1682
819 Ga0501084_0245643 3300054114 Bacteria 1511
820 Ga0501082_0025055 3300060353 Bacteria 5139
821 Ga0501082_0050044 3300060353 Bacteria 3603
822 Ga0501082_0067226 3300060353 Bacteria 3086
823 Ga0501082_0395879 3300060353 Bacteria 1205
824 Ga0501082_0434975 3300060353 Bacteria 1146
825 2506580567 2506520007 Bacteria 5442880
826 2506585706 2506520008 Bacteria 5443009
827 2508854364 2508501071 Bacteria 5454741
828 2511136599 2510917022 Bacteria 6504556
829 2511171945 2510917026 Bacteria 7046020
830 2511379640 2511231025 Bacteria 5324661
831 2511390338 2511231027 Bacteria 5013807
832 2511433686 2511231035 Bacteria 5341610
833 2524460110 2524023209 Bacteria 6679728
834 2535486069 2534681786 Bacteria 3308809
835 2547695979 2547132181 Bacteria 4945084
836 2548649439 2547132416 Bacteria 4633861
837 2555258926 2554235234 Bacteria 5762085
838 2562464635 2561511199 Bacteria 5155034
839 2585274244 2582581307 Bacteria 6597605
840 2585280343 2582581308 Bacteria 7413247
841 2585322621 2582581315 Bacteria 7318924
842 2585330734 2582581316 Bacteria 7774528
843 2585532573 2585427527 Bacteria 7273426
844 2585554411 2585427530 Bacteria 7383882
845 2585560693 2585427531 Bacteria 6992870
846 2585826374 2585427591 Bacteria 5482980
847 2585830592 2585427592 Bacteria 5370892
848 2585898899 2585427608 Bacteria 6544331
849 2585903509 2585427609 Bacteria 6667127
850 2587981372 2585428125 Bacteria 6662905
851 2599410304 2599185169 Bacteria 5441380
852 2599723280 2599185236 Bacteria 6875203
853 2601523516 2600255254 Bacteria 5281859
854 2601528675 2600255255 Bacteria 5282785
855 2601534441 2600255256 Bacteria 5597742
856 2601538780 2600255257 Bacteria 5597196
857 2601615508 2600255280 Bacteria 5292309
858 2601619566 2600255281 Bacteria 5288753
859 2601644019 2600255287 Bacteria 5210468
860 2601647971 2600255288 Bacteria 5282738
861 2601653560 2600255289 Bacteria 5281907
862 2601658319 2600255290 Bacteria 5282218
863 2601663844 2600255291 Bacteria 5217298
864 2601696275 2600255298 Bacteria 5215185
865 2601701476 2600255299 Bacteria 5218662
866 2601706215 2600255300 Bacteria 5287774
867 2601711800 2600255301 Bacteria 5280532
868 2601716818 2600255302 Bacteria 5288235
869 2601721299 2600255303 Bacteria 5219315
870 2601727224 2600255304 Bacteria 5283973
871 2601731764 2600255305 Bacteria 5282329
872 2601736776 2600255306 Bacteria 5281613
873 2601740258 2600255307 Bacteria 5439064
874 2601751195 2600255309 Bacteria 5431045
875 2601757129 2600255310 Bacteria 5600903
876 2601762270 2600255311 Bacteria 5598766
877 2602018945 2600255392 Bacteria 5437392
878 2603639478 2602042046 Bacteria 5483348
879 2603644345 2602042047 Bacteria 4697674
880 2603661232 2602042052 Bacteria 5215873
881 2603666507 2602042053 Bacteria 5214361
882 2603701130 2602042066 Bacteria 4423871
883 2603704952 2602042067 Bacteria 4863713
884 2603839161 2602042103 Bacteria 5284714
885 2603843579 2602042104 Bacteria 5281639
886 2603849318 2602042105 Bacteria 5282303
887 2603854388 2602042106 Bacteria 5282744
888 2603865727 2602042109 Bacteria 5152801
889 2603872443 2602042110 Bacteria 5283285
890 2603877319 2602042111 Bacteria 5212080
891 2606049624 2603880178 Bacteria 5283018
892 2606070939 2603880184 Bacteria 5217896
893 2606147308 2603880202 Bacteria 5284684
894 2606177033 2603880211 Bacteria 5284226
895 2608670723 2608642108 Bacteria 4104624
896 2609911397 2609459761 Bacteria 5513740
897 2616307356 2615840626 Bacteria 7921970
898 2616554900 2615840698 Bacteria 7319877
899 2617383572 2617270742 Bacteria 6808054
900 2637223134 2636415599 Bacteria 5718434
901 2650897363 2648501693 Bacteria 5069560
902 2656276360 2654587920 Bacteria 5475511
903 2671104529 2667528172 Bacteria 5170840
904 2671106668 2667528173 Bacteria 5375747
905 2671112149 2667528174 Bacteria 6435400
906 2671586135 2671180115 Bacteria 5353919
907 2676408675 2675903046 Bacteria 5451247
908 2681998109 2681812866 Bacteria 4552357
909 2682008229 2681812869 Bacteria 5014465
910 2686354666 2684622997 Bacteria 4624240
911 2689447121 2687453601 Bacteria 5546041
912 2707101139 2706794495 Bacteria 4536932
913 2712471306 2711768156 Bacteria 4471618
914 2738944469 2738541317 Bacteria 5340176
915 2739307524 2738543024 Bacteria 5603683
916 2753357266 2751185800 Bacteria 5467370
917 2753857741 2751185917 Bacteria 4551186
918 2757571324 2757320392 Bacteria 3737298
919 2758639672 2758568016 Bacteria 5645291
920 2765466346 2765235802 Bacteria 5618596
921 2765590856 2765235842 Bacteria 4799256
922 2770198979 2767802442 Bacteria 5747986
923 2772440923 2772190666 Bacteria 5117644
924 2775540423 2775506706 Bacteria 4873073
925 2776270248 2775506902 Bacteria 6208009
926 2776285023 2775506904 Bacteria 5954060
927 2777019458 2775507074 Bacteria 5532402
928 2778175966 2775507266 Bacteria 7392367
929 2792312562 2791355010 Bacteria 4864581
930 2793403862 2791355275 Bacteria 4429597
931 2807177024 2806310673 Bacteria 4801221
932 2809124013 2808606414 Bacteria 4917181
933 2813726765 2811995292 Bacteria 5303342
934 2814694138 2814123068 Bacteria 5687681
935 2819609645 2818991448 Bacteria 6772224
936 2819639742 2818991453 Bacteria 7181617
937 2821120739 2821118458 Bacteria 4714306
938 2823376617 2823373977 Bacteria 4779415
939 2828308496 2828305725 Bacteria 4916900
940 2838033088 2838029111 Bacteria 6603031
941 2839998308 2839993093 Bacteria 5512535
942 2840769141 2840764183 Bacteria 6358399
943 2842298664 2842298080 Bacteria 6123127
944 2842359469 2842357229 Bacteria 6485165
945 2842479821 2842475841 Bacteria 6603183
946 2842483433 2842482326 Bacteria 7212537
947 2842506997 2842502639 Bacteria 6604161
948 2842510692 2842509118 Bacteria 6850950
949 2842872306 2842871566 Bacteria 4827117
950 2844429230 2844425489 Bacteria 4854065
951 2844531327 2844528606 Bacteria 4733806
952 2847090311 2847085930 Bacteria 5070450
953 2847801538 2847797336 Bacteria 5176640
954 2852106051 2852103415 Bacteria 5193810
955 2852391149 2852387548 Bacteria 8025568
956 2854604941 2854601825 Bacteria 4797592
957 2854916733 2854911287 Bacteria 5582813
958 2865016085 2865014394 Bacteria 4764573
959 2869556529 2869551831 Bacteria 5474685
960 2876605890 2876601092 Bacteria 5114497
961 2881611337 2881609920 Bacteria 4405319
962 2884087012 2884086401 Bacteria 5005459
963 2888371028 2888366609 Bacteria 5155009
964 2888376270 2888373701 Bacteria 5098052
965 2891675504 2891670763 Bacteria 4967099
966 2894655577 2894652903 Bacteria 4587256
967 2899806464 2899803654 Bacteria 5577784
968 2904474184 2904474040 Bacteria 5504324
969 2904507199 2904504865 Bacteria 5152820
970 2904517048 2904513164 Bacteria 5476410
971 2904582283 2904578770 Bacteria 5302906
972 2908672870 2908669403 Bacteria 5740494
973 2909044673 2909042592 Bacteria 6499737
974 2913309088 2913308742 Bacteria 5350706
975 2915652011 2915650412 Bacteria 4288180
976 2919113496 2919108558 Bacteria 5897419
977 2919122933 2919119836 Bacteria 5208557
978 2919150531 2919150387 Bacteria 5500879
979 2919173348 2919171160 Bacteria 6499771
980 2919410634 2919408235 Bacteria 6149349
981 2923636747 2923634449 Bacteria 4753480
982 2927145404 2927143783 Bacteria 5504251
983 2927836792 2927833300 Bacteria 4923934
984 2928524227 2928521798 Bacteria 4960112
985 2932407119 2932406140 Bacteria 5134491
986 2935629514 2935625433 Bacteria 5042964
987 2937544128 2937539931 Bacteria 4639830
988 2937971236 2937967321 Bacteria 5094075
989 2939572431 2939568625 Bacteria 4542555
990 2939576605 2939573065 Bacteria 4926053
991 2939582359 2939577877 Bacteria 5132791
992 2939605876 2939602548 Bacteria 4950493
993 2939610573 2939607340 Bacteria 4719256
994 2939620577 2939617950 Bacteria 4820956
995 2939645642 2939642701 Bacteria 4475280
996 2945875828 2945874760 Bacteria 5527237
997 2945954543 2945951305 Bacteria 4918162
998 2954013176 2954011201 Bacteria 4762601
999 2969080165 2969079654 Bacteria 5439582
1000 2971821513 2971820967 Bacteria 5823634
1001 2974314915 2974310843 Bacteria 4947816
1002 2974440310 2974435778 Bacteria 4876478
1003 2978977016 2978975091 Bacteria 4704313
1004 2984498378 2984494565 Bacteria 5000175
1005 2984562620 2984559226 Bacteria 5683096
1006 2984600680 2984595703 Bacteria 5682994
1007 2990263480 2990261002 Bacteria 4919493
1008 2996312126 2996310559 Bacteria 6357320
1009 3000377475 3000376612 Bacteria 4705565
1010 3002145138 3002141150 Bacteria 5254435
1011 3005418530 3005416602 Bacteria 7064308
1012 640939924 640753048 Bacteria 5495657
1013 8002291629 8002285264 Bacteria 6717907
1014 8004593829 8004592986 Bacteria 5122074
1015 8005318578 8005314921 Bacteria 7072929
1016 8005488539 8005484373 Bacteria 6297373
1017 8005649006 8005645114 Bacteria 6950293
1018 8005662486 8005658619 Bacteria 4500593
1019 8005682246 8005682033 Bacteria 6726518
1020 8015397106 8015394850 Bacteria 5064660
1021 8016737432 8016733728 Bacteria 5274317
1022 8018226387 8018221730 Bacteria 4616064
1023 8018407095 8018405270 Bacteria 4978981
1024 8019502658 8019499862 Bacteria 5169538
1025 8019507466 8019504834 Bacteria 4819156
1026 8054848501 8054844752 Bacteria 4450330
1027 8054849760 8054849141 Bacteria 5232694
1028 8055089523 8055087960 Bacteria 4784273
1029 8055095992 8055092621 Bacteria 4873875
1030 8055101736 8055097453 Bacteria 4865496
1031 8055697674 8055693939 Bacteria 4772047
1032 8056876128 8056875544 Bacteria 4355797
1033 8057308474 8057304971 Bacteria 4649742
1034 8057580998 8057575449 Bacteria 7367519
1035 Ga0501084_0009351
1036 SwRhRL2b_contig_2229515
1037 JGI24740J21852_10000449
1038 JGI25156J39149_1000215
1039 JGI25162J39368_1000031
1040 JGI25162J39368_1000449
1041 JGI25162J39368_1000471
1042 JGI25154J39366_1000169
1043 JGI25157J39369_1000226
1044 JGI25163J39215_1000261
1045 JGI25164J39214_1000001
1046 JGI25152J39213_1000063
1047 JGI25159J45721_1000718
1048 JGI25165J46597_1000443
1049 JGI25165J46597_1001071
1050 JGI25165J46597_1006237
1051 rootH2_10324399
1052 JGI25160J50197_1000114
1053 JGI26145J50221_1000724
1054 JGI25161J50226_1000089
1055 Ga0055538_1000004
1056 Ga0055539_1000004
1057 Ga0055533_1000007
1058 Ga0055525_1000007
1059 Ga0055531_10013484
1060 Ga0055541_1000004
1061 Ga0058692_1001387
1062 Ga0058692_1002827
1063 Ga0058692_1008101
1064 Ga0058692_1009185
1065 Ga0058692_1016402
1066 Ga0058692_1028962
1067 Ga0055543_1000002
1068 Ga0065165_1000537
1069 Ga0065703_1018907
1070 Ga0065704_10001070
1071 Ga0065704_10001534
1072 Ga0065704_10001858
1073 Ga0065704_10002429
1074 Ga0065704_10006610
1075 Ga0065704_10013586
1076 Ga0065704_10093217
1077 Ga0065707_10108180
1078 Ga0070676_10027376
1079 Ga0070676_10140843
1080 Ga0070683_100027190
1081 Ga0070690_100000539
1082 Ga0070690_100010622
1083 Ga0070670_100017812
1084 Ga0070677_10014550
1085 Ga0068869_100044440
1086 Ga0068869_100347549
1087 Ga0070666_10027773
1088 Ga0070666_10155230
1089 Ga0070680_100040696
1090 Ga0068868_100016978
1091 Ga0070660_100019059
1092 Ga0070689_100016769
1093 Ga0070689_100021941
1094 Ga0070689_100031840
1095 Ga0070687_100000401
1096 Ga0070687_100042289
1097 Ga0070661_100012095
1098 Ga0070668_100022105
1099 Ga0070671_100004342
1100 Ga0070674_100001020
1101 Ga0070673_100002768
1102 Ga0070673_100036202
1103 Ga0070673_100067045
1104 Ga0070688_100108415
1105 Ga0070688_100129114
1106 Ga0070659_100011884
1107 Ga0070714_100023128
1108 Ga0070713_100066546
1109 Ga0070713_100156809
1110 Ga0070701_10083355
1111 Ga0070711_100009650
1112 Ga0070705_100005704
1113 Ga0070700_100007133
1114 Ga0070694_100024935
1115 Ga0070678_100015341
1116 Ga0070678_100015570
1117 Ga0070678_100020438
1118 Ga0070662_100002557
1119 Ga0070662_100004962
1120 Ga0070681_10009409
1121 Ga0068867_100002693
1122 Ga0070679_100021719
1123 Ga0070672_100006520
1124 Ga0070672_100056029
1125 Ga0070686_100002070
1126 Ga0070695_100056780
1127 Ga0070693_100070556
1128 Ga0070665_100002206
1129 Ga0070665_100010158
1130 Ga0070665_100031391
1131 Ga0070665_100048948
1132 Ga0070665_100178171
1133 Ga0070664_100001498
1134 Ga0070664_100017690
1135 Ga0068857_100000020
1136 Ga0068857_100030667
1137 Ga0070702_100053943
1138 Ga0068852_100014145
1139 Ga0068852_100049144
1140 Ga0068851_10000221
1141 Ga0068870_10005500
1142 Ga0068858_100033841
1143 Ga0068862_100180184
1144 Ga0081455_10030083
1145 Ga0070717_10181562
1146 Ga0075363_100106950
1147 Ga0075364_10021925
1148 Ga0070712_100004848
1149 Ga0075367_10151258
1150 Ga0075366_10002364
1151 Ga0097621_100022779
1152 Ga0068871_100306038
1153 Ga0075428_100323363
1154 Ga0075430_100123490
1155 Ga0075431_100041363
1156 Ga0075431_100070799
1157 Ga0075431_100198596
1158 Ga0075433_10014754
1159 Ga0075429_100005400
1160 Ga0075429_100014404
1161 Ga0075429_100444970
1162 Ga0068865_100002426
1163 Ga0068865_100154924
1164 Ga0079104_1000485
1165 Ga0079104_1000490
1166 Ga0079104_1000624
1167 Ga0079104_1000660
1168 Ga0079104_1001897
1169 Ga0079104_1002516
1170 Ga0079104_1002794
1171 Ga0079104_1006842
1172 Ga0079104_1014417
1173 Ga0075435_100162880
1174 Ga0105251_10001425
1175 Ga0105251_10002220
1176 Ga0105251_10002228
1177 Ga0105251_10002491
1178 Ga0105251_10002841
1179 Ga0105251_10005427
1180 Ga0105251_10008910
1181 Ga0105251_10011814
1182 Ga0105251_10015900
1183 Ga0105251_10088147
1184 Ga0105251_10101907
1185 Ga0105244_10000033
1186 Ga0105244_10000505
1187 Ga0105244_10000565
1188 Ga0105244_10000822
1189 Ga0105244_10001412
1190 Ga0105244_10002138
1191 Ga0105244_10002840
1192 Ga0105244_10004471
1193 Ga0105244_10005243
1194 Ga0105244_10018339
1195 Ga0105244_10076228
1196 Ga0105244_10099818
1197 Ga0105244_10156267
1198 Ga0105250_10000098
1199 Ga0105250_10000165
1200 Ga0105250_10000321
1201 Ga0105250_10000351
1202 Ga0105250_10001790
1203 Ga0105250_10004800
1204 Ga0105250_10006878
1205 Ga0105250_10015710
1206 Ga0105240_10000019
1207 Ga0105245_10007384
1208 Ga0105247_10000027
1209 Ga0114129_10063906
1210 Ga0105243_10001901
1211 Ga0105243_10003148
1212 Ga0105243_10003945
1213 Ga0105243_10157788
1214 Ga0105243_10267977
1215 Ga0105241_10000006
1216 Ga0105241_10017641
1217 Ga0105242_10003004
1218 Ga0105248_10444841
1219 Ga0105237_10002680
1220 Ga0105239_10002581
1221 Ga0105246_10004374
1222 Ga0105246_10122072
1223 Ga0105246_10172746
1224 Ga0157373_10000301
1225 Ga0157373_10002114
1226 Ga0157373_10014332
1227 Ga0157373_10016018
1228 Ga0157371_10000159
1229 Ga0157371_10000349
1230 Ga0157371_10001320
1231 Ga0157371_10001630
1232 Ga0157371_10020620
1233 Ga0157371_10022635
1234 Ga0157371_10110400
1235 Ga0157370_10001424
1236 Ga0157370_10003061
1237 Ga0157369_10024732
1238 Ga0157374_10010962
1239 Ga0157378_10016174
1240 Ga0163162_10008063
1241 Ga0157372_10000517
1242 Ga0157372_10008131
1243 Ga0157372_10165155
1244 Ga0157372_10183821
1245 Ga0157372_10207861
1246 Ga0157372_10273027
1247 Ga0157372_10275848
1248 Ga0157372_10472686
1249 Ga0157375_10211095
1250 Ga0163163_10041019
1251 Ga0163163_10165435
1252 Ga0157380_10099016
1253 Ga0182008_10021763
1254 Ga0182008_10025779
1255 Ga0182008_10058683
1256 Ga0182006_1000376
1257 Ga0182006_1000652
1258 Ga0182007_10032719
1259 Ga0182005_1002849
1260 Ga0183366_1002
1261 Ga0183370_1002
1262 Ga0183369_1002
1263 Ga0183368_1005
1264 Ga0163161_10000036
1265 Ga0163161_10143786
1266 Ga0163161_10151804
1267 Ga0163161_10157119
1268 Ga0213876_10000013
1269 Ga0228598_1000779
1270 Ga0209435_100005
1271 Ga0209760_100006
1272 Ga0209784_100001
1273 Ga0209566_100001
1274 Ga0209674_100002
1275 Ga0209563_100008
1276 Ga0207427_100002
1277 Ga0209437_100078
1278 Ga0209437_100114
1279 Ga0209437_100291
1280 Ga0209646_1000011
1281 Ga0209026_1000008
1282 Ga0209677_100004
1283 Ga0209677_100524
1284 Ga0209759_1000004
1285 Ga0209129_1000010
1286 Ga0209233_1000157
1287 Ga0209233_1000192
1288 Ga0209233_1000194
1289 Ga0209233_1001399
1290 Ga0209130_1000083
1291 Ga0209676_1020610
1292 Ga0209025_1024737
1293 Ga0209758_1000657
1294 Ga0209050_1030485
1295 Ga0207426_1000173
1296 Ga0209051_1017207
1297 Ga0209257_1005500
1298 Ga0207697_10106612
1299 Ga0207656_10015155
1300 Ga0207696_1000014
1301 Ga0207696_1000027
1302 Ga0207696_1000137
1303 Ga0207696_1000188
1304 Ga0207696_1000272
1305 Ga0207696_1000356
1306 Ga0207696_1000466
1307 Ga0207696_1000800
1308 Ga0207696_1007349
1309 Ga0207696_1023980
1310 Ga0207696_1035017
1311 Ga0207655_1000024
1312 Ga0207655_1000028
1313 Ga0207655_1000065
1314 Ga0207655_1000072
1315 Ga0207655_1000186
1316 Ga0207655_1000397
1317 Ga0207655_1001028
1318 Ga0207655_1001295
1319 Ga0207655_1001763
1320 Ga0207655_1003209
1321 Ga0207655_1003378
1322 Ga0207655_1005165
1323 Ga0207655_1008316
1324 Ga0207655_1011918
1325 Ga0207655_1032714
1326 Ga0207655_1068907
1327 Ga0207713_1000019
1328 Ga0207713_1000157
1329 Ga0207713_1000181
1330 Ga0207713_1000272
1331 Ga0207713_1000300
1332 Ga0207713_1000672
1333 Ga0207713_1004072
1334 Ga0207713_1007104
1335 Ga0207713_1009166
1336 Ga0207713_1030551
1337 Ga0207713_1034504
1338 Ga0207713_1090723
1339 Ga0207682_10004305
1340 Ga0207682_10048308
1341 Ga0207642_10052739
1342 Ga0207710_10000007
1343 Ga0207688_10019282
1344 Ga0207645_10000491
1345 Ga0207654_10000008
1346 Ga0207695_10000049
1347 Ga0207671_10000860
1348 Ga0207693_10001110
1349 Ga0207693_10003425
1350 Ga0207660_10196631
1351 Ga0207662_10001193
1352 Ga0207657_10001426
1353 Ga0207652_10022607
1354 Ga0207650_10026935
1355 Ga0207659_10012807
1356 Ga0207644_10052478
1357 Ga0207706_10000793
1358 Ga0207706_10005929
1359 Ga0207686_10029851
1360 Ga0207709_10000726
1361 Ga0207709_10138551
1362 Ga0207670_10006332
1363 Ga0207670_10039355
1364 Ga0207669_10002032
1365 Ga0207691_10000089
1366 Ga0207691_10032395
1367 Ga0207691_10224603
1368 Ga0207689_10005053
1369 Ga0207661_10036398
1370 Ga0207679_10005736
1371 Ga0207679_10099840
1372 Ga0207651_10020956
1373 Ga0207651_10152589
1374 Ga0207712_10140188
1375 Ga0207668_10005034
1376 Ga0207640_10059442
1377 Ga0207708_10000969
1378 Ga0207648_10006014
1379 Ga0207674_10000119
1380 Ga0207675_100025761
1381 Ga0207683_10000118
1382 Ga0207683_10369831
1383 Ga0209281_1000025
1384 Ga0209281_1000096
1385 Ga0209281_1000279
1386 Ga0209281_1000281
1387 Ga0209281_1000328
1388 Ga0209281_1000369
1389 Ga0209281_1000558
1390 Ga0209281_1000723
1391 Ga0209281_1000953
1392 Ga0209281_1001042
1393 Ga0209281_1002724
1394 Ga0209973_1000528
1395 Ga0209371_1000013
1396 Ga0209371_1000019
1397 Ga0209371_1000069
1398 Ga0209371_1000083
1399 Ga0209371_1000149
1400 Ga0209371_1000346
1401 Ga0209371_1000351
1402 Ga0209371_1000509
1403 Ga0209371_1000663
1404 Ga0209371_1000759
1405 Ga0209371_1000804
1406 Ga0209371_1002463
1407 Ga0209371_1002564
1408 Ga0209371_1002905
1409 Ga0209371_1004479
1410 Ga0209371_1005492
1411 Ga0209371_1005938
1412 Ga0209371_1010862
1413 Ga0209969_1000081
1414 Ga0209967_1001071
1415 Ga0209996_1000001
1416 Ga0209984_1002511
1417 Ga0210000_1000003
1418 Ga0209995_1000345
1419 Ga0209968_1000643
1420 Ga0209999_1000262
1421 Ga0209982_1001101
1422 Ga0209970_1008147
1423 Ga0210002_1000075
1424 Ga0209983_1001181
1425 Ga0209971_1000339
1426 Ga0209966_1000425
1427 Ga0209998_10000165
1428 Ga0209974_10002753
1429 Ga0207428_10003400
1430 Ga0268266_10000142
1431 Ga0268266_10019945
1432 Ga0268266_10032511
1433 Ga0268266_10409747
1434 Ga0268264_10045271
1435 Ga0268264_10174290
1436 Ga0265318_10047325
1437 Ga0268256_1000014
1438 Ga0268256_1000024
1439 Ga0268256_1000066
1440 Ga0268256_1000074
1441 Ga0268256_1000293
1442 Ga0268256_1000294
1443 Ga0268256_1000734
1444 Ga0268256_1000918
1445 Ga0268256_1002265
1446 Ga0268256_1002344
1447 Ga0268256_1002373
1448 Ga0268256_1002611
1449 Ga0268256_1002616
1450 Ga0268256_1004231
1451 Ga0268256_1005400
1452 Ga0268256_1010019
1453 Ga0268256_1016374
1454 Ga0265773_1002260
1455 Ga0265330_10061813
1456 Ga0265325_10008951
1457 Ga0265325_10152706
1458 Ga0265340_10001019
1459 Ga0265340_10012971
1460 Ga0265340_10078344
1461 Ga0265339_10023636
1462 Ga0307408_100135071
1463 Ga0265313_10000522
1464 Ga0265313_10013071
1465 Ga0265313_10061307
1466 Ga0307508_10056023
1467 Ga0265314_10063845
1468 Ga0265342_10006229
1469 Ga0265342_10049960
1470 Ga0307413_10118695
1471 Ga0307410_10001871
1472 Ga0307407_10084677
1473 Ga0307409_100005707
1474 Ga0307416_100001523
1475 Ga0307416_100301569
1476 Ga0307510_10159259
1477 Ga0373948_0013266
1478 Ga0373934_0021830
1479 Ga0373940_0008837
1480 Ga0373945_0002178
1481 Ga0373954_0009647
1482 Ga0373956_0000993
1483 Ga0373956_0013098
1484 Ga0373943_0065487
1485 Ga0373943_0082662
1486 Ga0373955_0016851
1487 Ga0373955_0121647
1488 Ga0373924_0006435
1489 Ga0373931_0087138
1490 Ga0373931_0102005
1491 Ga0373935_0026077
1492 Ga0373935_0063286
1493 Ga0373927_0011124
1494 Ga0373933_0004893
1495 Ga0373933_0119911
1496 Ga0373937_0000917
1497 Ga0373925_0017742
1498 Ga0373925_0046105
1499 Ga0373925_0139808
1500 Ga0400487_22513
1501 Ga0436365_0471682
1502 Ga0439438_000003
1503 Ga0439438_000282
1504 Ga0439438_000434
1505 Ga0439447_000460
1506 Ga0439447_001914
1507 Ga0439447_002846
1508 Ga0439466_0000002
1509 Ga0439432_000566
1510 Ga0439432_001003
1511 Ga0439432_001530
1512 Ga0439432_006918
1513 Ga0439432_011946
1514 Ga0439432_050471
1515 Ga0439452_000004
1516 Ga0439452_000011
1517 Ga0439452_000078
1518 Ga0439452_000079
1519 Ga0439452_000498
1520 Ga0439452_001372
1521 Ga0439452_005027
1522 Ga0439463_001405
1523 Ga0450907_000011
1524 Ga0439464_0000480
1525 Ga0439464_0000835
1526 Ga0439464_0002919
1527 Ga0439464_0037258
1528 Ga0466981_0000050
1529 Ga0453683_0002183
1530 Ga0495627_000017
1531 Ga0495627_039039
1532 Ga0495591_000010
1533 Ga0495591_000090
1534 Ga0495591_008692
1535 Ga0495629_0004045
1536 Ga0495629_0110851
1537 Ga0495638_0009212
1538 Ga0495651_0003405
1539 Ga0495651_0108448
1540 Ga0495653_0010771
1541 Ga0495653_0076265
1542 Ga0495653_0141771
1543 Ga0495650_0000004
1544 Ga0495650_0000040
1545 Ga0495662_0000962
1546 Ga0495662_0092255
1547 Ga0495662_0145934
1548 Ga0495664_0000189
1549 Ga0495664_0057002
1550 Ga0495664_0060025
1551 Ga0495585_0003087
1552 Ga0495607_0007704
1553 Ga0495606_0000399
1554 Ga0495608_0003600
1555 Ga0495608_0074309
1556 Ga0495616_0036251
1557 Ga0495618_0005858
1558 Ga0495618_0013451
1559 Ga0495618_0113179
1560 Ga0495620_0004428
1561 Ga0495628_0064866
1562 Ga0495630_0010043
1563 Ga0495630_0062397
1564 Ga0495637_0076767
1565 Ga0495643_0009513
1566 Ga0495643_0012022
1567 Ga0495644_0001240
1568 Ga0495648_0025365
1569 Ga0495666_0130454
1570 Ga0495652_0062255
1571 Ga0495652_0156266
1572 Ga0495654_0000036
1573 Ga0495654_0000089
1574 Ga0495654_0001414
1575 Ga0495654_0006656
1576 Ga0495654_0007828
1577 Ga0495654_0011543
1578 Ga0495665_0036818
1579 Ga0495640_0017827
1580 Ga0495640_0022695
1581 Ga0495640_0047158
1582 Ga0495586_0005750
1583 Ga0495587_0002660
1584 Ga0495587_0180924
1585 Ga0495597_0001169
1586 Ga0495645_0013174
1587 Ga0495645_0084923
1588 Ga0495667_0002184
1589 Ga0495667_0031709
1590 Ga0495668_0018313
1591 Ga0495634_0030542
1592 Ga0495625_0026706
1593 Ga0495635_0005714
1594 Ga0495588_0008161
1595 Ga0495599_0010386
1596 Ga0495599_0019612
1597 Ga0495623_0001753
1598 Ga0495646_0009424
1599 Ga0495646_0129277
1600 Ga0495658_0113114
1601 Ga0495613_0015542
1602 Ga0495613_0084733
1603 Ga0495671_0001824
1604 Ga0495649_0015867
1605 Ga0495649_0085897
1606 Ga0495589_0000013
1607 Ga0495589_0001531
1608 Ga0495600_0003284
1609 Ga0495600_0222713
1610 Ga0495660_0000022
1611 Ga0495660_0000184
1612 Ga0495660_0009386
1613 Ga0495604_0001751
1614 Ga0495636_0038768
1615 Ga0495674_0010400
1616 Ga0495674_0029546
1617 Ga0495672_0000003
1618 Ga0495672_0000082
1619 Ga0495672_0000103
1620 Ga0495676_0123587
1621 Ga0495680_0001204
1622 Ga0495675_0008632
1623 Ga0495675_0017704
1624 Ga0495679_000059
1625 Ga0495679_001176
1626 Ga0495673_0000011
1627 Ga0495673_0000117
1628 Ga0495681_0063598
1629 Ga0495684_0027627
1630 Ga0495684_0046434
1631 Ga0495684_0196146
1632 Ga0495686_0023082
1633 Ga0495602_0054974
1634 Ga0496100_0020046
1635 Ga0496100_0021063
1636 Ga0496100_0327114
1637 Ga0496101_0000144
1638 Ga0496102_0007586
1639 Ga0496102_0124521
1640 Ga0496102_0243430
1641 Ga0496104_0000153
1642 Ga0496104_0001602
1643 Ga0496104_0072416
1644 Ga0496104_0396721
1645 Ga0496105_0008262
1646 Ga0496105_0266126
1647 Ga0496105_0364291
1648 Ga0496107_0091072
1649 Ga0496110_0070201
1650 Ga0496111_0026200
1651 Ga0496111_0170038
1652 Ga0496111_0351684
1653 Ga0496112_0072822
1654 Ga0496113_0258725
1655 Ga0496113_0276204
1656 Ga0496114_0335312
1657 Ga0496115_0041888
1658 Ga0496116_0000009
1659 Ga0496116_0000016
1660 Ga0496116_0000148
1661 Ga0496116_0000777
1662 Ga0496116_0001014
1663 Ga0496116_0002172
1664 Ga0496116_0013724
1665 Ga0496116_0086262
1666 Ga0496116_0098066
1667 Ga0496116_0129522
1668 Ga0496116_0196610
1669 Ga0496117_0000116
1670 Ga0496117_0002487
1671 Ga0496117_0005006
1672 Ga0496117_0005369
1673 Ga0496117_0005435
1674 Ga0496117_0006918
1675 Ga0496117_0035041
1676 Ga0496117_0042050
1677 Ga0496117_0052762
1678 Ga0496117_0110532
1679 Ga0496117_0115120
1680 Ga0496117_0131419
1681 Ga0496117_0175935
1682 Ga0496117_0261191
1683 Ga0496118_0000906
1684 Ga0496118_0001701
1685 Ga0496118_0004732
1686 Ga0496118_0004852
1687 Ga0496118_0007265
1688 Ga0496118_0007795
1689 Ga0496118_0007826
1690 Ga0496118_0013851
1691 Ga0496118_0014265
1692 Ga0496118_0015913
1693 Ga0496118_0063118
1694 Ga0496118_0131896
1695 Ga0496119_0000096
1696 Ga0496119_0000472
1697 Ga0496119_0000586
1698 Ga0496119_0002196
1699 Ga0496119_0002287
1700 Ga0496119_0002663
1701 Ga0496119_0002975
1702 Ga0496119_0003291
1703 Ga0496119_0018393
1704 Ga0496119_0019571
1705 Ga0496119_0023595
1706 Ga0496119_0046692
1707 Ga0496119_0059638
1708 Ga0496119_0152323
1709 Ga0496120_0000068
1710 Ga0496120_0000166
1711 Ga0496120_0000389
1712 Ga0496120_0000572
1713 Ga0496120_0000602
1714 Ga0496120_0001236
1715 Ga0496120_0001364
1716 Ga0496120_0001521
1717 Ga0496120_0002363
1718 Ga0496120_0006318
1719 Ga0496120_0009015
1720 Ga0496120_0024995
1721 Ga0496120_0029973
1722 Ga0496120_0045608
1723 Ga0496120_0052555
1724 Ga0496120_0075730
1725 Ga0496120_0165239
1726 Ga0496121_0000052
1727 Ga0496121_0001407
1728 Ga0496121_0003985
1729 Ga0496121_0007946
1730 Ga0496121_0010723
1731 Ga0496121_0031562
1732 Ga0496121_0091888
1733 Ga0496121_0127925
1734 Ga0496122_0000070
1735 Ga0496122_0000392
1736 Ga0496122_0002311
1737 Ga0496122_0003665
1738 Ga0496122_0008374
1739 Ga0496122_0010138
1740 Ga0496122_0012297
1741 Ga0496122_0015706
1742 Ga0496122_0024217
1743 Ga0496122_0025645
1744 Ga0496122_0078133
1745 Ga0496123_0000017
1746 Ga0496123_0000131
1747 Ga0496123_0001554
1748 Ga0496123_0001924
1749 Ga0496123_0004679
1750 Ga0496123_0006706
1751 Ga0496123_0007192
1752 Ga0496123_0052895
1753 Ga0496123_0053471
1754 Ga0496123_0073406
1755 Ga0496123_0075724
1756 Ga0496123_0098954
1757 Ga0496124_0000053
1758 Ga0496124_0000303
1759 Ga0496124_0000630
1760 Ga0496124_0001210
1761 Ga0496124_0001921
1762 Ga0496124_0002062
1763 Ga0496124_0003880
1764 Ga0496124_0004583
1765 Ga0496124_0009686
1766 Ga0496124_0011012
1767 Ga0496124_0030577
1768 Ga0496124_0031483
1769 Ga0496124_0038930
1770 Ga0496124_0040972
1771 Ga0496124_0124721
1772 Ga0496124_0127223
1773 Ga0496125_0000056
1774 Ga0496125_0000329
1775 Ga0496125_0002880
1776 Ga0496125_0008126
1777 Ga0496125_0008724
1778 Ga0496125_0014954
1779 Ga0496126_0000137
1780 Ga0496126_0000818
1781 Ga0496126_0025978
1782 Ga0496126_0035995
1783 Ga0496126_0037205
1784 Ga0496126_0039024
1785 Ga0496126_0071555
1786 Ga0495678_000142
1787 Ga0495678_037537
1788 Ga0495682_0000034
1789 Ga0501033_0080497
1790 Ga0501034_0050830
1791 Ga0501034_0109009
1792 Ga0501038_0211111
1793 Ga0501046_0121964
1794 Ga0501047_0013360
1795 Ga0501047_0040203
1796 Ga0501047_0052523
1797 Ga0501047_0270655
1798 Ga0501067_0008176
1799 Ga0501067_0014574
1800 Ga0501067_0026561
1801 Ga0501068_0081154
1802 Ga0501069_0022611
1803 Ga0501069_0037274
1804 Ga0501070_0007890
1805 Ga0501070_0077636
1806 Ga0501070_0252744
1807 Ga0501072_0017632
1808 Ga0501073_0032601
1809 Ga0501074_0095267
1810 Ga0501074_0216356
1811 Ga0501076_0157277
1812 Ga0501077_0029901
1813 Ga0501233_018062
1814 Ga0501079_0061509
1815 Ga0501080_0072661
1816 Ga0501080_0074653
1817 Ga0501080_0105338
1818 Ga0501083_0004742
1819 Ga0501083_0018349
1820 Ga0501083_0112220
1821 Ga0501035_0003726
1822 Ga0501035_0051407
1823 Ga0501044_0034569
1824 Ga0501044_0098397
1825 Ga0501044_0245234
1826 nmdc:mga00v17_12262_c1
1827 nmdc:mga00v17_26883_c1
1828 nmdc:mga00v17_37338_c1
1829 nmdc:mga0k408_5714_c2
1830 nmdc:mga05p37_72861_c1
1831 nmdc:mga09592_14738_c1
1832 nmdc:mga0qj67_41057_c1
1833 nmdc:mga06r32_285292_c1
1834 nmdc:mga0rr50_616455_c1
1835 nmdc:mga08x19_112405_c1
1836 nmdc:mga08x19_145376_c1
1837 nmdc:mga0a205_105968_c1
1838 Ga0495601_0023347
1839 Ga0495601_0026298
1840 Ga0495601_0043811
1841 Ga0495612_0000213
1842 Ga0495595_0001849
1843 Ga0495619_0000666
1844 Ga0495619_0002522
1845 Ga0500593_037334
1846 Ga0500618_000706
1847 Ga0500621_000010
1848 Ga0500616_0002271
1849 Ga0500627_0031176
1850 Ga0501084_0052721
1851 Ga0501084_0158231
1852 Ga0501084_0200950
1853 Ga0501084_0245643
1854 Ga0501082_0025055
1855 Ga0501082_0050044
1856 Ga0501082_0067226
1857 Ga0501082_0395879
1858 Ga0501082_0434975
1859 2506580567
1860 2506585706
1861 2508854364
1862 2511136599
1863 2511171945
1864 2511379640
1865 2511390338
1866 2511433686
1867 2524460110
1868 2535486069
1869 2547695979
1870 2548649439
1871 2555258926
1872 2562464635
1873 2585274244
1874 2585280343
1875 2585322621
1876 2585330734
1877 2585532573
1878 2585554411
1879 2585560693
1880 2585826374
1881 2585830592
1882 2585898899
1883 2585903509
1884 2587981372
1885 2599410304
1886 2599723280
1887 2601523516
1888 2601528675
1889 2601534441
1890 2601538780
1891 2601615508
1892 2601619566
1893 2601644019
1894 2601647971
1895 2601653560
1896 2601658319
1897 2601663844
1898 2601696275
1899 2601701476
1900 2601706215
1901 2601711800
1902 2601716818
1903 2601721299
1904 2601727224
1905 2601731764
1906 2601736776
1907 2601740258
1908 2601751195
1909 2601757129
1910 2601762270
1911 2602018945
1912 2603639478
1913 2603644345
1914 2603661232
1915 2603666507
1916 2603701130
1917 2603704952
1918 2603839161
1919 2603843579
1920 2603849318
1921 2603854388
1922 2603865727
1923 2603872443
1924 2603877319
1925 2606049624
1926 2606070939
1927 2606147308
1928 2606177033
1929 2608670723
1930 2609911397
1931 2616307356
1932 2616554900
1933 2617383572
1934 2637223134
1935 2650897363
1936 2656276360
1937 2671104529
1938 2671106668
1939 2671112149
1940 2671586135
1941 2676408675
1942 2681998109
1943 2682008229
1944 2686354666
1945 2689447121
1946 2707101139
1947 2712471306
1948 2738944469
1949 2739307524
1950 2753357266
1951 2753857741
1952 2757571324
1953 2758639672
1954 2765466346
1955 2765590856
1956 2770198979
1957 2772440923
1958 2775540423
1959 2776270248
1960 2776285023
1961 2777019458
1962 2778175966
1963 2792312562
1964 2793403862
1965 2807177024
1966 2809124013
1967 2813726765
1968 2814694138
1969 2819609645
1970 2819639742
1971 2821120739
1972 2823376617
1973 2828308496
1974 2838033088
1975 2839998308
1976 2840769141
1977 2842298664
1978 2842359469
1979 2842479821
1980 2842483433
1981 2842506997
1982 2842510692
1983 2842872306
1984 2844429230
1985 2844531327
1986 2847090311
1987 2847801538
1988 2852106051
1989 2852391149
1990 2854604941
1991 2854916733
1992 2865016085
1993 2869556529
1994 2876605890
1995 2881611337
1996 2884087012
1997 2888371028
1998 2888376270
1999 2891675504
2000 2894655577
2001 2899806464
2002 2904474184
2003 2904507199
2004 2904517048
2005 2904582283
2006 2908672870
2007 2909044673
2008 2913309088
2009 2915652011
2010 2919113496
2011 2919122933
2012 2919150531
2013 2919173348
2014 2919410634
2015 2923636747
2016 2927145404
2017 2927836792
2018 2928524227
2019 2932407119
2020 2935629514
2021 2937544128
2022 2937971236
2023 2939572431
2024 2939576605
2025 2939582359
2026 2939605876
2027 2939610573
2028 2939620577
2029 2939645642
2030 2945875828
2031 2945954543
2032 2954013176
2033 2969080165
2034 2971821513
2035 2974314915
2036 2974440310
2037 2978977016
2038 2984498378
2039 2984562620
2040 2984600680
2041 2990263480
2042 2996312126
2043 3000377475
2044 3002145138
2045 3005418530
2046 640939924
2047 8002291629
2048 8004593829
2049 8005318578
2050 8005488539
2051 8005649006
2052 8005662486
2053 8005682246
2054 8015397106
2055 8016737432
2056 8018226387
2057 8018407095
2058 8019502658
2059 8019507466
2060 8054848501
2061 8054849760
2062 8055089523
2063 8055095992
2064 8055101736
2065 8055697674
2066 8056876128
2067 8057308474
2068 8057580998

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01380

SIS

SIS domain

78

211

0.97

PF00571

CBS

CBS domain

305

360

0.94

PF00571

CBS

CBS domain

239

297

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9864 10 183
2xhz-assembly1.cif.gz_B probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography 0.9808 10 183
3fna-assembly3.cif.gz_A crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 0.9744 198 322
3fna-assembly3.cif.gz_B-2 crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 0.9705 199 324
3k2v-assembly1.cif.gz_B structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from klebsiella pneumoniae subsp. pneumoniae. 0.9698 198 324
ID Description Score Start End Superfamily
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 1.001 202 324 3.10.580.10
af_P45395_202_325_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9846 202 324 3.10.580.10
3fnaA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9677 198 322 3.10.580.10
3fnaA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9509 198 322 3.10.580.10
af_P45395_11_201_3.40.50.10490 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.95 11 200 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A656SJ60-F1-model_v4 deleted 0.9975 45 126
AF-A0A4V2AMI0-F1-model_v4 SIS domain-containing protein 0.9783 23 168 GO:0097367
GO:1901135
AF-A0A832J690-F1-model_v4 CBS domain-containing protein 0.9632 229 328
AF-A0A656SJ60-F1-model_v4 deleted 0.9624 45 126
AF-A0A382IFM7-F1-model_v4 SIS domain-containing protein 0.9594 10 131 GO:0097367
GO:1901135

Map