F488688
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1034 | 587 | 2068 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300054114|Ga0501084_0009351|Ga0501084_0009351_6938_8020 |
| Length | 360 |
| Sequence | MVARPPPVGSGTPAKLLNPSRNKQGQPVAASPKPAGRPADGAVASALRTITTERTGLDALAAALAGALAEPFAATVKVIRQARGRVIVSGVGKSGHVARKIASTLASTGTPAFFVHPAEASHGDLGMVTPDDVIVALSWSGESAELRSVVEHSRRFRIPLVAFTSAPDSTLARKSDHVLLLPRADEACPHGLSPTTSALMQLALGDALAIALLEDRGFSAEDFHVLHPGGKLGASLHFVRDVMHQDAAVPLIGPGATLGEAILTIGEKRLGCVGVVDDGGKLIGIITDGDVRRHLTGDDPLAAPVQAVMTRTPKTIAPDALVGTALDLLNKTKITALFVVDAGKPLGVVHMHDLLRIGVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 16 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 17 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 120 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 121 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 122 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 126 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 210 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 217 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 222 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 223 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 239 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 240 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 245 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 246 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 247 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 248 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 249 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 250 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 251 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 252 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 253 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 254 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 327 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 328 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 329 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 330 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 331 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 332 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 333 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 334 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 335 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 336 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 337 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 354 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 373 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 375 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 377 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 379 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 380 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 381 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 382 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 383 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 384 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 385 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 386 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 387 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 388 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 389 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 390 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 391 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 392 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 393 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 394 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 395 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 396 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 397 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 398 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 399 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 400 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 401 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 402 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 403 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 404 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 405 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 406 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 407 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 408 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 409 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 410 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 411 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 412 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 413 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 414 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 415 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 416 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 417 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 418 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 419 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 420 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 421 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 422 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 423 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 424 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 425 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 426 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 427 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 428 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 429 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 430 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 431 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 432 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 433 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 434 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 435 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 436 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 437 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 438 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 439 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 440 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 441 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 442 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 443 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 444 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 445 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 446 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 447 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 448 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 449 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 450 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 451 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 452 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 453 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 454 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 455 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 456 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 457 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 458 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 459 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 460 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 461 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 462 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 463 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 464 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 465 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 466 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 467 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 468 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 469 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 470 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 471 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 472 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 473 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 474 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 475 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 476 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 477 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 478 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 479 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 480 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 481 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 482 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 483 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 484 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 485 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 486 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 487 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 488 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 489 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 490 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 491 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 492 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 493 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 494 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 495 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 496 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 497 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 498 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 499 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 500 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 501 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 502 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 503 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 504 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 505 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 506 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 507 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 508 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 509 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 510 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 511 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 512 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 513 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 514 | 2881609920 | Pantoea sp. ARC607 | Isolate | Rhizosphere |
| 515 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 516 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 517 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 518 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 519 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 520 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 521 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 522 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 523 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 524 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 525 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 526 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 527 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 528 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 529 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 530 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 531 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 532 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 533 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 534 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 535 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 536 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 537 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 538 | 2932406140 | Serratia sp. 2723 | Isolate | Rhizosphere |
| 539 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 540 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 541 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 542 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 543 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 544 | 2939577877 | Serratia sp. 509 | Isolate | Rhizosphere |
| 545 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 546 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 547 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 548 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 549 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 550 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 551 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 552 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 553 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 554 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 555 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 556 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 557 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 558 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 559 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 560 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 561 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 562 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 563 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 564 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 565 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 566 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 567 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 568 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 569 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 570 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 571 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 572 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 573 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 574 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
| 575 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 576 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 577 | 8019499862 | Kluyvera sp. 1366 | Isolate | Rhizosphere |
| 578 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 579 | 8054844752 | Dryocola boscaweniae H18W14 | Isolate | Rhizosphere |
| 580 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 581 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 582 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 583 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 584 | 8055693939 | Hafnia alvei A23BA | Isolate | Rhizosphere |
| 585 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 586 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 587 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.59 |
| Metatranscriptomes | 0.1 |
| Isolates | 20.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.39 |
| Bulb | 0.1 |
| Endosphere | 5.61 |
| Nodule | 3.68 |
| Rhizoplane | 7.83 |
| Rhizosphere | 63.06 |
| Stem | 0.1 |
| Stem Tuber | 0.1 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501084_0009351 | 3300054114 | Bacteria | 8112 |
| 2 | SwRhRL2b_contig_2229515 | 2162886007 | Bacteria | 1041 |
| 3 | JGI24740J21852_10000449 | 3300001979 | Bacteria | 17614 |
| 4 | JGI25156J39149_1000215 | 3300002705 | Bacteria | 40194 |
| 5 | JGI25162J39368_1000031 | 3300002737 | Bacteria | 210480 |
| 6 | JGI25162J39368_1000449 | 3300002737 | Bacteria | 32568 |
| 7 | JGI25162J39368_1000471 | 3300002737 | Bacteria | 31064 |
| 8 | JGI25154J39366_1000169 | 3300002738 | Bacteria | 50665 |
| 9 | JGI25157J39369_1000226 | 3300002741 | Bacteria | 44207 |
| 10 | JGI25163J39215_1000261 | 3300002771 | Bacteria | 18973 |
| 11 | JGI25164J39214_1000001 | 3300002772 | Bacteria | 477015 |
| 12 | JGI25152J39213_1000063 | 3300002773 | Bacteria | 71659 |
| 13 | JGI25159J45721_1000718 | 3300002987 | Bacteria | 14447 |
| 14 | JGI25165J46597_1000443 | 3300003214 | Bacteria | 41663 |
| 15 | JGI25165J46597_1001071 | 3300003214 | Bacteria | 17571 |
| 16 | JGI25165J46597_1006237 | 3300003214 | Bacteria | 2140 |
| 17 | rootH2_10324399 | 3300003320 | Bacteria | 1632 |
| 18 | JGI25160J50197_1000114 | 3300003354 | Bacteria | 75947 |
| 19 | JGI26145J50221_1000724 | 3300003371 | Bacteria | 2707 |
| 20 | JGI25161J50226_1000089 | 3300003374 | Bacteria | 73775 |
| 21 | Ga0055538_1000004 | 3300003751 | Bacteria | 615646 |
| 22 | Ga0055539_1000004 | 3300003752 | Bacteria | 615646 |
| 23 | Ga0055533_1000007 | 3300003756 | Bacteria | 615646 |
| 24 | Ga0055525_1000007 | 3300003759 | Bacteria | 615646 |
| 25 | Ga0055531_10013484 | 3300003794 | Bacteria | 3762 |
| 26 | Ga0055541_1000004 | 3300003841 | Bacteria | 615646 |
| 27 | Ga0058692_1001387 | 3300003856 | Bacteria | 8962 |
| 28 | Ga0058692_1002827 | 3300003856 | Bacteria | 5690 |
| 29 | Ga0058692_1008101 | 3300003856 | Bacteria | 2726 |
| 30 | Ga0058692_1009185 | 3300003856 | Bacteria | 2506 |
| 31 | Ga0058692_1016402 | 3300003856 | Bacteria | 1646 |
| 32 | Ga0058692_1028962 | 3300003856 | Bacteria | 1064 |
| 33 | Ga0055543_1000002 | 3300004625 | Bacteria | 390020 |
| 34 | Ga0065165_1000537 | 3300005262 | Bacteria | 57544 |
| 35 | Ga0065703_1018907 | 3300005272 | Bacteria | 5240 |
| 36 | Ga0065704_10001070 | 3300005289 | Bacteria | 9761 |
| 37 | Ga0065704_10001534 | 3300005289 | Bacteria | 24742 |
| 38 | Ga0065704_10001858 | 3300005289 | Bacteria | 23782 |
| 39 | Ga0065704_10002429 | 3300005289 | Bacteria | 11867 |
| 40 | Ga0065704_10006610 | 3300005289 | Bacteria | 4362 |
| 41 | Ga0065704_10013586 | 3300005289 | Bacteria | 1491 |
| 42 | Ga0065704_10093217 | 3300005289 | Bacteria | 2610 |
| 43 | Ga0065707_10108180 | 3300005295 | Bacteria | 2521 |
| 44 | Ga0070676_10027376 | 3300005328 | Bacteria | 3232 |
| 45 | Ga0070676_10140843 | 3300005328 | Bacteria | 1535 |
| 46 | Ga0070683_100027190 | 3300005329 | Bacteria | 5159 |
| 47 | Ga0070690_100000539 | 3300005330 | Bacteria | 18931 |
| 48 | Ga0070690_100010622 | 3300005330 | Bacteria | 5362 |
| 49 | Ga0070670_100017812 | 3300005331 | Bacteria | 6095 |
| 50 | Ga0070677_10014550 | 3300005333 | Bacteria | 2771 |
| 51 | Ga0068869_100044440 | 3300005334 | Bacteria | 3195 |
| 52 | Ga0068869_100347549 | 3300005334 | Bacteria | 1208 |
| 53 | Ga0070666_10027773 | 3300005335 | Bacteria | 3708 |
| 54 | Ga0070666_10155230 | 3300005335 | Bacteria | 1598 |
| 55 | Ga0070680_100040696 | 3300005336 | Bacteria | 3765 |
| 56 | Ga0068868_100016978 | 3300005338 | Bacteria | 5416 |
| 57 | Ga0070660_100019059 | 3300005339 | Bacteria | 5024 |
| 58 | Ga0070689_100016769 | 3300005340 | Bacteria | 5366 |
| 59 | Ga0070689_100021941 | 3300005340 | Bacteria | 4761 |
| 60 | Ga0070689_100031840 | 3300005340 | Bacteria | 4008 |
| 61 | Ga0070687_100000401 | 3300005343 | Bacteria | 14719 |
| 62 | Ga0070687_100042289 | 3300005343 | Bacteria | 2308 |
| 63 | Ga0070661_100012095 | 3300005344 | Bacteria | 6032 |
| 64 | Ga0070668_100022105 | 3300005347 | Bacteria | 4808 |
| 65 | Ga0070671_100004342 | 3300005355 | Bacteria | 11219 |
| 66 | Ga0070674_100001020 | 3300005356 | Bacteria | 14599 |
| 67 | Ga0070673_100002768 | 3300005364 | Bacteria | 10780 |
| 68 | Ga0070673_100036202 | 3300005364 | Bacteria | 3749 |
| 69 | Ga0070673_100067045 | 3300005364 | Bacteria | 2869 |
| 70 | Ga0070688_100108415 | 3300005365 | Bacteria | 1843 |
| 71 | Ga0070688_100129114 | 3300005365 | Bacteria | 1703 |
| 72 | Ga0070659_100011884 | 3300005366 | Bacteria | 6445 |
| 73 | Ga0070714_100023128 | 3300005435 | Bacteria | 5102 |
| 74 | Ga0070713_100066546 | 3300005436 | Bacteria | 3031 |
| 75 | Ga0070713_100156809 | 3300005436 | Bacteria | 2029 |
| 76 | Ga0070701_10083355 | 3300005438 | Bacteria | 1736 |
| 77 | Ga0070711_100009650 | 3300005439 | Bacteria | 5948 |
| 78 | Ga0070705_100005704 | 3300005440 | Bacteria | 6080 |
| 79 | Ga0070700_100007133 | 3300005441 | Bacteria | 6015 |
| 80 | Ga0070694_100024935 | 3300005444 | Bacteria | 3864 |
| 81 | Ga0070678_100015341 | 3300005456 | Bacteria | 4867 |
| 82 | Ga0070678_100015570 | 3300005456 | Bacteria | 4836 |
| 83 | Ga0070678_100020438 | 3300005456 | Bacteria | 4344 |
| 84 | Ga0070662_100002557 | 3300005457 | Bacteria | 11203 |
| 85 | Ga0070662_100004962 | 3300005457 | Bacteria | 8453 |
| 86 | Ga0070681_10009409 | 3300005458 | Bacteria | 9616 |
| 87 | Ga0068867_100002693 | 3300005459 | Bacteria | 12530 |
| 88 | Ga0070679_100021719 | 3300005530 | Bacteria | 6269 |
| 89 | Ga0070672_100006520 | 3300005543 | Bacteria | 7846 |
| 90 | Ga0070672_100056029 | 3300005543 | Bacteria | 3090 |
| 91 | Ga0070686_100002070 | 3300005544 | Bacteria | 11080 |
| 92 | Ga0070695_100056780 | 3300005545 | Bacteria | 2527 |
| 93 | Ga0070693_100070556 | 3300005547 | Bacteria | 2056 |
| 94 | Ga0070665_100002206 | 3300005548 | Bacteria | 21732 |
| 95 | Ga0070665_100010158 | 3300005548 | Bacteria | 9520 |
| 96 | Ga0070665_100031391 | 3300005548 | Bacteria | 5348 |
| 97 | Ga0070665_100048948 | 3300005548 | Bacteria | 4242 |
| 98 | Ga0070665_100178171 | 3300005548 | Bacteria | 2126 |
| 99 | Ga0070664_100001498 | 3300005564 | Bacteria | 18609 |
| 100 | Ga0070664_100017690 | 3300005564 | Bacteria | 5854 |
| 101 | Ga0068857_100000020 | 3300005577 | Bacteria | 89305 |
| 102 | Ga0068857_100030667 | 3300005577 | Bacteria | 4749 |
| 103 | Ga0070702_100053943 | 3300005615 | Bacteria | 2311 |
| 104 | Ga0068852_100014145 | 3300005616 | Bacteria | 6129 |
| 105 | Ga0068852_100049144 | 3300005616 | Bacteria | 3607 |
| 106 | Ga0068851_10000221 | 3300005834 | Bacteria | 27516 |
| 107 | Ga0068870_10005500 | 3300005840 | Bacteria | 5534 |
| 108 | Ga0068858_100033841 | 3300005842 | Bacteria | 4740 |
| 109 | Ga0068862_100180184 | 3300005844 | Bacteria | 1896 |
| 110 | Ga0081455_10030083 | 3300005937 | Bacteria | 4939 |
| 111 | Ga0070717_10181562 | 3300006028 | Bacteria | 1835 |
| 112 | Ga0075363_100106950 | 3300006048 | Bacteria | 1552 |
| 113 | Ga0075364_10021925 | 3300006051 | Bacteria | 4029 |
| 114 | Ga0070712_100004848 | 3300006175 | Bacteria | 8318 |
| 115 | Ga0075367_10151258 | 3300006178 | Bacteria | 1440 |
| 116 | Ga0075366_10002364 | 3300006195 | Bacteria | 9662 |
| 117 | Ga0097621_100022779 | 3300006237 | Bacteria | 4867 |
| 118 | Ga0068871_100306038 | 3300006358 | Bacteria | 1396 |
| 119 | Ga0075428_100323363 | 3300006844 | Bacteria | 1657 |
| 120 | Ga0075430_100123490 | 3300006846 | Bacteria | 2158 |
| 121 | Ga0075431_100041363 | 3300006847 | Bacteria | 4751 |
| 122 | Ga0075431_100070799 | 3300006847 | Bacteria | 3598 |
| 123 | Ga0075431_100198596 | 3300006847 | Bacteria | 2053 |
| 124 | Ga0075433_10014754 | 3300006852 | Bacteria | 6395 |
| 125 | Ga0075429_100005400 | 3300006880 | Bacteria | 10997 |
| 126 | Ga0075429_100014404 | 3300006880 | Bacteria | 6853 |
| 127 | Ga0075429_100444970 | 3300006880 | Bacteria | 1135 |
| 128 | Ga0068865_100002426 | 3300006881 | Bacteria | 11015 |
| 129 | Ga0068865_100154924 | 3300006881 | Bacteria | 1742 |
| 130 | Ga0079104_1000485 | 3300006946 | Bacteria | 43922 |
| 131 | Ga0079104_1000490 | 3300006946 | Bacteria | 42967 |
| 132 | Ga0079104_1000624 | 3300006946 | Bacteria | 34658 |
| 133 | Ga0079104_1000660 | 3300006946 | Bacteria | 32875 |
| 134 | Ga0079104_1001897 | 3300006946 | Bacteria | 12619 |
| 135 | Ga0079104_1002516 | 3300006946 | Bacteria | 9735 |
| 136 | Ga0079104_1002794 | 3300006946 | Bacteria | 8797 |
| 137 | Ga0079104_1006842 | 3300006946 | Bacteria | 4227 |
| 138 | Ga0079104_1014417 | 3300006946 | Bacteria | 2384 |
| 139 | Ga0075435_100162880 | 3300007076 | Bacteria | 1879 |
| 140 | Ga0105251_10001425 | 3300009011 | Bacteria | 20604 |
| 141 | Ga0105251_10002220 | 3300009011 | Bacteria | 15494 |
| 142 | Ga0105251_10002228 | 3300009011 | Bacteria | 15467 |
| 143 | Ga0105251_10002491 | 3300009011 | Bacteria | 14415 |
| 144 | Ga0105251_10002841 | 3300009011 | Bacteria | 13080 |
| 145 | Ga0105251_10005427 | 3300009011 | Bacteria | 8332 |
| 146 | Ga0105251_10008910 | 3300009011 | Bacteria | 6001 |
| 147 | Ga0105251_10011814 | 3300009011 | Bacteria | 4970 |
| 148 | Ga0105251_10015900 | 3300009011 | Bacteria | 4092 |
| 149 | Ga0105251_10088147 | 3300009011 | Bacteria | 1428 |
| 150 | Ga0105251_10101907 | 3300009011 | Bacteria | 1312 |
| 151 | Ga0105244_10000033 | 3300009036 | Bacteria | 172219 |
| 152 | Ga0105244_10000505 | 3300009036 | Bacteria | 34917 |
| 153 | Ga0105244_10000565 | 3300009036 | Bacteria | 33084 |
| 154 | Ga0105244_10000822 | 3300009036 | Bacteria | 26216 |
| 155 | Ga0105244_10001412 | 3300009036 | Bacteria | 19445 |
| 156 | Ga0105244_10002138 | 3300009036 | Bacteria | 15170 |
| 157 | Ga0105244_10002840 | 3300009036 | Bacteria | 12855 |
| 158 | Ga0105244_10004471 | 3300009036 | Bacteria | 9606 |
| 159 | Ga0105244_10005243 | 3300009036 | Bacteria | 8658 |
| 160 | Ga0105244_10018339 | 3300009036 | Bacteria | 3928 |
| 161 | Ga0105244_10076228 | 3300009036 | Bacteria | 1665 |
| 162 | Ga0105244_10099818 | 3300009036 | Bacteria | 1421 |
| 163 | Ga0105244_10156267 | 3300009036 | Bacteria | 1091 |
| 164 | Ga0105250_10000098 | 3300009092 | Bacteria | 78269 |
| 165 | Ga0105250_10000165 | 3300009092 | Bacteria | 57113 |
| 166 | Ga0105250_10000321 | 3300009092 | Bacteria | 36864 |
| 167 | Ga0105250_10000351 | 3300009092 | Bacteria | 35223 |
| 168 | Ga0105250_10001790 | 3300009092 | Bacteria | 11256 |
| 169 | Ga0105250_10004800 | 3300009092 | Bacteria | 6158 |
| 170 | Ga0105250_10006878 | 3300009092 | Bacteria | 4932 |
| 171 | Ga0105250_10015710 | 3300009092 | Bacteria | 3099 |
| 172 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 173 | Ga0105245_10007384 | 3300009098 | Bacteria | 9623 |
| 174 | Ga0105247_10000027 | 3300009101 | Bacteria | 201966 |
| 175 | Ga0114129_10063906 | 3300009147 | Bacteria | 5136 |
| 176 | Ga0105243_10001901 | 3300009148 | Bacteria | 17803 |
| 177 | Ga0105243_10003148 | 3300009148 | Bacteria | 13544 |
| 178 | Ga0105243_10003945 | 3300009148 | Bacteria | 11845 |
| 179 | Ga0105243_10157788 | 3300009148 | Bacteria | 1953 |
| 180 | Ga0105243_10267977 | 3300009148 | Bacteria | 1532 |
| 181 | Ga0105241_10000006 | 3300009174 | Bacteria | 373608 |
| 182 | Ga0105241_10017641 | 3300009174 | Bacteria | 5248 |
| 183 | Ga0105242_10003004 | 3300009176 | Bacteria | 13183 |
| 184 | Ga0105248_10444841 | 3300009177 | Bacteria | 1460 |
| 185 | Ga0105237_10002680 | 3300009545 | Bacteria | 21825 |
| 186 | Ga0105239_10002581 | 3300010375 | Bacteria | 22935 |
| 187 | Ga0105246_10004374 | 3300011119 | Bacteria | 8595 |
| 188 | Ga0105246_10122072 | 3300011119 | Bacteria | 1932 |
| 189 | Ga0105246_10172746 | 3300011119 | Bacteria | 1657 |
| 190 | Ga0157373_10000301 | 3300013100 | Bacteria | 40059 |
| 191 | Ga0157373_10002114 | 3300013100 | Bacteria | 15036 |
| 192 | Ga0157373_10014332 | 3300013100 | Bacteria | 5810 |
| 193 | Ga0157373_10016018 | 3300013100 | Bacteria | 5472 |
| 194 | Ga0157371_10000159 | 3300013102 | Bacteria | 98984 |
| 195 | Ga0157371_10000349 | 3300013102 | Bacteria | 59337 |
| 196 | Ga0157371_10001320 | 3300013102 | Bacteria | 26053 |
| 197 | Ga0157371_10001630 | 3300013102 | Bacteria | 22978 |
| 198 | Ga0157371_10020620 | 3300013102 | Bacteria | 4850 |
| 199 | Ga0157371_10022635 | 3300013102 | Bacteria | 4600 |
| 200 | Ga0157371_10110400 | 3300013102 | Bacteria | 1952 |
| 201 | Ga0157370_10001424 | 3300013104 | Bacteria | 29698 |
| 202 | Ga0157370_10003061 | 3300013104 | Bacteria | 19833 |
| 203 | Ga0157369_10024732 | 3300013105 | Bacteria | 6674 |
| 204 | Ga0157374_10010962 | 3300013296 | Bacteria | 7827 |
| 205 | Ga0157378_10016174 | 3300013297 | Bacteria | 6532 |
| 206 | Ga0163162_10008063 | 3300013306 | Bacteria | 10277 |
| 207 | Ga0157372_10000517 | 3300013307 | Bacteria | 42523 |
| 208 | Ga0157372_10008131 | 3300013307 | Bacteria | 11154 |
| 209 | Ga0157372_10165155 | 3300013307 | Bacteria | 2560 |
| 210 | Ga0157372_10183821 | 3300013307 | Bacteria | 2420 |
| 211 | Ga0157372_10207861 | 3300013307 | Bacteria | 2268 |
| 212 | Ga0157372_10273027 | 3300013307 | Bacteria | 1965 |
| 213 | Ga0157372_10275848 | 3300013307 | Bacteria | 1954 |
| 214 | Ga0157372_10472686 | 3300013307 | Bacteria | 1461 |
| 215 | Ga0157375_10211095 | 3300013308 | Bacteria | 2099 |
| 216 | Ga0163163_10041019 | 3300014325 | Bacteria | 4524 |
| 217 | Ga0163163_10165435 | 3300014325 | Bacteria | 2258 |
| 218 | Ga0157380_10099016 | 3300014326 | Bacteria | 2424 |
| 219 | Ga0182008_10021763 | 3300014497 | Bacteria | 3292 |
| 220 | Ga0182008_10025779 | 3300014497 | Bacteria | 2985 |
| 221 | Ga0182008_10058683 | 3300014497 | Bacteria | 1899 |
| 222 | Ga0182006_1000376 | 3300015261 | Bacteria | 37065 |
| 223 | Ga0182006_1000652 | 3300015261 | Bacteria | 24669 |
| 224 | Ga0182007_10032719 | 3300015262 | Bacteria | 1765 |
| 225 | Ga0182005_1002849 | 3300015265 | Bacteria | 6017 |
| 226 | Ga0183366_1002 | 3300015679 | Bacteria | 791639 |
| 227 | Ga0183370_1002 | 3300015680 | Bacteria | 791639 |
| 228 | Ga0183369_1002 | 3300015685 | Bacteria | 791621 |
| 229 | Ga0183368_1005 | 3300015687 | Bacteria | 791621 |
| 230 | Ga0163161_10000036 | 3300017792 | Bacteria | 153121 |
| 231 | Ga0163161_10143786 | 3300017792 | Bacteria | 1808 |
| 232 | Ga0163161_10151804 | 3300017792 | Bacteria | 1761 |
| 233 | Ga0163161_10157119 | 3300017792 | Bacteria | 1732 |
| 234 | Ga0213876_10000013 | 3300021384 | Bacteria | 342052 |
| 235 | Ga0228598_1000779 | 3300024227 | Bacteria | 6844 |
| 236 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 237 | Ga0209760_100006 | 3300025207 | Bacteria | 224535 |
| 238 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 239 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 240 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 241 | Ga0209563_100008 | 3300025230 | Bacteria | 1554545 |
| 242 | Ga0207427_100002 | 3300025231 | Bacteria | 1355321 |
| 243 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 244 | Ga0209437_100114 | 3300025233 | Bacteria | 210697 |
| 245 | Ga0209437_100291 | 3300025233 | Bacteria | 72764 |
| 246 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 247 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 248 | Ga0209677_100004 | 3300025253 | Bacteria | 1554545 |
| 249 | Ga0209677_100524 | 3300025253 | Bacteria | 21308 |
| 250 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 251 | Ga0209129_1000010 | 3300025258 | Bacteria | 583357 |
| 252 | Ga0209233_1000157 | 3300025261 | Bacteria | 164269 |
| 253 | Ga0209233_1000192 | 3300025261 | Bacteria | 127171 |
| 254 | Ga0209233_1000194 | 3300025261 | Bacteria | 126185 |
| 255 | Ga0209233_1001399 | 3300025261 | Bacteria | 9542 |
| 256 | Ga0209130_1000083 | 3300025284 | Bacteria | 162582 |
| 257 | Ga0209676_1020610 | 3300025292 | Bacteria | 2234 |
| 258 | Ga0209025_1024737 | 3300025294 | Bacteria | 3088 |
| 259 | Ga0209758_1000657 | 3300025297 | Bacteria | 51923 |
| 260 | Ga0209050_1030485 | 3300025298 | Bacteria | 1702 |
| 261 | Ga0207426_1000173 | 3300025302 | Bacteria | 162697 |
| 262 | Ga0209051_1017207 | 3300025303 | Bacteria | 3236 |
| 263 | Ga0209257_1005500 | 3300025304 | Bacteria | 8851 |
| 264 | Ga0207697_10106612 | 3300025315 | Bacteria | 1198 |
| 265 | Ga0207656_10015155 | 3300025321 | Bacteria | 2980 |
| 266 | Ga0207696_1000014 | 3300025711 | Bacteria | 517939 |
| 267 | Ga0207696_1000027 | 3300025711 | Bacteria | 412783 |
| 268 | Ga0207696_1000137 | 3300025711 | Bacteria | 127683 |
| 269 | Ga0207696_1000188 | 3300025711 | Bacteria | 95866 |
| 270 | Ga0207696_1000272 | 3300025711 | Bacteria | 62222 |
| 271 | Ga0207696_1000356 | 3300025711 | Bacteria | 46221 |
| 272 | Ga0207696_1000466 | 3300025711 | Bacteria | 35122 |
| 273 | Ga0207696_1000800 | 3300025711 | Bacteria | 20360 |
| 274 | Ga0207696_1007349 | 3300025711 | Bacteria | 4324 |
| 275 | Ga0207696_1023980 | 3300025711 | Bacteria | 1917 |
| 276 | Ga0207696_1035017 | 3300025711 | Bacteria | 1497 |
| 277 | Ga0207655_1000024 | 3300025728 | Bacteria | 459774 |
| 278 | Ga0207655_1000028 | 3300025728 | Bacteria | 437324 |
| 279 | Ga0207655_1000065 | 3300025728 | Bacteria | 252767 |
| 280 | Ga0207655_1000072 | 3300025728 | Bacteria | 236536 |
| 281 | Ga0207655_1000186 | 3300025728 | Bacteria | 110125 |
| 282 | Ga0207655_1000397 | 3300025728 | Bacteria | 60486 |
| 283 | Ga0207655_1001028 | 3300025728 | Bacteria | 28168 |
| 284 | Ga0207655_1001295 | 3300025728 | Bacteria | 23673 |
| 285 | Ga0207655_1001763 | 3300025728 | Bacteria | 18919 |
| 286 | Ga0207655_1003209 | 3300025728 | Bacteria | 12295 |
| 287 | Ga0207655_1003378 | 3300025728 | Bacteria | 11924 |
| 288 | Ga0207655_1005165 | 3300025728 | Bacteria | 8983 |
| 289 | Ga0207655_1008316 | 3300025728 | Bacteria | 6601 |
| 290 | Ga0207655_1011918 | 3300025728 | Bacteria | 5129 |
| 291 | Ga0207655_1032714 | 3300025728 | Bacteria | 2371 |
| 292 | Ga0207655_1068907 | 3300025728 | Bacteria | 1325 |
| 293 | Ga0207713_1000019 | 3300025735 | Bacteria | 361225 |
| 294 | Ga0207713_1000157 | 3300025735 | Bacteria | 102471 |
| 295 | Ga0207713_1000181 | 3300025735 | Bacteria | 90733 |
| 296 | Ga0207713_1000272 | 3300025735 | Bacteria | 63323 |
| 297 | Ga0207713_1000300 | 3300025735 | Bacteria | 56459 |
| 298 | Ga0207713_1000672 | 3300025735 | Bacteria | 32332 |
| 299 | Ga0207713_1004072 | 3300025735 | Bacteria | 9639 |
| 300 | Ga0207713_1007104 | 3300025735 | Bacteria | 6697 |
| 301 | Ga0207713_1009166 | 3300025735 | Bacteria | 5607 |
| 302 | Ga0207713_1030551 | 3300025735 | Bacteria | 2397 |
| 303 | Ga0207713_1034504 | 3300025735 | Bacteria | 2197 |
| 304 | Ga0207713_1090723 | 3300025735 | Bacteria | 1074 |
| 305 | Ga0207682_10004305 | 3300025893 | Bacteria | 5983 |
| 306 | Ga0207682_10048308 | 3300025893 | Bacteria | 1754 |
| 307 | Ga0207642_10052739 | 3300025899 | Bacteria | 1847 |
| 308 | Ga0207710_10000007 | 3300025900 | Bacteria | 488292 |
| 309 | Ga0207688_10019282 | 3300025901 | Bacteria | 3714 |
| 310 | Ga0207645_10000491 | 3300025907 | Bacteria | 32560 |
| 311 | Ga0207654_10000008 | 3300025911 | Bacteria | 375871 |
| 312 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 313 | Ga0207671_10000860 | 3300025914 | Bacteria | 38458 |
| 314 | Ga0207693_10001110 | 3300025915 | Bacteria | 24219 |
| 315 | Ga0207693_10003425 | 3300025915 | Bacteria | 13537 |
| 316 | Ga0207660_10196631 | 3300025917 | Bacteria | 1573 |
| 317 | Ga0207662_10001193 | 3300025918 | Bacteria | 12379 |
| 318 | Ga0207657_10001426 | 3300025919 | Bacteria | 25509 |
| 319 | Ga0207652_10022607 | 3300025921 | Bacteria | 5204 |
| 320 | Ga0207650_10026935 | 3300025925 | Bacteria | 4108 |
| 321 | Ga0207659_10012807 | 3300025926 | Bacteria | 5355 |
| 322 | Ga0207644_10052478 | 3300025931 | Bacteria | 2930 |
| 323 | Ga0207706_10000793 | 3300025933 | Bacteria | 32687 |
| 324 | Ga0207706_10005929 | 3300025933 | Bacteria | 11363 |
| 325 | Ga0207686_10029851 | 3300025934 | Bacteria | 3221 |
| 326 | Ga0207709_10000726 | 3300025935 | Bacteria | 26397 |
| 327 | Ga0207709_10138551 | 3300025935 | Bacteria | 1669 |
| 328 | Ga0207670_10006332 | 3300025936 | Bacteria | 6556 |
| 329 | Ga0207670_10039355 | 3300025936 | Bacteria | 3096 |
| 330 | Ga0207669_10002032 | 3300025937 | Bacteria | 8576 |
| 331 | Ga0207691_10000089 | 3300025940 | Bacteria | 77701 |
| 332 | Ga0207691_10032395 | 3300025940 | Bacteria | 4872 |
| 333 | Ga0207691_10224603 | 3300025940 | Bacteria | 1627 |
| 334 | Ga0207689_10005053 | 3300025942 | Bacteria | 11892 |
| 335 | Ga0207661_10036398 | 3300025944 | Bacteria | 3842 |
| 336 | Ga0207679_10005736 | 3300025945 | Bacteria | 7790 |
| 337 | Ga0207679_10099840 | 3300025945 | Bacteria | 2267 |
| 338 | Ga0207651_10020956 | 3300025960 | Bacteria | 3959 |
| 339 | Ga0207651_10152589 | 3300025960 | Bacteria | 1800 |
| 340 | Ga0207712_10140188 | 3300025961 | Bacteria | 1854 |
| 341 | Ga0207668_10005034 | 3300025972 | Bacteria | 7779 |
| 342 | Ga0207640_10059442 | 3300025981 | Bacteria | 2523 |
| 343 | Ga0207708_10000969 | 3300026075 | Bacteria | 21528 |
| 344 | Ga0207648_10006014 | 3300026089 | Bacteria | 12109 |
| 345 | Ga0207674_10000119 | 3300026116 | Bacteria | 91959 |
| 346 | Ga0207675_100025761 | 3300026118 | Bacteria | 5473 |
| 347 | Ga0207683_10000118 | 3300026121 | Bacteria | 64632 |
| 348 | Ga0207683_10369831 | 3300026121 | Bacteria | 1317 |
| 349 | Ga0209281_1000025 | 3300027111 | Bacteria | 488275 |
| 350 | Ga0209281_1000096 | 3300027111 | Bacteria | 236276 |
| 351 | Ga0209281_1000279 | 3300027111 | Bacteria | 96898 |
| 352 | Ga0209281_1000281 | 3300027111 | Bacteria | 96061 |
| 353 | Ga0209281_1000328 | 3300027111 | Bacteria | 82899 |
| 354 | Ga0209281_1000369 | 3300027111 | Bacteria | 73041 |
| 355 | Ga0209281_1000558 | 3300027111 | Bacteria | 45216 |
| 356 | Ga0209281_1000723 | 3300027111 | Bacteria | 32737 |
| 357 | Ga0209281_1000953 | 3300027111 | Bacteria | 23576 |
| 358 | Ga0209281_1001042 | 3300027111 | Bacteria | 21087 |
| 359 | Ga0209281_1002724 | 3300027111 | Bacteria | 6629 |
| 360 | Ga0209973_1000528 | 3300027252 | Bacteria | 2921 |
| 361 | Ga0209371_1000013 | 3300027312 | Bacteria | 691516 |
| 362 | Ga0209371_1000019 | 3300027312 | Bacteria | 583561 |
| 363 | Ga0209371_1000069 | 3300027312 | Bacteria | 207967 |
| 364 | Ga0209371_1000083 | 3300027312 | Bacteria | 184176 |
| 365 | Ga0209371_1000149 | 3300027312 | Bacteria | 110455 |
| 366 | Ga0209371_1000346 | 3300027312 | Bacteria | 50802 |
| 367 | Ga0209371_1000351 | 3300027312 | Bacteria | 50314 |
| 368 | Ga0209371_1000509 | 3300027312 | Bacteria | 37163 |
| 369 | Ga0209371_1000663 | 3300027312 | Bacteria | 30042 |
| 370 | Ga0209371_1000759 | 3300027312 | Bacteria | 26909 |
| 371 | Ga0209371_1000804 | 3300027312 | Bacteria | 25939 |
| 372 | Ga0209371_1002463 | 3300027312 | Bacteria | 10317 |
| 373 | Ga0209371_1002564 | 3300027312 | Bacteria | 10026 |
| 374 | Ga0209371_1002905 | 3300027312 | Bacteria | 8968 |
| 375 | Ga0209371_1004479 | 3300027312 | Bacteria | 6038 |
| 376 | Ga0209371_1005492 | 3300027312 | Bacteria | 5018 |
| 377 | Ga0209371_1005938 | 3300027312 | Bacteria | 4689 |
| 378 | Ga0209371_1010862 | 3300027312 | Bacteria | 2756 |
| 379 | Ga0209969_1000081 | 3300027360 | Bacteria | 11756 |
| 380 | Ga0209967_1001071 | 3300027364 | Bacteria | 3493 |
| 381 | Ga0209996_1000001 | 3300027395 | Bacteria | 64824 |
| 382 | Ga0209984_1002511 | 3300027424 | Bacteria | 2055 |
| 383 | Ga0210000_1000003 | 3300027462 | Bacteria | 41189 |
| 384 | Ga0209995_1000345 | 3300027471 | Bacteria | 7242 |
| 385 | Ga0209968_1000643 | 3300027526 | Bacteria | 5392 |
| 386 | Ga0209999_1000262 | 3300027543 | Bacteria | 7684 |
| 387 | Ga0209982_1001101 | 3300027552 | Bacteria | 3614 |
| 388 | Ga0209970_1008147 | 3300027614 | Bacteria | 1721 |
| 389 | Ga0210002_1000075 | 3300027617 | Bacteria | 15616 |
| 390 | Ga0209983_1001181 | 3300027665 | Bacteria | 5769 |
| 391 | Ga0209971_1000339 | 3300027682 | Bacteria | 12903 |
| 392 | Ga0209966_1000425 | 3300027695 | Bacteria | 12073 |
| 393 | Ga0209998_10000165 | 3300027717 | Bacteria | 24428 |
| 394 | Ga0209974_10002753 | 3300027876 | Bacteria | 6375 |
| 395 | Ga0207428_10003400 | 3300027907 | Bacteria | 15468 |
| 396 | Ga0268266_10000142 | 3300028379 | Bacteria | 138183 |
| 397 | Ga0268266_10019945 | 3300028379 | Bacteria | 5713 |
| 398 | Ga0268266_10032511 | 3300028379 | Bacteria | 4432 |
| 399 | Ga0268266_10409747 | 3300028379 | Bacteria | 1283 |
| 400 | Ga0268264_10045271 | 3300028381 | Bacteria | 3653 |
| 401 | Ga0268264_10174290 | 3300028381 | Bacteria | 1948 |
| 402 | Ga0265318_10047325 | 3300028577 | Bacteria | 1622 |
| 403 | Ga0268256_1000014 | 3300030500 | Bacteria | 691435 |
| 404 | Ga0268256_1000024 | 3300030500 | Bacteria | 488637 |
| 405 | Ga0268256_1000066 | 3300030500 | Bacteria | 199115 |
| 406 | Ga0268256_1000074 | 3300030500 | Bacteria | 184102 |
| 407 | Ga0268256_1000293 | 3300030500 | Bacteria | 50802 |
| 408 | Ga0268256_1000294 | 3300030500 | Bacteria | 50324 |
| 409 | Ga0268256_1000734 | 3300030500 | Bacteria | 24107 |
| 410 | Ga0268256_1000918 | 3300030500 | Bacteria | 20350 |
| 411 | Ga0268256_1002265 | 3300030500 | Bacteria | 10026 |
| 412 | Ga0268256_1002344 | 3300030500 | Bacteria | 9763 |
| 413 | Ga0268256_1002373 | 3300030500 | Bacteria | 9687 |
| 414 | Ga0268256_1002611 | 3300030500 | Bacteria | 8968 |
| 415 | Ga0268256_1002616 | 3300030500 | Bacteria | 8950 |
| 416 | Ga0268256_1004231 | 3300030500 | Bacteria | 6039 |
| 417 | Ga0268256_1005400 | 3300030500 | Bacteria | 5018 |
| 418 | Ga0268256_1010019 | 3300030500 | Bacteria | 3096 |
| 419 | Ga0268256_1016374 | 3300030500 | Bacteria | 2128 |
| 420 | Ga0265773_1002260 | 3300031018 | Bacteria | 1150 |
| 421 | Ga0265330_10061813 | 3300031235 | Bacteria | 1629 |
| 422 | Ga0265325_10008951 | 3300031241 | Bacteria | 5879 |
| 423 | Ga0265325_10152706 | 3300031241 | Bacteria | 1091 |
| 424 | Ga0265340_10001019 | 3300031247 | Bacteria | 15981 |
| 425 | Ga0265340_10012971 | 3300031247 | Bacteria | 4391 |
| 426 | Ga0265340_10078344 | 3300031247 | Bacteria | 1558 |
| 427 | Ga0265339_10023636 | 3300031249 | Bacteria | 3551 |
| 428 | Ga0307408_100135071 | 3300031548 | Unclassified | 1929 |
| 429 | Ga0265313_10000522 | 3300031595 | Bacteria | 40272 |
| 430 | Ga0265313_10013071 | 3300031595 | Bacteria | 5014 |
| 431 | Ga0265313_10061307 | 3300031595 | Bacteria | 1761 |
| 432 | Ga0307508_10056023 | 3300031616 | Bacteria | 3492 |
| 433 | Ga0265314_10063845 | 3300031711 | Bacteria | 2496 |
| 434 | Ga0265342_10006229 | 3300031712 | Bacteria | 8913 |
| 435 | Ga0265342_10049960 | 3300031712 | Bacteria | 2500 |
| 436 | Ga0307413_10118695 | 3300031824 | Unclassified | 1786 |
| 437 | Ga0307410_10001871 | 3300031852 | Bacteria | 9814 |
| 438 | Ga0307407_10084677 | 3300031903 | Unclassified | 1927 |
| 439 | Ga0307409_100005707 | 3300031995 | Bacteria | 7213 |
| 440 | Ga0307416_100001523 | 3300032002 | Bacteria | 12653 |
| 441 | Ga0307416_100301569 | 3300032002 | Bacteria | 1593 |
| 442 | Ga0307510_10159259 | 3300033180 | Bacteria | 1858 |
| 443 | Ga0373948_0013266 | 3300034817 | Bacteria | 1485 |
| 444 | Ga0373934_0021830 | 3300035086 | Bacteria | 2468 |
| 445 | Ga0373940_0008837 | 3300035088 | Bacteria | 2325 |
| 446 | Ga0373945_0002178 | 3300035116 | Bacteria | 6117 |
| 447 | Ga0373954_0009647 | 3300035118 | Bacteria | 4249 |
| 448 | Ga0373956_0000993 | 3300035119 | Bacteria | 11739 |
| 449 | Ga0373956_0013098 | 3300035119 | Bacteria | 3448 |
| 450 | Ga0373943_0065487 | 3300035170 | Bacteria | 1827 |
| 451 | Ga0373943_0082662 | 3300035170 | Bacteria | 1649 |
| 452 | Ga0373955_0016851 | 3300035172 | Bacteria | 3604 |
| 453 | Ga0373955_0121647 | 3300035172 | Bacteria | 1518 |
| 454 | Ga0373924_0006435 | 3300035410 | Bacteria | 4210 |
| 455 | Ga0373931_0087138 | 3300035691 | Bacteria | 1734 |
| 456 | Ga0373931_0102005 | 3300035691 | Bacteria | 1615 |
| 457 | Ga0373935_0026077 | 3300035692 | Bacteria | 3604 |
| 458 | Ga0373935_0063286 | 3300035692 | Bacteria | 2371 |
| 459 | Ga0373927_0011124 | 3300035695 | Bacteria | 5993 |
| 460 | Ga0373933_0004893 | 3300035724 | Bacteria | 7309 |
| 461 | Ga0373933_0119911 | 3300035724 | Bacteria | 1647 |
| 462 | Ga0373937_0000917 | 3300036401 | Bacteria | 24992 |
| 463 | Ga0373925_0017742 | 3300037068 | Bacteria | 5165 |
| 464 | Ga0373925_0046105 | 3300037068 | Bacteria | 3240 |
| 465 | Ga0373925_0139808 | 3300037068 | Bacteria | 1894 |
| 466 | Ga0400487_22513 | 3300039110 | Bacteria | 4494 |
| 467 | Ga0436365_0471682 | 3300039437 | Bacteria | 352256 |
| 468 | Ga0439438_000003 | 3300041405 | Bacteria | 464587 |
| 469 | Ga0439438_000282 | 3300041405 | Bacteria | 22830 |
| 470 | Ga0439438_000434 | 3300041405 | Bacteria | 19009 |
| 471 | Ga0439447_000460 | 3300041407 | Bacteria | 15181 |
| 472 | Ga0439447_001914 | 3300041407 | Bacteria | 7611 |
| 473 | Ga0439447_002846 | 3300041407 | Bacteria | 6215 |
| 474 | Ga0439466_0000002 | 3300041411 | Bacteria | 494198 |
| 475 | Ga0439432_000566 | 3300042006 | Bacteria | 13854 |
| 476 | Ga0439432_001003 | 3300042006 | Bacteria | 10667 |
| 477 | Ga0439432_001530 | 3300042006 | Bacteria | 8686 |
| 478 | Ga0439432_006918 | 3300042006 | Bacteria | 4035 |
| 479 | Ga0439432_011946 | 3300042006 | Bacteria | 2983 |
| 480 | Ga0439432_050471 | 3300042006 | Bacteria | 1298 |
| 481 | Ga0439452_000004 | 3300042010 | Bacteria | 764268 |
| 482 | Ga0439452_000011 | 3300042010 | Bacteria | 428451 |
| 483 | Ga0439452_000078 | 3300042010 | Bacteria | 83572 |
| 484 | Ga0439452_000079 | 3300042010 | Bacteria | 83084 |
| 485 | Ga0439452_000498 | 3300042010 | Bacteria | 21480 |
| 486 | Ga0439452_001372 | 3300042010 | Bacteria | 10056 |
| 487 | Ga0439452_005027 | 3300042010 | Bacteria | 4320 |
| 488 | Ga0439463_001405 | 3300042016 | Bacteria | 6397 |
| 489 | Ga0450907_000011 | 3300042146 | Bacteria | 90100 |
| 490 | Ga0439464_0000480 | 3300042439 | Bacteria | 8070 |
| 491 | Ga0439464_0000835 | 3300042439 | Bacteria | 6808 |
| 492 | Ga0439464_0002919 | 3300042439 | Bacteria | 4258 |
| 493 | Ga0439464_0037258 | 3300042439 | Bacteria | 1379 |
| 494 | Ga0466981_0000050 | 3300044669 | Bacteria | 33071 |
| 495 | Ga0453683_0002183 | 3300044673 | Bacteria | 15564 |
| 496 | Ga0495627_000017 | 3300046453 | Bacteria | 317280 |
| 497 | Ga0495627_039039 | 3300046453 | Bacteria | 1466 |
| 498 | Ga0495591_000010 | 3300046458 | Bacteria | 327794 |
| 499 | Ga0495591_000090 | 3300046458 | Bacteria | 101695 |
| 500 | Ga0495591_008692 | 3300046458 | Bacteria | 4131 |
| 501 | Ga0495629_0004045 | 3300046459 | Bacteria | 11023 |
| 502 | Ga0495629_0110851 | 3300046459 | Bacteria | 1913 |
| 503 | Ga0495638_0009212 | 3300046460 | Bacteria | 6940 |
| 504 | Ga0495651_0003405 | 3300046462 | Bacteria | 12195 |
| 505 | Ga0495651_0108448 | 3300046462 | Bacteria | 2056 |
| 506 | Ga0495653_0010771 | 3300046463 | Bacteria | 7488 |
| 507 | Ga0495653_0076265 | 3300046463 | Bacteria | 2492 |
| 508 | Ga0495653_0141771 | 3300046463 | Bacteria | 1689 |
| 509 | Ga0495650_0000004 | 3300046471 | Bacteria | 779487 |
| 510 | Ga0495650_0000040 | 3300046471 | Bacteria | 366254 |
| 511 | Ga0495662_0000962 | 3300046476 | Bacteria | 14098 |
| 512 | Ga0495662_0092255 | 3300046476 | Bacteria | 1477 |
| 513 | Ga0495662_0145934 | 3300046476 | Bacteria | 1165 |
| 514 | Ga0495664_0000189 | 3300046477 | Bacteria | 30129 |
| 515 | Ga0495664_0057002 | 3300046477 | Bacteria | 2324 |
| 516 | Ga0495664_0060025 | 3300046477 | Bacteria | 2264 |
| 517 | Ga0495585_0003087 | 3300046492 | Bacteria | 11456 |
| 518 | Ga0495607_0007704 | 3300046501 | Bacteria | 7417 |
| 519 | Ga0495606_0000399 | 3300046507 | Bacteria | 73352 |
| 520 | Ga0495608_0003600 | 3300046511 | Bacteria | 11116 |
| 521 | Ga0495608_0074309 | 3300046511 | Bacteria | 2215 |
| 522 | Ga0495616_0036251 | 3300046513 | Bacteria | 2546 |
| 523 | Ga0495618_0005858 | 3300046514 | Bacteria | 7470 |
| 524 | Ga0495618_0013451 | 3300046514 | Bacteria | 4976 |
| 525 | Ga0495618_0113179 | 3300046514 | Bacteria | 1737 |
| 526 | Ga0495620_0004428 | 3300046515 | Bacteria | 7923 |
| 527 | Ga0495628_0064866 | 3300046516 | Bacteria | 2858 |
| 528 | Ga0495630_0010043 | 3300046517 | Bacteria | 6817 |
| 529 | Ga0495630_0062397 | 3300046517 | Bacteria | 2800 |
| 530 | Ga0495637_0076767 | 3300046520 | Bacteria | 1338 |
| 531 | Ga0495643_0009513 | 3300046522 | Bacteria | 6039 |
| 532 | Ga0495643_0012022 | 3300046522 | Bacteria | 5239 |
| 533 | Ga0495644_0001240 | 3300046523 | Bacteria | 10444 |
| 534 | Ga0495648_0025365 | 3300046524 | Bacteria | 4015 |
| 535 | Ga0495666_0130454 | 3300046526 | Bacteria | 1175 |
| 536 | Ga0495652_0062255 | 3300046529 | Bacteria | 3146 |
| 537 | Ga0495652_0156266 | 3300046529 | Bacteria | 1776 |
| 538 | Ga0495654_0000036 | 3300046530 | Bacteria | 191434 |
| 539 | Ga0495654_0000089 | 3300046530 | Bacteria | 102765 |
| 540 | Ga0495654_0001414 | 3300046530 | Bacteria | 16623 |
| 541 | Ga0495654_0006656 | 3300046530 | Bacteria | 6539 |
| 542 | Ga0495654_0007828 | 3300046530 | Bacteria | 5941 |
| 543 | Ga0495654_0011543 | 3300046530 | Bacteria | 4777 |
| 544 | Ga0495665_0036818 | 3300046531 | Bacteria | 2611 |
| 545 | Ga0495640_0017827 | 3300046533 | Bacteria | 5281 |
| 546 | Ga0495640_0022695 | 3300046533 | Bacteria | 4582 |
| 547 | Ga0495640_0047158 | 3300046533 | Bacteria | 2982 |
| 548 | Ga0495586_0005750 | 3300046535 | Bacteria | 6630 |
| 549 | Ga0495587_0002660 | 3300046536 | Bacteria | 11930 |
| 550 | Ga0495587_0180924 | 3300046536 | Bacteria | 1195 |
| 551 | Ga0495597_0001169 | 3300046542 | Bacteria | 19719 |
| 552 | Ga0495645_0013174 | 3300046543 | Bacteria | 5845 |
| 553 | Ga0495645_0084923 | 3300046543 | Bacteria | 2266 |
| 554 | Ga0495667_0002184 | 3300046559 | Bacteria | 13079 |
| 555 | Ga0495667_0031709 | 3300046559 | Bacteria | 3544 |
| 556 | Ga0495668_0018313 | 3300046616 | Bacteria | 4047 |
| 557 | Ga0495634_0030542 | 3300046642 | Bacteria | 3720 |
| 558 | Ga0495625_0026706 | 3300046660 | Bacteria | 4357 |
| 559 | Ga0495635_0005714 | 3300046663 | Bacteria | 8666 |
| 560 | Ga0495588_0008161 | 3300046674 | Bacteria | 4793 |
| 561 | Ga0495599_0010386 | 3300046678 | Bacteria | 5696 |
| 562 | Ga0495599_0019612 | 3300046678 | Bacteria | 4215 |
| 563 | Ga0495623_0001753 | 3300046679 | Bacteria | 14560 |
| 564 | Ga0495646_0009424 | 3300046680 | Bacteria | 6195 |
| 565 | Ga0495646_0129277 | 3300046680 | Bacteria | 1423 |
| 566 | Ga0495658_0113114 | 3300046683 | Bacteria | 1634 |
| 567 | Ga0495613_0015542 | 3300046689 | Bacteria | 5661 |
| 568 | Ga0495613_0084733 | 3300046689 | Bacteria | 2301 |
| 569 | Ga0495671_0001824 | 3300046692 | Bacteria | 13726 |
| 570 | Ga0495649_0015867 | 3300046694 | Bacteria | 4279 |
| 571 | Ga0495649_0085897 | 3300046694 | Bacteria | 1679 |
| 572 | Ga0495589_0000013 | 3300046794 | Bacteria | 248616 |
| 573 | Ga0495589_0001531 | 3300046794 | Bacteria | 13310 |
| 574 | Ga0495600_0003284 | 3300046809 | Bacteria | 9481 |
| 575 | Ga0495600_0222713 | 3300046809 | Bacteria | 1206 |
| 576 | Ga0495660_0000022 | 3300046810 | Bacteria | 284337 |
| 577 | Ga0495660_0000184 | 3300046810 | Bacteria | 67383 |
| 578 | Ga0495660_0009386 | 3300046810 | Bacteria | 5705 |
| 579 | Ga0495604_0001751 | 3300047317 | Bacteria | 17746 |
| 580 | Ga0495636_0038768 | 3300047318 | Bacteria | 1972 |
| 581 | Ga0495674_0010400 | 3300047319 | Bacteria | 8809 |
| 582 | Ga0495674_0029546 | 3300047319 | Bacteria | 4989 |
| 583 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 584 | Ga0495672_0000082 | 3300047320 | Bacteria | 159422 |
| 585 | Ga0495672_0000103 | 3300047320 | Bacteria | 136164 |
| 586 | Ga0495676_0123587 | 3300047321 | Bacteria | 1879 |
| 587 | Ga0495680_0001204 | 3300047322 | Bacteria | 28378 |
| 588 | Ga0495675_0008632 | 3300047444 | Bacteria | 6317 |
| 589 | Ga0495675_0017704 | 3300047444 | Bacteria | 4517 |
| 590 | Ga0495679_000059 | 3300047446 | Bacteria | 109922 |
| 591 | Ga0495679_001176 | 3300047446 | Bacteria | 15545 |
| 592 | Ga0495673_0000011 | 3300047469 | Bacteria | 674140 |
| 593 | Ga0495673_0000117 | 3300047469 | Bacteria | 148662 |
| 594 | Ga0495681_0063598 | 3300047470 | Bacteria | 1693 |
| 595 | Ga0495684_0027627 | 3300047471 | Bacteria | 4356 |
| 596 | Ga0495684_0046434 | 3300047471 | Bacteria | 3322 |
| 597 | Ga0495684_0196146 | 3300047471 | Bacteria | 1490 |
| 598 | Ga0495686_0023082 | 3300047472 | Bacteria | 4110 |
| 599 | Ga0495602_0054974 | 3300048088 | Bacteria | 3509 |
| 600 | Ga0496100_0020046 | 3300048903 | Bacteria | 4002 |
| 601 | Ga0496100_0021063 | 3300048903 | Bacteria | 3920 |
| 602 | Ga0496100_0327114 | 3300048903 | Bacteria | 1153 |
| 603 | Ga0496101_0000144 | 3300048904 | Bacteria | 63019 |
| 604 | Ga0496102_0007586 | 3300048905 | Bacteria | 9267 |
| 605 | Ga0496102_0124521 | 3300048905 | Bacteria | 2409 |
| 606 | Ga0496102_0243430 | 3300048905 | Bacteria | 1696 |
| 607 | Ga0496104_0000153 | 3300048907 | Bacteria | 63666 |
| 608 | Ga0496104_0001602 | 3300048907 | Bacteria | 19480 |
| 609 | Ga0496104_0072416 | 3300048907 | Bacteria | 3277 |
| 610 | Ga0496104_0396721 | 3300048907 | Bacteria | 1292 |
| 611 | Ga0496105_0008262 | 3300048908 | Bacteria | 8095 |
| 612 | Ga0496105_0266126 | 3300048908 | Bacteria | 1385 |
| 613 | Ga0496105_0364291 | 3300048908 | Bacteria | 1152 |
| 614 | Ga0496107_0091072 | 3300048910 | Bacteria | 2229 |
| 615 | Ga0496110_0070201 | 3300048913 | Bacteria | 3103 |
| 616 | Ga0496111_0026200 | 3300048914 | Bacteria | 4117 |
| 617 | Ga0496111_0170038 | 3300048914 | Bacteria | 1619 |
| 618 | Ga0496111_0351684 | 3300048914 | Bacteria | 1091 |
| 619 | Ga0496112_0072822 | 3300048915 | Bacteria | 3396 |
| 620 | Ga0496113_0258725 | 3300048916 | Bacteria | 1390 |
| 621 | Ga0496113_0276204 | 3300048916 | Bacteria | 1343 |
| 622 | Ga0496114_0335312 | 3300048917 | Bacteria | 1337 |
| 623 | Ga0496115_0041888 | 3300048918 | Bacteria | 3647 |
| 624 | Ga0496116_0000009 | 3300048919 | Bacteria | 716119 |
| 625 | Ga0496116_0000016 | 3300048919 | Bacteria | 555146 |
| 626 | Ga0496116_0000148 | 3300048919 | Bacteria | 142458 |
| 627 | Ga0496116_0000777 | 3300048919 | Bacteria | 40580 |
| 628 | Ga0496116_0001014 | 3300048919 | Bacteria | 34246 |
| 629 | Ga0496116_0002172 | 3300048919 | Bacteria | 20890 |
| 630 | Ga0496116_0013724 | 3300048919 | Bacteria | 6513 |
| 631 | Ga0496116_0086262 | 3300048919 | Bacteria | 1926 |
| 632 | Ga0496116_0098066 | 3300048919 | Bacteria | 1759 |
| 633 | Ga0496116_0129522 | 3300048919 | Bacteria | 1441 |
| 634 | Ga0496116_0196610 | 3300048919 | Bacteria | 1060 |
| 635 | Ga0496117_0000116 | 3300048920 | Bacteria | 178919 |
| 636 | Ga0496117_0002487 | 3300048920 | Bacteria | 23118 |
| 637 | Ga0496117_0005006 | 3300048920 | Bacteria | 14211 |
| 638 | Ga0496117_0005369 | 3300048920 | Bacteria | 13499 |
| 639 | Ga0496117_0005435 | 3300048920 | Bacteria | 13378 |
| 640 | Ga0496117_0006918 | 3300048920 | Bacteria | 11245 |
| 641 | Ga0496117_0035041 | 3300048920 | Bacteria | 3773 |
| 642 | Ga0496117_0042050 | 3300048920 | Bacteria | 3340 |
| 643 | Ga0496117_0052762 | 3300048920 | Bacteria | 2861 |
| 644 | Ga0496117_0110532 | 3300048920 | Bacteria | 1713 |
| 645 | Ga0496117_0115120 | 3300048920 | Bacteria | 1665 |
| 646 | Ga0496117_0131419 | 3300048920 | Bacteria | 1516 |
| 647 | Ga0496117_0175935 | 3300048920 | Bacteria | 1236 |
| 648 | Ga0496117_0261191 | 3300048920 | Bacteria | 938 |
| 649 | Ga0496118_0000906 | 3300048921 | Bacteria | 46311 |
| 650 | Ga0496118_0001701 | 3300048921 | Bacteria | 32176 |
| 651 | Ga0496118_0004732 | 3300048921 | Bacteria | 15930 |
| 652 | Ga0496118_0004852 | 3300048921 | Bacteria | 15658 |
| 653 | Ga0496118_0007265 | 3300048921 | Bacteria | 11805 |
| 654 | Ga0496118_0007795 | 3300048921 | Bacteria | 11237 |
| 655 | Ga0496118_0007826 | 3300048921 | Bacteria | 11209 |
| 656 | Ga0496118_0013851 | 3300048921 | Bacteria | 7592 |
| 657 | Ga0496118_0014265 | 3300048921 | Bacteria | 7452 |
| 658 | Ga0496118_0015913 | 3300048921 | Bacteria | 6931 |
| 659 | Ga0496118_0063118 | 3300048921 | Bacteria | 2728 |
| 660 | Ga0496118_0131896 | 3300048921 | Bacteria | 1603 |
| 661 | Ga0496119_0000096 | 3300048922 | Bacteria | 129464 |
| 662 | Ga0496119_0000472 | 3300048922 | Bacteria | 54962 |
| 663 | Ga0496119_0000586 | 3300048922 | Bacteria | 49220 |
| 664 | Ga0496119_0002196 | 3300048922 | Bacteria | 21812 |
| 665 | Ga0496119_0002287 | 3300048922 | Bacteria | 21206 |
| 666 | Ga0496119_0002663 | 3300048922 | Bacteria | 19316 |
| 667 | Ga0496119_0002975 | 3300048922 | Bacteria | 18006 |
| 668 | Ga0496119_0003291 | 3300048922 | Bacteria | 16893 |
| 669 | Ga0496119_0018393 | 3300048922 | Bacteria | 5202 |
| 670 | Ga0496119_0019571 | 3300048922 | Bacteria | 4977 |
| 671 | Ga0496119_0023595 | 3300048922 | Bacteria | 4355 |
| 672 | Ga0496119_0046692 | 3300048922 | Bacteria | 2702 |
| 673 | Ga0496119_0059638 | 3300048922 | Bacteria | 2290 |
| 674 | Ga0496119_0152323 | 3300048922 | Bacteria | 1237 |
| 675 | Ga0496120_0000068 | 3300048923 | Bacteria | 166108 |
| 676 | Ga0496120_0000166 | 3300048923 | Bacteria | 111571 |
| 677 | Ga0496120_0000389 | 3300048923 | Bacteria | 70922 |
| 678 | Ga0496120_0000572 | 3300048923 | Bacteria | 56188 |
| 679 | Ga0496120_0000602 | 3300048923 | Bacteria | 54478 |
| 680 | Ga0496120_0001236 | 3300048923 | Bacteria | 32273 |
| 681 | Ga0496120_0001364 | 3300048923 | Bacteria | 29931 |
| 682 | Ga0496120_0001521 | 3300048923 | Bacteria | 27309 |
| 683 | Ga0496120_0002363 | 3300048923 | Bacteria | 19342 |
| 684 | Ga0496120_0006318 | 3300048923 | Bacteria | 9121 |
| 685 | Ga0496120_0009015 | 3300048923 | Bacteria | 7131 |
| 686 | Ga0496120_0024995 | 3300048923 | Bacteria | 3715 |
| 687 | Ga0496120_0029973 | 3300048923 | Bacteria | 3315 |
| 688 | Ga0496120_0045608 | 3300048923 | Bacteria | 2538 |
| 689 | Ga0496120_0052555 | 3300048923 | Bacteria | 2319 |
| 690 | Ga0496120_0075730 | 3300048923 | Bacteria | 1836 |
| 691 | Ga0496120_0165239 | 3300048923 | Bacteria | 1099 |
| 692 | Ga0496121_0000052 | 3300048924 | Bacteria | 313410 |
| 693 | Ga0496121_0001407 | 3300048924 | Bacteria | 40738 |
| 694 | Ga0496121_0003985 | 3300048924 | Bacteria | 20369 |
| 695 | Ga0496121_0007946 | 3300048924 | Bacteria | 12678 |
| 696 | Ga0496121_0010723 | 3300048924 | Bacteria | 10279 |
| 697 | Ga0496121_0031562 | 3300048924 | Bacteria | 4836 |
| 698 | Ga0496121_0091888 | 3300048924 | Bacteria | 2367 |
| 699 | Ga0496121_0127925 | 3300048924 | Bacteria | 1906 |
| 700 | Ga0496122_0000070 | 3300048925 | Bacteria | 223198 |
| 701 | Ga0496122_0000392 | 3300048925 | Bacteria | 93045 |
| 702 | Ga0496122_0002311 | 3300048925 | Bacteria | 27505 |
| 703 | Ga0496122_0003665 | 3300048925 | Bacteria | 19943 |
| 704 | Ga0496122_0008374 | 3300048925 | Bacteria | 11180 |
| 705 | Ga0496122_0010138 | 3300048925 | Bacteria | 9768 |
| 706 | Ga0496122_0012297 | 3300048925 | Bacteria | 8548 |
| 707 | Ga0496122_0015706 | 3300048925 | Bacteria | 7220 |
| 708 | Ga0496122_0024217 | 3300048925 | Bacteria | 5318 |
| 709 | Ga0496122_0025645 | 3300048925 | Bacteria | 5112 |
| 710 | Ga0496122_0078133 | 3300048925 | Bacteria | 2319 |
| 711 | Ga0496123_0000017 | 3300048926 | Bacteria | 415261 |
| 712 | Ga0496123_0000131 | 3300048926 | Bacteria | 153642 |
| 713 | Ga0496123_0001554 | 3300048926 | Bacteria | 31553 |
| 714 | Ga0496123_0001924 | 3300048926 | Bacteria | 27116 |
| 715 | Ga0496123_0004679 | 3300048926 | Bacteria | 14185 |
| 716 | Ga0496123_0006706 | 3300048926 | Bacteria | 11090 |
| 717 | Ga0496123_0007192 | 3300048926 | Bacteria | 10563 |
| 718 | Ga0496123_0052895 | 3300048926 | Bacteria | 2688 |
| 719 | Ga0496123_0053471 | 3300048926 | Bacteria | 2668 |
| 720 | Ga0496123_0073406 | 3300048926 | Bacteria | 2122 |
| 721 | Ga0496123_0075724 | 3300048926 | Bacteria | 2075 |
| 722 | Ga0496123_0098954 | 3300048926 | Bacteria | 1703 |
| 723 | Ga0496124_0000053 | 3300048927 | Bacteria | 252285 |
| 724 | Ga0496124_0000303 | 3300048927 | Bacteria | 91070 |
| 725 | Ga0496124_0000630 | 3300048927 | Bacteria | 58501 |
| 726 | Ga0496124_0001210 | 3300048927 | Bacteria | 39962 |
| 727 | Ga0496124_0001921 | 3300048927 | Bacteria | 28471 |
| 728 | Ga0496124_0002062 | 3300048927 | Bacteria | 27252 |
| 729 | Ga0496124_0003880 | 3300048927 | Bacteria | 17881 |
| 730 | Ga0496124_0004583 | 3300048927 | Bacteria | 16033 |
| 731 | Ga0496124_0009686 | 3300048927 | Bacteria | 9864 |
| 732 | Ga0496124_0011012 | 3300048927 | Bacteria | 9083 |
| 733 | Ga0496124_0030577 | 3300048927 | Bacteria | 4777 |
| 734 | Ga0496124_0031483 | 3300048927 | Bacteria | 4695 |
| 735 | Ga0496124_0038930 | 3300048927 | Bacteria | 4124 |
| 736 | Ga0496124_0040972 | 3300048927 | Bacteria | 4001 |
| 737 | Ga0496124_0124721 | 3300048927 | Bacteria | 2053 |
| 738 | Ga0496124_0127223 | 3300048927 | Bacteria | 2028 |
| 739 | Ga0496125_0000056 | 3300048928 | Bacteria | 271016 |
| 740 | Ga0496125_0000329 | 3300048928 | Bacteria | 91776 |
| 741 | Ga0496125_0002880 | 3300048928 | Bacteria | 21658 |
| 742 | Ga0496125_0008126 | 3300048928 | Bacteria | 11051 |
| 743 | Ga0496125_0008724 | 3300048928 | Bacteria | 10549 |
| 744 | Ga0496125_0014954 | 3300048928 | Bacteria | 7536 |
| 745 | Ga0496126_0000137 | 3300048929 | Bacteria | 167415 |
| 746 | Ga0496126_0000818 | 3300048929 | Bacteria | 55553 |
| 747 | Ga0496126_0025978 | 3300048929 | Bacteria | 5622 |
| 748 | Ga0496126_0035995 | 3300048929 | Bacteria | 4633 |
| 749 | Ga0496126_0037205 | 3300048929 | Bacteria | 4543 |
| 750 | Ga0496126_0039024 | 3300048929 | Bacteria | 4411 |
| 751 | Ga0496126_0071555 | 3300048929 | Bacteria | 3086 |
| 752 | Ga0495678_000142 | 3300049459 | Bacteria | 86788 |
| 753 | Ga0495678_037537 | 3300049459 | Bacteria | 1967 |
| 754 | Ga0495682_0000034 | 3300049460 | Bacteria | 131806 |
| 755 | Ga0501033_0080497 | 3300049570 | Bacteria | 2390 |
| 756 | Ga0501034_0050830 | 3300049571 | Bacteria | 4180 |
| 757 | Ga0501034_0109009 | 3300049571 | Bacteria | 2760 |
| 758 | Ga0501038_0211111 | 3300049574 | Bacteria | 1553 |
| 759 | Ga0501046_0121964 | 3300049580 | Bacteria | 1983 |
| 760 | Ga0501047_0013360 | 3300049581 | Bacteria | 7782 |
| 761 | Ga0501047_0040203 | 3300049581 | Bacteria | 4523 |
| 762 | Ga0501047_0052523 | 3300049581 | Bacteria | 3939 |
| 763 | Ga0501047_0270655 | 3300049581 | Bacteria | 1545 |
| 764 | Ga0501067_0008176 | 3300049583 | Bacteria | 5811 |
| 765 | Ga0501067_0014574 | 3300049583 | Bacteria | 4352 |
| 766 | Ga0501067_0026561 | 3300049583 | Bacteria | 3207 |
| 767 | Ga0501068_0081154 | 3300049584 | Bacteria | 1991 |
| 768 | Ga0501069_0022611 | 3300049585 | Bacteria | 3422 |
| 769 | Ga0501069_0037274 | 3300049585 | Bacteria | 2683 |
| 770 | Ga0501070_0007890 | 3300049586 | Bacteria | 9018 |
| 771 | Ga0501070_0077636 | 3300049586 | Bacteria | 2748 |
| 772 | Ga0501070_0252744 | 3300049586 | Bacteria | 1441 |
| 773 | Ga0501072_0017632 | 3300049588 | Bacteria | 5491 |
| 774 | Ga0501073_0032601 | 3300049589 | Bacteria | 3714 |
| 775 | Ga0501074_0095267 | 3300049590 | Bacteria | 2132 |
| 776 | Ga0501074_0216356 | 3300049590 | Bacteria | 1364 |
| 777 | Ga0501076_0157277 | 3300049592 | Bacteria | 1851 |
| 778 | Ga0501077_0029901 | 3300049593 | Bacteria | 3465 |
| 779 | Ga0501233_018062 | 3300049668 | Unclassified | 1479 |
| 780 | Ga0501079_0061509 | 3300049741 | Bacteria | 2897 |
| 781 | Ga0501080_0072661 | 3300049742 | Bacteria | 3200 |
| 782 | Ga0501080_0074653 | 3300049742 | Bacteria | 3154 |
| 783 | Ga0501080_0105338 | 3300049742 | Bacteria | 2615 |
| 784 | Ga0501083_0004742 | 3300049744 | Bacteria | 9604 |
| 785 | Ga0501083_0018349 | 3300049744 | Bacteria | 4876 |
| 786 | Ga0501083_0112220 | 3300049744 | Bacteria | 1791 |
| 787 | Ga0501035_0003726 | 3300049822 | Bacteria | 14536 |
| 788 | Ga0501035_0051407 | 3300049822 | Bacteria | 3690 |
| 789 | Ga0501044_0034569 | 3300049823 | Bacteria | 5299 |
| 790 | Ga0501044_0098397 | 3300049823 | Bacteria | 2945 |
| 791 | Ga0501044_0245234 | 3300049823 | Bacteria | 1734 |
| 792 | nmdc:mga00v17_12262_c1 | 3300050491 | Bacteria | 4728 |
| 793 | nmdc:mga00v17_26883_c1 | 3300050491 | Bacteria | 3356 |
| 794 | nmdc:mga00v17_37338_c1 | 3300050491 | Bacteria | 2900 |
| 795 | nmdc:mga0k408_5714_c2 | 3300050493 | Bacteria | 4889 |
| 796 | nmdc:mga05p37_72861_c1 | 3300050507 | Bacteria | 4227 |
| 797 | nmdc:mga09592_14738_c1 | 3300050508 | Bacteria | 6378 |
| 798 | nmdc:mga0qj67_41057_c1 | 3300050509 | Bacteria | 3638 |
| 799 | nmdc:mga06r32_285292_c1 | 3300050510 | Bacteria | 1638 |
| 800 | nmdc:mga0rr50_616455_c1 | 3300050513 | Bacteria | 925 |
| 801 | nmdc:mga08x19_112405_c1 | 3300050514 | Bacteria | 1818 |
| 802 | nmdc:mga08x19_145376_c1 | 3300050514 | Bacteria | 1603 |
| 803 | nmdc:mga0a205_105968_c1 | 3300050515 | Bacteria | 2710 |
| 804 | Ga0495601_0023347 | 3300053077 | Bacteria | 3799 |
| 805 | Ga0495601_0026298 | 3300053077 | Bacteria | 3592 |
| 806 | Ga0495601_0043811 | 3300053077 | Bacteria | 2811 |
| 807 | Ga0495612_0000213 | 3300053078 | Bacteria | 24541 |
| 808 | Ga0495595_0001849 | 3300053084 | Bacteria | 8223 |
| 809 | Ga0495619_0000666 | 3300053085 | Bacteria | 22530 |
| 810 | Ga0495619_0002522 | 3300053085 | Bacteria | 11978 |
| 811 | Ga0500593_037334 | 3300053117 | Bacteria | 2176 |
| 812 | Ga0500618_000706 | 3300053125 | Bacteria | 19584 |
| 813 | Ga0500621_000010 | 3300053126 | Bacteria | 169537 |
| 814 | Ga0500616_0002271 | 3300053153 | Bacteria | 16324 |
| 815 | Ga0500627_0031176 | 3300053158 | Bacteria | 2238 |
| 816 | Ga0501084_0052721 | 3300054114 | Bacteria | 3402 |
| 817 | Ga0501084_0158231 | 3300054114 | Bacteria | 1911 |
| 818 | Ga0501084_0200950 | 3300054114 | Bacteria | 1682 |
| 819 | Ga0501084_0245643 | 3300054114 | Bacteria | 1511 |
| 820 | Ga0501082_0025055 | 3300060353 | Bacteria | 5139 |
| 821 | Ga0501082_0050044 | 3300060353 | Bacteria | 3603 |
| 822 | Ga0501082_0067226 | 3300060353 | Bacteria | 3086 |
| 823 | Ga0501082_0395879 | 3300060353 | Bacteria | 1205 |
| 824 | Ga0501082_0434975 | 3300060353 | Bacteria | 1146 |
| 825 | 2506580567 | 2506520007 | Bacteria | 5442880 |
| 826 | 2506585706 | 2506520008 | Bacteria | 5443009 |
| 827 | 2508854364 | 2508501071 | Bacteria | 5454741 |
| 828 | 2511136599 | 2510917022 | Bacteria | 6504556 |
| 829 | 2511171945 | 2510917026 | Bacteria | 7046020 |
| 830 | 2511379640 | 2511231025 | Bacteria | 5324661 |
| 831 | 2511390338 | 2511231027 | Bacteria | 5013807 |
| 832 | 2511433686 | 2511231035 | Bacteria | 5341610 |
| 833 | 2524460110 | 2524023209 | Bacteria | 6679728 |
| 834 | 2535486069 | 2534681786 | Bacteria | 3308809 |
| 835 | 2547695979 | 2547132181 | Bacteria | 4945084 |
| 836 | 2548649439 | 2547132416 | Bacteria | 4633861 |
| 837 | 2555258926 | 2554235234 | Bacteria | 5762085 |
| 838 | 2562464635 | 2561511199 | Bacteria | 5155034 |
| 839 | 2585274244 | 2582581307 | Bacteria | 6597605 |
| 840 | 2585280343 | 2582581308 | Bacteria | 7413247 |
| 841 | 2585322621 | 2582581315 | Bacteria | 7318924 |
| 842 | 2585330734 | 2582581316 | Bacteria | 7774528 |
| 843 | 2585532573 | 2585427527 | Bacteria | 7273426 |
| 844 | 2585554411 | 2585427530 | Bacteria | 7383882 |
| 845 | 2585560693 | 2585427531 | Bacteria | 6992870 |
| 846 | 2585826374 | 2585427591 | Bacteria | 5482980 |
| 847 | 2585830592 | 2585427592 | Bacteria | 5370892 |
| 848 | 2585898899 | 2585427608 | Bacteria | 6544331 |
| 849 | 2585903509 | 2585427609 | Bacteria | 6667127 |
| 850 | 2587981372 | 2585428125 | Bacteria | 6662905 |
| 851 | 2599410304 | 2599185169 | Bacteria | 5441380 |
| 852 | 2599723280 | 2599185236 | Bacteria | 6875203 |
| 853 | 2601523516 | 2600255254 | Bacteria | 5281859 |
| 854 | 2601528675 | 2600255255 | Bacteria | 5282785 |
| 855 | 2601534441 | 2600255256 | Bacteria | 5597742 |
| 856 | 2601538780 | 2600255257 | Bacteria | 5597196 |
| 857 | 2601615508 | 2600255280 | Bacteria | 5292309 |
| 858 | 2601619566 | 2600255281 | Bacteria | 5288753 |
| 859 | 2601644019 | 2600255287 | Bacteria | 5210468 |
| 860 | 2601647971 | 2600255288 | Bacteria | 5282738 |
| 861 | 2601653560 | 2600255289 | Bacteria | 5281907 |
| 862 | 2601658319 | 2600255290 | Bacteria | 5282218 |
| 863 | 2601663844 | 2600255291 | Bacteria | 5217298 |
| 864 | 2601696275 | 2600255298 | Bacteria | 5215185 |
| 865 | 2601701476 | 2600255299 | Bacteria | 5218662 |
| 866 | 2601706215 | 2600255300 | Bacteria | 5287774 |
| 867 | 2601711800 | 2600255301 | Bacteria | 5280532 |
| 868 | 2601716818 | 2600255302 | Bacteria | 5288235 |
| 869 | 2601721299 | 2600255303 | Bacteria | 5219315 |
| 870 | 2601727224 | 2600255304 | Bacteria | 5283973 |
| 871 | 2601731764 | 2600255305 | Bacteria | 5282329 |
| 872 | 2601736776 | 2600255306 | Bacteria | 5281613 |
| 873 | 2601740258 | 2600255307 | Bacteria | 5439064 |
| 874 | 2601751195 | 2600255309 | Bacteria | 5431045 |
| 875 | 2601757129 | 2600255310 | Bacteria | 5600903 |
| 876 | 2601762270 | 2600255311 | Bacteria | 5598766 |
| 877 | 2602018945 | 2600255392 | Bacteria | 5437392 |
| 878 | 2603639478 | 2602042046 | Bacteria | 5483348 |
| 879 | 2603644345 | 2602042047 | Bacteria | 4697674 |
| 880 | 2603661232 | 2602042052 | Bacteria | 5215873 |
| 881 | 2603666507 | 2602042053 | Bacteria | 5214361 |
| 882 | 2603701130 | 2602042066 | Bacteria | 4423871 |
| 883 | 2603704952 | 2602042067 | Bacteria | 4863713 |
| 884 | 2603839161 | 2602042103 | Bacteria | 5284714 |
| 885 | 2603843579 | 2602042104 | Bacteria | 5281639 |
| 886 | 2603849318 | 2602042105 | Bacteria | 5282303 |
| 887 | 2603854388 | 2602042106 | Bacteria | 5282744 |
| 888 | 2603865727 | 2602042109 | Bacteria | 5152801 |
| 889 | 2603872443 | 2602042110 | Bacteria | 5283285 |
| 890 | 2603877319 | 2602042111 | Bacteria | 5212080 |
| 891 | 2606049624 | 2603880178 | Bacteria | 5283018 |
| 892 | 2606070939 | 2603880184 | Bacteria | 5217896 |
| 893 | 2606147308 | 2603880202 | Bacteria | 5284684 |
| 894 | 2606177033 | 2603880211 | Bacteria | 5284226 |
| 895 | 2608670723 | 2608642108 | Bacteria | 4104624 |
| 896 | 2609911397 | 2609459761 | Bacteria | 5513740 |
| 897 | 2616307356 | 2615840626 | Bacteria | 7921970 |
| 898 | 2616554900 | 2615840698 | Bacteria | 7319877 |
| 899 | 2617383572 | 2617270742 | Bacteria | 6808054 |
| 900 | 2637223134 | 2636415599 | Bacteria | 5718434 |
| 901 | 2650897363 | 2648501693 | Bacteria | 5069560 |
| 902 | 2656276360 | 2654587920 | Bacteria | 5475511 |
| 903 | 2671104529 | 2667528172 | Bacteria | 5170840 |
| 904 | 2671106668 | 2667528173 | Bacteria | 5375747 |
| 905 | 2671112149 | 2667528174 | Bacteria | 6435400 |
| 906 | 2671586135 | 2671180115 | Bacteria | 5353919 |
| 907 | 2676408675 | 2675903046 | Bacteria | 5451247 |
| 908 | 2681998109 | 2681812866 | Bacteria | 4552357 |
| 909 | 2682008229 | 2681812869 | Bacteria | 5014465 |
| 910 | 2686354666 | 2684622997 | Bacteria | 4624240 |
| 911 | 2689447121 | 2687453601 | Bacteria | 5546041 |
| 912 | 2707101139 | 2706794495 | Bacteria | 4536932 |
| 913 | 2712471306 | 2711768156 | Bacteria | 4471618 |
| 914 | 2738944469 | 2738541317 | Bacteria | 5340176 |
| 915 | 2739307524 | 2738543024 | Bacteria | 5603683 |
| 916 | 2753357266 | 2751185800 | Bacteria | 5467370 |
| 917 | 2753857741 | 2751185917 | Bacteria | 4551186 |
| 918 | 2757571324 | 2757320392 | Bacteria | 3737298 |
| 919 | 2758639672 | 2758568016 | Bacteria | 5645291 |
| 920 | 2765466346 | 2765235802 | Bacteria | 5618596 |
| 921 | 2765590856 | 2765235842 | Bacteria | 4799256 |
| 922 | 2770198979 | 2767802442 | Bacteria | 5747986 |
| 923 | 2772440923 | 2772190666 | Bacteria | 5117644 |
| 924 | 2775540423 | 2775506706 | Bacteria | 4873073 |
| 925 | 2776270248 | 2775506902 | Bacteria | 6208009 |
| 926 | 2776285023 | 2775506904 | Bacteria | 5954060 |
| 927 | 2777019458 | 2775507074 | Bacteria | 5532402 |
| 928 | 2778175966 | 2775507266 | Bacteria | 7392367 |
| 929 | 2792312562 | 2791355010 | Bacteria | 4864581 |
| 930 | 2793403862 | 2791355275 | Bacteria | 4429597 |
| 931 | 2807177024 | 2806310673 | Bacteria | 4801221 |
| 932 | 2809124013 | 2808606414 | Bacteria | 4917181 |
| 933 | 2813726765 | 2811995292 | Bacteria | 5303342 |
| 934 | 2814694138 | 2814123068 | Bacteria | 5687681 |
| 935 | 2819609645 | 2818991448 | Bacteria | 6772224 |
| 936 | 2819639742 | 2818991453 | Bacteria | 7181617 |
| 937 | 2821120739 | 2821118458 | Bacteria | 4714306 |
| 938 | 2823376617 | 2823373977 | Bacteria | 4779415 |
| 939 | 2828308496 | 2828305725 | Bacteria | 4916900 |
| 940 | 2838033088 | 2838029111 | Bacteria | 6603031 |
| 941 | 2839998308 | 2839993093 | Bacteria | 5512535 |
| 942 | 2840769141 | 2840764183 | Bacteria | 6358399 |
| 943 | 2842298664 | 2842298080 | Bacteria | 6123127 |
| 944 | 2842359469 | 2842357229 | Bacteria | 6485165 |
| 945 | 2842479821 | 2842475841 | Bacteria | 6603183 |
| 946 | 2842483433 | 2842482326 | Bacteria | 7212537 |
| 947 | 2842506997 | 2842502639 | Bacteria | 6604161 |
| 948 | 2842510692 | 2842509118 | Bacteria | 6850950 |
| 949 | 2842872306 | 2842871566 | Bacteria | 4827117 |
| 950 | 2844429230 | 2844425489 | Bacteria | 4854065 |
| 951 | 2844531327 | 2844528606 | Bacteria | 4733806 |
| 952 | 2847090311 | 2847085930 | Bacteria | 5070450 |
| 953 | 2847801538 | 2847797336 | Bacteria | 5176640 |
| 954 | 2852106051 | 2852103415 | Bacteria | 5193810 |
| 955 | 2852391149 | 2852387548 | Bacteria | 8025568 |
| 956 | 2854604941 | 2854601825 | Bacteria | 4797592 |
| 957 | 2854916733 | 2854911287 | Bacteria | 5582813 |
| 958 | 2865016085 | 2865014394 | Bacteria | 4764573 |
| 959 | 2869556529 | 2869551831 | Bacteria | 5474685 |
| 960 | 2876605890 | 2876601092 | Bacteria | 5114497 |
| 961 | 2881611337 | 2881609920 | Bacteria | 4405319 |
| 962 | 2884087012 | 2884086401 | Bacteria | 5005459 |
| 963 | 2888371028 | 2888366609 | Bacteria | 5155009 |
| 964 | 2888376270 | 2888373701 | Bacteria | 5098052 |
| 965 | 2891675504 | 2891670763 | Bacteria | 4967099 |
| 966 | 2894655577 | 2894652903 | Bacteria | 4587256 |
| 967 | 2899806464 | 2899803654 | Bacteria | 5577784 |
| 968 | 2904474184 | 2904474040 | Bacteria | 5504324 |
| 969 | 2904507199 | 2904504865 | Bacteria | 5152820 |
| 970 | 2904517048 | 2904513164 | Bacteria | 5476410 |
| 971 | 2904582283 | 2904578770 | Bacteria | 5302906 |
| 972 | 2908672870 | 2908669403 | Bacteria | 5740494 |
| 973 | 2909044673 | 2909042592 | Bacteria | 6499737 |
| 974 | 2913309088 | 2913308742 | Bacteria | 5350706 |
| 975 | 2915652011 | 2915650412 | Bacteria | 4288180 |
| 976 | 2919113496 | 2919108558 | Bacteria | 5897419 |
| 977 | 2919122933 | 2919119836 | Bacteria | 5208557 |
| 978 | 2919150531 | 2919150387 | Bacteria | 5500879 |
| 979 | 2919173348 | 2919171160 | Bacteria | 6499771 |
| 980 | 2919410634 | 2919408235 | Bacteria | 6149349 |
| 981 | 2923636747 | 2923634449 | Bacteria | 4753480 |
| 982 | 2927145404 | 2927143783 | Bacteria | 5504251 |
| 983 | 2927836792 | 2927833300 | Bacteria | 4923934 |
| 984 | 2928524227 | 2928521798 | Bacteria | 4960112 |
| 985 | 2932407119 | 2932406140 | Bacteria | 5134491 |
| 986 | 2935629514 | 2935625433 | Bacteria | 5042964 |
| 987 | 2937544128 | 2937539931 | Bacteria | 4639830 |
| 988 | 2937971236 | 2937967321 | Bacteria | 5094075 |
| 989 | 2939572431 | 2939568625 | Bacteria | 4542555 |
| 990 | 2939576605 | 2939573065 | Bacteria | 4926053 |
| 991 | 2939582359 | 2939577877 | Bacteria | 5132791 |
| 992 | 2939605876 | 2939602548 | Bacteria | 4950493 |
| 993 | 2939610573 | 2939607340 | Bacteria | 4719256 |
| 994 | 2939620577 | 2939617950 | Bacteria | 4820956 |
| 995 | 2939645642 | 2939642701 | Bacteria | 4475280 |
| 996 | 2945875828 | 2945874760 | Bacteria | 5527237 |
| 997 | 2945954543 | 2945951305 | Bacteria | 4918162 |
| 998 | 2954013176 | 2954011201 | Bacteria | 4762601 |
| 999 | 2969080165 | 2969079654 | Bacteria | 5439582 |
| 1000 | 2971821513 | 2971820967 | Bacteria | 5823634 |
| 1001 | 2974314915 | 2974310843 | Bacteria | 4947816 |
| 1002 | 2974440310 | 2974435778 | Bacteria | 4876478 |
| 1003 | 2978977016 | 2978975091 | Bacteria | 4704313 |
| 1004 | 2984498378 | 2984494565 | Bacteria | 5000175 |
| 1005 | 2984562620 | 2984559226 | Bacteria | 5683096 |
| 1006 | 2984600680 | 2984595703 | Bacteria | 5682994 |
| 1007 | 2990263480 | 2990261002 | Bacteria | 4919493 |
| 1008 | 2996312126 | 2996310559 | Bacteria | 6357320 |
| 1009 | 3000377475 | 3000376612 | Bacteria | 4705565 |
| 1010 | 3002145138 | 3002141150 | Bacteria | 5254435 |
| 1011 | 3005418530 | 3005416602 | Bacteria | 7064308 |
| 1012 | 640939924 | 640753048 | Bacteria | 5495657 |
| 1013 | 8002291629 | 8002285264 | Bacteria | 6717907 |
| 1014 | 8004593829 | 8004592986 | Bacteria | 5122074 |
| 1015 | 8005318578 | 8005314921 | Bacteria | 7072929 |
| 1016 | 8005488539 | 8005484373 | Bacteria | 6297373 |
| 1017 | 8005649006 | 8005645114 | Bacteria | 6950293 |
| 1018 | 8005662486 | 8005658619 | Bacteria | 4500593 |
| 1019 | 8005682246 | 8005682033 | Bacteria | 6726518 |
| 1020 | 8015397106 | 8015394850 | Bacteria | 5064660 |
| 1021 | 8016737432 | 8016733728 | Bacteria | 5274317 |
| 1022 | 8018226387 | 8018221730 | Bacteria | 4616064 |
| 1023 | 8018407095 | 8018405270 | Bacteria | 4978981 |
| 1024 | 8019502658 | 8019499862 | Bacteria | 5169538 |
| 1025 | 8019507466 | 8019504834 | Bacteria | 4819156 |
| 1026 | 8054848501 | 8054844752 | Bacteria | 4450330 |
| 1027 | 8054849760 | 8054849141 | Bacteria | 5232694 |
| 1028 | 8055089523 | 8055087960 | Bacteria | 4784273 |
| 1029 | 8055095992 | 8055092621 | Bacteria | 4873875 |
| 1030 | 8055101736 | 8055097453 | Bacteria | 4865496 |
| 1031 | 8055697674 | 8055693939 | Bacteria | 4772047 |
| 1032 | 8056876128 | 8056875544 | Bacteria | 4355797 |
| 1033 | 8057308474 | 8057304971 | Bacteria | 4649742 |
| 1034 | 8057580998 | 8057575449 | Bacteria | 7367519 |
| 1035 | Ga0501084_0009351 | |||
| 1036 | SwRhRL2b_contig_2229515 | |||
| 1037 | JGI24740J21852_10000449 | |||
| 1038 | JGI25156J39149_1000215 | |||
| 1039 | JGI25162J39368_1000031 | |||
| 1040 | JGI25162J39368_1000449 | |||
| 1041 | JGI25162J39368_1000471 | |||
| 1042 | JGI25154J39366_1000169 | |||
| 1043 | JGI25157J39369_1000226 | |||
| 1044 | JGI25163J39215_1000261 | |||
| 1045 | JGI25164J39214_1000001 | |||
| 1046 | JGI25152J39213_1000063 | |||
| 1047 | JGI25159J45721_1000718 | |||
| 1048 | JGI25165J46597_1000443 | |||
| 1049 | JGI25165J46597_1001071 | |||
| 1050 | JGI25165J46597_1006237 | |||
| 1051 | rootH2_10324399 | |||
| 1052 | JGI25160J50197_1000114 | |||
| 1053 | JGI26145J50221_1000724 | |||
| 1054 | JGI25161J50226_1000089 | |||
| 1055 | Ga0055538_1000004 | |||
| 1056 | Ga0055539_1000004 | |||
| 1057 | Ga0055533_1000007 | |||
| 1058 | Ga0055525_1000007 | |||
| 1059 | Ga0055531_10013484 | |||
| 1060 | Ga0055541_1000004 | |||
| 1061 | Ga0058692_1001387 | |||
| 1062 | Ga0058692_1002827 | |||
| 1063 | Ga0058692_1008101 | |||
| 1064 | Ga0058692_1009185 | |||
| 1065 | Ga0058692_1016402 | |||
| 1066 | Ga0058692_1028962 | |||
| 1067 | Ga0055543_1000002 | |||
| 1068 | Ga0065165_1000537 | |||
| 1069 | Ga0065703_1018907 | |||
| 1070 | Ga0065704_10001070 | |||
| 1071 | Ga0065704_10001534 | |||
| 1072 | Ga0065704_10001858 | |||
| 1073 | Ga0065704_10002429 | |||
| 1074 | Ga0065704_10006610 | |||
| 1075 | Ga0065704_10013586 | |||
| 1076 | Ga0065704_10093217 | |||
| 1077 | Ga0065707_10108180 | |||
| 1078 | Ga0070676_10027376 | |||
| 1079 | Ga0070676_10140843 | |||
| 1080 | Ga0070683_100027190 | |||
| 1081 | Ga0070690_100000539 | |||
| 1082 | Ga0070690_100010622 | |||
| 1083 | Ga0070670_100017812 | |||
| 1084 | Ga0070677_10014550 | |||
| 1085 | Ga0068869_100044440 | |||
| 1086 | Ga0068869_100347549 | |||
| 1087 | Ga0070666_10027773 | |||
| 1088 | Ga0070666_10155230 | |||
| 1089 | Ga0070680_100040696 | |||
| 1090 | Ga0068868_100016978 | |||
| 1091 | Ga0070660_100019059 | |||
| 1092 | Ga0070689_100016769 | |||
| 1093 | Ga0070689_100021941 | |||
| 1094 | Ga0070689_100031840 | |||
| 1095 | Ga0070687_100000401 | |||
| 1096 | Ga0070687_100042289 | |||
| 1097 | Ga0070661_100012095 | |||
| 1098 | Ga0070668_100022105 | |||
| 1099 | Ga0070671_100004342 | |||
| 1100 | Ga0070674_100001020 | |||
| 1101 | Ga0070673_100002768 | |||
| 1102 | Ga0070673_100036202 | |||
| 1103 | Ga0070673_100067045 | |||
| 1104 | Ga0070688_100108415 | |||
| 1105 | Ga0070688_100129114 | |||
| 1106 | Ga0070659_100011884 | |||
| 1107 | Ga0070714_100023128 | |||
| 1108 | Ga0070713_100066546 | |||
| 1109 | Ga0070713_100156809 | |||
| 1110 | Ga0070701_10083355 | |||
| 1111 | Ga0070711_100009650 | |||
| 1112 | Ga0070705_100005704 | |||
| 1113 | Ga0070700_100007133 | |||
| 1114 | Ga0070694_100024935 | |||
| 1115 | Ga0070678_100015341 | |||
| 1116 | Ga0070678_100015570 | |||
| 1117 | Ga0070678_100020438 | |||
| 1118 | Ga0070662_100002557 | |||
| 1119 | Ga0070662_100004962 | |||
| 1120 | Ga0070681_10009409 | |||
| 1121 | Ga0068867_100002693 | |||
| 1122 | Ga0070679_100021719 | |||
| 1123 | Ga0070672_100006520 | |||
| 1124 | Ga0070672_100056029 | |||
| 1125 | Ga0070686_100002070 | |||
| 1126 | Ga0070695_100056780 | |||
| 1127 | Ga0070693_100070556 | |||
| 1128 | Ga0070665_100002206 | |||
| 1129 | Ga0070665_100010158 | |||
| 1130 | Ga0070665_100031391 | |||
| 1131 | Ga0070665_100048948 | |||
| 1132 | Ga0070665_100178171 | |||
| 1133 | Ga0070664_100001498 | |||
| 1134 | Ga0070664_100017690 | |||
| 1135 | Ga0068857_100000020 | |||
| 1136 | Ga0068857_100030667 | |||
| 1137 | Ga0070702_100053943 | |||
| 1138 | Ga0068852_100014145 | |||
| 1139 | Ga0068852_100049144 | |||
| 1140 | Ga0068851_10000221 | |||
| 1141 | Ga0068870_10005500 | |||
| 1142 | Ga0068858_100033841 | |||
| 1143 | Ga0068862_100180184 | |||
| 1144 | Ga0081455_10030083 | |||
| 1145 | Ga0070717_10181562 | |||
| 1146 | Ga0075363_100106950 | |||
| 1147 | Ga0075364_10021925 | |||
| 1148 | Ga0070712_100004848 | |||
| 1149 | Ga0075367_10151258 | |||
| 1150 | Ga0075366_10002364 | |||
| 1151 | Ga0097621_100022779 | |||
| 1152 | Ga0068871_100306038 | |||
| 1153 | Ga0075428_100323363 | |||
| 1154 | Ga0075430_100123490 | |||
| 1155 | Ga0075431_100041363 | |||
| 1156 | Ga0075431_100070799 | |||
| 1157 | Ga0075431_100198596 | |||
| 1158 | Ga0075433_10014754 | |||
| 1159 | Ga0075429_100005400 | |||
| 1160 | Ga0075429_100014404 | |||
| 1161 | Ga0075429_100444970 | |||
| 1162 | Ga0068865_100002426 | |||
| 1163 | Ga0068865_100154924 | |||
| 1164 | Ga0079104_1000485 | |||
| 1165 | Ga0079104_1000490 | |||
| 1166 | Ga0079104_1000624 | |||
| 1167 | Ga0079104_1000660 | |||
| 1168 | Ga0079104_1001897 | |||
| 1169 | Ga0079104_1002516 | |||
| 1170 | Ga0079104_1002794 | |||
| 1171 | Ga0079104_1006842 | |||
| 1172 | Ga0079104_1014417 | |||
| 1173 | Ga0075435_100162880 | |||
| 1174 | Ga0105251_10001425 | |||
| 1175 | Ga0105251_10002220 | |||
| 1176 | Ga0105251_10002228 | |||
| 1177 | Ga0105251_10002491 | |||
| 1178 | Ga0105251_10002841 | |||
| 1179 | Ga0105251_10005427 | |||
| 1180 | Ga0105251_10008910 | |||
| 1181 | Ga0105251_10011814 | |||
| 1182 | Ga0105251_10015900 | |||
| 1183 | Ga0105251_10088147 | |||
| 1184 | Ga0105251_10101907 | |||
| 1185 | Ga0105244_10000033 | |||
| 1186 | Ga0105244_10000505 | |||
| 1187 | Ga0105244_10000565 | |||
| 1188 | Ga0105244_10000822 | |||
| 1189 | Ga0105244_10001412 | |||
| 1190 | Ga0105244_10002138 | |||
| 1191 | Ga0105244_10002840 | |||
| 1192 | Ga0105244_10004471 | |||
| 1193 | Ga0105244_10005243 | |||
| 1194 | Ga0105244_10018339 | |||
| 1195 | Ga0105244_10076228 | |||
| 1196 | Ga0105244_10099818 | |||
| 1197 | Ga0105244_10156267 | |||
| 1198 | Ga0105250_10000098 | |||
| 1199 | Ga0105250_10000165 | |||
| 1200 | Ga0105250_10000321 | |||
| 1201 | Ga0105250_10000351 | |||
| 1202 | Ga0105250_10001790 | |||
| 1203 | Ga0105250_10004800 | |||
| 1204 | Ga0105250_10006878 | |||
| 1205 | Ga0105250_10015710 | |||
| 1206 | Ga0105240_10000019 | |||
| 1207 | Ga0105245_10007384 | |||
| 1208 | Ga0105247_10000027 | |||
| 1209 | Ga0114129_10063906 | |||
| 1210 | Ga0105243_10001901 | |||
| 1211 | Ga0105243_10003148 | |||
| 1212 | Ga0105243_10003945 | |||
| 1213 | Ga0105243_10157788 | |||
| 1214 | Ga0105243_10267977 | |||
| 1215 | Ga0105241_10000006 | |||
| 1216 | Ga0105241_10017641 | |||
| 1217 | Ga0105242_10003004 | |||
| 1218 | Ga0105248_10444841 | |||
| 1219 | Ga0105237_10002680 | |||
| 1220 | Ga0105239_10002581 | |||
| 1221 | Ga0105246_10004374 | |||
| 1222 | Ga0105246_10122072 | |||
| 1223 | Ga0105246_10172746 | |||
| 1224 | Ga0157373_10000301 | |||
| 1225 | Ga0157373_10002114 | |||
| 1226 | Ga0157373_10014332 | |||
| 1227 | Ga0157373_10016018 | |||
| 1228 | Ga0157371_10000159 | |||
| 1229 | Ga0157371_10000349 | |||
| 1230 | Ga0157371_10001320 | |||
| 1231 | Ga0157371_10001630 | |||
| 1232 | Ga0157371_10020620 | |||
| 1233 | Ga0157371_10022635 | |||
| 1234 | Ga0157371_10110400 | |||
| 1235 | Ga0157370_10001424 | |||
| 1236 | Ga0157370_10003061 | |||
| 1237 | Ga0157369_10024732 | |||
| 1238 | Ga0157374_10010962 | |||
| 1239 | Ga0157378_10016174 | |||
| 1240 | Ga0163162_10008063 | |||
| 1241 | Ga0157372_10000517 | |||
| 1242 | Ga0157372_10008131 | |||
| 1243 | Ga0157372_10165155 | |||
| 1244 | Ga0157372_10183821 | |||
| 1245 | Ga0157372_10207861 | |||
| 1246 | Ga0157372_10273027 | |||
| 1247 | Ga0157372_10275848 | |||
| 1248 | Ga0157372_10472686 | |||
| 1249 | Ga0157375_10211095 | |||
| 1250 | Ga0163163_10041019 | |||
| 1251 | Ga0163163_10165435 | |||
| 1252 | Ga0157380_10099016 | |||
| 1253 | Ga0182008_10021763 | |||
| 1254 | Ga0182008_10025779 | |||
| 1255 | Ga0182008_10058683 | |||
| 1256 | Ga0182006_1000376 | |||
| 1257 | Ga0182006_1000652 | |||
| 1258 | Ga0182007_10032719 | |||
| 1259 | Ga0182005_1002849 | |||
| 1260 | Ga0183366_1002 | |||
| 1261 | Ga0183370_1002 | |||
| 1262 | Ga0183369_1002 | |||
| 1263 | Ga0183368_1005 | |||
| 1264 | Ga0163161_10000036 | |||
| 1265 | Ga0163161_10143786 | |||
| 1266 | Ga0163161_10151804 | |||
| 1267 | Ga0163161_10157119 | |||
| 1268 | Ga0213876_10000013 | |||
| 1269 | Ga0228598_1000779 | |||
| 1270 | Ga0209435_100005 | |||
| 1271 | Ga0209760_100006 | |||
| 1272 | Ga0209784_100001 | |||
| 1273 | Ga0209566_100001 | |||
| 1274 | Ga0209674_100002 | |||
| 1275 | Ga0209563_100008 | |||
| 1276 | Ga0207427_100002 | |||
| 1277 | Ga0209437_100078 | |||
| 1278 | Ga0209437_100114 | |||
| 1279 | Ga0209437_100291 | |||
| 1280 | Ga0209646_1000011 | |||
| 1281 | Ga0209026_1000008 | |||
| 1282 | Ga0209677_100004 | |||
| 1283 | Ga0209677_100524 | |||
| 1284 | Ga0209759_1000004 | |||
| 1285 | Ga0209129_1000010 | |||
| 1286 | Ga0209233_1000157 | |||
| 1287 | Ga0209233_1000192 | |||
| 1288 | Ga0209233_1000194 | |||
| 1289 | Ga0209233_1001399 | |||
| 1290 | Ga0209130_1000083 | |||
| 1291 | Ga0209676_1020610 | |||
| 1292 | Ga0209025_1024737 | |||
| 1293 | Ga0209758_1000657 | |||
| 1294 | Ga0209050_1030485 | |||
| 1295 | Ga0207426_1000173 | |||
| 1296 | Ga0209051_1017207 | |||
| 1297 | Ga0209257_1005500 | |||
| 1298 | Ga0207697_10106612 | |||
| 1299 | Ga0207656_10015155 | |||
| 1300 | Ga0207696_1000014 | |||
| 1301 | Ga0207696_1000027 | |||
| 1302 | Ga0207696_1000137 | |||
| 1303 | Ga0207696_1000188 | |||
| 1304 | Ga0207696_1000272 | |||
| 1305 | Ga0207696_1000356 | |||
| 1306 | Ga0207696_1000466 | |||
| 1307 | Ga0207696_1000800 | |||
| 1308 | Ga0207696_1007349 | |||
| 1309 | Ga0207696_1023980 | |||
| 1310 | Ga0207696_1035017 | |||
| 1311 | Ga0207655_1000024 | |||
| 1312 | Ga0207655_1000028 | |||
| 1313 | Ga0207655_1000065 | |||
| 1314 | Ga0207655_1000072 | |||
| 1315 | Ga0207655_1000186 | |||
| 1316 | Ga0207655_1000397 | |||
| 1317 | Ga0207655_1001028 | |||
| 1318 | Ga0207655_1001295 | |||
| 1319 | Ga0207655_1001763 | |||
| 1320 | Ga0207655_1003209 | |||
| 1321 | Ga0207655_1003378 | |||
| 1322 | Ga0207655_1005165 | |||
| 1323 | Ga0207655_1008316 | |||
| 1324 | Ga0207655_1011918 | |||
| 1325 | Ga0207655_1032714 | |||
| 1326 | Ga0207655_1068907 | |||
| 1327 | Ga0207713_1000019 | |||
| 1328 | Ga0207713_1000157 | |||
| 1329 | Ga0207713_1000181 | |||
| 1330 | Ga0207713_1000272 | |||
| 1331 | Ga0207713_1000300 | |||
| 1332 | Ga0207713_1000672 | |||
| 1333 | Ga0207713_1004072 | |||
| 1334 | Ga0207713_1007104 | |||
| 1335 | Ga0207713_1009166 | |||
| 1336 | Ga0207713_1030551 | |||
| 1337 | Ga0207713_1034504 | |||
| 1338 | Ga0207713_1090723 | |||
| 1339 | Ga0207682_10004305 | |||
| 1340 | Ga0207682_10048308 | |||
| 1341 | Ga0207642_10052739 | |||
| 1342 | Ga0207710_10000007 | |||
| 1343 | Ga0207688_10019282 | |||
| 1344 | Ga0207645_10000491 | |||
| 1345 | Ga0207654_10000008 | |||
| 1346 | Ga0207695_10000049 | |||
| 1347 | Ga0207671_10000860 | |||
| 1348 | Ga0207693_10001110 | |||
| 1349 | Ga0207693_10003425 | |||
| 1350 | Ga0207660_10196631 | |||
| 1351 | Ga0207662_10001193 | |||
| 1352 | Ga0207657_10001426 | |||
| 1353 | Ga0207652_10022607 | |||
| 1354 | Ga0207650_10026935 | |||
| 1355 | Ga0207659_10012807 | |||
| 1356 | Ga0207644_10052478 | |||
| 1357 | Ga0207706_10000793 | |||
| 1358 | Ga0207706_10005929 | |||
| 1359 | Ga0207686_10029851 | |||
| 1360 | Ga0207709_10000726 | |||
| 1361 | Ga0207709_10138551 | |||
| 1362 | Ga0207670_10006332 | |||
| 1363 | Ga0207670_10039355 | |||
| 1364 | Ga0207669_10002032 | |||
| 1365 | Ga0207691_10000089 | |||
| 1366 | Ga0207691_10032395 | |||
| 1367 | Ga0207691_10224603 | |||
| 1368 | Ga0207689_10005053 | |||
| 1369 | Ga0207661_10036398 | |||
| 1370 | Ga0207679_10005736 | |||
| 1371 | Ga0207679_10099840 | |||
| 1372 | Ga0207651_10020956 | |||
| 1373 | Ga0207651_10152589 | |||
| 1374 | Ga0207712_10140188 | |||
| 1375 | Ga0207668_10005034 | |||
| 1376 | Ga0207640_10059442 | |||
| 1377 | Ga0207708_10000969 | |||
| 1378 | Ga0207648_10006014 | |||
| 1379 | Ga0207674_10000119 | |||
| 1380 | Ga0207675_100025761 | |||
| 1381 | Ga0207683_10000118 | |||
| 1382 | Ga0207683_10369831 | |||
| 1383 | Ga0209281_1000025 | |||
| 1384 | Ga0209281_1000096 | |||
| 1385 | Ga0209281_1000279 | |||
| 1386 | Ga0209281_1000281 | |||
| 1387 | Ga0209281_1000328 | |||
| 1388 | Ga0209281_1000369 | |||
| 1389 | Ga0209281_1000558 | |||
| 1390 | Ga0209281_1000723 | |||
| 1391 | Ga0209281_1000953 | |||
| 1392 | Ga0209281_1001042 | |||
| 1393 | Ga0209281_1002724 | |||
| 1394 | Ga0209973_1000528 | |||
| 1395 | Ga0209371_1000013 | |||
| 1396 | Ga0209371_1000019 | |||
| 1397 | Ga0209371_1000069 | |||
| 1398 | Ga0209371_1000083 | |||
| 1399 | Ga0209371_1000149 | |||
| 1400 | Ga0209371_1000346 | |||
| 1401 | Ga0209371_1000351 | |||
| 1402 | Ga0209371_1000509 | |||
| 1403 | Ga0209371_1000663 | |||
| 1404 | Ga0209371_1000759 | |||
| 1405 | Ga0209371_1000804 | |||
| 1406 | Ga0209371_1002463 | |||
| 1407 | Ga0209371_1002564 | |||
| 1408 | Ga0209371_1002905 | |||
| 1409 | Ga0209371_1004479 | |||
| 1410 | Ga0209371_1005492 | |||
| 1411 | Ga0209371_1005938 | |||
| 1412 | Ga0209371_1010862 | |||
| 1413 | Ga0209969_1000081 | |||
| 1414 | Ga0209967_1001071 | |||
| 1415 | Ga0209996_1000001 | |||
| 1416 | Ga0209984_1002511 | |||
| 1417 | Ga0210000_1000003 | |||
| 1418 | Ga0209995_1000345 | |||
| 1419 | Ga0209968_1000643 | |||
| 1420 | Ga0209999_1000262 | |||
| 1421 | Ga0209982_1001101 | |||
| 1422 | Ga0209970_1008147 | |||
| 1423 | Ga0210002_1000075 | |||
| 1424 | Ga0209983_1001181 | |||
| 1425 | Ga0209971_1000339 | |||
| 1426 | Ga0209966_1000425 | |||
| 1427 | Ga0209998_10000165 | |||
| 1428 | Ga0209974_10002753 | |||
| 1429 | Ga0207428_10003400 | |||
| 1430 | Ga0268266_10000142 | |||
| 1431 | Ga0268266_10019945 | |||
| 1432 | Ga0268266_10032511 | |||
| 1433 | Ga0268266_10409747 | |||
| 1434 | Ga0268264_10045271 | |||
| 1435 | Ga0268264_10174290 | |||
| 1436 | Ga0265318_10047325 | |||
| 1437 | Ga0268256_1000014 | |||
| 1438 | Ga0268256_1000024 | |||
| 1439 | Ga0268256_1000066 | |||
| 1440 | Ga0268256_1000074 | |||
| 1441 | Ga0268256_1000293 | |||
| 1442 | Ga0268256_1000294 | |||
| 1443 | Ga0268256_1000734 | |||
| 1444 | Ga0268256_1000918 | |||
| 1445 | Ga0268256_1002265 | |||
| 1446 | Ga0268256_1002344 | |||
| 1447 | Ga0268256_1002373 | |||
| 1448 | Ga0268256_1002611 | |||
| 1449 | Ga0268256_1002616 | |||
| 1450 | Ga0268256_1004231 | |||
| 1451 | Ga0268256_1005400 | |||
| 1452 | Ga0268256_1010019 | |||
| 1453 | Ga0268256_1016374 | |||
| 1454 | Ga0265773_1002260 | |||
| 1455 | Ga0265330_10061813 | |||
| 1456 | Ga0265325_10008951 | |||
| 1457 | Ga0265325_10152706 | |||
| 1458 | Ga0265340_10001019 | |||
| 1459 | Ga0265340_10012971 | |||
| 1460 | Ga0265340_10078344 | |||
| 1461 | Ga0265339_10023636 | |||
| 1462 | Ga0307408_100135071 | |||
| 1463 | Ga0265313_10000522 | |||
| 1464 | Ga0265313_10013071 | |||
| 1465 | Ga0265313_10061307 | |||
| 1466 | Ga0307508_10056023 | |||
| 1467 | Ga0265314_10063845 | |||
| 1468 | Ga0265342_10006229 | |||
| 1469 | Ga0265342_10049960 | |||
| 1470 | Ga0307413_10118695 | |||
| 1471 | Ga0307410_10001871 | |||
| 1472 | Ga0307407_10084677 | |||
| 1473 | Ga0307409_100005707 | |||
| 1474 | Ga0307416_100001523 | |||
| 1475 | Ga0307416_100301569 | |||
| 1476 | Ga0307510_10159259 | |||
| 1477 | Ga0373948_0013266 | |||
| 1478 | Ga0373934_0021830 | |||
| 1479 | Ga0373940_0008837 | |||
| 1480 | Ga0373945_0002178 | |||
| 1481 | Ga0373954_0009647 | |||
| 1482 | Ga0373956_0000993 | |||
| 1483 | Ga0373956_0013098 | |||
| 1484 | Ga0373943_0065487 | |||
| 1485 | Ga0373943_0082662 | |||
| 1486 | Ga0373955_0016851 | |||
| 1487 | Ga0373955_0121647 | |||
| 1488 | Ga0373924_0006435 | |||
| 1489 | Ga0373931_0087138 | |||
| 1490 | Ga0373931_0102005 | |||
| 1491 | Ga0373935_0026077 | |||
| 1492 | Ga0373935_0063286 | |||
| 1493 | Ga0373927_0011124 | |||
| 1494 | Ga0373933_0004893 | |||
| 1495 | Ga0373933_0119911 | |||
| 1496 | Ga0373937_0000917 | |||
| 1497 | Ga0373925_0017742 | |||
| 1498 | Ga0373925_0046105 | |||
| 1499 | Ga0373925_0139808 | |||
| 1500 | Ga0400487_22513 | |||
| 1501 | Ga0436365_0471682 | |||
| 1502 | Ga0439438_000003 | |||
| 1503 | Ga0439438_000282 | |||
| 1504 | Ga0439438_000434 | |||
| 1505 | Ga0439447_000460 | |||
| 1506 | Ga0439447_001914 | |||
| 1507 | Ga0439447_002846 | |||
| 1508 | Ga0439466_0000002 | |||
| 1509 | Ga0439432_000566 | |||
| 1510 | Ga0439432_001003 | |||
| 1511 | Ga0439432_001530 | |||
| 1512 | Ga0439432_006918 | |||
| 1513 | Ga0439432_011946 | |||
| 1514 | Ga0439432_050471 | |||
| 1515 | Ga0439452_000004 | |||
| 1516 | Ga0439452_000011 | |||
| 1517 | Ga0439452_000078 | |||
| 1518 | Ga0439452_000079 | |||
| 1519 | Ga0439452_000498 | |||
| 1520 | Ga0439452_001372 | |||
| 1521 | Ga0439452_005027 | |||
| 1522 | Ga0439463_001405 | |||
| 1523 | Ga0450907_000011 | |||
| 1524 | Ga0439464_0000480 | |||
| 1525 | Ga0439464_0000835 | |||
| 1526 | Ga0439464_0002919 | |||
| 1527 | Ga0439464_0037258 | |||
| 1528 | Ga0466981_0000050 | |||
| 1529 | Ga0453683_0002183 | |||
| 1530 | Ga0495627_000017 | |||
| 1531 | Ga0495627_039039 | |||
| 1532 | Ga0495591_000010 | |||
| 1533 | Ga0495591_000090 | |||
| 1534 | Ga0495591_008692 | |||
| 1535 | Ga0495629_0004045 | |||
| 1536 | Ga0495629_0110851 | |||
| 1537 | Ga0495638_0009212 | |||
| 1538 | Ga0495651_0003405 | |||
| 1539 | Ga0495651_0108448 | |||
| 1540 | Ga0495653_0010771 | |||
| 1541 | Ga0495653_0076265 | |||
| 1542 | Ga0495653_0141771 | |||
| 1543 | Ga0495650_0000004 | |||
| 1544 | Ga0495650_0000040 | |||
| 1545 | Ga0495662_0000962 | |||
| 1546 | Ga0495662_0092255 | |||
| 1547 | Ga0495662_0145934 | |||
| 1548 | Ga0495664_0000189 | |||
| 1549 | Ga0495664_0057002 | |||
| 1550 | Ga0495664_0060025 | |||
| 1551 | Ga0495585_0003087 | |||
| 1552 | Ga0495607_0007704 | |||
| 1553 | Ga0495606_0000399 | |||
| 1554 | Ga0495608_0003600 | |||
| 1555 | Ga0495608_0074309 | |||
| 1556 | Ga0495616_0036251 | |||
| 1557 | Ga0495618_0005858 | |||
| 1558 | Ga0495618_0013451 | |||
| 1559 | Ga0495618_0113179 | |||
| 1560 | Ga0495620_0004428 | |||
| 1561 | Ga0495628_0064866 | |||
| 1562 | Ga0495630_0010043 | |||
| 1563 | Ga0495630_0062397 | |||
| 1564 | Ga0495637_0076767 | |||
| 1565 | Ga0495643_0009513 | |||
| 1566 | Ga0495643_0012022 | |||
| 1567 | Ga0495644_0001240 | |||
| 1568 | Ga0495648_0025365 | |||
| 1569 | Ga0495666_0130454 | |||
| 1570 | Ga0495652_0062255 | |||
| 1571 | Ga0495652_0156266 | |||
| 1572 | Ga0495654_0000036 | |||
| 1573 | Ga0495654_0000089 | |||
| 1574 | Ga0495654_0001414 | |||
| 1575 | Ga0495654_0006656 | |||
| 1576 | Ga0495654_0007828 | |||
| 1577 | Ga0495654_0011543 | |||
| 1578 | Ga0495665_0036818 | |||
| 1579 | Ga0495640_0017827 | |||
| 1580 | Ga0495640_0022695 | |||
| 1581 | Ga0495640_0047158 | |||
| 1582 | Ga0495586_0005750 | |||
| 1583 | Ga0495587_0002660 | |||
| 1584 | Ga0495587_0180924 | |||
| 1585 | Ga0495597_0001169 | |||
| 1586 | Ga0495645_0013174 | |||
| 1587 | Ga0495645_0084923 | |||
| 1588 | Ga0495667_0002184 | |||
| 1589 | Ga0495667_0031709 | |||
| 1590 | Ga0495668_0018313 | |||
| 1591 | Ga0495634_0030542 | |||
| 1592 | Ga0495625_0026706 | |||
| 1593 | Ga0495635_0005714 | |||
| 1594 | Ga0495588_0008161 | |||
| 1595 | Ga0495599_0010386 | |||
| 1596 | Ga0495599_0019612 | |||
| 1597 | Ga0495623_0001753 | |||
| 1598 | Ga0495646_0009424 | |||
| 1599 | Ga0495646_0129277 | |||
| 1600 | Ga0495658_0113114 | |||
| 1601 | Ga0495613_0015542 | |||
| 1602 | Ga0495613_0084733 | |||
| 1603 | Ga0495671_0001824 | |||
| 1604 | Ga0495649_0015867 | |||
| 1605 | Ga0495649_0085897 | |||
| 1606 | Ga0495589_0000013 | |||
| 1607 | Ga0495589_0001531 | |||
| 1608 | Ga0495600_0003284 | |||
| 1609 | Ga0495600_0222713 | |||
| 1610 | Ga0495660_0000022 | |||
| 1611 | Ga0495660_0000184 | |||
| 1612 | Ga0495660_0009386 | |||
| 1613 | Ga0495604_0001751 | |||
| 1614 | Ga0495636_0038768 | |||
| 1615 | Ga0495674_0010400 | |||
| 1616 | Ga0495674_0029546 | |||
| 1617 | Ga0495672_0000003 | |||
| 1618 | Ga0495672_0000082 | |||
| 1619 | Ga0495672_0000103 | |||
| 1620 | Ga0495676_0123587 | |||
| 1621 | Ga0495680_0001204 | |||
| 1622 | Ga0495675_0008632 | |||
| 1623 | Ga0495675_0017704 | |||
| 1624 | Ga0495679_000059 | |||
| 1625 | Ga0495679_001176 | |||
| 1626 | Ga0495673_0000011 | |||
| 1627 | Ga0495673_0000117 | |||
| 1628 | Ga0495681_0063598 | |||
| 1629 | Ga0495684_0027627 | |||
| 1630 | Ga0495684_0046434 | |||
| 1631 | Ga0495684_0196146 | |||
| 1632 | Ga0495686_0023082 | |||
| 1633 | Ga0495602_0054974 | |||
| 1634 | Ga0496100_0020046 | |||
| 1635 | Ga0496100_0021063 | |||
| 1636 | Ga0496100_0327114 | |||
| 1637 | Ga0496101_0000144 | |||
| 1638 | Ga0496102_0007586 | |||
| 1639 | Ga0496102_0124521 | |||
| 1640 | Ga0496102_0243430 | |||
| 1641 | Ga0496104_0000153 | |||
| 1642 | Ga0496104_0001602 | |||
| 1643 | Ga0496104_0072416 | |||
| 1644 | Ga0496104_0396721 | |||
| 1645 | Ga0496105_0008262 | |||
| 1646 | Ga0496105_0266126 | |||
| 1647 | Ga0496105_0364291 | |||
| 1648 | Ga0496107_0091072 | |||
| 1649 | Ga0496110_0070201 | |||
| 1650 | Ga0496111_0026200 | |||
| 1651 | Ga0496111_0170038 | |||
| 1652 | Ga0496111_0351684 | |||
| 1653 | Ga0496112_0072822 | |||
| 1654 | Ga0496113_0258725 | |||
| 1655 | Ga0496113_0276204 | |||
| 1656 | Ga0496114_0335312 | |||
| 1657 | Ga0496115_0041888 | |||
| 1658 | Ga0496116_0000009 | |||
| 1659 | Ga0496116_0000016 | |||
| 1660 | Ga0496116_0000148 | |||
| 1661 | Ga0496116_0000777 | |||
| 1662 | Ga0496116_0001014 | |||
| 1663 | Ga0496116_0002172 | |||
| 1664 | Ga0496116_0013724 | |||
| 1665 | Ga0496116_0086262 | |||
| 1666 | Ga0496116_0098066 | |||
| 1667 | Ga0496116_0129522 | |||
| 1668 | Ga0496116_0196610 | |||
| 1669 | Ga0496117_0000116 | |||
| 1670 | Ga0496117_0002487 | |||
| 1671 | Ga0496117_0005006 | |||
| 1672 | Ga0496117_0005369 | |||
| 1673 | Ga0496117_0005435 | |||
| 1674 | Ga0496117_0006918 | |||
| 1675 | Ga0496117_0035041 | |||
| 1676 | Ga0496117_0042050 | |||
| 1677 | Ga0496117_0052762 | |||
| 1678 | Ga0496117_0110532 | |||
| 1679 | Ga0496117_0115120 | |||
| 1680 | Ga0496117_0131419 | |||
| 1681 | Ga0496117_0175935 | |||
| 1682 | Ga0496117_0261191 | |||
| 1683 | Ga0496118_0000906 | |||
| 1684 | Ga0496118_0001701 | |||
| 1685 | Ga0496118_0004732 | |||
| 1686 | Ga0496118_0004852 | |||
| 1687 | Ga0496118_0007265 | |||
| 1688 | Ga0496118_0007795 | |||
| 1689 | Ga0496118_0007826 | |||
| 1690 | Ga0496118_0013851 | |||
| 1691 | Ga0496118_0014265 | |||
| 1692 | Ga0496118_0015913 | |||
| 1693 | Ga0496118_0063118 | |||
| 1694 | Ga0496118_0131896 | |||
| 1695 | Ga0496119_0000096 | |||
| 1696 | Ga0496119_0000472 | |||
| 1697 | Ga0496119_0000586 | |||
| 1698 | Ga0496119_0002196 | |||
| 1699 | Ga0496119_0002287 | |||
| 1700 | Ga0496119_0002663 | |||
| 1701 | Ga0496119_0002975 | |||
| 1702 | Ga0496119_0003291 | |||
| 1703 | Ga0496119_0018393 | |||
| 1704 | Ga0496119_0019571 | |||
| 1705 | Ga0496119_0023595 | |||
| 1706 | Ga0496119_0046692 | |||
| 1707 | Ga0496119_0059638 | |||
| 1708 | Ga0496119_0152323 | |||
| 1709 | Ga0496120_0000068 | |||
| 1710 | Ga0496120_0000166 | |||
| 1711 | Ga0496120_0000389 | |||
| 1712 | Ga0496120_0000572 | |||
| 1713 | Ga0496120_0000602 | |||
| 1714 | Ga0496120_0001236 | |||
| 1715 | Ga0496120_0001364 | |||
| 1716 | Ga0496120_0001521 | |||
| 1717 | Ga0496120_0002363 | |||
| 1718 | Ga0496120_0006318 | |||
| 1719 | Ga0496120_0009015 | |||
| 1720 | Ga0496120_0024995 | |||
| 1721 | Ga0496120_0029973 | |||
| 1722 | Ga0496120_0045608 | |||
| 1723 | Ga0496120_0052555 | |||
| 1724 | Ga0496120_0075730 | |||
| 1725 | Ga0496120_0165239 | |||
| 1726 | Ga0496121_0000052 | |||
| 1727 | Ga0496121_0001407 | |||
| 1728 | Ga0496121_0003985 | |||
| 1729 | Ga0496121_0007946 | |||
| 1730 | Ga0496121_0010723 | |||
| 1731 | Ga0496121_0031562 | |||
| 1732 | Ga0496121_0091888 | |||
| 1733 | Ga0496121_0127925 | |||
| 1734 | Ga0496122_0000070 | |||
| 1735 | Ga0496122_0000392 | |||
| 1736 | Ga0496122_0002311 | |||
| 1737 | Ga0496122_0003665 | |||
| 1738 | Ga0496122_0008374 | |||
| 1739 | Ga0496122_0010138 | |||
| 1740 | Ga0496122_0012297 | |||
| 1741 | Ga0496122_0015706 | |||
| 1742 | Ga0496122_0024217 | |||
| 1743 | Ga0496122_0025645 | |||
| 1744 | Ga0496122_0078133 | |||
| 1745 | Ga0496123_0000017 | |||
| 1746 | Ga0496123_0000131 | |||
| 1747 | Ga0496123_0001554 | |||
| 1748 | Ga0496123_0001924 | |||
| 1749 | Ga0496123_0004679 | |||
| 1750 | Ga0496123_0006706 | |||
| 1751 | Ga0496123_0007192 | |||
| 1752 | Ga0496123_0052895 | |||
| 1753 | Ga0496123_0053471 | |||
| 1754 | Ga0496123_0073406 | |||
| 1755 | Ga0496123_0075724 | |||
| 1756 | Ga0496123_0098954 | |||
| 1757 | Ga0496124_0000053 | |||
| 1758 | Ga0496124_0000303 | |||
| 1759 | Ga0496124_0000630 | |||
| 1760 | Ga0496124_0001210 | |||
| 1761 | Ga0496124_0001921 | |||
| 1762 | Ga0496124_0002062 | |||
| 1763 | Ga0496124_0003880 | |||
| 1764 | Ga0496124_0004583 | |||
| 1765 | Ga0496124_0009686 | |||
| 1766 | Ga0496124_0011012 | |||
| 1767 | Ga0496124_0030577 | |||
| 1768 | Ga0496124_0031483 | |||
| 1769 | Ga0496124_0038930 | |||
| 1770 | Ga0496124_0040972 | |||
| 1771 | Ga0496124_0124721 | |||
| 1772 | Ga0496124_0127223 | |||
| 1773 | Ga0496125_0000056 | |||
| 1774 | Ga0496125_0000329 | |||
| 1775 | Ga0496125_0002880 | |||
| 1776 | Ga0496125_0008126 | |||
| 1777 | Ga0496125_0008724 | |||
| 1778 | Ga0496125_0014954 | |||
| 1779 | Ga0496126_0000137 | |||
| 1780 | Ga0496126_0000818 | |||
| 1781 | Ga0496126_0025978 | |||
| 1782 | Ga0496126_0035995 | |||
| 1783 | Ga0496126_0037205 | |||
| 1784 | Ga0496126_0039024 | |||
| 1785 | Ga0496126_0071555 | |||
| 1786 | Ga0495678_000142 | |||
| 1787 | Ga0495678_037537 | |||
| 1788 | Ga0495682_0000034 | |||
| 1789 | Ga0501033_0080497 | |||
| 1790 | Ga0501034_0050830 | |||
| 1791 | Ga0501034_0109009 | |||
| 1792 | Ga0501038_0211111 | |||
| 1793 | Ga0501046_0121964 | |||
| 1794 | Ga0501047_0013360 | |||
| 1795 | Ga0501047_0040203 | |||
| 1796 | Ga0501047_0052523 | |||
| 1797 | Ga0501047_0270655 | |||
| 1798 | Ga0501067_0008176 | |||
| 1799 | Ga0501067_0014574 | |||
| 1800 | Ga0501067_0026561 | |||
| 1801 | Ga0501068_0081154 | |||
| 1802 | Ga0501069_0022611 | |||
| 1803 | Ga0501069_0037274 | |||
| 1804 | Ga0501070_0007890 | |||
| 1805 | Ga0501070_0077636 | |||
| 1806 | Ga0501070_0252744 | |||
| 1807 | Ga0501072_0017632 | |||
| 1808 | Ga0501073_0032601 | |||
| 1809 | Ga0501074_0095267 | |||
| 1810 | Ga0501074_0216356 | |||
| 1811 | Ga0501076_0157277 | |||
| 1812 | Ga0501077_0029901 | |||
| 1813 | Ga0501233_018062 | |||
| 1814 | Ga0501079_0061509 | |||
| 1815 | Ga0501080_0072661 | |||
| 1816 | Ga0501080_0074653 | |||
| 1817 | Ga0501080_0105338 | |||
| 1818 | Ga0501083_0004742 | |||
| 1819 | Ga0501083_0018349 | |||
| 1820 | Ga0501083_0112220 | |||
| 1821 | Ga0501035_0003726 | |||
| 1822 | Ga0501035_0051407 | |||
| 1823 | Ga0501044_0034569 | |||
| 1824 | Ga0501044_0098397 | |||
| 1825 | Ga0501044_0245234 | |||
| 1826 | nmdc:mga00v17_12262_c1 | |||
| 1827 | nmdc:mga00v17_26883_c1 | |||
| 1828 | nmdc:mga00v17_37338_c1 | |||
| 1829 | nmdc:mga0k408_5714_c2 | |||
| 1830 | nmdc:mga05p37_72861_c1 | |||
| 1831 | nmdc:mga09592_14738_c1 | |||
| 1832 | nmdc:mga0qj67_41057_c1 | |||
| 1833 | nmdc:mga06r32_285292_c1 | |||
| 1834 | nmdc:mga0rr50_616455_c1 | |||
| 1835 | nmdc:mga08x19_112405_c1 | |||
| 1836 | nmdc:mga08x19_145376_c1 | |||
| 1837 | nmdc:mga0a205_105968_c1 | |||
| 1838 | Ga0495601_0023347 | |||
| 1839 | Ga0495601_0026298 | |||
| 1840 | Ga0495601_0043811 | |||
| 1841 | Ga0495612_0000213 | |||
| 1842 | Ga0495595_0001849 | |||
| 1843 | Ga0495619_0000666 | |||
| 1844 | Ga0495619_0002522 | |||
| 1845 | Ga0500593_037334 | |||
| 1846 | Ga0500618_000706 | |||
| 1847 | Ga0500621_000010 | |||
| 1848 | Ga0500616_0002271 | |||
| 1849 | Ga0500627_0031176 | |||
| 1850 | Ga0501084_0052721 | |||
| 1851 | Ga0501084_0158231 | |||
| 1852 | Ga0501084_0200950 | |||
| 1853 | Ga0501084_0245643 | |||
| 1854 | Ga0501082_0025055 | |||
| 1855 | Ga0501082_0050044 | |||
| 1856 | Ga0501082_0067226 | |||
| 1857 | Ga0501082_0395879 | |||
| 1858 | Ga0501082_0434975 | |||
| 1859 | 2506580567 | |||
| 1860 | 2506585706 | |||
| 1861 | 2508854364 | |||
| 1862 | 2511136599 | |||
| 1863 | 2511171945 | |||
| 1864 | 2511379640 | |||
| 1865 | 2511390338 | |||
| 1866 | 2511433686 | |||
| 1867 | 2524460110 | |||
| 1868 | 2535486069 | |||
| 1869 | 2547695979 | |||
| 1870 | 2548649439 | |||
| 1871 | 2555258926 | |||
| 1872 | 2562464635 | |||
| 1873 | 2585274244 | |||
| 1874 | 2585280343 | |||
| 1875 | 2585322621 | |||
| 1876 | 2585330734 | |||
| 1877 | 2585532573 | |||
| 1878 | 2585554411 | |||
| 1879 | 2585560693 | |||
| 1880 | 2585826374 | |||
| 1881 | 2585830592 | |||
| 1882 | 2585898899 | |||
| 1883 | 2585903509 | |||
| 1884 | 2587981372 | |||
| 1885 | 2599410304 | |||
| 1886 | 2599723280 | |||
| 1887 | 2601523516 | |||
| 1888 | 2601528675 | |||
| 1889 | 2601534441 | |||
| 1890 | 2601538780 | |||
| 1891 | 2601615508 | |||
| 1892 | 2601619566 | |||
| 1893 | 2601644019 | |||
| 1894 | 2601647971 | |||
| 1895 | 2601653560 | |||
| 1896 | 2601658319 | |||
| 1897 | 2601663844 | |||
| 1898 | 2601696275 | |||
| 1899 | 2601701476 | |||
| 1900 | 2601706215 | |||
| 1901 | 2601711800 | |||
| 1902 | 2601716818 | |||
| 1903 | 2601721299 | |||
| 1904 | 2601727224 | |||
| 1905 | 2601731764 | |||
| 1906 | 2601736776 | |||
| 1907 | 2601740258 | |||
| 1908 | 2601751195 | |||
| 1909 | 2601757129 | |||
| 1910 | 2601762270 | |||
| 1911 | 2602018945 | |||
| 1912 | 2603639478 | |||
| 1913 | 2603644345 | |||
| 1914 | 2603661232 | |||
| 1915 | 2603666507 | |||
| 1916 | 2603701130 | |||
| 1917 | 2603704952 | |||
| 1918 | 2603839161 | |||
| 1919 | 2603843579 | |||
| 1920 | 2603849318 | |||
| 1921 | 2603854388 | |||
| 1922 | 2603865727 | |||
| 1923 | 2603872443 | |||
| 1924 | 2603877319 | |||
| 1925 | 2606049624 | |||
| 1926 | 2606070939 | |||
| 1927 | 2606147308 | |||
| 1928 | 2606177033 | |||
| 1929 | 2608670723 | |||
| 1930 | 2609911397 | |||
| 1931 | 2616307356 | |||
| 1932 | 2616554900 | |||
| 1933 | 2617383572 | |||
| 1934 | 2637223134 | |||
| 1935 | 2650897363 | |||
| 1936 | 2656276360 | |||
| 1937 | 2671104529 | |||
| 1938 | 2671106668 | |||
| 1939 | 2671112149 | |||
| 1940 | 2671586135 | |||
| 1941 | 2676408675 | |||
| 1942 | 2681998109 | |||
| 1943 | 2682008229 | |||
| 1944 | 2686354666 | |||
| 1945 | 2689447121 | |||
| 1946 | 2707101139 | |||
| 1947 | 2712471306 | |||
| 1948 | 2738944469 | |||
| 1949 | 2739307524 | |||
| 1950 | 2753357266 | |||
| 1951 | 2753857741 | |||
| 1952 | 2757571324 | |||
| 1953 | 2758639672 | |||
| 1954 | 2765466346 | |||
| 1955 | 2765590856 | |||
| 1956 | 2770198979 | |||
| 1957 | 2772440923 | |||
| 1958 | 2775540423 | |||
| 1959 | 2776270248 | |||
| 1960 | 2776285023 | |||
| 1961 | 2777019458 | |||
| 1962 | 2778175966 | |||
| 1963 | 2792312562 | |||
| 1964 | 2793403862 | |||
| 1965 | 2807177024 | |||
| 1966 | 2809124013 | |||
| 1967 | 2813726765 | |||
| 1968 | 2814694138 | |||
| 1969 | 2819609645 | |||
| 1970 | 2819639742 | |||
| 1971 | 2821120739 | |||
| 1972 | 2823376617 | |||
| 1973 | 2828308496 | |||
| 1974 | 2838033088 | |||
| 1975 | 2839998308 | |||
| 1976 | 2840769141 | |||
| 1977 | 2842298664 | |||
| 1978 | 2842359469 | |||
| 1979 | 2842479821 | |||
| 1980 | 2842483433 | |||
| 1981 | 2842506997 | |||
| 1982 | 2842510692 | |||
| 1983 | 2842872306 | |||
| 1984 | 2844429230 | |||
| 1985 | 2844531327 | |||
| 1986 | 2847090311 | |||
| 1987 | 2847801538 | |||
| 1988 | 2852106051 | |||
| 1989 | 2852391149 | |||
| 1990 | 2854604941 | |||
| 1991 | 2854916733 | |||
| 1992 | 2865016085 | |||
| 1993 | 2869556529 | |||
| 1994 | 2876605890 | |||
| 1995 | 2881611337 | |||
| 1996 | 2884087012 | |||
| 1997 | 2888371028 | |||
| 1998 | 2888376270 | |||
| 1999 | 2891675504 | |||
| 2000 | 2894655577 | |||
| 2001 | 2899806464 | |||
| 2002 | 2904474184 | |||
| 2003 | 2904507199 | |||
| 2004 | 2904517048 | |||
| 2005 | 2904582283 | |||
| 2006 | 2908672870 | |||
| 2007 | 2909044673 | |||
| 2008 | 2913309088 | |||
| 2009 | 2915652011 | |||
| 2010 | 2919113496 | |||
| 2011 | 2919122933 | |||
| 2012 | 2919150531 | |||
| 2013 | 2919173348 | |||
| 2014 | 2919410634 | |||
| 2015 | 2923636747 | |||
| 2016 | 2927145404 | |||
| 2017 | 2927836792 | |||
| 2018 | 2928524227 | |||
| 2019 | 2932407119 | |||
| 2020 | 2935629514 | |||
| 2021 | 2937544128 | |||
| 2022 | 2937971236 | |||
| 2023 | 2939572431 | |||
| 2024 | 2939576605 | |||
| 2025 | 2939582359 | |||
| 2026 | 2939605876 | |||
| 2027 | 2939610573 | |||
| 2028 | 2939620577 | |||
| 2029 | 2939645642 | |||
| 2030 | 2945875828 | |||
| 2031 | 2945954543 | |||
| 2032 | 2954013176 | |||
| 2033 | 2969080165 | |||
| 2034 | 2971821513 | |||
| 2035 | 2974314915 | |||
| 2036 | 2974440310 | |||
| 2037 | 2978977016 | |||
| 2038 | 2984498378 | |||
| 2039 | 2984562620 | |||
| 2040 | 2984600680 | |||
| 2041 | 2990263480 | |||
| 2042 | 2996312126 | |||
| 2043 | 3000377475 | |||
| 2044 | 3002145138 | |||
| 2045 | 3005418530 | |||
| 2046 | 640939924 | |||
| 2047 | 8002291629 | |||
| 2048 | 8004593829 | |||
| 2049 | 8005318578 | |||
| 2050 | 8005488539 | |||
| 2051 | 8005649006 | |||
| 2052 | 8005662486 | |||
| 2053 | 8005682246 | |||
| 2054 | 8015397106 | |||
| 2055 | 8016737432 | |||
| 2056 | 8018226387 | |||
| 2057 | 8018407095 | |||
| 2058 | 8019502658 | |||
| 2059 | 8019507466 | |||
| 2060 | 8054848501 | |||
| 2061 | 8054849760 | |||
| 2062 | 8055089523 | |||
| 2063 | 8055095992 | |||
| 2064 | 8055101736 | |||
| 2065 | 8055697674 | |||
| 2066 | 8056876128 | |||
| 2067 | 8057308474 | |||
| 2068 | 8057580998 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xhz-assembly1.cif.gz_B | probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography | 0.9864 | 10 | 183 |
| 2xhz-assembly1.cif.gz_B | probing the active site of the sugar isomerase domain from e. coli arabinose-5-phosphate isomerase via x-ray crystallography | 0.9808 | 10 | 183 |
| 3fna-assembly3.cif.gz_A | crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 | 0.9744 | 198 | 322 |
| 3fna-assembly3.cif.gz_B-2 | crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073 | 0.9705 | 199 | 324 |
| 3k2v-assembly1.cif.gz_B | structure of the cbs pair of a putative d-arabinose 5-phosphate isomerase from klebsiella pneumoniae subsp. pneumoniae. | 0.9698 | 198 | 324 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P45395_202_325_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 1.001 | 202 | 324 | 3.10.580.10 |
| af_P45395_202_325_3.10.580.10 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9846 | 202 | 324 | 3.10.580.10 |
| 3fnaA00 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9677 | 198 | 322 | 3.10.580.10 |
| 3fnaA00 | Alpha Beta;Roll;CBS-domain;CBS-domain | 0.9509 | 198 | 322 | 3.10.580.10 |
| af_P45395_11_201_3.40.50.10490 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 | 0.95 | 11 | 200 | 3.40.50.10490 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A656SJ60-F1-model_v4 | deleted | 0.9975 | 45 | 126 |
|
| AF-A0A4V2AMI0-F1-model_v4 | SIS domain-containing protein | 0.9783 | 23 | 168 |
GO:0097367
GO:1901135 |
| AF-A0A832J690-F1-model_v4 | CBS domain-containing protein | 0.9632 | 229 | 328 |
|
| AF-A0A656SJ60-F1-model_v4 | deleted | 0.9624 | 45 | 126 |
|
| AF-A0A382IFM7-F1-model_v4 | SIS domain-containing protein | 0.9594 | 10 | 131 |
GO:0097367
GO:1901135 |