F488694

General Info

Members Datasets Scaffolds Average Seq Length
1035 795 2071 275

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100003953|Ga0070665_1000039538
Length 294
Sequence MSTPSASSSEWKCKAMTARMDKRFADLRAENRPALITYFMGGDPDFETSLGIMKALPEAGADVIELGMPFSDPMADGPAIQLAGQRALKGGQTLKTTLDLAREFRKEDDATPIVMMGYYNPIYIYGVDKFLDDALAAGVDGLIVVDLPPEMDDELCVPALARGVNFIRLATPTTDGKRLPTVLKNTSGFVYYVSMNGITGSALPDPSLISGAVGRIKAHTELPVCVGFGVKTADHAKAIGAVADGVVVGSAIVNQIAGSLTKDGQATADTVPSVTTLVKGLSTGVRASRLAAAE

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
51 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
58 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
61 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
62 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
63 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
64 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
65 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
66 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
105 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
126 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
127 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
136 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
137 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
138 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
139 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
140 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
145 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
211 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
214 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
217 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
218 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
219 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
220 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
221 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
222 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
226 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
227 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
236 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
237 2509276019 Ensifer aridi TW10 Isolate Nodule
238 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
239 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
240 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
241 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
242 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
243 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
244 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
245 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
246 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
247 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
248 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
249 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
250 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
251 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
252 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
253 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
254 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
255 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
256 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
257 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
258 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
259 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
260 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
261 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
262 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
263 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
264 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
265 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
266 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
267 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
268 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
269 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
270 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
271 2516143018 Ensifer sp. BR816 Isolate Nodule
272 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
273 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
274 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
275 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
276 2519899620 Rhizobium sp. Pop5 Isolate Nodule
277 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
278 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
279 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
280 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
281 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
282 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
283 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
284 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
285 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
286 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
287 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
288 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
289 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
290 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
291 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
292 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
293 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
294 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
295 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
296 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
297 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
298 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
299 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
300 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
301 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
302 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
303 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
304 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
305 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
306 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
307 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
308 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
309 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
310 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
311 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
312 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
313 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
314 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
315 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
316 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
317 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
318 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
319 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
320 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
321 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
322 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
323 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
324 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
325 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
326 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
327 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
328 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
329 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
330 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
331 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
332 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
333 2643221557 Ensifer sp. Root558 Isolate Unclassified
334 2643221568 Rhizobium sp. Root564 Isolate Unclassified
335 2643221582 Rhizobium sp. Root651 Isolate Unclassified
336 2643221599 Rhizobium sp. Root708 Isolate Unclassified
337 2643221607 Rhizobium sp. Root73 Isolate Unclassified
338 2643221610 Ensifer sp. Root74 Isolate Unclassified
339 2643221618 Ensifer sp. Root231 Isolate Unclassified
340 2643221626 Ensifer sp. Root31 Isolate Unclassified
341 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
342 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
343 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
344 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
345 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
346 2643221655 Ensifer sp. Root1252 Isolate Unclassified
347 2643221659 Ensifer sp. Root127 Isolate Unclassified
348 2643221668 Ensifer sp. Root423 Isolate Unclassified
349 2643221675 Ensifer sp. Root1298 Isolate Unclassified
350 2643221680 Ensifer sp. Root1312 Isolate Unclassified
351 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
352 2643221688 Rhizobium sp. Root482 Isolate Unclassified
353 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
354 2643221693 Rhizobium sp. Root491 Isolate Unclassified
355 2643221698 Ensifer sp. Root142 Isolate Unclassified
356 2643221712 Ensifer sp. Root258 Isolate Unclassified
357 2643221718 Rhizobium sp. Root268 Isolate Unclassified
358 2643221719 Rhizobium sp. Root274 Isolate Unclassified
359 2643221723 Ensifer sp. Root278 Isolate Unclassified
360 2643221726 Ensifer sp. Root954 Isolate Unclassified
361 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
362 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
363 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
364 2718217882 Rhizobium sp. N741 Isolate Nodule
365 2718217927 Rhizobium sp. N324 Isolate Nodule
366 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
367 2718218009 Rhizobium sp. N561 Isolate Nodule
368 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
369 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
370 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
371 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
372 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
373 2718218363 Rhizobium sp. N113 Isolate Nodule
374 2718218365 Rhizobium sp. N731 Isolate Nodule
375 2718218366 Rhizobium sp. N621 Isolate Nodule
376 2718218423 Rhizobium sp. N941 Isolate Nodule
377 2721755514 Rhizobium sp. N6212 Isolate Nodule
378 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
379 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
380 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
381 2721755809 Rhizobium sp. N541 Isolate Nodule
382 2721755810 Rhizobium sp. N871 Isolate Nodule
383 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
384 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
385 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
386 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
387 2728369365 Rhizobium sp. N1341 Isolate Nodule
388 2728369397 Rhizobium sp. N1314 Isolate Nodule
389 2738541293 Rhizobium sp. GV031 Isolate Unclassified
390 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
391 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
392 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
393 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
394 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
395 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
396 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
397 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
398 2791355256 Rhizobium sp. M10 Isolate Nodule
399 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
400 2791355260 Rhizobium sp. L9 Isolate Nodule
401 2791355261 Rhizobium sp. J15 Isolate Nodule
402 2791355262 Rhizobium sp. M1 Isolate Nodule
403 2791355263 Rhizobium chutanense C5 Isolate Nodule
404 2791355264 Rhizobium sp. S9 Isolate Nodule
405 2791355265 Rhizobium sp. H4 Isolate Nodule
406 2791355266 Rhizobium sp. L43 Isolate Nodule
407 2791355267 Rhizobium sp. L18 Isolate Nodule
408 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
409 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
410 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
411 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
412 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
413 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
414 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
415 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
416 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
417 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
418 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
419 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
420 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
421 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
422 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
423 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
424 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
425 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
426 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
427 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
428 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
429 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
430 2838048938 Rhizobium pisi 27/80 Isolate Nodule
431 2838061910 Rhizobium phaseoli L15 Isolate Nodule
432 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
433 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
434 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
435 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
436 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
437 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
438 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
439 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
440 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
441 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
442 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
443 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
444 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
445 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
446 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
447 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
448 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
449 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
450 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
451 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
452 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
453 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
454 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
455 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
456 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
457 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
458 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
459 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
460 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
461 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
462 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
463 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
464 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
465 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
466 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
467 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
468 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
469 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
470 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
471 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
472 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
473 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
474 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
475 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
476 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
477 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
478 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
479 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
480 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
481 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
482 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
483 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
484 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
485 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
486 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
487 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
488 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
489 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
490 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
491 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
492 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
493 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
494 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
495 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
496 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
497 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
498 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
499 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
500 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
501 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
502 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
503 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
504 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
505 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
506 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
507 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
508 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
509 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
510 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
511 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
512 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
513 2844163670 Ensifer sp. 1H6 Isolate Unclassified
514 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
515 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
516 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
517 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
518 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
519 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
520 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
521 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
522 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
523 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
524 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
525 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
526 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
527 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
528 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
529 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
530 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
531 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
532 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
533 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
534 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
535 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
536 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
537 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
538 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
539 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
540 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
541 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
542 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
543 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
544 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
545 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
546 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
547 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
548 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
549 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
550 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
551 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
552 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
553 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
554 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
555 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
556 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
557 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
558 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
559 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
560 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
561 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
562 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
563 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
564 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
565 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
566 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
567 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
568 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
569 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
570 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
571 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
572 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
573 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
574 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
575 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
576 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
577 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
578 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
579 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
580 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
581 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
582 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
583 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
584 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
585 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
586 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
587 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
588 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
589 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
590 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
591 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
592 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
593 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
594 2933599457 Rhizobium phaseoli M3 Isolate Nodule
595 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
596 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
597 2936381700 Rhizobium chutanense C16 Isolate Unclassified
598 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
599 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
600 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
601 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
602 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
603 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
604 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
605 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
606 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
607 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
608 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
609 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
610 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
611 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
612 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
613 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
614 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
615 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
616 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
617 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
618 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
619 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
620 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
621 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
622 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
623 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
624 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
625 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
626 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
627 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
628 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
629 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
630 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
631 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
632 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
633 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
634 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
635 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
636 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
637 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
638 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
639 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
640 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
641 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
642 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
643 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
644 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
645 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
646 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
647 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
648 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
649 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
650 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
651 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
652 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
653 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
654 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
655 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
656 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
657 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
658 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
659 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
660 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
661 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
662 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
663 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
664 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
665 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
666 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
667 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
668 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
669 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
670 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
671 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
672 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
673 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
674 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
675 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
676 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
677 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
678 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
679 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
680 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
681 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
682 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
683 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
684 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
685 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
686 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
687 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
688 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
689 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
690 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
691 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
692 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
693 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
694 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
695 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
696 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
697 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
698 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
699 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
700 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
701 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
702 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
703 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
704 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
705 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
706 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
707 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
708 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
709 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
710 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
711 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
712 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
713 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
714 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
715 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
716 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
717 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
718 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
719 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
720 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
721 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
722 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
723 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
724 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
725 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
726 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
727 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
728 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
729 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
730 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
731 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
732 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
733 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
734 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
735 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
736 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
737 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
738 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
739 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
740 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
741 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
742 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
743 2996887358 Rhizobium sp. R711 Isolate Nodule
744 2996893221 Rhizobium sp. R635 Isolate Nodule
745 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
746 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
747 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
748 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
749 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
750 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
751 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
752 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
753 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
754 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
755 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
756 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
757 8005258706 Rhizobium sp. R693 Isolate Nodule
758 8005275841 Rhizobium sp. N4311 Isolate Nodule
759 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
760 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
761 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
762 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
763 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
764 8005321885 Rhizobium sp. R72 Isolate Nodule
765 8005382845 Rhizobium sp. R634 Isolate Nodule
766 8005395548 Rhizobium sp. R339 Isolate Nodule
767 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
768 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
769 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
770 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
771 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
772 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
773 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
774 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
775 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
776 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
777 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
778 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
779 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
780 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
781 8018176218 Rhizobium sp. N122 Isolate Nodule
782 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
783 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
784 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
785 8024501048 Rhizobium sp. H4 Isolate Nodule
786 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
787 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
788 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
789 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
790 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
791 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
792 8056382006 Rhizobium croatiense 13T Isolate Nodule
793 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
794 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
795 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.31
Metatranscriptomes 0.58
Isolates 54.11

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 17
Nodule 40.68
Rhizoplane 1.45
Rhizosphere 23.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100003953 3300005548 Bacteria 15632
2 JGI25155J39150_1000018 3300002704 Bacteria 157606
3 JGI25156J39149_1000055 3300002705 Bacteria 87733
4 JGI25162J39368_1000601 3300002737 Bacteria 25918
5 JGI25162J39368_1000642 3300002737 Bacteria 24772
6 JGI25162J39368_1002212 3300002737 Bacteria 8005
7 JGI25154J39366_1000069 3300002738 Bacteria 96438
8 JGI25158J39367_1006750 3300002739 Bacteria 1638
9 JGI25157J39369_1000076 3300002741 Bacteria 87678
10 JGI25152J39213_1000960 3300002773 Bacteria 14075
11 JGI25152J39213_1002404 3300002773 Bacteria 7150
12 JGI25152J39213_1005422 3300002773 Bacteria 3723
13 JGI25152J39213_1005832 3300002773 Bacteria 3491
14 JGI25150J39212_1000018 3300002774 Bacteria 146535
15 JGI25150J39212_1001297 3300002774 Bacteria 7118
16 JGI25159J45721_1000022 3300002987 Bacteria 119463
17 JGI25159J45721_1000487 3300002987 Bacteria 18177
18 JGI25159J45721_1000929 3300002987 Bacteria 12760
19 JGI25151J46595_10000034 3300003187 Bacteria 192271
20 JGI25151J46595_10003225 3300003187 Bacteria 9104
21 JGI25151J46595_10022650 3300003187 Bacteria 2603
22 JGI25151J46595_10022800 3300003187 Bacteria 2592
23 JGI25151J46595_10033088 3300003187 Bacteria 1996
24 JGI25151J46595_10064130 3300003187 Bacteria 1152
25 JGI25165J46597_1000999 3300003214 Bacteria 18766
26 JGI25165J46597_1001072 3300003214 Bacteria 17563
27 JGI25165J46597_1001234 3300003214 Bacteria 15175
28 JGI25165J46597_1003592 3300003214 Bacteria 3765
29 JGI25153J46596_10003986 3300003215 Bacteria 8069
30 JGI25153J46596_10009941 3300003215 Bacteria 4353
31 JGI25153J46596_10014627 3300003215 Bacteria 3249
32 JGI25153J46596_10016937 3300003215 Bacteria 2893
33 rootH1_10077283 3300003316 Bacteria 2520
34 rootH1_10077283 3300003323 Bacteria 1524
35 JGI25160J50197_1000051 3300003354 Bacteria 132923
36 JGI25160J50197_1000056 3300003354 Bacteria 119463
37 JGI25160J50197_1006840 3300003354 Bacteria 4560
38 JGI25161J50226_1000011 3300003374 Bacteria 210140
39 JGI25161J50226_1000214 3300003374 Bacteria 36702
40 JGI25161J50226_1000940 3300003374 Bacteria 10419
41 Ga0055526_1000547 3300003771 Bacteria 29689
42 Ga0055526_1001114 3300003771 Bacteria 19551
43 Ga0055526_1010530 3300003771 Bacteria 4286
44 Ga0055526_1012924 3300003771 Bacteria 3583
45 Ga0055524_1003689 3300003775 Bacteria 7329
46 Ga0055524_1003800 3300003775 Bacteria 7176
47 Ga0055524_1011885 3300003775 Bacteria 3372
48 Ga0055524_1019635 3300003775 Bacteria 2303
49 Ga0055536_1012052 3300003781 Bacteria 3246
50 Ga0055528_1002353 3300003790 Bacteria 10230
51 Ga0055528_1006196 3300003790 Bacteria 5450
52 Ga0055528_1008554 3300003790 Bacteria 4364
53 Ga0055528_1039507 3300003790 Bacteria 1077
54 Ga0055528_1042960 3300003790 Bacteria 988
55 Ga0055540_1003887 3300003792 Bacteria 7012
56 Ga0055540_1004370 3300003792 Bacteria 6408
57 Ga0055531_10002635 3300003794 Bacteria 11870
58 Ga0055531_10014248 3300003794 Bacteria 3596
59 Ga0058692_1006899 3300003856 Bacteria 3065
60 Ga0058692_1015180 3300003856 Bacteria 1743
61 Ga0055543_1000041 3300004625 Bacteria 118501
62 Ga0055543_1000180 3300004625 Bacteria 52220
63 Ga0055543_1000205 3300004625 Bacteria 48094
64 Ga0065165_1000155 3300005262 Bacteria 119501
65 Ga0065165_1000303 3300005262 Bacteria 82513
66 Ga0065165_1015756 3300005262 Bacteria 2868
67 Ga0070670_100000217 3300005331 Bacteria 53128
68 Ga0070666_10029564 3300005335 Bacteria 3603
69 Ga0070660_100117939 3300005339 Bacteria 2117
70 Ga0070668_100081898 3300005347 Bacteria 2531
71 Ga0070669_100034026 3300005353 Bacteria 3689
72 Ga0070669_100175321 3300005353 Bacteria 1674
73 Ga0070669_100392540 3300005353 Bacteria 1134
74 Ga0070671_100002651 3300005355 Bacteria 13851
75 Ga0070659_100383154 3300005366 Bacteria 1185
76 Ga0070679_100218200 3300005530 Bacteria 1869
77 Ga0070665_100125958 3300005548 Bacteria 2564
78 Ga0070665_100182314 3300005548 Bacteria 2101
79 Ga0070665_100856931 3300005548 Bacteria 922
80 Ga0068855_100071913 3300005563 Bacteria 4020
81 Ga0068856_100275802 3300005614 Bacteria 1698
82 Ga0075365_10084736 3300006038 Bacteria 2152
83 Ga0075368_10001563 3300006042 Bacteria 7347
84 Ga0075363_100116791 3300006048 Bacteria 1486
85 Ga0075364_10000055 3300006051 Bacteria 41950
86 Ga0075364_10007551 3300006051 Bacteria 6463
87 Ga0075367_10001363 3300006178 Bacteria 10408
88 Ga0075367_10005693 3300006178 Bacteria 6222
89 Ga0075367_10144264 3300006178 Bacteria 1476
90 Ga0075369_10011640 3300006186 Bacteria 3463
91 Ga0075369_10016192 3300006186 Bacteria 3004
92 Ga0075370_10005904 3300006353 Bacteria 6124
93 Ga0079104_1000310 3300006946 Bacteria 61815
94 Ga0079104_1009137 3300006946 Bacteria 3383
95 Ga0099826_10000099 3300006948 Bacteria 40813
96 Ga0099826_10019836 3300006948 Bacteria 5051
97 Ga0105251_10012897 3300009011 Bacteria 4702
98 Ga0105250_10017442 3300009092 Bacteria 2919
99 Ga0105243_10003892 3300009148 Bacteria 11916
100 Ga0105248_10007086 3300009177 Bacteria 12279
101 Ga0105237_10069615 3300009545 Bacteria 3514
102 Ga0123341_1000071 3300009765 Bacteria 43545
103 Ga0123342_1013898 3300009766 Bacteria 7887
104 Ga0105239_10014374 3300010375 Bacteria 8784
105 Ga0105246_10035200 3300011119 Bacteria 3345
106 Ga0105246_10185362 3300011119 Bacteria 1606
107 Ga0157373_10221956 3300013100 Bacteria 1333
108 Ga0157371_10000071 3300013102 Bacteria 164088
109 Ga0157371_10004809 3300013102 Bacteria 11620
110 Ga0157370_10000079 3300013104 Bacteria 107305
111 Ga0171463_1004 3300013249 Bacteria 437207
112 Ga0183363_1178 3300015690 Bacteria 13879
113 Ga0163161_10416869 3300017792 Bacteria 1080
114 Ga0214544_1000079 3300021320 Bacteria 121742
115 Ga0214542_1000064 3300021321 Bacteria 127681
116 Ga0214542_1028891 3300021321 Bacteria 2336
117 Ga0214543_1000015 3300021327 Bacteria 305679
118 Ga0214543_1000063 3300021327 Bacteria 127694
119 Ga0228711_1000030 3300022739 Bacteria 94546
120 Ga0228710_1000002 3300022740 Bacteria 287279
121 Ga0209435_100031 3300025206 Bacteria 164115
122 Ga0209436_100013 3300025208 Bacteria 131492
123 Ga0209436_100204 3300025208 Bacteria 27500
124 Ga0209436_113293 3300025208 Bacteria 1353
125 Ga0209437_100179 3300025233 Bacteria 134210
126 Ga0209437_100181 3300025233 Bacteria 132953
127 Ga0207425_1000035 3300025245 Bacteria 225942
128 Ga0207425_1000592 3300025245 Bacteria 21123
129 Ga0207425_1021251 3300025245 Bacteria 1377
130 Ga0209646_1000102 3300025246 Bacteria 164115
131 Ga0209026_1000096 3300025250 Bacteria 164115
132 Ga0209677_101959 3300025253 Bacteria 8209
133 Ga0209759_1000090 3300025256 Bacteria 164115
134 Ga0209129_1000029 3300025258 Bacteria 401149
135 Ga0209129_1000050 3300025258 Bacteria 267408
136 Ga0209129_1001908 3300025258 Bacteria 10991
137 Ga0209129_1004450 3300025258 Bacteria 5458
138 Ga0209129_1005545 3300025258 Bacteria 4419
139 Ga0209129_1014936 3300025258 Bacteria 1626
140 Ga0209233_1000185 3300025261 Bacteria 133788
141 Ga0209233_1000212 3300025261 Bacteria 110364
142 Ga0209233_1000263 3300025261 Bacteria 79293
143 Ga0209455_1014964 3300025272 Bacteria 1729
144 Ga0209673_1000033 3300025273 Bacteria 335369
145 Ga0209673_1000050 3300025273 Bacteria 285287
146 Ga0209673_1001329 3300025273 Bacteria 24789
147 Ga0209673_1002646 3300025273 Bacteria 11985
148 Ga0209673_1004300 3300025273 Bacteria 7697
149 Ga0209130_1000009 3300025284 Bacteria 498952
150 Ga0209130_1000058 3300025284 Bacteria 210250
151 Ga0209130_1000133 3300025284 Bacteria 119561
152 Ga0209130_1008168 3300025284 Bacteria 3122
153 Ga0209130_1025944 3300025284 Bacteria 1263
154 Ga0209676_1003565 3300025292 Bacteria 9407
155 Ga0209676_1013135 3300025292 Bacteria 3202
156 Ga0209676_1032315 3300025292 Bacteria 1576
157 Ga0209025_1000042 3300025294 Bacteria 370577
158 Ga0209025_1000132 3300025294 Bacteria 197432
159 Ga0209025_1000536 3300025294 Bacteria 71932
160 Ga0209025_1000815 3300025294 Bacteria 50019
161 Ga0209025_1001759 3300025294 Bacteria 25933
162 Ga0209025_1010008 3300025294 Bacteria 6496
163 Ga0209025_1011966 3300025294 Bacteria 5633
164 Ga0209025_1013178 3300025294 Bacteria 5220
165 Ga0209025_1019557 3300025294 Bacteria 3758
166 Ga0209564_1000193 3300025295 Bacteria 141731
167 Ga0209564_1000227 3300025295 Bacteria 125497
168 Ga0209564_1000700 3300025295 Bacteria 49128
169 Ga0209564_1012685 3300025295 Bacteria 3649
170 Ga0209564_1023477 3300025295 Bacteria 2141
171 Ga0209564_1024537 3300025295 Bacteria 2057
172 Ga0209758_1000299 3300025297 Bacteria 97367
173 Ga0209758_1000811 3300025297 Bacteria 44054
174 Ga0209758_1001376 3300025297 Bacteria 29001
175 Ga0209758_1005224 3300025297 Bacteria 10175
176 Ga0209758_1013589 3300025297 Bacteria 4420
177 Ga0209050_1005486 3300025298 Bacteria 7943
178 Ga0209256_1000737 3300025299 Bacteria 43040
179 Ga0209256_1003023 3300025299 Bacteria 12437
180 Ga0209256_1003361 3300025299 Bacteria 11329
181 Ga0209256_1004974 3300025299 Bacteria 7962
182 Ga0209256_1007850 3300025299 Bacteria 5125
183 Ga0209256_1008082 3300025299 Bacteria 4969
184 Ga0209256_1008373 3300025299 Bacteria 4814
185 Ga0207426_1000131 3300025302 Bacteria 210250
186 Ga0207426_1000248 3300025302 Bacteria 119561
187 Ga0207426_1000450 3300025302 Bacteria 65777
188 Ga0207426_1007855 3300025302 Bacteria 4407
189 Ga0209051_1000547 3300025303 Bacteria 45743
190 Ga0209051_1005634 3300025303 Bacteria 7253
191 Ga0209051_1008704 3300025303 Bacteria 5341
192 Ga0209257_1001429 3300025304 Bacteria 28341
193 Ga0209257_1006010 3300025304 Bacteria 8115
194 Ga0207713_1027597 3300025735 Bacteria 2576
195 Ga0207680_10051161 3300025903 Bacteria 2469
196 Ga0207705_10005041 3300025909 Bacteria 9902
197 Ga0207671_10000234 3300025914 Bacteria 83448
198 Ga0207657_10123378 3300025919 Bacteria 2129
199 Ga0207681_10019601 3300025923 Bacteria 4276
200 Ga0207650_10000825 3300025925 Bacteria 23738
201 Ga0207659_10259749 3300025926 Bacteria 1412
202 Ga0207644_10003921 3300025931 Bacteria 9654
203 Ga0207690_10222973 3300025932 Bacteria 1443
204 Ga0207669_10020725 3300025937 Bacteria 3454
205 Ga0207691_10087127 3300025940 Bacteria 2801
206 Ga0207711_10033400 3300025941 Bacteria 4353
207 Ga0207667_10035747 3300025949 Bacteria 5328
208 Ga0207668_10011587 3300025972 Bacteria 5364
209 Ga0207668_10271248 3300025972 Bacteria 1387
210 Ga0207678_10108173 3300026067 Bacteria 2372
211 Ga0207702_10129644 3300026078 Bacteria 2268
212 Ga0209281_1000028 3300027111 Bacteria 440027
213 Ga0209281_1000030 3300027111 Bacteria 425931
214 Ga0209281_1000144 3300027111 Bacteria 172471
215 Ga0209371_1000037 3300027312 Bacteria 367074
216 Ga0209371_1000693 3300027312 Bacteria 28682
217 Ga0209371_1001893 3300027312 Bacteria 12828
218 Ga0209282_1000004 3300027666 Bacteria 425931
219 Ga0209282_1000875 3300027666 Bacteria 15605
220 Ga0209282_1035683 3300027666 Bacteria 3009
221 Ga0209813_10025228 3300027866 Bacteria 1707
222 Ga0268266_10004792 3300028379 Bacteria 12853
223 Ga0268266_10090003 3300028379 Bacteria 2689
224 Ga0268266_10563575 3300028379 Bacteria 1092
225 Ga0265318_10006490 3300028577 Bacteria 5381
226 Ga0307515_10001115 3300028794 Bacteria 61466
227 Ga0307515_10001473 3300028794 Bacteria 52908
228 Ga0307515_10008463 3300028794 Bacteria 20045
229 Ga0268256_1000039 3300030500 Bacteria 354969
230 Ga0268256_1005835 3300030500 Bacteria 4731
231 Ga0265332_10052147 3300031238 Bacteria 1757
232 Ga0265331_10053558 3300031250 Bacteria 1924
233 Ga0307513_10000998 3300031456 Bacteria 40880
234 Ga0307513_10012271 3300031456 Bacteria 10588
235 Ga0307513_10137693 3300031456 Bacteria 2374
236 Ga0307408_100038184 3300031548 Bacteria 3387
237 Ga0307408_100063046 3300031548 Bacteria 2711
238 Ga0265314_10049992 3300031711 Bacteria 2923
239 Ga0307405_10005526 3300031731 Bacteria 6106
240 Ga0307406_10023469 3300031901 Bacteria 3671
241 Ga0307412_10002378 3300031911 Bacteria 10442
242 Ga0315914_1000001 3300031967 Bacteria 416633
243 Ga0307409_100053192 3300031995 Bacteria 3110
244 Ga0307409_100057628 3300031995 Bacteria 3012
245 Ga0307409_100140176 3300031995 Bacteria 2082
246 Ga0307416_100180292 3300032002 Bacteria 1979
247 Ga0307416_100663037 3300032002 Bacteria 1129
248 Ga0307414_10255734 3300032004 Bacteria 1458
249 Ga0307414_10481378 3300032004 Bacteria 1095
250 Ga0307411_10511510 3300032005 Bacteria 1017
251 Ga0315913_1000022 3300033430 Bacteria 94546
252 Ga0315915_1000002 3300033464 Bacteria 425854
253 Ga0373960_0017266 3300035121 Bacteria 1868
254 Ga0373962_0069360 3300035242 Bacteria 1051
255 Ga0373927_0000068 3300035695 Bacteria 75823
256 Ga0373925_0002087 3300037068 Bacteria 16423
257 Ga0395901_0273407 3300038443 Bacteria 1757
258 Ga0400488_46517 3300038741 Bacteria 1538
259 Ga0436363_1337260 3300039450 Bacteria 1314
260 Ga0439436_0016987 3300041404 Bacteria 2179
261 Ga0439466_0057085 3300041411 Bacteria 1265
262 Ga0439465_0036266 3300041413 Bacteria 1583
263 Ga0439465_0047890 3300041413 Bacteria 1394
264 Ga0439465_0086759 3300041413 Bacteria 1067
265 Ga0451787_093977 3300041441 Bacteria 2999
266 Ga0451793_1420962 3300041452 Bacteria 1122
267 Ga0451841_0865164 3300041498 Bacteria 1366
268 Ga0451845_0030003 3300041501 Bacteria 3519
269 Ga0451853_3132945 3300041512 Bacteria 4857
270 Ga0439431_0021416 3300041997 Bacteria 1552
271 Ga0439449_0003731 3300042007 Bacteria 5904
272 Ga0439449_0058052 3300042007 Bacteria 1429
273 Ga0439449_0062252 3300042007 Bacteria 1377
274 Ga0439449_0098536 3300042007 Bacteria 1080
275 Ga0439462_0031665 3300042015 Bacteria 1401
276 Ga0450906_009517 3300042145 Bacteria 1851
277 Ga0439434_0039603 3300042435 Bacteria 1446
278 Ga0450918_001704 3300042531 Bacteria 4293
279 Ga0466965_0086956 3300044683 Bacteria 1586
280 Ga0495629_0036128 3300046459 Bacteria 3490
281 Ga0495638_0000110 3300046460 Bacteria 131410
282 Ga0495638_0031000 3300046460 Bacteria 3438
283 Ga0495662_0041796 3300046476 Bacteria 2213
284 Ga0495664_0139228 3300046477 Bacteria 1471
285 Ga0495607_0068029 3300046501 Bacteria 1999
286 Ga0495583_0084814 3300046506 Bacteria 1372
287 Ga0495606_0001343 3300046507 Bacteria 33471
288 Ga0495610_0058573 3300046512 Bacteria 1842
289 Ga0495654_0015451 3300046530 Bacteria 4052
290 Ga0495597_0132594 3300046542 Bacteria 1033
291 Ga0495622_0098234 3300046557 Bacteria 1343
292 Ga0495633_0085488 3300046558 Bacteria 1467
293 Ga0495625_0024334 3300046660 Bacteria 4611
294 Ga0495625_0125664 3300046660 Bacteria 1741
295 Ga0495635_0072409 3300046663 Bacteria 2361
296 Ga0495588_0018770 3300046674 Bacteria 3377
297 Ga0495649_0099359 3300046694 Bacteria 1548
298 Ga0495604_0039039 3300047317 Bacteria 3732
299 Ga0495672_0195347 3300047320 Bacteria 1015
300 Ga0495673_0144458 3300047469 Bacteria 925
301 Ga0495681_0004940 3300047470 Bacteria 8999
302 Ga0495686_0000972 3300047472 Bacteria 35241
303 Ga0495686_0005867 3300047472 Bacteria 9574
304 Ga0495686_0041805 3300047472 Bacteria 2917
305 Ga0496105_0312802 3300048908 Bacteria 1260
306 Ga0496106_0000565 3300048909 Bacteria 26364
307 Ga0496110_0236512 3300048913 Bacteria 1662
308 Ga0496114_0340490 3300048917 Bacteria 1326
309 Ga0496116_0000057 3300048919 Bacteria 281652
310 Ga0496116_0058064 3300048919 Bacteria 2525
311 Ga0496116_0083579 3300048919 Bacteria 1970
312 Ga0496116_0107679 3300048919 Bacteria 1647
313 Ga0496117_0000031 3300048920 Bacteria 381048
314 Ga0496117_0004115 3300048920 Bacteria 16297
315 Ga0496117_0005808 3300048920 Bacteria 12787
316 Ga0496117_0030723 3300048920 Bacteria 4116
317 Ga0496117_0066510 3300048920 Bacteria 2444
318 Ga0496117_0217035 3300048920 Bacteria 1067
319 Ga0496118_0000208 3300048921 Bacteria 102645
320 Ga0496118_0009144 3300048921 Bacteria 10074
321 Ga0496119_0032448 3300048922 Bacteria 3480
322 Ga0496119_0035931 3300048922 Bacteria 3239
323 Ga0496119_0189008 3300048922 Bacteria 1074
324 Ga0496120_0000387 3300048923 Bacteria 71224
325 Ga0496120_0005441 3300048923 Bacteria 10160
326 Ga0496120_0015772 3300048923 Bacteria 4967
327 Ga0496120_0017340 3300048923 Bacteria 4673
328 Ga0496121_0000034 3300048924 Bacteria 377095
329 Ga0496121_0000660 3300048924 Bacteria 64425
330 Ga0496121_0003338 3300048924 Bacteria 23036
331 Ga0496121_0011537 3300048924 Bacteria 9790
332 Ga0496121_0043028 3300048924 Bacteria 3917
333 Ga0496121_0047999 3300048924 Bacteria 3637
334 Ga0496121_0188061 3300048924 Bacteria 1483
335 Ga0496121_0203987 3300048924 Bacteria 1407
336 Ga0496122_0000023 3300048925 Bacteria 381035
337 Ga0496122_0000082 3300048925 Bacteria 209159
338 Ga0496122_0000308 3300048925 Bacteria 107960
339 Ga0496122_0006963 3300048925 Bacteria 12739
340 Ga0496122_0033860 3300048925 Bacteria 4193
341 Ga0496122_0041495 3300048925 Bacteria 3637
342 Ga0496122_0044947 3300048925 Bacteria 3439
343 Ga0496122_0116522 3300048925 Bacteria 1737
344 Ga0496122_0207816 3300048925 Bacteria 1137
345 Ga0496123_0000027 3300048926 Bacteria 306773
346 Ga0496123_0000066 3300048926 Bacteria 210327
347 Ga0496123_0000067 3300048926 Bacteria 209159
348 Ga0496123_0022385 3300048926 Bacteria 4871
349 Ga0496123_0062047 3300048926 Bacteria 2397
350 Ga0496123_0145943 3300048926 Bacteria 1285
351 Ga0496124_0000294 3300048927 Bacteria 93153
352 Ga0496124_0000917 3300048927 Bacteria 47584
353 Ga0496124_0007827 3300048927 Bacteria 11274
354 Ga0496124_0023755 3300048927 Bacteria 5588
355 Ga0496124_0038206 3300048927 Bacteria 4169
356 Ga0496124_0045573 3300048927 Bacteria 3759
357 Ga0496124_0058674 3300048927 Bacteria 3236
358 Ga0496124_0085128 3300048927 Bacteria 2591
359 Ga0496124_0169352 3300048927 Bacteria 1694
360 Ga0496124_0194579 3300048927 Bacteria 1548
361 Ga0496124_0291788 3300048927 Bacteria 1183
362 Ga0496125_0000030 3300048928 Bacteria 375023
363 Ga0496125_0001030 3300048928 Bacteria 43251
364 Ga0496125_0003238 3300048928 Bacteria 20072
365 Ga0496125_0294006 3300048928 Bacteria 999
366 Ga0496126_0000115 3300048929 Bacteria 188546
367 Ga0496126_0000258 3300048929 Bacteria 113843
368 Ga0496126_0075628 3300048929 Bacteria 2988
369 Ga0496126_0244301 3300048929 Bacteria 1498
370 Ga0496126_0362061 3300048929 Bacteria 1184
371 Ga0496126_0381565 3300048929 Bacteria 1147
372 Ga0501031_0000002 3300049568 Bacteria 217588
373 Ga0501031_0000623 3300049568 Bacteria 20933
374 Ga0501031_0175452 3300049568 Bacteria 1400
375 Ga0501031_0237412 3300049568 Bacteria 1185
376 Ga0501032_0000001 3300049569 Bacteria 422097
377 Ga0501032_0000004 3300049569 Bacteria 310855
378 Ga0501032_0092568 3300049569 Bacteria 2005
379 Ga0501033_0000016 3300049570 Bacteria 217458
380 Ga0501033_0000275 3300049570 Bacteria 49587
381 Ga0501033_0000281 3300049570 Bacteria 49116
382 Ga0501033_0149825 3300049570 Bacteria 1683
383 Ga0501034_0000011 3300049571 Bacteria 310855
384 Ga0501034_0000036 3300049571 Bacteria 239274
385 Ga0501034_0000483 3300049571 Bacteria 65030
386 Ga0501034_0005551 3300049571 Bacteria 13755
387 Ga0501034_0013334 3300049571 Bacteria 8465
388 Ga0501034_0040645 3300049571 Bacteria 4707
389 Ga0501034_0063531 3300049571 Bacteria 3705
390 Ga0501034_0310346 3300049571 Bacteria 1512
391 Ga0501034_0310469 3300049571 Bacteria 1512
392 Ga0501036_0000001 3300049572 Bacteria 310855
393 Ga0501036_0032330 3300049572 Bacteria 4420
394 Ga0501036_0465188 3300049572 Bacteria 1053
395 Ga0501037_0000006 3300049573 Bacteria 217461
396 Ga0501037_0000091 3300049573 Bacteria 84811
397 Ga0501037_0109142 3300049573 Bacteria 1994
398 Ga0501037_0114256 3300049573 Bacteria 1943
399 Ga0501038_0000003 3300049574 Bacteria 310855
400 Ga0501038_0000346 3300049574 Bacteria 39784
401 Ga0501038_0066583 3300049574 Bacteria 3067
402 Ga0501038_0091125 3300049574 Bacteria 2554
403 Ga0501039_0000004 3300049575 Bacteria 310855
404 Ga0501039_0000011 3300049575 Bacteria 245124
405 Ga0501039_0158746 3300049575 Bacteria 1777
406 Ga0501040_0000896 3300049576 Bacteria 18701
407 Ga0501043_0000016 3300049579 Bacteria 170869
408 Ga0501043_0000155 3300049579 Bacteria 62570
409 Ga0501043_0010599 3300049579 Bacteria 7216
410 Ga0501046_0047744 3300049580 Bacteria 3394
411 Ga0501047_0001401 3300049581 Bacteria 23638
412 Ga0501047_0181271 3300049581 Bacteria 1972
413 Ga0501069_0173594 3300049585 Bacteria 1244
414 Ga0501070_0001201 3300049586 Bacteria 23189
415 Ga0501070_0035607 3300049586 Bacteria 4159
416 Ga0501070_0037952 3300049586 Bacteria 4020
417 Ga0501073_0235000 3300049589 Bacteria 1266
418 Ga0501074_0197778 3300049590 Bacteria 1433
419 Ga0501080_0035634 3300049742 Bacteria 4644
420 Ga0501080_0288434 3300049742 Bacteria 1491
421 Ga0501035_0000009 3300049822 Bacteria 310827
422 Ga0501035_0000364 3300049822 Bacteria 52172
423 Ga0501035_0010467 3300049822 Bacteria 8594
424 Ga0501035_0018281 3300049822 Bacteria 6457
425 Ga0501035_0026446 3300049822 Bacteria 5308
426 Ga0501044_0000005 3300049823 Bacteria 310855
427 Ga0501044_0000923 3300049823 Bacteria 35383
428 Ga0501044_0010209 3300049823 Bacteria 10203
429 Ga0501044_0060375 3300049823 Bacteria 3882
430 Ga0501044_0102798 3300049823 Bacteria 2872
431 Ga0501044_0315066 3300049823 Bacteria 1490
432 nmdc:mga00v17_15_c1 3300050491 Bacteria 126234
433 nmdc:mga00v17_853_c1 3300050491 Bacteria 16525
434 nmdc:mga0yw44_155107_c1 3300050492 Bacteria 1496
435 nmdc:mga0yw44_437151_c1 3300050492 Bacteria 886
436 nmdc:mga0yw44_9569_c1 3300050492 Bacteria 4911
437 nmdc:mga0yw44_96564_c1 3300050492 Bacteria 1876
438 nmdc:mga06z11_126300_c1 3300050494 Bacteria 1432
439 nmdc:mga04h51_19734_c1 3300050495 Bacteria 2003
440 nmdc:mga07m45_93414_c1 3300050496 Bacteria 1725
441 nmdc:mga0sz30_262_c1 3300050516 Bacteria 20170
442 nmdc:mga0sz30_49473_c1 3300050516 Bacteria 1781
443 nmdc:mga0sz30_57527_c1 3300050516 Bacteria 1657
444 Ga0500644_0058201 3300053088 Bacteria 1351
445 Ga0500646_0095376 3300053090 Bacteria 927
446 Ga0500556_0059750 3300053104 Bacteria 1401
447 Ga0500572_006445 3300053111 Bacteria 2687
448 Ga0500608_064866 3300053122 Bacteria 1742
449 Ga0500618_000541 3300053125 Bacteria 23494
450 Ga0500618_026072 3300053125 Bacteria 1397
451 Ga0500655_026378 3300053133 Bacteria 1106
452 Ga0500658_0000212 3300053134 Bacteria 27662
453 Ga0500559_0016484 3300053136 Bacteria 3120
454 Ga0500561_0000061 3300053137 Bacteria 21576
455 Ga0500568_0001241 3300053139 Bacteria 16914
456 Ga0500568_0001349 3300053139 Bacteria 15981
457 Ga0500573_0020160 3300053140 Bacteria 3818
458 Ga0500590_008347 3300053148 Bacteria 5164
459 Ga0500616_0002356 3300053153 Bacteria 15881
460 Ga0500616_0007287 3300053153 Bacteria 7055
461 Ga0500616_0018083 3300053153 Bacteria 3988
462 Ga0500616_0077964 3300053153 Bacteria 1672
463 Ga0500622_0000169 3300053156 Bacteria 70224
464 Ga0500622_0000441 3300053156 Bacteria 39445
465 Ga0500624_001783 3300053157 Bacteria 3144
466 Ga0500627_0004068 3300053158 Bacteria 4633
467 Ga0500627_0055586 3300053158 Bacteria 1733
468 Ga0500634_0112321 3300053161 Bacteria 1342
469 Ga0500636_0000030 3300053177 Bacteria 77501
470 Ga0587083_0003098 3300059505 Bacteria 2164
471 Ga0587090_000340 3300059510 Bacteria 3709
472 Ga0587106_001937 3300059605 Bacteria 1946
473 Ga0587068_001459 3300059641 Bacteria 2663
474 Ga0587069_000734 3300059642 Bacteria 2670
475 Ga0587072_000658 3300059643 Bacteria 3714
476 Ga0530510_0298805 3300061734 Bacteria 1205
477 2509108826 2508501122 Bacteria 6292184
478 2509377957 2509276019 Bacteria 6802256
479 2509389207 2509276021 Bacteria 7634384
480 2509444766 2509276033 Bacteria 7180565
481 2510305856 2510065057 Bacteria 6649661
482 2510839214 2510461069 Bacteria 5505000
483 2510896908 2510461076 Bacteria 8618824
484 2511135816 2510917022 Bacteria 6504556
485 2511173774 2510917026 Bacteria 7046020
486 2511185197 2510917028 Bacteria 6185411
487 2511194228 2510917030 Bacteria 7460662
488 2511391924 2511231027 Bacteria 5013807
489 2511498622 2511231052 Bacteria 6974333
490 2512973415 2512875026 Bacteria 6861065
491 2513580385 2513237085 Bacteria 7695351
492 2513588140 2513237086 Bacteria 7265287
493 2513597821 2513237088 Bacteria 6927906
494 2513602067 2513237089 Bacteria 6553624
495 2513620996 2513237091 Bacteria 6900273
496 2513711552 2513237103 Bacteria 7647401
497 2513865099 2513237138 Bacteria 7368160
498 2513885421 2513237140 Bacteria 7076289
499 2513904690 2513237143 Bacteria 6664116
500 2513912929 2513237144 Bacteria 7530820
501 2513929522 2513237146 Bacteria 7166346
502 2513983521 2513237156 Bacteria 6402557
503 2514001681 2513237159 Bacteria 6810126
504 2514003334 2513237160 Bacteria 6650282
505 2514023154 2513237162 Bacteria 7468464
506 2515114621 2515075009 Bacteria 7288508
507 2515612398 2515154107 Bacteria 6795637
508 2515634959 2515154113 Bacteria 7807172
509 2515644477 2515154114 Bacteria 7848616
510 2515660946 2515154116 Bacteria 7552979
511 2515741804 2515154134 Bacteria 7220242
512 2516205734 2516143018 Bacteria 6951533
513 2516894899 2516653046 Bacteria 6989037
514 2517038264 2516653077 Bacteria 7555578
515 2517078542 2516653085 Bacteria 7346596
516 2517571582 2517487022 Bacteria 7227575
517 2520376513 2519899620 Bacteria 6499161
518 2524450283 2524023207 Bacteria 6813453
519 2524461216 2524023209 Bacteria 6679728
520 2530647154 2529292951 Bacteria 6916614
521 2537874485 2537561587 Bacteria 5425293
522 2551678435 2551306084 Bacteria 8942552
523 2551685208 2551306085 Bacteria 7347181
524 2551690793 2551306086 Bacteria 6843938
525 2551704597 2551306087 Bacteria 7351905
526 2551710835 2551306089 Bacteria 7162724
527 2551717169 2551306090 Bacteria 7953713
528 2551730427 2551306091 Bacteria 7086830
529 2551733377 2551306092 Bacteria 6992595
530 2551740065 2551306093 Bacteria 7064773
531 2554249015 2554235003 Bacteria 5877155
532 2558867545 2558860100 Bacteria 8458965
533 2559296103 2558860242 Bacteria 5568029
534 2561468576 2558860983 Bacteria 4133860
535 2585166465 2582581283 Bacteria 6030556
536 2585201522 2582581294 Bacteria 6626667
537 2585224136 2582581298 Bacteria 7315509
538 2585231843 2582581299 Bacteria 6518058
539 2585257145 2582581304 Bacteria 5831370
540 2585267212 2582581306 Bacteria 6450535
541 2585272094 2582581307 Bacteria 6597605
542 2585327436 2582581315 Bacteria 7318924
543 2585334025 2582581316 Bacteria 7774528
544 2585388263 2582581865 Bacteria 6644329
545 2585396137 2582581866 Bacteria 6859583
546 2585399969 2582581867 Bacteria 7184437
547 2585529159 2585427526 Bacteria 7258840
548 2585535677 2585427527 Bacteria 7273426
549 2585549836 2585427529 Bacteria 7395659
550 2585551055 2585427530 Bacteria 7383882
551 2585563361 2585427531 Bacteria 6992870
552 2585821058 2585427590 Bacteria 6824633
553 2585845089 2585427594 Bacteria 6180594
554 2585897217 2585427608 Bacteria 6544331
555 2585909132 2585427609 Bacteria 6667127
556 2585998104 2585427633 Bacteria 6413184
557 2586002683 2585427634 Bacteria 6455027
558 2587984546 2585428125 Bacteria 6662905
559 2599335723 2599185156 Bacteria 5403036
560 2599419936 2599185170 Bacteria 7295545
561 2599603104 2599185210 Bacteria 5624189
562 2599722664 2599185236 Bacteria 6875203
563 2600194011 2599185352 Bacteria 7228948
564 2600377469 2600254933 Bacteria 4750527
565 2601610991 2600255279 Bacteria 5605316
566 2601747765 2600255308 Bacteria 5611129
567 2616297520 2615840624 Bacteria 6557588
568 2616306385 2615840626 Bacteria 7921970
569 2616551127 2615840698 Bacteria 7319877
570 2617382358 2617270742 Bacteria 6808054
571 2643773406 2643221550 Bacteria 4619371
572 2643777605 2643221551 Bacteria 3750538
573 2643796053 2643221555 Bacteria 3749717
574 2643806898 2643221557 Bacteria 7184309
575 2643854797 2643221568 Bacteria 5187270
576 2643921627 2643221582 Bacteria 5804683
577 2644002672 2643221599 Bacteria 6292121
578 2644052479 2643221607 Bacteria 6314006
579 2644068906 2643221610 Bacteria 7480339
580 2644105725 2643221618 Bacteria 7717186
581 2644146391 2643221626 Bacteria 8069654
582 2644194622 2643221634 Bacteria 6705461
583 2644201138 2643221636 Bacteria 6583769
584 2644209701 2643221637 Bacteria 5345260
585 2644240287 2643221643 Bacteria 5749658
586 2644299663 2643221653 Bacteria 4569637
587 2644310338 2643221655 Bacteria 7722067
588 2644334877 2643221659 Bacteria 7890716
589 2644378282 2643221668 Bacteria 7306521
590 2644419977 2643221675 Bacteria 7473456
591 2644453333 2643221680 Bacteria 7473610
592 2644484757 2643221686 Bacteria 6310811
593 2644492520 2643221688 Bacteria 5260751
594 2644501278 2643221689 Bacteria 6042950
595 2644521681 2643221693 Bacteria 5513853
596 2644544929 2643221698 Bacteria 7756764
597 2644615421 2643221712 Bacteria 7729434
598 2644653229 2643221718 Bacteria 5345506
599 2644657891 2643221719 Bacteria 4568197
600 2644675133 2643221723 Bacteria 7095460
601 2644688640 2643221726 Bacteria 7455827
602 2657682274 2657244999 Bacteria 5946535
603 2671115994 2667528174 Bacteria 6435400
604 2692319801 2690316117 Bacteria 6800650
605 2719183160 2718217882 Bacteria 6556348
606 2719387879 2718217927 Bacteria 6972593
607 2719667500 2718217997 Bacteria 6740740
608 2719733877 2718218009 Bacteria 6478651
609 2720493920 2718218199 Bacteria 6740745
610 2720615383 2718218232 Bacteria 6720332
611 2720622169 2718218233 Bacteria 6662049
612 2720633523 2718218235 Bacteria 6630699
613 2720777221 2718218269 Bacteria 6906114
614 2721149272 2718218363 Bacteria 6524337
615 2721160674 2718218365 Bacteria 6274507
616 2721166085 2718218366 Bacteria 6425255
617 2721401512 2718218423 Bacteria 6438183
618 2722842255 2721755514 Bacteria 6424414
619 2723028821 2721755556 Bacteria 6745503
620 2723562434 2721755684 Bacteria 6859907
621 2723569128 2721755685 Bacteria 6704835
622 2724040326 2721755809 Bacteria 6438790
623 2724046633 2721755810 Bacteria 6479005
624 2724091828 2721755819 Bacteria 6906405
625 2724106393 2721755822 Bacteria 6726041
626 2724112200 2721755823 Bacteria 6752556
627 2730109757 2728369352 Bacteria 6745171
628 2730166395 2728369365 Bacteria 6555560
629 2730300306 2728369397 Bacteria 6274511
630 2738800995 2738541293 Bacteria 7065685
631 2738947124 2738541317 Bacteria 5340176
632 2753458441 2751185821 Bacteria 6189929
633 2778179251 2775507266 Bacteria 7392367
634 2792582375 2791355082 Bacteria 5973319
635 2792621771 2791355091 Bacteria 6135441
636 2792628972 2791355092 Bacteria 6248105
637 2792640114 2791355094 Bacteria 7011481
638 2793281858 2791355253 Bacteria 5171699
639 2793295433 2791355256 Bacteria 6798008
640 2793317932 2791355259 Bacteria 7254731
641 2793324593 2791355260 Bacteria 6598818
642 2793329636 2791355261 Bacteria 6661293
643 2793332432 2791355262 Bacteria 6774204
644 2793339026 2791355263 Bacteria 6872478
645 2793346796 2791355264 Bacteria 6429314
646 2793356811 2791355265 Bacteria 6539969
647 2793359176 2791355266 Bacteria 7116587
648 2793366099 2791355267 Bacteria 7222458
649 2802717053 2802428858 Bacteria 6636079
650 2802724959 2802428859 Bacteria 6667919
651 2802729709 2802428860 Bacteria 6525526
652 2802737055 2802428861 Bacteria 6534206
653 2802743460 2802428862 Bacteria 6633353
654 2802749414 2802428863 Bacteria 6410669
655 2804753832 2802429268 Bacteria 6094027
656 2805930938 2802429605 Bacteria 6875453
657 2805936787 2802429606 Bacteria 6346811
658 2808988071 2808606387 Bacteria 5697198
659 2819244109 2818991272 Bacteria 4622173
660 2819561113 2818991439 Bacteria 6907412
661 2819612004 2818991448 Bacteria 6772224
662 2819638453 2818991453 Bacteria 7181617
663 2819688389 2818991461 Bacteria 7026071
664 2821129181 2821123053 Bacteria 7836056
665 2837683444 2837678835 Bacteria 5252418
666 2838018126 2838016132 Bacteria 6577831
667 2838023806 2838022645 Bacteria 6494267
668 2838034154 2838029111 Bacteria 6603031
669 2838041986 2838035591 Bacteria 7166484
670 2838046786 2838042994 Bacteria 6046894
671 2838051015 2838048938 Bacteria 6044578
672 2838062781 2838061910 Bacteria 6794874
673 2838072326 2838068647 Bacteria 6208656
674 2838078023 2838074704 Bacteria 6785777
675 2838668163 2838661181 Bacteria 7385261
676 2838674260 2838668709 Bacteria 6671819
677 2838678516 2838675328 Bacteria 4909118
678 2838683678 2838680041 Bacteria 6545511
679 2838693375 2838686498 Bacteria 7807632
680 2838698206 2838694306 Bacteria 6853137
681 2838706663 2838701080 Bacteria 6669771
682 2838711321 2838707686 Bacteria 6619912
683 2838718396 2838714209 Bacteria 5525906
684 2838722812 2838719591 Bacteria 5523910
685 2838728462 2838724970 Bacteria 4908691
686 2838735369 2838729681 Bacteria 7400765
687 2838742198 2838736955 Bacteria 5760694
688 2838748082 2838742623 Bacteria 7396178
689 2841846054 2841840854 Bacteria 5761912
690 2841850368 2841846520 Bacteria 5345850
691 2841857441 2841851746 Bacteria 7532261
692 2841863379 2841859092 Bacteria 5436171
693 2841867556 2841864319 Bacteria 6742987
694 2842081122 2842077413 Bacteria 6508645
695 2842116626 2842110456 Bacteria 7656360
696 2842122101 2842118031 Bacteria 7033875
697 2842129122 2842124991 Bacteria 5346824
698 2842133409 2842130223 Bacteria 4909145
699 2842145758 2842140634 Bacteria 5759631
700 2842148992 2842146304 Bacteria 5957337
701 2842155680 2842152218 Bacteria 4908957
702 2842162384 2842156927 Bacteria 6894975
703 2842166915 2842163707 Bacteria 6916235
704 2842174362 2842170452 Bacteria 5525737
705 2842179023 2842175837 Bacteria 4908771
706 2842186024 2842180545 Bacteria 6888678
707 2842190820 2842187318 Bacteria 5524014
708 2842194687 2842192696 Bacteria 6147454
709 2842201161 2842198810 Bacteria 6608673
710 2842207613 2842205361 Bacteria 6340321
711 2842214856 2842211629 Bacteria 5523832
712 2842221987 2842217011 Bacteria 7497767
713 2842227577 2842224351 Bacteria 5524473
714 2842235483 2842229732 Bacteria 7475766
715 2842241115 2842237096 Bacteria 6620661
716 2842249234 2842243621 Bacteria 7421798
717 2842256454 2842250916 Bacteria 6579627
718 2842263189 2842257432 Bacteria 7401195
719 2842269246 2842264693 Bacteria 6472963
720 2842277843 2842271015 Bacteria 7807131
721 2842280676 2842278818 Bacteria 6340002
722 2842290378 2842285085 Bacteria 6011953
723 2842294779 2842291075 Bacteria 7076806
724 2842302660 2842298080 Bacteria 6123127
725 2842305614 2842304105 Bacteria 7023636
726 2842311618 2842311132 Bacteria 6616990
727 2842323680 2842317721 Bacteria 6793725
728 2842346899 2842341865 Bacteria 7003929
729 2842358838 2842357229 Bacteria 6485165
730 2842366070 2842363717 Bacteria 6844742
731 2842375203 2842370503 Bacteria 7038661
732 2842381177 2842377471 Bacteria 7140707
733 2842388248 2842384541 Bacteria 7057858
734 2842395738 2842395702 Bacteria 6780583
735 2842408212 2842402390 Bacteria 6681310
736 2842414974 2842409023 Bacteria 6687331
737 2842421517 2842415677 Bacteria 6596907
738 2842425958 2842422224 Bacteria 6239196
739 2842433470 2842428310 Bacteria 6767288
740 2842439475 2842434925 Bacteria 6502746
741 2842446217 2842441272 Bacteria 6769273
742 2842448544 2842447887 Bacteria 6754142
743 2842467719 2842462802 Bacteria 6588055
744 2842474317 2842469257 Bacteria 6752936
745 2842480878 2842475841 Bacteria 6603183
746 2842485313 2842482326 Bacteria 7212537
747 2842491371 2842489311 Bacteria 6620893
748 2842501894 2842495871 Bacteria 6820686
749 2842507511 2842502639 Bacteria 6604161
750 2842519884 2842515876 Bacteria 5436280
751 2842527096 2842521101 Bacteria 6569494
752 2842874076 2842871566 Bacteria 4827117
753 2842926489 2842922631 Bacteria 5824079
754 2844167956 2844163670 Bacteria 7266046
755 2844456776 2844454524 Bacteria 7952546
756 2847420975 2847417321 Bacteria 6913799
757 2848995808 2848992105 Bacteria 6810864
758 2850082787 2850079185 Bacteria 6848280
759 2852387574 2852387548 Bacteria 8025568
760 2854897764 2854896431 Bacteria 5869725
761 2854922341 2854916844 Bacteria 5725939
762 2855827533 2855825444 Bacteria 6785811
763 2855842908 2855839649 Bacteria 7135830
764 2855873669 2855872281 Bacteria 6964271
765 2857536122 2857531043 Bacteria 6754041
766 2858803586 2858800743 Bacteria 6603254
767 2876376999 2876369609 Bacteria 6807521
768 2881858830 2881853255 Bacteria 6698367
769 2889916070 2889914905 Bacteria 5702301
770 2891048552 2891048133 Bacteria 4447501
771 2891377755 2891373044 Bacteria 5202277
772 2896390048 2896384573 Bacteria 7700774
773 2899794793 2899792073 Bacteria 4926588
774 2899805032 2899803654 Bacteria 5577784
775 2899849454 2899845264 Bacteria 5672268
776 2906429263 2906427513 Bacteria 6375796
777 2913300321 2913295892 Bacteria 6333755
778 2913312047 2913308742 Bacteria 5350706
779 2915981678 2915980308 Bacteria 6624279
780 2915993543 2915986958 Bacteria 6739310
781 2915998969 2915993759 Bacteria 7016183
782 2916004441 2916000859 Bacteria 6865702
783 2916008471 2916007675 Bacteria 6898660
784 2916019899 2916014648 Bacteria 6946486
785 2916023965 2916021584 Bacteria 6854472
786 2916031890 2916028427 Bacteria 6748433
787 2916040531 2916035215 Bacteria 6755766
788 2916043464 2916041962 Bacteria 6820487
789 2916050611 2916048683 Bacteria 6543552
790 2916058725 2916055098 Bacteria 6758838
791 2916066449 2916061851 Bacteria 6737736
792 2916074965 2916068649 Bacteria 6943657
793 2916078383 2916076590 Bacteria 6596108
794 2919107972 2919100787 Bacteria 7710546
795 2919118347 2919114240 Bacteria 5700270
796 2919170433 2919166419 Bacteria 4952238
797 2919176857 2919171160 Bacteria 6499771
798 2919411488 2919408235 Bacteria 6149349
799 2920760178 2920760137 Bacteria 7427611
800 2920826094 2920822456 Bacteria 6897201
801 2921205034 2921201388 Bacteria 6926299
802 2921211996 2921208531 Bacteria 6745326
803 2921240322 2921237296 Bacteria 6876710
804 2921244453 2921244191 Bacteria 6568419
805 2921252767 2921250672 Bacteria 6677771
806 2921260407 2921257292 Bacteria 6808382
807 2921267491 2921263974 Bacteria 6864552
808 2921283446 2921282425 Bacteria 6826397
809 2921294014 2921289301 Bacteria 7316391
810 2921302890 2921296804 Bacteria 7176999
811 2923559940 2923556063 Bacteria 6793593
812 2924144843 2924144063 Bacteria 6883928
813 2924157279 2924150972 Bacteria 7169444
814 2924158748 2924158325 Bacteria 7188855
815 2924166801 2924165586 Bacteria 7260590
816 2924175832 2924172951 Bacteria 6749356
817 2924183433 2924179722 Bacteria 6843264
818 2924186941 2924186466 Bacteria 6876637
819 2924193451 2924193448 Bacteria 6955718
820 2924201480 2924200457 Bacteria 6757188
821 2924213742 2924207177 Bacteria 6917007
822 2924214497 2924214083 Bacteria 7080103
823 2924227167 2924221636 Bacteria 7113495
824 2924234002 2924228884 Bacteria 6633132
825 2926754876 2926754445 Bacteria 5964435
826 2926762041 2926760298 Bacteria 5505990
827 2928522662 2928521798 Bacteria 4960112
828 2929142026 2929138655 Bacteria 5810547
829 2933010474 2933006813 Bacteria 4912075
830 2933015854 2933011516 Bacteria 5439334
831 2933016930 2933016740 Bacteria 6355406
832 2933572121 2933570622 Bacteria 7023390
833 2933592768 2933586486 Bacteria 7667493
834 2933597408 2933594066 Bacteria 5594265
835 2933602822 2933599457 Bacteria 5858799
836 2935898140 2935894831 Bacteria 6620579
837 2935903418 2935901341 Bacteria 7341747
838 2936381738 2936381700 Bacteria 7006523
839 2936997470 2936996657 Bacteria 6298727
840 2937004066 2937002841 Bacteria 6934057
841 2937016133 2937009748 Bacteria 6746052
842 2937020611 2937016420 Bacteria 6782579
843 2937023142 2937023124 Bacteria 6815156
844 2937031690 2937029754 Bacteria 6424026
845 2937042513 2937036028 Bacteria 6846469
846 2937044060 2937042894 Bacteria 6741576
847 2937053573 2937049772 Bacteria 6757901
848 2937059339 2937056579 Bacteria 7107896
849 2937070533 2937063883 Bacteria 7199456
850 2937071742 2937071275 Bacteria 6984483
851 2937081525 2937078374 Bacteria 6610289
852 2937090843 2937084907 Bacteria 6618516
853 2937096804 2937091812 Bacteria 6979387
854 2937102919 2937098957 Bacteria 7249374
855 2937109756 2937106411 Bacteria 6947143
856 2937114278 2937113482 Bacteria 6505872
857 2937125718 2937119839 Bacteria 6597547
858 2937129743 2937126314 Bacteria 6771275
859 2937843564 2937843397 Bacteria 5256375
860 2941501518 2941499720 Bacteria 7599444
861 2954013957 2954011201 Bacteria 4762601
862 2957376757 2957375807 Bacteria 6425588
863 2957384887 2957382221 Bacteria 6737050
864 2957395162 2957388812 Bacteria 6778072
865 2957396178 2957395598 Bacteria 6822399
866 2957405513 2957402308 Bacteria 6741770
867 2957411678 2957408893 Bacteria 6558585
868 2957417435 2957415311 Bacteria 6991633
869 2957422863 2957422303 Bacteria 7172205
870 2957430114 2957430029 Bacteria 7022557
871 2957441705 2957437181 Bacteria 6568994
872 2957448354 2957443900 Bacteria 6869977
873 2957454643 2957450854 Bacteria 6765715
874 2957461034 2957457609 Bacteria 6967680
875 2957471010 2957464669 Bacteria 6568877
876 2957475359 2957471148 Bacteria 6797643
877 2957481417 2957478035 Bacteria 6756658
878 2957489049 2957484790 Bacteria 6703082
879 2957491896 2957491536 Bacteria 6695180
880 2957505138 2957498199 Bacteria 7126688
881 2957508303 2957505466 Bacteria 7253085
882 2960585969 2960584000 Bacteria 6864594
883 2960592835 2960591022 Bacteria 6622873
884 2960597863 2960597568 Bacteria 6550735
885 2960607455 2960603979 Bacteria 6898737
886 2960611571 2960610863 Bacteria 6691244
887 2960619057 2960617483 Bacteria 6727748
888 2960629096 2960624210 Bacteria 6875384
889 2960635556 2960631154 Bacteria 6732508
890 2960643549 2960637947 Bacteria 7296468
891 2960646512 2960645483 Bacteria 7211087
892 2960659759 2960652885 Bacteria 7083688
893 2960664847 2960660292 Bacteria 7041660
894 2960673323 2960667422 Bacteria 6763020
895 2960675102 2960674078 Bacteria 6609048
896 2960681760 2960680706 Bacteria 6624464
897 2960689301 2960687367 Bacteria 6535474
898 2960700686 2960693952 Bacteria 6749742
899 2964608191 2964607997 Bacteria 7101408
900 2964620325 2964615318 Bacteria 6809089
901 2964623008 2964621998 Bacteria 6834995
902 2964629717 2964628898 Bacteria 7083044
903 2964639257 2964636051 Bacteria 7091832
904 2964643574 2964643177 Bacteria 6820887
905 2964655178 2964649959 Bacteria 6675118
906 2964660013 2964656573 Bacteria 7100150
907 2964669434 2964663802 Bacteria 7019362
908 2964675053 2964670856 Bacteria 6851364
909 2964681645 2964678106 Bacteria 6792020
910 2964685883 2964685014 Bacteria 6839111
911 2964695176 2964691889 Bacteria 6802758
912 2964699194 2964698721 Bacteria 6765331
913 2964705821 2964705432 Bacteria 7114648
914 2964713498 2964712639 Bacteria 6695970
915 2964720584 2964719344 Bacteria 7286602
916 2967668292 2967664464 Bacteria 6948836
917 2967672524 2967671571 Bacteria 7021409
918 2967681282 2967678726 Bacteria 7264382
919 2967692392 2967686174 Bacteria 6678622
920 2967696499 2967693043 Bacteria 6804451
921 2967700398 2967699805 Bacteria 6854538
922 2967712991 2967706974 Bacteria 7186053
923 2967721230 2967714385 Bacteria 7000047
924 2967727549 2967721400 Bacteria 7073753
925 2967732196 2967728569 Bacteria 6641507
926 2967738497 2967735183 Bacteria 6827012
927 2967742983 2967742019 Bacteria 6794534
928 2967752582 2967748971 Bacteria 6733771
929 2967757781 2967755722 Bacteria 6814706
930 2967765762 2967762386 Bacteria 6923502
931 2967770312 2967769361 Bacteria 6587838
932 2967777064 2967775926 Bacteria 6738189
933 2970022023 2970019648 Bacteria 7072033
934 2970028643 2970026789 Bacteria 6785236
935 2970034956 2970033650 Bacteria 7118744
936 2970046633 2970040964 Bacteria 6731123
937 2970049590 2970047711 Bacteria 7088379
938 2970058802 2970054988 Bacteria 6611507
939 2970062638 2970061556 Bacteria 7099761
940 2970071208 2970068827 Bacteria 7123112
941 2970082602 2970076120 Bacteria 6697332
942 2970086783 2970082768 Bacteria 6183754
943 2970095730 2970088815 Bacteria 6933825
944 2970096567 2970095765 Bacteria 6936963
945 2970104577 2970102677 Bacteria 6812532
946 2970113961 2970109326 Bacteria 6863976
947 2970118408 2970116247 Bacteria 6501857
948 2970124471 2970122695 Bacteria 6625855
949 2970133488 2970129317 Bacteria 6806560
950 2970137809 2970136068 Bacteria 7207982
951 2970147370 2970143518 Bacteria 6446480
952 2970156748 2970149975 Bacteria 6779706
953 2970158108 2970156795 Bacteria 7168044
954 2970170721 2970164137 Bacteria 6861252
955 2970174054 2970170962 Bacteria 6876229
956 2970178857 2970177841 Bacteria 6768001
957 2970185863 2970184632 Bacteria 7054431
958 2970197879 2970191845 Bacteria 7032787
959 2970627597 2970627176 Bacteria 6680862
960 2977517477 2977516862 Bacteria 6940108
961 2977527431 2977523885 Bacteria 6960446
962 2977531235 2977530762 Bacteria 6951399
963 2977544436 2977537788 Bacteria 6929320
964 2977547457 2977544691 Bacteria 6875412
965 2977557978 2977551784 Bacteria 7125765
966 2977564689 2977558990 Bacteria 6863948
967 2977571346 2977565890 Bacteria 6901543
968 2977577280 2977572785 Bacteria 6763888
969 2977583033 2977579622 Bacteria 6772100
970 2978972771 2978969890 Bacteria 5400756
971 2979092690 2979089926 Bacteria 5670289
972 2979099919 2979095461 Bacteria 5669583
973 2979104662 2979100975 Bacteria 5423623
974 2984513541 2984509177 Bacteria 5274802
975 2984522879 2984518228 Bacteria 5277463
976 2984542187 2984537506 Bacteria 5277481
977 2984591023 2984587000 Bacteria 5263363
978 2984601615 2984601300 Bacteria 5455244
979 2989355110 2989349275 Bacteria 6349068
980 2989771798 2989771324 Bacteria 5605128
981 2989780276 2989776772 Bacteria 4843317
982 2995394271 2995392953 Bacteria 4539380
983 2996311581 2996310559 Bacteria 6357320
984 2996890487 2996887358 Bacteria 5795980
985 2996896180 2996893221 Bacteria 5823108
986 3005415988 3005409236 Bacteria 7188837
987 3005416854 3005416602 Bacteria 7064308
988 3005449873 3005445848 Bacteria 6906074
989 3005456164 3005452660 Bacteria 5889319
990 639645880 639633055 Bacteria 7751309
991 643827563 643692032 Bacteria 6891900
992 648737342 648276728 Bacteria 6968865
993 650738520 650716007 Bacteria 5573770
994 8003573619 8003570095 Bacteria 5747666
995 8003995489 8003992118 Bacteria 7266902
996 8004003249 8003999396 Bacteria 7063185
997 8005249437 8005246636 Bacteria 4933972
998 8005262674 8005258706 Bacteria 6184835
999 8005278079 8005275841 Bacteria 6929066
1000 8005286547 8005282627 Bacteria 6675747
1001 8005292015 8005289223 Bacteria 6634003
1002 8005306153 8005301065 Bacteria 6614431
1003 8005309728 8005307578 Bacteria 7395396
1004 8005315942 8005314921 Bacteria 7072929
1005 8005325014 8005321885 Bacteria 5795980
1006 8005387573 8005382845 Bacteria 6732062
1007 8005398408 8005395548 Bacteria 6806915
1008 8005431991 8005430974 Bacteria 6689030
1009 8005465317 8005460587 Bacteria 7157962
1010 8005487032 8005484373 Bacteria 6297373
1011 8005497894 8005497431 Bacteria 6477605
1012 8005623628 8005619151 Bacteria 7030230
1013 8005630811 8005626139 Bacteria 6534237
1014 8005645223 8005645114 Bacteria 6950293
1015 8005660990 8005658619 Bacteria 4500593
1016 8005669300 8005668836 Bacteria 6953162
1017 8005687331 8005682033 Bacteria 6726518
1018 8005694150 8005688590 Bacteria 6610080
1019 8005695795 8005695170 Bacteria 6912330
1020 8018128641 8018127388 Bacteria 7351159
1021 8018152154 8018150411 Bacteria 5549903
1022 8018177677 8018176218 Bacteria 6896178
1023 8023686759 8023680758 Bacteria 7729763
1024 8024484579 8024479707 Bacteria 6954785
1025 8024491041 8024486573 Bacteria 6540512
1026 8024504051 8024501048 Bacteria 6427847
1027 8046768340 8046767195 Bacteria 7547379
1028 8049296432 8049293176 Bacteria 6128433
1029 8054463911 8054460903 Bacteria 4872905
1030 8054559935 8054558443 Bacteria 5204801
1031 8055432982 8055431914 Bacteria 4551896
1032 8056380611 8056375014 Bacteria 7006639
1033 8056383329 8056382006 Bacteria 6408074
1034 8056878387 8056875544 Bacteria 4355797
1035 8057581991 8057575449 Bacteria 7367519
1036 8057879497 8057874678 Bacteria 7494653
1037 Ga0070665_100003953
1038 JGI25155J39150_1000018
1039 JGI25156J39149_1000055
1040 JGI25162J39368_1000601
1041 JGI25162J39368_1000642
1042 JGI25162J39368_1002212
1043 JGI25154J39366_1000069
1044 JGI25158J39367_1006750
1045 JGI25157J39369_1000076
1046 JGI25152J39213_1000960
1047 JGI25152J39213_1002404
1048 JGI25152J39213_1005422
1049 JGI25152J39213_1005832
1050 JGI25150J39212_1000018
1051 JGI25150J39212_1001297
1052 JGI25159J45721_1000022
1053 JGI25159J45721_1000487
1054 JGI25159J45721_1000929
1055 JGI25151J46595_10000034
1056 JGI25151J46595_10003225
1057 JGI25151J46595_10022650
1058 JGI25151J46595_10022800
1059 JGI25151J46595_10033088
1060 JGI25151J46595_10064130
1061 JGI25165J46597_1000999
1062 JGI25165J46597_1001072
1063 JGI25165J46597_1001234
1064 JGI25165J46597_1003592
1065 JGI25153J46596_10003986
1066 JGI25153J46596_10009941
1067 JGI25153J46596_10014627
1068 JGI25153J46596_10016937
1069 rootH1_10077283
1070 JGI25160J50197_1000051
1071 JGI25160J50197_1000056
1072 JGI25160J50197_1006840
1073 JGI25161J50226_1000011
1074 JGI25161J50226_1000214
1075 JGI25161J50226_1000940
1076 Ga0055526_1000547
1077 Ga0055526_1001114
1078 Ga0055526_1010530
1079 Ga0055526_1012924
1080 Ga0055524_1003689
1081 Ga0055524_1003800
1082 Ga0055524_1011885
1083 Ga0055524_1019635
1084 Ga0055536_1012052
1085 Ga0055528_1002353
1086 Ga0055528_1006196
1087 Ga0055528_1008554
1088 Ga0055528_1039507
1089 Ga0055528_1042960
1090 Ga0055540_1003887
1091 Ga0055540_1004370
1092 Ga0055531_10002635
1093 Ga0055531_10014248
1094 Ga0058692_1006899
1095 Ga0058692_1015180
1096 Ga0055543_1000041
1097 Ga0055543_1000180
1098 Ga0055543_1000205
1099 Ga0065165_1000155
1100 Ga0065165_1000303
1101 Ga0065165_1015756
1102 Ga0070670_100000217
1103 Ga0070666_10029564
1104 Ga0070660_100117939
1105 Ga0070668_100081898
1106 Ga0070669_100034026
1107 Ga0070669_100175321
1108 Ga0070669_100392540
1109 Ga0070671_100002651
1110 Ga0070659_100383154
1111 Ga0070679_100218200
1112 Ga0070665_100125958
1113 Ga0070665_100182314
1114 Ga0070665_100856931
1115 Ga0068855_100071913
1116 Ga0068856_100275802
1117 Ga0075365_10084736
1118 Ga0075368_10001563
1119 Ga0075363_100116791
1120 Ga0075364_10000055
1121 Ga0075364_10007551
1122 Ga0075367_10001363
1123 Ga0075367_10005693
1124 Ga0075367_10144264
1125 Ga0075369_10011640
1126 Ga0075369_10016192
1127 Ga0075370_10005904
1128 Ga0079104_1000310
1129 Ga0079104_1009137
1130 Ga0099826_10000099
1131 Ga0099826_10019836
1132 Ga0105251_10012897
1133 Ga0105250_10017442
1134 Ga0105243_10003892
1135 Ga0105248_10007086
1136 Ga0105237_10069615
1137 Ga0123341_1000071
1138 Ga0123342_1013898
1139 Ga0105239_10014374
1140 Ga0105246_10035200
1141 Ga0105246_10185362
1142 Ga0157373_10221956
1143 Ga0157371_10000071
1144 Ga0157371_10004809
1145 Ga0157370_10000079
1146 Ga0171463_1004
1147 Ga0183363_1178
1148 Ga0163161_10416869
1149 Ga0214544_1000079
1150 Ga0214542_1000064
1151 Ga0214542_1028891
1152 Ga0214543_1000015
1153 Ga0214543_1000063
1154 Ga0228711_1000030
1155 Ga0228710_1000002
1156 Ga0209435_100031
1157 Ga0209436_100013
1158 Ga0209436_100204
1159 Ga0209436_113293
1160 Ga0209437_100179
1161 Ga0209437_100181
1162 Ga0207425_1000035
1163 Ga0207425_1000592
1164 Ga0207425_1021251
1165 Ga0209646_1000102
1166 Ga0209026_1000096
1167 Ga0209677_101959
1168 Ga0209759_1000090
1169 Ga0209129_1000029
1170 Ga0209129_1000050
1171 Ga0209129_1001908
1172 Ga0209129_1004450
1173 Ga0209129_1005545
1174 Ga0209129_1014936
1175 Ga0209233_1000185
1176 Ga0209233_1000212
1177 Ga0209233_1000263
1178 Ga0209455_1014964
1179 Ga0209673_1000033
1180 Ga0209673_1000050
1181 Ga0209673_1001329
1182 Ga0209673_1002646
1183 Ga0209673_1004300
1184 Ga0209130_1000009
1185 Ga0209130_1000058
1186 Ga0209130_1000133
1187 Ga0209130_1008168
1188 Ga0209130_1025944
1189 Ga0209676_1003565
1190 Ga0209676_1013135
1191 Ga0209676_1032315
1192 Ga0209025_1000042
1193 Ga0209025_1000132
1194 Ga0209025_1000536
1195 Ga0209025_1000815
1196 Ga0209025_1001759
1197 Ga0209025_1010008
1198 Ga0209025_1011966
1199 Ga0209025_1013178
1200 Ga0209025_1019557
1201 Ga0209564_1000193
1202 Ga0209564_1000227
1203 Ga0209564_1000700
1204 Ga0209564_1012685
1205 Ga0209564_1023477
1206 Ga0209564_1024537
1207 Ga0209758_1000299
1208 Ga0209758_1000811
1209 Ga0209758_1001376
1210 Ga0209758_1005224
1211 Ga0209758_1013589
1212 Ga0209050_1005486
1213 Ga0209256_1000737
1214 Ga0209256_1003023
1215 Ga0209256_1003361
1216 Ga0209256_1004974
1217 Ga0209256_1007850
1218 Ga0209256_1008082
1219 Ga0209256_1008373
1220 Ga0207426_1000131
1221 Ga0207426_1000248
1222 Ga0207426_1000450
1223 Ga0207426_1007855
1224 Ga0209051_1000547
1225 Ga0209051_1005634
1226 Ga0209051_1008704
1227 Ga0209257_1001429
1228 Ga0209257_1006010
1229 Ga0207713_1027597
1230 Ga0207680_10051161
1231 Ga0207705_10005041
1232 Ga0207671_10000234
1233 Ga0207657_10123378
1234 Ga0207681_10019601
1235 Ga0207650_10000825
1236 Ga0207659_10259749
1237 Ga0207644_10003921
1238 Ga0207690_10222973
1239 Ga0207669_10020725
1240 Ga0207691_10087127
1241 Ga0207711_10033400
1242 Ga0207667_10035747
1243 Ga0207668_10011587
1244 Ga0207668_10271248
1245 Ga0207678_10108173
1246 Ga0207702_10129644
1247 Ga0209281_1000028
1248 Ga0209281_1000030
1249 Ga0209281_1000144
1250 Ga0209371_1000037
1251 Ga0209371_1000693
1252 Ga0209371_1001893
1253 Ga0209282_1000004
1254 Ga0209282_1000875
1255 Ga0209282_1035683
1256 Ga0209813_10025228
1257 Ga0268266_10004792
1258 Ga0268266_10090003
1259 Ga0268266_10563575
1260 Ga0265318_10006490
1261 Ga0307515_10001115
1262 Ga0307515_10001473
1263 Ga0307515_10008463
1264 Ga0268256_1000039
1265 Ga0268256_1005835
1266 Ga0265332_10052147
1267 Ga0265331_10053558
1268 Ga0307513_10000998
1269 Ga0307513_10012271
1270 Ga0307513_10137693
1271 Ga0307408_100038184
1272 Ga0307408_100063046
1273 Ga0265314_10049992
1274 Ga0307405_10005526
1275 Ga0307406_10023469
1276 Ga0307412_10002378
1277 Ga0315914_1000001
1278 Ga0307409_100053192
1279 Ga0307409_100057628
1280 Ga0307409_100140176
1281 Ga0307416_100180292
1282 Ga0307416_100663037
1283 Ga0307414_10255734
1284 Ga0307414_10481378
1285 Ga0307411_10511510
1286 Ga0315913_1000022
1287 Ga0315915_1000002
1288 Ga0373960_0017266
1289 Ga0373962_0069360
1290 Ga0373927_0000068
1291 Ga0373925_0002087
1292 Ga0395901_0273407
1293 Ga0400488_46517
1294 Ga0436363_1337260
1295 Ga0439436_0016987
1296 Ga0439466_0057085
1297 Ga0439465_0036266
1298 Ga0439465_0047890
1299 Ga0439465_0086759
1300 Ga0451787_093977
1301 Ga0451793_1420962
1302 Ga0451841_0865164
1303 Ga0451845_0030003
1304 Ga0451853_3132945
1305 Ga0439431_0021416
1306 Ga0439449_0003731
1307 Ga0439449_0058052
1308 Ga0439449_0062252
1309 Ga0439449_0098536
1310 Ga0439462_0031665
1311 Ga0450906_009517
1312 Ga0439434_0039603
1313 Ga0450918_001704
1314 Ga0466965_0086956
1315 Ga0495629_0036128
1316 Ga0495638_0000110
1317 Ga0495638_0031000
1318 Ga0495662_0041796
1319 Ga0495664_0139228
1320 Ga0495607_0068029
1321 Ga0495583_0084814
1322 Ga0495606_0001343
1323 Ga0495610_0058573
1324 Ga0495654_0015451
1325 Ga0495597_0132594
1326 Ga0495622_0098234
1327 Ga0495633_0085488
1328 Ga0495625_0024334
1329 Ga0495625_0125664
1330 Ga0495635_0072409
1331 Ga0495588_0018770
1332 Ga0495649_0099359
1333 Ga0495604_0039039
1334 Ga0495672_0195347
1335 Ga0495673_0144458
1336 Ga0495681_0004940
1337 Ga0495686_0000972
1338 Ga0495686_0005867
1339 Ga0495686_0041805
1340 Ga0496105_0312802
1341 Ga0496106_0000565
1342 Ga0496110_0236512
1343 Ga0496114_0340490
1344 Ga0496116_0000057
1345 Ga0496116_0058064
1346 Ga0496116_0083579
1347 Ga0496116_0107679
1348 Ga0496117_0000031
1349 Ga0496117_0004115
1350 Ga0496117_0005808
1351 Ga0496117_0030723
1352 Ga0496117_0066510
1353 Ga0496117_0217035
1354 Ga0496118_0000208
1355 Ga0496118_0009144
1356 Ga0496119_0032448
1357 Ga0496119_0035931
1358 Ga0496119_0189008
1359 Ga0496120_0000387
1360 Ga0496120_0005441
1361 Ga0496120_0015772
1362 Ga0496120_0017340
1363 Ga0496121_0000034
1364 Ga0496121_0000660
1365 Ga0496121_0003338
1366 Ga0496121_0011537
1367 Ga0496121_0043028
1368 Ga0496121_0047999
1369 Ga0496121_0188061
1370 Ga0496121_0203987
1371 Ga0496122_0000023
1372 Ga0496122_0000082
1373 Ga0496122_0000308
1374 Ga0496122_0006963
1375 Ga0496122_0033860
1376 Ga0496122_0041495
1377 Ga0496122_0044947
1378 Ga0496122_0116522
1379 Ga0496122_0207816
1380 Ga0496123_0000027
1381 Ga0496123_0000066
1382 Ga0496123_0000067
1383 Ga0496123_0022385
1384 Ga0496123_0062047
1385 Ga0496123_0145943
1386 Ga0496124_0000294
1387 Ga0496124_0000917
1388 Ga0496124_0007827
1389 Ga0496124_0023755
1390 Ga0496124_0038206
1391 Ga0496124_0045573
1392 Ga0496124_0058674
1393 Ga0496124_0085128
1394 Ga0496124_0169352
1395 Ga0496124_0194579
1396 Ga0496124_0291788
1397 Ga0496125_0000030
1398 Ga0496125_0001030
1399 Ga0496125_0003238
1400 Ga0496125_0294006
1401 Ga0496126_0000115
1402 Ga0496126_0000258
1403 Ga0496126_0075628
1404 Ga0496126_0244301
1405 Ga0496126_0362061
1406 Ga0496126_0381565
1407 Ga0501031_0000002
1408 Ga0501031_0000623
1409 Ga0501031_0175452
1410 Ga0501031_0237412
1411 Ga0501032_0000001
1412 Ga0501032_0000004
1413 Ga0501032_0092568
1414 Ga0501033_0000016
1415 Ga0501033_0000275
1416 Ga0501033_0000281
1417 Ga0501033_0149825
1418 Ga0501034_0000011
1419 Ga0501034_0000036
1420 Ga0501034_0000483
1421 Ga0501034_0005551
1422 Ga0501034_0013334
1423 Ga0501034_0040645
1424 Ga0501034_0063531
1425 Ga0501034_0310346
1426 Ga0501034_0310469
1427 Ga0501036_0000001
1428 Ga0501036_0032330
1429 Ga0501036_0465188
1430 Ga0501037_0000006
1431 Ga0501037_0000091
1432 Ga0501037_0109142
1433 Ga0501037_0114256
1434 Ga0501038_0000003
1435 Ga0501038_0000346
1436 Ga0501038_0066583
1437 Ga0501038_0091125
1438 Ga0501039_0000004
1439 Ga0501039_0000011
1440 Ga0501039_0158746
1441 Ga0501040_0000896
1442 Ga0501043_0000016
1443 Ga0501043_0000155
1444 Ga0501043_0010599
1445 Ga0501046_0047744
1446 Ga0501047_0001401
1447 Ga0501047_0181271
1448 Ga0501069_0173594
1449 Ga0501070_0001201
1450 Ga0501070_0035607
1451 Ga0501070_0037952
1452 Ga0501073_0235000
1453 Ga0501074_0197778
1454 Ga0501080_0035634
1455 Ga0501080_0288434
1456 Ga0501035_0000009
1457 Ga0501035_0000364
1458 Ga0501035_0010467
1459 Ga0501035_0018281
1460 Ga0501035_0026446
1461 Ga0501044_0000005
1462 Ga0501044_0000923
1463 Ga0501044_0010209
1464 Ga0501044_0060375
1465 Ga0501044_0102798
1466 Ga0501044_0315066
1467 nmdc:mga00v17_15_c1
1468 nmdc:mga00v17_853_c1
1469 nmdc:mga0yw44_155107_c1
1470 nmdc:mga0yw44_437151_c1
1471 nmdc:mga0yw44_9569_c1
1472 nmdc:mga0yw44_96564_c1
1473 nmdc:mga06z11_126300_c1
1474 nmdc:mga04h51_19734_c1
1475 nmdc:mga07m45_93414_c1
1476 nmdc:mga0sz30_262_c1
1477 nmdc:mga0sz30_49473_c1
1478 nmdc:mga0sz30_57527_c1
1479 Ga0500644_0058201
1480 Ga0500646_0095376
1481 Ga0500556_0059750
1482 Ga0500572_006445
1483 Ga0500608_064866
1484 Ga0500618_000541
1485 Ga0500618_026072
1486 Ga0500655_026378
1487 Ga0500658_0000212
1488 Ga0500559_0016484
1489 Ga0500561_0000061
1490 Ga0500568_0001241
1491 Ga0500568_0001349
1492 Ga0500573_0020160
1493 Ga0500590_008347
1494 Ga0500616_0002356
1495 Ga0500616_0007287
1496 Ga0500616_0018083
1497 Ga0500616_0077964
1498 Ga0500622_0000169
1499 Ga0500622_0000441
1500 Ga0500624_001783
1501 Ga0500627_0004068
1502 Ga0500627_0055586
1503 Ga0500634_0112321
1504 Ga0500636_0000030
1505 Ga0587083_0003098
1506 Ga0587090_000340
1507 Ga0587106_001937
1508 Ga0587068_001459
1509 Ga0587069_000734
1510 Ga0587072_000658
1511 Ga0530510_0298805
1512 2509108826
1513 2509377957
1514 2509389207
1515 2509444766
1516 2510305856
1517 2510839214
1518 2510896908
1519 2511135816
1520 2511173774
1521 2511185197
1522 2511194228
1523 2511391924
1524 2511498622
1525 2512973415
1526 2513580385
1527 2513588140
1528 2513597821
1529 2513602067
1530 2513620996
1531 2513711552
1532 2513865099
1533 2513885421
1534 2513904690
1535 2513912929
1536 2513929522
1537 2513983521
1538 2514001681
1539 2514003334
1540 2514023154
1541 2515114621
1542 2515612398
1543 2515634959
1544 2515644477
1545 2515660946
1546 2515741804
1547 2516205734
1548 2516894899
1549 2517038264
1550 2517078542
1551 2517571582
1552 2520376513
1553 2524450283
1554 2524461216
1555 2530647154
1556 2537874485
1557 2551678435
1558 2551685208
1559 2551690793
1560 2551704597
1561 2551710835
1562 2551717169
1563 2551730427
1564 2551733377
1565 2551740065
1566 2554249015
1567 2558867545
1568 2559296103
1569 2561468576
1570 2585166465
1571 2585201522
1572 2585224136
1573 2585231843
1574 2585257145
1575 2585267212
1576 2585272094
1577 2585327436
1578 2585334025
1579 2585388263
1580 2585396137
1581 2585399969
1582 2585529159
1583 2585535677
1584 2585549836
1585 2585551055
1586 2585563361
1587 2585821058
1588 2585845089
1589 2585897217
1590 2585909132
1591 2585998104
1592 2586002683
1593 2587984546
1594 2599335723
1595 2599419936
1596 2599603104
1597 2599722664
1598 2600194011
1599 2600377469
1600 2601610991
1601 2601747765
1602 2616297520
1603 2616306385
1604 2616551127
1605 2617382358
1606 2643773406
1607 2643777605
1608 2643796053
1609 2643806898
1610 2643854797
1611 2643921627
1612 2644002672
1613 2644052479
1614 2644068906
1615 2644105725
1616 2644146391
1617 2644194622
1618 2644201138
1619 2644209701
1620 2644240287
1621 2644299663
1622 2644310338
1623 2644334877
1624 2644378282
1625 2644419977
1626 2644453333
1627 2644484757
1628 2644492520
1629 2644501278
1630 2644521681
1631 2644544929
1632 2644615421
1633 2644653229
1634 2644657891
1635 2644675133
1636 2644688640
1637 2657682274
1638 2671115994
1639 2692319801
1640 2719183160
1641 2719387879
1642 2719667500
1643 2719733877
1644 2720493920
1645 2720615383
1646 2720622169
1647 2720633523
1648 2720777221
1649 2721149272
1650 2721160674
1651 2721166085
1652 2721401512
1653 2722842255
1654 2723028821
1655 2723562434
1656 2723569128
1657 2724040326
1658 2724046633
1659 2724091828
1660 2724106393
1661 2724112200
1662 2730109757
1663 2730166395
1664 2730300306
1665 2738800995
1666 2738947124
1667 2753458441
1668 2778179251
1669 2792582375
1670 2792621771
1671 2792628972
1672 2792640114
1673 2793281858
1674 2793295433
1675 2793317932
1676 2793324593
1677 2793329636
1678 2793332432
1679 2793339026
1680 2793346796
1681 2793356811
1682 2793359176
1683 2793366099
1684 2802717053
1685 2802724959
1686 2802729709
1687 2802737055
1688 2802743460
1689 2802749414
1690 2804753832
1691 2805930938
1692 2805936787
1693 2808988071
1694 2819244109
1695 2819561113
1696 2819612004
1697 2819638453
1698 2819688389
1699 2821129181
1700 2837683444
1701 2838018126
1702 2838023806
1703 2838034154
1704 2838041986
1705 2838046786
1706 2838051015
1707 2838062781
1708 2838072326
1709 2838078023
1710 2838668163
1711 2838674260
1712 2838678516
1713 2838683678
1714 2838693375
1715 2838698206
1716 2838706663
1717 2838711321
1718 2838718396
1719 2838722812
1720 2838728462
1721 2838735369
1722 2838742198
1723 2838748082
1724 2841846054
1725 2841850368
1726 2841857441
1727 2841863379
1728 2841867556
1729 2842081122
1730 2842116626
1731 2842122101
1732 2842129122
1733 2842133409
1734 2842145758
1735 2842148992
1736 2842155680
1737 2842162384
1738 2842166915
1739 2842174362
1740 2842179023
1741 2842186024
1742 2842190820
1743 2842194687
1744 2842201161
1745 2842207613
1746 2842214856
1747 2842221987
1748 2842227577
1749 2842235483
1750 2842241115
1751 2842249234
1752 2842256454
1753 2842263189
1754 2842269246
1755 2842277843
1756 2842280676
1757 2842290378
1758 2842294779
1759 2842302660
1760 2842305614
1761 2842311618
1762 2842323680
1763 2842346899
1764 2842358838
1765 2842366070
1766 2842375203
1767 2842381177
1768 2842388248
1769 2842395738
1770 2842408212
1771 2842414974
1772 2842421517
1773 2842425958
1774 2842433470
1775 2842439475
1776 2842446217
1777 2842448544
1778 2842467719
1779 2842474317
1780 2842480878
1781 2842485313
1782 2842491371
1783 2842501894
1784 2842507511
1785 2842519884
1786 2842527096
1787 2842874076
1788 2842926489
1789 2844167956
1790 2844456776
1791 2847420975
1792 2848995808
1793 2850082787
1794 2852387574
1795 2854897764
1796 2854922341
1797 2855827533
1798 2855842908
1799 2855873669
1800 2857536122
1801 2858803586
1802 2876376999
1803 2881858830
1804 2889916070
1805 2891048552
1806 2891377755
1807 2896390048
1808 2899794793
1809 2899805032
1810 2899849454
1811 2906429263
1812 2913300321
1813 2913312047
1814 2915981678
1815 2915993543
1816 2915998969
1817 2916004441
1818 2916008471
1819 2916019899
1820 2916023965
1821 2916031890
1822 2916040531
1823 2916043464
1824 2916050611
1825 2916058725
1826 2916066449
1827 2916074965
1828 2916078383
1829 2919107972
1830 2919118347
1831 2919170433
1832 2919176857
1833 2919411488
1834 2920760178
1835 2920826094
1836 2921205034
1837 2921211996
1838 2921240322
1839 2921244453
1840 2921252767
1841 2921260407
1842 2921267491
1843 2921283446
1844 2921294014
1845 2921302890
1846 2923559940
1847 2924144843
1848 2924157279
1849 2924158748
1850 2924166801
1851 2924175832
1852 2924183433
1853 2924186941
1854 2924193451
1855 2924201480
1856 2924213742
1857 2924214497
1858 2924227167
1859 2924234002
1860 2926754876
1861 2926762041
1862 2928522662
1863 2929142026
1864 2933010474
1865 2933015854
1866 2933016930
1867 2933572121
1868 2933592768
1869 2933597408
1870 2933602822
1871 2935898140
1872 2935903418
1873 2936381738
1874 2936997470
1875 2937004066
1876 2937016133
1877 2937020611
1878 2937023142
1879 2937031690
1880 2937042513
1881 2937044060
1882 2937053573
1883 2937059339
1884 2937070533
1885 2937071742
1886 2937081525
1887 2937090843
1888 2937096804
1889 2937102919
1890 2937109756
1891 2937114278
1892 2937125718
1893 2937129743
1894 2937843564
1895 2941501518
1896 2954013957
1897 2957376757
1898 2957384887
1899 2957395162
1900 2957396178
1901 2957405513
1902 2957411678
1903 2957417435
1904 2957422863
1905 2957430114
1906 2957441705
1907 2957448354
1908 2957454643
1909 2957461034
1910 2957471010
1911 2957475359
1912 2957481417
1913 2957489049
1914 2957491896
1915 2957505138
1916 2957508303
1917 2960585969
1918 2960592835
1919 2960597863
1920 2960607455
1921 2960611571
1922 2960619057
1923 2960629096
1924 2960635556
1925 2960643549
1926 2960646512
1927 2960659759
1928 2960664847
1929 2960673323
1930 2960675102
1931 2960681760
1932 2960689301
1933 2960700686
1934 2964608191
1935 2964620325
1936 2964623008
1937 2964629717
1938 2964639257
1939 2964643574
1940 2964655178
1941 2964660013
1942 2964669434
1943 2964675053
1944 2964681645
1945 2964685883
1946 2964695176
1947 2964699194
1948 2964705821
1949 2964713498
1950 2964720584
1951 2967668292
1952 2967672524
1953 2967681282
1954 2967692392
1955 2967696499
1956 2967700398
1957 2967712991
1958 2967721230
1959 2967727549
1960 2967732196
1961 2967738497
1962 2967742983
1963 2967752582
1964 2967757781
1965 2967765762
1966 2967770312
1967 2967777064
1968 2970022023
1969 2970028643
1970 2970034956
1971 2970046633
1972 2970049590
1973 2970058802
1974 2970062638
1975 2970071208
1976 2970082602
1977 2970086783
1978 2970095730
1979 2970096567
1980 2970104577
1981 2970113961
1982 2970118408
1983 2970124471
1984 2970133488
1985 2970137809
1986 2970147370
1987 2970156748
1988 2970158108
1989 2970170721
1990 2970174054
1991 2970178857
1992 2970185863
1993 2970197879
1994 2970627597
1995 2977517477
1996 2977527431
1997 2977531235
1998 2977544436
1999 2977547457
2000 2977557978
2001 2977564689
2002 2977571346
2003 2977577280
2004 2977583033
2005 2978972771
2006 2979092690
2007 2979099919
2008 2979104662
2009 2984513541
2010 2984522879
2011 2984542187
2012 2984591023
2013 2984601615
2014 2989355110
2015 2989771798
2016 2989780276
2017 2995394271
2018 2996311581
2019 2996890487
2020 2996896180
2021 3005415988
2022 3005416854
2023 3005449873
2024 3005456164
2025 639645880
2026 643827563
2027 648737342
2028 650738520
2029 8003573619
2030 8003995489
2031 8004003249
2032 8005249437
2033 8005262674
2034 8005278079
2035 8005286547
2036 8005292015
2037 8005306153
2038 8005309728
2039 8005315942
2040 8005325014
2041 8005387573
2042 8005398408
2043 8005431991
2044 8005465317
2045 8005487032
2046 8005497894
2047 8005623628
2048 8005630811
2049 8005645223
2050 8005660990
2051 8005669300
2052 8005687331
2053 8005694150
2054 8005695795
2055 8018128641
2056 8018152154
2057 8018177677
2058 8023686759
2059 8024484579
2060 8024491041
2061 8024504051
2062 8046768340
2063 8049296432
2064 8054463911
2065 8054559935
2066 8055432982
2067 8056380611
2068 8056383329
2069 8056878387
2070 8057581991
2071 8057879497

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00290

Trp_syntA

Tryptophan synthase alpha chain

24

281

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ey5-assembly1.cif.gz_C lbcats 0.9521 4 266
8b06-assembly1.cif.gz_A tryptophan synthase - cryo-trapping by the spitrobot crystal plunger after 25 sec 0.9473 2 270
1kfe-assembly1.cif.gz_A crystal structure of alphat183v mutant of tryptophan synthase from salmonella typhimurium with l-ser bound to the beta site 0.9468 2 271
5kmy-assembly1.cif.gz_A crystal structure of tryptophan synthase subunit alpha from legionella pneumophila str. paris 0.9461 1 270
1qoq-assembly1.cif.gz_A crystal structure of wild-type tryptophan synthase complexed with indole glycerol phosphate 0.9453 2 271
ID Description Score Start End Superfamily
5ey5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9447 2 270 3.20.20.70
af_A0A1D8PMH6_3_266_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9376 3 266 3.20.20.70
5kzmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9367 2 270 3.20.20.70
6du1C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9349 2 271 3.20.20.70
5k9xA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9315 2 266 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A5R2N013-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9894 16 149 GO:0004834
GO:0005829
GO:0006568
AF-A0A7Y2L3C2-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9862 2 177 GO:0004834
GO:0005829
GO:0006568
AF-A0A5R2N013-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9821 16 149 GO:0004834
GO:0005829
GO:0006568
AF-A0A0U3ALB5-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9816 86 273 GO:0004834
GO:0005829
GO:0006568
AF-Q0G7P0-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9808 1 273 GO:0004834
GO:0005829
GO:0006568

Map