F488702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1035 | 522 | 935 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300049823|Ga0501044_0960558|Ga0501044_0960558_145_708 |
| Length | 187 |
| Sequence | MGKSTTAKFFAEEGVPVHDSDAVVHRLYEGEAVPAIEAAFPGTTVDGKVDRDKLSAHLVAHPGDFKKLEALVHPLVRAAEQRFLAEAEKRGDKAVVLDIPLLYETAAEARCNAVVVVSAPEETQRARMKERGMSDARFEAIIARQVPDAVKRERADFVVDSGQGLDHARAQVREILRAVATLPKRGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 11 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 12 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 13 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 14 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 15 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 16 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 17 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 18 | 2791355199 | |||
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 21 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 22 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 23 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 24 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 25 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 26 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 27 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 28 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 29 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 30 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 31 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 32 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 33 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 34 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 35 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 36 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 37 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 38 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 39 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 40 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 41 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 42 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 43 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 44 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 45 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 46 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 47 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 48 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 49 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 50 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 51 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 52 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 53 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 54 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 55 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 56 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 57 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 58 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 59 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 60 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 61 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 62 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 63 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 64 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 65 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 66 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 67 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 68 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 69 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 70 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 71 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 72 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 73 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 74 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 75 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 76 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 77 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 78 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 79 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 80 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 81 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 82 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 83 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 84 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 85 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 86 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 87 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 88 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 89 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 90 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 91 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 92 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 93 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 94 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 96 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 99 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 101 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 104 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 117 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 125 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 126 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 127 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 128 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 129 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 131 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 132 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 136 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 138 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 139 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 140 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 142 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 143 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 144 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 145 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 146 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 147 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 148 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 149 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 150 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 151 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 152 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 153 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 155 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 156 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 157 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 159 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 161 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 162 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 163 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 164 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 166 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 167 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 168 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 169 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 170 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 171 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 173 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 174 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 175 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 176 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 177 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 178 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 186 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 187 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 188 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 191 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 192 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 193 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 201 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 202 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 203 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 205 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 206 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 207 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 208 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 209 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 210 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 211 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 212 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 213 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 214 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 272 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 273 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 274 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 277 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 282 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 283 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 284 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 285 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 286 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 287 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 288 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 289 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 290 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 291 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 292 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 293 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 294 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 295 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 296 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 297 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 298 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 299 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 300 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 302 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 303 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 304 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 305 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 306 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 307 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 309 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 310 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 311 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 312 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 313 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 314 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 315 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 316 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 317 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 318 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 319 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 320 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 321 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 322 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 323 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 324 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 325 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 326 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 327 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 329 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 330 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 331 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 399 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 400 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 401 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 402 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 403 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 404 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 405 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 406 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 408 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 409 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 410 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 411 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 412 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 413 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 414 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 415 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 416 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 417 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 418 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 419 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 420 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 421 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 445 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 448 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 451 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 452 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 453 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 454 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 455 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 456 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 457 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 458 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 459 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 460 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 461 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 462 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 465 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 468 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 472 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 473 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 474 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 475 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 476 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 477 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 478 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 479 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 480 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 481 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 482 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 483 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 484 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 485 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 486 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 487 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 488 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 489 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 490 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 491 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 492 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 493 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 494 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 495 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 496 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 497 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 498 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 499 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 500 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 501 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 502 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 503 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 504 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 505 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 506 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 507 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 508 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 509 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 510 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 511 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 512 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 513 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 514 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 515 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 516 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 517 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 518 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 519 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 520 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 521 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 522 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.33 |
| Metatranscriptomes | 0.1 |
| Isolates | 9.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.28 |
| Nodule | 7.54 |
| Rhizoplane | 7.63 |
| Rhizosphere | 67.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10012640 | 3300001979 | Bacteria | 3176 |
| 2 | JGI25406J46586_10000066 | 3300003203 | Bacteria | 48110 |
| 3 | rootH1_10247459 | 3300003323 | Bacteria | 1939 |
| 4 | JGI25404J52841_10026242 | 3300003659 | Bacteria | 1254 |
| 5 | Ga0055543_1009271 | 3300004625 | Bacteria | 2125 |
| 6 | Ga0065165_1000365 | 3300005262 | Bacteria | 74017 |
| 7 | Ga0070658_10086338 | 3300005327 | Bacteria | 2581 |
| 8 | Ga0070683_100083743 | 3300005329 | Bacteria | 2987 |
| 9 | Ga0070690_100274280 | 3300005330 | Bacteria | 1201 |
| 10 | Ga0070690_100469775 | 3300005330 | Bacteria | 936 |
| 11 | Ga0070670_100957109 | 3300005331 | Bacteria | 778 |
| 12 | Ga0068869_100102947 | 3300005334 | Bacteria | 2162 |
| 13 | Ga0068869_100393970 | 3300005334 | Bacteria | 1138 |
| 14 | Ga0070680_100184111 | 3300005336 | Bacteria | 1759 |
| 15 | Ga0070680_100325980 | 3300005336 | Bacteria | 1304 |
| 16 | Ga0070682_100109183 | 3300005337 | Bacteria | 1841 |
| 17 | Ga0068868_100006458 | 3300005338 | Bacteria | 8298 |
| 18 | Ga0070660_100002843 | 3300005339 | Bacteria | 11922 |
| 19 | Ga0070661_100121771 | 3300005344 | Bacteria | 1955 |
| 20 | Ga0070661_100536953 | 3300005344 | Bacteria | 940 |
| 21 | Ga0070692_10127817 | 3300005345 | Bacteria | 1425 |
| 22 | Ga0070668_100015369 | 3300005347 | Bacteria | 5720 |
| 23 | Ga0070668_100033661 | 3300005347 | Bacteria | 3903 |
| 24 | Ga0070668_100117461 | 3300005347 | Bacteria | 2122 |
| 25 | Ga0070669_100365289 | 3300005353 | Bacteria | 1174 |
| 26 | Ga0070675_100508884 | 3300005354 | Bacteria | 1086 |
| 27 | Ga0070671_100090093 | 3300005355 | Bacteria | 2568 |
| 28 | Ga0070671_100097781 | 3300005355 | Bacteria | 2462 |
| 29 | Ga0070671_100158144 | 3300005355 | Bacteria | 1915 |
| 30 | Ga0070671_100472751 | 3300005355 | Bacteria | 1077 |
| 31 | Ga0070674_100043742 | 3300005356 | Bacteria | 3048 |
| 32 | Ga0070674_100095774 | 3300005356 | Bacteria | 2152 |
| 33 | Ga0070673_100366580 | 3300005364 | Bacteria | 1282 |
| 34 | Ga0070667_100202757 | 3300005367 | Bacteria | 1760 |
| 35 | Ga0070709_10000584 | 3300005434 | Bacteria | 21359 |
| 36 | Ga0070709_10067203 | 3300005434 | Bacteria | 2301 |
| 37 | Ga0070714_100051084 | 3300005435 | Bacteria | 3524 |
| 38 | Ga0070714_100067843 | 3300005435 | Bacteria | 3077 |
| 39 | Ga0070714_100142313 | 3300005435 | Bacteria | 2154 |
| 40 | Ga0070714_100143476 | 3300005435 | Bacteria | 2146 |
| 41 | Ga0070714_100376877 | 3300005435 | Bacteria | 1337 |
| 42 | Ga0070713_100002764 | 3300005436 | Bacteria | 11471 |
| 43 | Ga0070713_100007994 | 3300005436 | Bacteria | 7475 |
| 44 | Ga0070713_100013200 | 3300005436 | Bacteria | 6090 |
| 45 | Ga0070713_100054190 | 3300005436 | Bacteria | 3326 |
| 46 | Ga0070713_100358213 | 3300005436 | Bacteria | 1355 |
| 47 | Ga0070710_10082864 | 3300005437 | Bacteria | 1876 |
| 48 | Ga0070710_10642190 | 3300005437 | Bacteria | 743 |
| 49 | Ga0070711_100003385 | 3300005439 | Bacteria | 9292 |
| 50 | Ga0070711_100144560 | 3300005439 | Bacteria | 1787 |
| 51 | Ga0070700_100663904 | 3300005441 | Bacteria | 825 |
| 52 | Ga0070708_100108643 | 3300005445 | Bacteria | 2548 |
| 53 | Ga0070663_100001666 | 3300005455 | Bacteria | 12295 |
| 54 | Ga0070663_100017648 | 3300005455 | Bacteria | 4662 |
| 55 | Ga0070663_100019459 | 3300005455 | Bacteria | 4475 |
| 56 | Ga0070663_100220296 | 3300005455 | Bacteria | 1489 |
| 57 | Ga0070678_100034858 | 3300005456 | Bacteria | 3508 |
| 58 | Ga0070678_100113296 | 3300005456 | Bacteria | 2126 |
| 59 | Ga0070678_100409613 | 3300005456 | Bacteria | 1180 |
| 60 | Ga0070678_100759381 | 3300005456 | Bacteria | 878 |
| 61 | Ga0070662_100103444 | 3300005457 | Bacteria | 2160 |
| 62 | Ga0070662_100148304 | 3300005457 | Bacteria | 1824 |
| 63 | Ga0070662_100477577 | 3300005457 | Bacteria | 1037 |
| 64 | Ga0070681_10073556 | 3300005458 | Bacteria | 3379 |
| 65 | Ga0070681_10204051 | 3300005458 | Bacteria | 1894 |
| 66 | Ga0070706_100446936 | 3300005467 | Bacteria | 1203 |
| 67 | Ga0070707_100093433 | 3300005468 | Bacteria | 2912 |
| 68 | Ga0070698_100083350 | 3300005471 | Bacteria | 3187 |
| 69 | Ga0070698_100120907 | 3300005471 | Bacteria | 2579 |
| 70 | Ga0070679_100060657 | 3300005530 | Bacteria | 3769 |
| 71 | Ga0070679_100131887 | 3300005530 | Bacteria | 2479 |
| 72 | Ga0070679_100444319 | 3300005530 | Bacteria | 1242 |
| 73 | Ga0070684_100013695 | 3300005535 | Bacteria | 6545 |
| 74 | Ga0070684_100413367 | 3300005535 | Bacteria | 1245 |
| 75 | Ga0070697_100068173 | 3300005536 | Bacteria | 2912 |
| 76 | Ga0070697_100152523 | 3300005536 | Bacteria | 1948 |
| 77 | Ga0068853_100006442 | 3300005539 | Bacteria | 9329 |
| 78 | Ga0068853_100129133 | 3300005539 | Bacteria | 2261 |
| 79 | Ga0068853_100301700 | 3300005539 | Bacteria | 1480 |
| 80 | Ga0068853_100338895 | 3300005539 | Bacteria | 1397 |
| 81 | Ga0068853_100784119 | 3300005539 | Bacteria | 912 |
| 82 | Ga0068853_101163117 | 3300005539 | Bacteria | 744 |
| 83 | Ga0070672_100067814 | 3300005543 | Bacteria | 2828 |
| 84 | Ga0070672_100652780 | 3300005543 | Bacteria | 919 |
| 85 | Ga0070665_100032806 | 3300005548 | Bacteria | 5225 |
| 86 | Ga0070665_100207596 | 3300005548 | Bacteria | 1959 |
| 87 | Ga0070665_100367340 | 3300005548 | Bacteria | 1445 |
| 88 | Ga0070665_100419032 | 3300005548 | Bacteria | 1348 |
| 89 | Ga0070665_100882380 | 3300005548 | Bacteria | 907 |
| 90 | Ga0070704_100276365 | 3300005549 | Bacteria | 1390 |
| 91 | Ga0068855_100006336 | 3300005563 | Bacteria | 14418 |
| 92 | Ga0068855_100056640 | 3300005563 | Bacteria | 4598 |
| 93 | Ga0068855_100173061 | 3300005563 | Bacteria | 2444 |
| 94 | Ga0068855_100315296 | 3300005563 | Bacteria | 1729 |
| 95 | Ga0068855_100423764 | 3300005563 | Bacteria | 1455 |
| 96 | Ga0070664_100044154 | 3300005564 | Bacteria | 3763 |
| 97 | Ga0070664_100539176 | 3300005564 | Bacteria | 1078 |
| 98 | Ga0070664_100879467 | 3300005564 | Bacteria | 840 |
| 99 | Ga0068857_100005001 | 3300005577 | Bacteria | 11266 |
| 100 | Ga0068857_100050370 | 3300005577 | Bacteria | 3695 |
| 101 | Ga0068857_100327325 | 3300005577 | Bacteria | 1416 |
| 102 | Ga0068857_100445182 | 3300005577 | Bacteria | 1210 |
| 103 | Ga0068854_100038575 | 3300005578 | Bacteria | 3360 |
| 104 | Ga0068854_100112686 | 3300005578 | Bacteria | 2054 |
| 105 | Ga0068856_100005232 | 3300005614 | Bacteria | 12806 |
| 106 | Ga0068856_100222530 | 3300005614 | Bacteria | 1903 |
| 107 | Ga0070702_100124149 | 3300005615 | Bacteria | 1621 |
| 108 | Ga0070702_100156062 | 3300005615 | Bacteria | 1470 |
| 109 | Ga0068852_100042907 | 3300005616 | Bacteria | 3832 |
| 110 | Ga0068852_100045014 | 3300005616 | Bacteria | 3752 |
| 111 | Ga0068852_100105825 | 3300005616 | Bacteria | 2549 |
| 112 | Ga0068852_101080807 | 3300005616 | Bacteria | 822 |
| 113 | Ga0068859_100207816 | 3300005617 | Bacteria | 2043 |
| 114 | Ga0068859_100750661 | 3300005617 | Bacteria | 1065 |
| 115 | Ga0068864_100607919 | 3300005618 | Bacteria | 1061 |
| 116 | Ga0068864_101301282 | 3300005618 | Bacteria | 727 |
| 117 | Ga0068861_100072794 | 3300005719 | Bacteria | 2667 |
| 118 | Ga0068851_10009214 | 3300005834 | Bacteria | 4582 |
| 119 | Ga0068851_10225768 | 3300005834 | Bacteria | 1054 |
| 120 | Ga0068870_10116859 | 3300005840 | Bacteria | 1531 |
| 121 | Ga0068863_100032605 | 3300005841 | Bacteria | 4964 |
| 122 | Ga0068863_100269190 | 3300005841 | Bacteria | 1649 |
| 123 | Ga0068863_100557688 | 3300005841 | Bacteria | 1132 |
| 124 | Ga0068860_100004221 | 3300005843 | Bacteria | 14730 |
| 125 | Ga0068860_100104642 | 3300005843 | Bacteria | 2702 |
| 126 | Ga0068862_100072386 | 3300005844 | Bacteria | 2977 |
| 127 | Ga0068862_100133794 | 3300005844 | Bacteria | 2195 |
| 128 | Ga0068862_100192780 | 3300005844 | Bacteria | 1835 |
| 129 | Ga0068862_100221413 | 3300005844 | Bacteria | 1713 |
| 130 | Ga0068862_100628791 | 3300005844 | Bacteria | 1033 |
| 131 | Ga0081455_10041411 | 3300005937 | Bacteria | 4051 |
| 132 | Ga0081540_1011590 | 3300005983 | Bacteria | 5885 |
| 133 | Ga0081540_1033663 | 3300005983 | Bacteria | 2778 |
| 134 | Ga0081540_1041776 | 3300005983 | Bacteria | 2373 |
| 135 | Ga0081540_1059678 | 3300005983 | Bacteria | 1829 |
| 136 | Ga0081540_1089461 | 3300005983 | Bacteria | 1358 |
| 137 | Ga0081539_10000064 | 3300005985 | Bacteria | 247020 |
| 138 | Ga0070717_10000598 | 3300006028 | Bacteria | 23163 |
| 139 | Ga0070717_10061554 | 3300006028 | Bacteria | 3111 |
| 140 | Ga0070717_10073218 | 3300006028 | Bacteria | 2863 |
| 141 | Ga0070717_10248780 | 3300006028 | Bacteria | 1570 |
| 142 | Ga0075365_10074787 | 3300006038 | Bacteria | 2285 |
| 143 | Ga0075365_10278942 | 3300006038 | Bacteria | 1176 |
| 144 | Ga0075368_10167082 | 3300006042 | Bacteria | 924 |
| 145 | Ga0075363_100001418 | 3300006048 | Bacteria | 9077 |
| 146 | Ga0070715_10172941 | 3300006163 | Bacteria | 1077 |
| 147 | Ga0070716_100029244 | 3300006173 | Bacteria | 2977 |
| 148 | Ga0070712_100005171 | 3300006175 | Bacteria | 8072 |
| 149 | Ga0070712_100005584 | 3300006175 | Bacteria | 7779 |
| 150 | Ga0075362_10140243 | 3300006177 | Bacteria | 1155 |
| 151 | Ga0075367_10027915 | 3300006178 | Bacteria | 3215 |
| 152 | Ga0075367_10087525 | 3300006178 | Bacteria | 1892 |
| 153 | Ga0075367_10144134 | 3300006178 | Bacteria | 1476 |
| 154 | Ga0075367_10211278 | 3300006178 | Bacteria | 1213 |
| 155 | Ga0075367_10345272 | 3300006178 | Bacteria | 939 |
| 156 | Ga0075369_10006992 | 3300006186 | Bacteria | 4283 |
| 157 | Ga0075366_10265088 | 3300006195 | Bacteria | 1049 |
| 158 | Ga0097621_100052686 | 3300006237 | Bacteria | 3315 |
| 159 | Ga0097621_100092813 | 3300006237 | Bacteria | 2529 |
| 160 | Ga0075370_10019651 | 3300006353 | Bacteria | 3682 |
| 161 | Ga0075370_10041274 | 3300006353 | Bacteria | 2604 |
| 162 | Ga0075370_10085718 | 3300006353 | Bacteria | 1814 |
| 163 | Ga0068871_100227703 | 3300006358 | Bacteria | 1617 |
| 164 | Ga0068871_100514290 | 3300006358 | Bacteria | 1080 |
| 165 | Ga0075428_100251323 | 3300006844 | Bacteria | 1905 |
| 166 | Ga0075433_10031337 | 3300006852 | Bacteria | 4545 |
| 167 | Ga0075434_100004035 | 3300006871 | Bacteria | 13164 |
| 168 | Ga0068865_100324292 | 3300006881 | Bacteria | 1240 |
| 169 | Ga0097620_100207824 | 3300006931 | Bacteria | 2043 |
| 170 | Ga0097620_100750707 | 3300006931 | Bacteria | 1065 |
| 171 | Ga0099825_1031523 | 3300006941 | Bacteria | 2238 |
| 172 | Ga0099824_1014228 | 3300006942 | Bacteria | 7980 |
| 173 | Ga0099822_1000827 | 3300006943 | Bacteria | 32648 |
| 174 | Ga0075435_100330395 | 3300007076 | Bacteria | 1306 |
| 175 | Ga0099794_10006977 | 3300007265 | Bacteria | 4607 |
| 176 | Ga0099794_10028876 | 3300007265 | Bacteria | 2581 |
| 177 | Ga0099794_10047829 | 3300007265 | Bacteria | 2052 |
| 178 | Ga0099794_10087498 | 3300007265 | Bacteria | 1543 |
| 179 | Ga0099795_10021988 | 3300007788 | Bacteria | 2100 |
| 180 | Ga0099795_10100091 | 3300007788 | Bacteria | 1136 |
| 181 | Ga0099795_10149576 | 3300007788 | Bacteria | 955 |
| 182 | Ga0099795_10156506 | 3300007788 | Bacteria | 937 |
| 183 | Ga0099795_10178223 | 3300007788 | Bacteria | 886 |
| 184 | Ga0105240_10019831 | 3300009093 | Bacteria | 8981 |
| 185 | Ga0105240_10025163 | 3300009093 | Bacteria | 7828 |
| 186 | Ga0105240_10232524 | 3300009093 | Bacteria | 2141 |
| 187 | Ga0105240_10963732 | 3300009093 | Bacteria | 914 |
| 188 | Ga0111539_10038919 | 3300009094 | Bacteria | 5735 |
| 189 | Ga0111539_10046457 | 3300009094 | Bacteria | 5193 |
| 190 | Ga0111539_10093169 | 3300009094 | Bacteria | 3539 |
| 191 | Ga0105245_10042438 | 3300009098 | Bacteria | 4059 |
| 192 | Ga0105245_10076458 | 3300009098 | Bacteria | 3050 |
| 193 | Ga0105245_10409909 | 3300009098 | Bacteria | 1356 |
| 194 | Ga0105245_10757004 | 3300009098 | Bacteria | 1007 |
| 195 | Ga0105247_10065622 | 3300009101 | Bacteria | 2258 |
| 196 | Ga0105247_10087391 | 3300009101 | Bacteria | 1974 |
| 197 | Ga0105247_10133263 | 3300009101 | Bacteria | 1621 |
| 198 | Ga0105247_10234758 | 3300009101 | Bacteria | 1247 |
| 199 | Ga0105247_10276028 | 3300009101 | Bacteria | 1158 |
| 200 | Ga0114129_10184351 | 3300009147 | Bacteria | 2838 |
| 201 | Ga0114129_10278936 | 3300009147 | Bacteria | 2233 |
| 202 | Ga0105243_10118967 | 3300009148 | Bacteria | 2224 |
| 203 | Ga0105243_10143191 | 3300009148 | Bacteria | 2042 |
| 204 | Ga0105243_10506393 | 3300009148 | Bacteria | 1145 |
| 205 | Ga0105241_10011853 | 3300009174 | Bacteria | 6404 |
| 206 | Ga0105241_10055927 | 3300009174 | Bacteria | 3024 |
| 207 | Ga0105241_10146258 | 3300009174 | Bacteria | 1929 |
| 208 | Ga0105242_10128515 | 3300009176 | Bacteria | 2184 |
| 209 | Ga0105242_10894548 | 3300009176 | Bacteria | 887 |
| 210 | Ga0105242_10946815 | 3300009176 | Bacteria | 865 |
| 211 | Ga0105248_10026101 | 3300009177 | Bacteria | 6500 |
| 212 | Ga0105248_10539361 | 3300009177 | Bacteria | 1316 |
| 213 | Ga0105248_10693439 | 3300009177 | Bacteria | 1149 |
| 214 | Ga0105248_10994895 | 3300009177 | Bacteria | 947 |
| 215 | Ga0105237_10080675 | 3300009545 | Bacteria | 3244 |
| 216 | Ga0105237_10094573 | 3300009545 | Bacteria | 2978 |
| 217 | Ga0105237_10340724 | 3300009545 | Bacteria | 1504 |
| 218 | Ga0105237_10344836 | 3300009545 | Bacteria | 1494 |
| 219 | Ga0105238_10005518 | 3300009551 | Bacteria | 12492 |
| 220 | Ga0105238_10008791 | 3300009551 | Bacteria | 10106 |
| 221 | Ga0105238_10052809 | 3300009551 | Bacteria | 4085 |
| 222 | Ga0105238_10249676 | 3300009551 | Bacteria | 1752 |
| 223 | Ga0105238_10267289 | 3300009551 | Bacteria | 1691 |
| 224 | Ga0105238_10350416 | 3300009551 | Bacteria | 1465 |
| 225 | Ga0105238_10466557 | 3300009551 | Bacteria | 1261 |
| 226 | Ga0105238_10482452 | 3300009551 | Bacteria | 1239 |
| 227 | Ga0105249_10328780 | 3300009553 | Bacteria | 1542 |
| 228 | Ga0105249_10656068 | 3300009553 | Bacteria | 1107 |
| 229 | Ga0105249_10930699 | 3300009553 | Bacteria | 937 |
| 230 | Ga0099796_10099874 | 3300010159 | Bacteria | 1090 |
| 231 | Ga0105239_10002519 | 3300010375 | Bacteria | 23275 |
| 232 | Ga0105239_10009940 | 3300010375 | Bacteria | 10682 |
| 233 | Ga0105239_10104111 | 3300010375 | Bacteria | 3142 |
| 234 | Ga0105239_10201950 | 3300010375 | Bacteria | 2227 |
| 235 | Ga0105239_10342564 | 3300010375 | Bacteria | 1687 |
| 236 | Ga0105239_11632647 | 3300010375 | Bacteria | 746 |
| 237 | Ga0105246_10005044 | 3300011119 | Bacteria | 8027 |
| 238 | Ga0105246_10117613 | 3300011119 | Bacteria | 1964 |
| 239 | Ga0105246_10214512 | 3300011119 | Bacteria | 1504 |
| 240 | Ga0105246_10372388 | 3300011119 | Bacteria | 1177 |
| 241 | Ga0105246_10842591 | 3300011119 | Bacteria | 817 |
| 242 | Ga0157373_10130680 | 3300013100 | Bacteria | 1766 |
| 243 | Ga0157371_10037614 | 3300013102 | Bacteria | 3463 |
| 244 | Ga0157370_10023260 | 3300013104 | Bacteria | 6153 |
| 245 | Ga0157370_10079949 | 3300013104 | Bacteria | 3079 |
| 246 | Ga0157370_10124200 | 3300013104 | Bacteria | 2410 |
| 247 | Ga0157370_10140192 | 3300013104 | Bacteria | 2253 |
| 248 | Ga0157369_10001511 | 3300013105 | Bacteria | 28540 |
| 249 | Ga0157374_10139727 | 3300013296 | Bacteria | 2351 |
| 250 | Ga0157378_10351344 | 3300013297 | Bacteria | 1440 |
| 251 | Ga0157378_10407304 | 3300013297 | Bacteria | 1341 |
| 252 | Ga0157378_10421925 | 3300013297 | Bacteria | 1319 |
| 253 | Ga0157378_11208769 | 3300013297 | Bacteria | 795 |
| 254 | Ga0163162_10116570 | 3300013306 | Bacteria | 2772 |
| 255 | Ga0163162_10166483 | 3300013306 | Bacteria | 2328 |
| 256 | Ga0163162_10373550 | 3300013306 | Bacteria | 1559 |
| 257 | Ga0163162_10650546 | 3300013306 | Bacteria | 1178 |
| 258 | Ga0157372_10040215 | 3300013307 | Bacteria | 5163 |
| 259 | Ga0157375_10231803 | 3300013308 | Bacteria | 2005 |
| 260 | Ga0157375_10320471 | 3300013308 | Bacteria | 1715 |
| 261 | Ga0163163_10264855 | 3300014325 | Bacteria | 1770 |
| 262 | Ga0163163_10591191 | 3300014325 | Bacteria | 1173 |
| 263 | Ga0163163_11050540 | 3300014325 | Bacteria | 878 |
| 264 | Ga0157380_10364798 | 3300014326 | Bacteria | 1357 |
| 265 | Ga0157380_10404689 | 3300014326 | Bacteria | 1296 |
| 266 | Ga0157380_10657898 | 3300014326 | Bacteria | 1046 |
| 267 | Ga0157379_10549392 | 3300014968 | Bacteria | 1074 |
| 268 | Ga0157379_10796082 | 3300014968 | Bacteria | 892 |
| 269 | Ga0157376_10558919 | 3300014969 | Bacteria | 1133 |
| 270 | Ga0182007_10106263 | 3300015262 | Bacteria | 932 |
| 271 | Ga0163161_10170239 | 3300017792 | Bacteria | 1665 |
| 272 | Ga0163161_10664779 | 3300017792 | Bacteria | 864 |
| 273 | Ga0214544_1000016 | 3300021320 | Bacteria | 204278 |
| 274 | Ga0214542_1000016 | 3300021321 | Bacteria | 210332 |
| 275 | Ga0214545_1000008 | 3300021324 | Bacteria | 215190 |
| 276 | Ga0214543_1001466 | 3300021327 | Bacteria | 45567 |
| 277 | Ga0213872_10028176 | 3300021361 | Bacteria | 2577 |
| 278 | Ga0213874_10006393 | 3300021377 | Bacteria | 2789 |
| 279 | Ga0213874_10142192 | 3300021377 | Bacteria | 831 |
| 280 | Ga0207656_10040764 | 3300025321 | Bacteria | 1970 |
| 281 | Ga0207656_10059443 | 3300025321 | Bacteria | 1673 |
| 282 | Ga0207692_10046169 | 3300025898 | Bacteria | 2183 |
| 283 | Ga0207642_10039639 | 3300025899 | Bacteria | 2049 |
| 284 | Ga0207710_10048533 | 3300025900 | Bacteria | 1900 |
| 285 | Ga0207710_10165869 | 3300025900 | Bacteria | 1078 |
| 286 | Ga0207710_10346458 | 3300025900 | Bacteria | 756 |
| 287 | Ga0207688_10037124 | 3300025901 | Bacteria | 2701 |
| 288 | Ga0207688_10112404 | 3300025901 | Bacteria | 1582 |
| 289 | Ga0207688_10113812 | 3300025901 | Bacteria | 1573 |
| 290 | Ga0207699_10003164 | 3300025906 | Bacteria | 7824 |
| 291 | Ga0207699_10017915 | 3300025906 | Bacteria | 3742 |
| 292 | Ga0207645_10084239 | 3300025907 | Bacteria | 2040 |
| 293 | Ga0207643_10026615 | 3300025908 | Bacteria | 3202 |
| 294 | Ga0207705_10592809 | 3300025909 | Bacteria | 862 |
| 295 | Ga0207705_10998734 | 3300025909 | Bacteria | 647 |
| 296 | Ga0207684_10108541 | 3300025910 | Bacteria | 2375 |
| 297 | Ga0207654_10000058 | 3300025911 | Bacteria | 75628 |
| 298 | Ga0207654_10272128 | 3300025911 | Bacteria | 1143 |
| 299 | Ga0207707_10004287 | 3300025912 | Bacteria | 12624 |
| 300 | Ga0207695_10000453 | 3300025913 | Bacteria | 89314 |
| 301 | Ga0207695_10015308 | 3300025913 | Bacteria | 9037 |
| 302 | Ga0207695_10169815 | 3300025913 | Bacteria | 2107 |
| 303 | Ga0207671_10112870 | 3300025914 | Bacteria | 2069 |
| 304 | Ga0207671_10230893 | 3300025914 | Bacteria | 1451 |
| 305 | Ga0207671_10264270 | 3300025914 | Bacteria | 1355 |
| 306 | Ga0207671_10406284 | 3300025914 | Bacteria | 1083 |
| 307 | Ga0207693_10013676 | 3300025915 | Bacteria | 6537 |
| 308 | Ga0207693_10028589 | 3300025915 | Bacteria | 4406 |
| 309 | Ga0207693_10384341 | 3300025915 | Unclassified | 1098 |
| 310 | Ga0207663_10197353 | 3300025916 | Bacteria | 1449 |
| 311 | Ga0207660_10001366 | 3300025917 | Bacteria | 16351 |
| 312 | Ga0207657_10001686 | 3300025919 | Bacteria | 23826 |
| 313 | Ga0207657_10247870 | 3300025919 | Bacteria | 1421 |
| 314 | Ga0207649_10094472 | 3300025920 | Bacteria | 1965 |
| 315 | Ga0207649_10583769 | 3300025920 | Bacteria | 858 |
| 316 | Ga0207652_10118808 | 3300025921 | Bacteria | 2350 |
| 317 | Ga0207652_10318114 | 3300025921 | Bacteria | 1405 |
| 318 | Ga0207646_10095001 | 3300025922 | Bacteria | 2670 |
| 319 | Ga0207694_10001512 | 3300025924 | Bacteria | 19799 |
| 320 | Ga0207694_10053306 | 3300025924 | Bacteria | 3136 |
| 321 | Ga0207659_10238898 | 3300025926 | Bacteria | 1469 |
| 322 | Ga0207687_10012464 | 3300025927 | Bacteria | 5554 |
| 323 | Ga0207687_10801348 | 3300025927 | Bacteria | 803 |
| 324 | Ga0207700_10001418 | 3300025928 | Bacteria | 13613 |
| 325 | Ga0207700_10021571 | 3300025928 | Bacteria | 4401 |
| 326 | Ga0207700_10061793 | 3300025928 | Bacteria | 2842 |
| 327 | Ga0207700_10155228 | 3300025928 | Bacteria | 1896 |
| 328 | Ga0207700_10342849 | 3300025928 | Bacteria | 1299 |
| 329 | Ga0207700_10850491 | 3300025928 | Bacteria | 816 |
| 330 | Ga0207664_10036266 | 3300025929 | Bacteria | 3811 |
| 331 | Ga0207664_10051603 | 3300025929 | Bacteria | 3249 |
| 332 | Ga0207664_10192569 | 3300025929 | Bacteria | 1756 |
| 333 | Ga0207644_10044608 | 3300025931 | Bacteria | 3151 |
| 334 | Ga0207644_10113029 | 3300025931 | Bacteria | 2056 |
| 335 | Ga0207644_10193983 | 3300025931 | Bacteria | 1598 |
| 336 | Ga0207690_10344343 | 3300025932 | Bacteria | 1177 |
| 337 | Ga0207706_10198707 | 3300025933 | Bacteria | 1759 |
| 338 | Ga0207706_10275241 | 3300025933 | Bacteria | 1469 |
| 339 | Ga0207706_10576759 | 3300025933 | Bacteria | 967 |
| 340 | Ga0207686_10352073 | 3300025934 | Bacteria | 1109 |
| 341 | Ga0207709_10149746 | 3300025935 | Bacteria | 1615 |
| 342 | Ga0207709_10507424 | 3300025935 | Bacteria | 942 |
| 343 | Ga0207709_10745270 | 3300025935 | Bacteria | 787 |
| 344 | Ga0207709_10929266 | 3300025935 | Bacteria | 708 |
| 345 | Ga0207670_10117959 | 3300025936 | Bacteria | 1924 |
| 346 | Ga0207704_10131323 | 3300025938 | Bacteria | 1735 |
| 347 | Ga0207704_10621507 | 3300025938 | Bacteria | 887 |
| 348 | Ga0207665_10006611 | 3300025939 | Bacteria | 7690 |
| 349 | Ga0207665_10009684 | 3300025939 | Bacteria | 6325 |
| 350 | Ga0207691_10040766 | 3300025940 | Bacteria | 4289 |
| 351 | Ga0207691_10086631 | 3300025940 | Bacteria | 2810 |
| 352 | Ga0207711_10074404 | 3300025941 | Bacteria | 2954 |
| 353 | Ga0207711_10256754 | 3300025941 | Bacteria | 1606 |
| 354 | Ga0207711_10272176 | 3300025941 | Bacteria | 1558 |
| 355 | Ga0207689_10124850 | 3300025942 | Bacteria | 2117 |
| 356 | Ga0207661_10063954 | 3300025944 | Bacteria | 2981 |
| 357 | Ga0207661_11058632 | 3300025944 | Bacteria | 747 |
| 358 | Ga0207679_10505844 | 3300025945 | Bacteria | 1079 |
| 359 | Ga0207667_10002324 | 3300025949 | Bacteria | 23814 |
| 360 | Ga0207667_10015224 | 3300025949 | Bacteria | 8745 |
| 361 | Ga0207667_10033395 | 3300025949 | Bacteria | 5531 |
| 362 | Ga0207667_10488784 | 3300025949 | Bacteria | 1249 |
| 363 | Ga0207667_10901392 | 3300025949 | Bacteria | 876 |
| 364 | Ga0207651_10933308 | 3300025960 | Bacteria | 774 |
| 365 | Ga0207712_10096412 | 3300025961 | Bacteria | 2189 |
| 366 | Ga0207712_10462446 | 3300025961 | Bacteria | 1078 |
| 367 | Ga0207668_10089525 | 3300025972 | Bacteria | 2256 |
| 368 | Ga0207668_10125277 | 3300025972 | Bacteria | 1952 |
| 369 | Ga0207668_10199380 | 3300025972 | Bacteria | 1592 |
| 370 | Ga0207668_10215261 | 3300025972 | Bacteria | 1539 |
| 371 | Ga0207640_10070630 | 3300025981 | Bacteria | 2349 |
| 372 | Ga0207640_10076689 | 3300025981 | Bacteria | 2270 |
| 373 | Ga0207658_10077192 | 3300025986 | Bacteria | 2541 |
| 374 | Ga0207658_10843502 | 3300025986 | Bacteria | 833 |
| 375 | Ga0207677_10232797 | 3300026023 | Bacteria | 1485 |
| 376 | Ga0207677_10774625 | 3300026023 | Bacteria | 857 |
| 377 | Ga0207703_10139249 | 3300026035 | Bacteria | 2104 |
| 378 | Ga0207703_10151133 | 3300026035 | Bacteria | 2025 |
| 379 | Ga0207703_10524942 | 3300026035 | Bacteria | 1114 |
| 380 | Ga0207703_10700143 | 3300026035 | Bacteria | 963 |
| 381 | Ga0207639_10002317 | 3300026041 | Bacteria | 12780 |
| 382 | Ga0207639_10074649 | 3300026041 | Bacteria | 2663 |
| 383 | Ga0207639_10260361 | 3300026041 | Bacteria | 1517 |
| 384 | Ga0207639_10681899 | 3300026041 | Bacteria | 952 |
| 385 | Ga0207639_10893142 | 3300026041 | Bacteria | 830 |
| 386 | Ga0207678_10004832 | 3300026067 | Bacteria | 12098 |
| 387 | Ga0207678_10033003 | 3300026067 | Bacteria | 4511 |
| 388 | Ga0207678_10039914 | 3300026067 | Bacteria | 4072 |
| 389 | Ga0207678_10051427 | 3300026067 | Bacteria | 3557 |
| 390 | Ga0207678_10138078 | 3300026067 | Bacteria | 2080 |
| 391 | Ga0207708_10160385 | 3300026075 | Bacteria | 1776 |
| 392 | Ga0207708_10255758 | 3300026075 | Bacteria | 1412 |
| 393 | Ga0207702_10000004 | 3300026078 | Bacteria | 422182 |
| 394 | Ga0207702_10001701 | 3300026078 | Bacteria | 21732 |
| 395 | Ga0207702_10246470 | 3300026078 | Bacteria | 1676 |
| 396 | Ga0207702_10507957 | 3300026078 | Bacteria | 1176 |
| 397 | Ga0207641_10130986 | 3300026088 | Bacteria | 2252 |
| 398 | Ga0207648_10027306 | 3300026089 | Bacteria | 5069 |
| 399 | Ga0207674_10046110 | 3300026116 | Bacteria | 4478 |
| 400 | Ga0207674_10050784 | 3300026116 | Bacteria | 4235 |
| 401 | Ga0207674_10175241 | 3300026116 | Bacteria | 2097 |
| 402 | Ga0207675_100101390 | 3300026118 | Bacteria | 2712 |
| 403 | Ga0207675_100167244 | 3300026118 | Bacteria | 2100 |
| 404 | Ga0207675_100272050 | 3300026118 | Bacteria | 1644 |
| 405 | Ga0207683_10115556 | 3300026121 | Bacteria | 2405 |
| 406 | Ga0207683_10125927 | 3300026121 | Bacteria | 2302 |
| 407 | Ga0207683_10175440 | 3300026121 | Bacteria | 1942 |
| 408 | Ga0207683_10310250 | 3300026121 | Bacteria | 1444 |
| 409 | Ga0207683_10534210 | 3300026121 | Bacteria | 1084 |
| 410 | Ga0207698_10495249 | 3300026142 | Bacteria | 1188 |
| 411 | Ga0207698_10803187 | 3300026142 | Bacteria | 943 |
| 412 | Ga0209589_1000021 | 3300027357 | Bacteria | 186431 |
| 413 | Ga0209489_100028 | 3300027361 | Bacteria | 186431 |
| 414 | Ga0209700_100037 | 3300027363 | Bacteria | 186431 |
| 415 | Ga0209179_1030015 | 3300027512 | Bacteria | 1109 |
| 416 | Ga0209588_1003941 | 3300027671 | Bacteria | 4150 |
| 417 | Ga0209588_1048049 | 3300027671 | Bacteria | 1380 |
| 418 | Ga0207428_10287250 | 3300027907 | Bacteria | 1220 |
| 419 | Ga0268266_10001190 | 3300028379 | Bacteria | 32120 |
| 420 | Ga0268266_10026048 | 3300028379 | Bacteria | 4974 |
| 421 | Ga0268266_10476481 | 3300028379 | Bacteria | 1189 |
| 422 | Ga0268266_10700181 | 3300028379 | Bacteria | 976 |
| 423 | Ga0268266_10731636 | 3300028379 | Bacteria | 954 |
| 424 | Ga0268265_10154937 | 3300028380 | Bacteria | 1937 |
| 425 | Ga0268265_10192622 | 3300028380 | Bacteria | 1762 |
| 426 | Ga0268265_10332195 | 3300028380 | Bacteria | 1381 |
| 427 | Ga0268265_10916809 | 3300028380 | Bacteria | 861 |
| 428 | Ga0268264_10000062 | 3300028381 | Bacteria | 302110 |
| 429 | Ga0268264_10675374 | 3300028381 | Bacteria | 1024 |
| 430 | Ga0265760_10108075 | 3300031090 | Bacteria | 884 |
| 431 | Ga0265330_10097393 | 3300031235 | Bacteria | 1260 |
| 432 | Ga0265330_10119124 | 3300031235 | Bacteria | 1125 |
| 433 | Ga0265332_10011743 | 3300031238 | Bacteria | 3890 |
| 434 | Ga0265325_10010784 | 3300031241 | Bacteria | 5272 |
| 435 | Ga0265339_10001062 | 3300031249 | Bacteria | 20880 |
| 436 | Ga0265331_10242966 | 3300031250 | Bacteria | 808 |
| 437 | Ga0265316_10085292 | 3300031344 | Bacteria | 2417 |
| 438 | Ga0265316_10153298 | 3300031344 | Bacteria | 1725 |
| 439 | Ga0307513_10530039 | 3300031456 | Bacteria | 892 |
| 440 | Ga0307509_10067311 | 3300031507 | Bacteria | 3752 |
| 441 | Ga0307509_10080587 | 3300031507 | Bacteria | 3366 |
| 442 | Ga0307509_10135766 | 3300031507 | Bacteria | 2406 |
| 443 | Ga0265313_10036979 | 3300031595 | Bacteria | 2447 |
| 444 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 445 | Ga0307508_10020190 | 3300031616 | Bacteria | 6052 |
| 446 | Ga0307508_10234793 | 3300031616 | Bacteria | 1431 |
| 447 | Ga0307508_10360973 | 3300031616 | Bacteria | 1043 |
| 448 | Ga0265314_10042090 | 3300031711 | Bacteria | 3262 |
| 449 | Ga0265314_10290674 | 3300031711 | Bacteria | 921 |
| 450 | Ga0307516_10008308 | 3300031730 | Bacteria | 11766 |
| 451 | Ga0307516_10022504 | 3300031730 | Bacteria | 6470 |
| 452 | Ga0307516_10093671 | 3300031730 | Bacteria | 2829 |
| 453 | Ga0307516_10150525 | 3300031730 | Bacteria | 2088 |
| 454 | Ga0307516_10258910 | 3300031730 | Bacteria | 1431 |
| 455 | Ga0307416_100387171 | 3300032002 | Bacteria | 1431 |
| 456 | Ga0307416_100779764 | 3300032002 | Bacteria | 1050 |
| 457 | Ga0307414_10502419 | 3300032004 | Bacteria | 1073 |
| 458 | Ga0307411_10334911 | 3300032005 | Bacteria | 1228 |
| 459 | Ga0307507_10019178 | 3300033179 | Bacteria | 7716 |
| 460 | Ga0307510_10001271 | 3300033180 | Bacteria | 27493 |
| 461 | Ga0307510_10037056 | 3300033180 | Bacteria | 5418 |
| 462 | Ga0307510_10257573 | 3300033180 | Bacteria | 1228 |
| 463 | Ga0307510_10352771 | 3300033180 | Bacteria | 921 |
| 464 | Ga0316215_1016178 | 3300033544 | Bacteria | 751 |
| 465 | Ga0373929_0025129 | 3300035085 | Bacteria | 1235 |
| 466 | Ga0373934_0002347 | 3300035086 | Bacteria | 6965 |
| 467 | Ga0373934_0138358 | 3300035086 | Bacteria | 995 |
| 468 | Ga0373953_0009436 | 3300035117 | Bacteria | 3358 |
| 469 | Ga0373954_0000883 | 3300035118 | Bacteria | 11661 |
| 470 | Ga0373957_0001330 | 3300035120 | Bacteria | 6639 |
| 471 | Ga0373957_0003010 | 3300035120 | Bacteria | 4895 |
| 472 | Ga0373960_0045134 | 3300035121 | Bacteria | 1289 |
| 473 | Ga0373943_0050697 | 3300035170 | Bacteria | 2041 |
| 474 | Ga0373943_0134359 | 3300035170 | Bacteria | 1327 |
| 475 | Ga0373955_0001067 | 3300035172 | Bacteria | 11681 |
| 476 | Ga0373942_0010998 | 3300035207 | Bacteria | 2138 |
| 477 | Ga0373961_0028592 | 3300035241 | Bacteria | 1538 |
| 478 | Ga0373924_0005686 | 3300035410 | Bacteria | 4425 |
| 479 | Ga0373924_0059871 | 3300035410 | Bacteria | 1591 |
| 480 | Ga0373931_0004670 | 3300035691 | Bacteria | 6269 |
| 481 | Ga0373931_0017858 | 3300035691 | Bacteria | 3516 |
| 482 | Ga0373931_0191093 | 3300035691 | Bacteria | 1218 |
| 483 | Ga0373935_0317980 | 3300035692 | Bacteria | 1104 |
| 484 | Ga0373927_0029245 | 3300035695 | Bacteria | 3590 |
| 485 | Ga0373927_0114291 | 3300035695 | Bacteria | 1759 |
| 486 | Ga0373927_0125611 | 3300035695 | Bacteria | 1675 |
| 487 | Ga0373933_0000031 | 3300035724 | Bacteria | 85038 |
| 488 | Ga0373933_0001638 | 3300035724 | Bacteria | 13046 |
| 489 | Ga0373933_0063631 | 3300035724 | Bacteria | 2230 |
| 490 | Ga0373947_0177924 | 3300035725 | Bacteria | 1383 |
| 491 | Ga0373937_0022664 | 3300036401 | Bacteria | 5648 |
| 492 | Ga0373937_0064731 | 3300036401 | Bacteria | 3363 |
| 493 | Ga0373937_0728202 | 3300036401 | Bacteria | 939 |
| 494 | Ga0373925_0011818 | 3300037068 | Bacteria | 6317 |
| 495 | Ga0373925_0021659 | 3300037068 | Bacteria | 4685 |
| 496 | Ga0373925_0045376 | 3300037068 | Bacteria | 3265 |
| 497 | Ga0373925_0205311 | 3300037068 | Bacteria | 1568 |
| 498 | Ga0373925_0254469 | 3300037068 | Bacteria | 1409 |
| 499 | Ga0395899_0157553 | 3300037312 | Bacteria | 1606 |
| 500 | Ga0395900_0010780 | 3300037418 | Bacteria | 9350 |
| 501 | Ga0395898_0157786 | 3300037466 | Bacteria | 2170 |
| 502 | Ga0395905_0707422 | 3300037471 | Bacteria | 910 |
| 503 | Ga0395901_0246919 | 3300038443 | Bacteria | 1860 |
| 504 | Ga0436365_1482520 | 3300039437 | Bacteria | 799 |
| 505 | Ga0436360_0322292 | 3300039438 | Bacteria | 1129 |
| 506 | Ga0436360_1064441 | 3300039438 | Bacteria | 1239 |
| 507 | Ga0436361_0097947 | 3300039447 | Bacteria | 1385 |
| 508 | Ga0436361_0681508 | 3300039447 | Bacteria | 2409 |
| 509 | Ga0436361_0875210 | 3300039447 | Unclassified | 2010 |
| 510 | Ga0436363_0863782 | 3300039450 | Bacteria | 5485 |
| 511 | Ga0436363_1043665 | 3300039450 | Bacteria | 4147 |
| 512 | Ga0436363_1148766 | 3300039450 | Bacteria | 3575 |
| 513 | Ga0436362_1113554 | 3300039453 | Bacteria | 1142 |
| 514 | Ga0451795_0763978 | 3300041456 | Bacteria | 706 |
| 515 | Ga0451800_0177409 | 3300041459 | Bacteria | 682 |
| 516 | Ga0451855_0967751 | 3300041511 | Bacteria | 730 |
| 517 | Ga0466970_0080158 | 3300044765 | Bacteria | 1764 |
| 518 | Ga0495592_0003085 | 3300046454 | Bacteria | 11889 |
| 519 | Ga0495603_0022882 | 3300046455 | Bacteria | 3782 |
| 520 | Ga0495603_0041392 | 3300046455 | Bacteria | 2755 |
| 521 | Ga0495603_0228551 | 3300046455 | Bacteria | 1073 |
| 522 | Ga0495629_0001972 | 3300046459 | Bacteria | 15994 |
| 523 | Ga0495629_0291853 | 3300046459 | Bacteria | 1118 |
| 524 | Ga0495638_0165373 | 3300046460 | Bacteria | 1273 |
| 525 | Ga0495638_0420853 | 3300046460 | Bacteria | 688 |
| 526 | Ga0495651_0113671 | 3300046462 | Bacteria | 1998 |
| 527 | Ga0495653_0002188 | 3300046463 | Bacteria | 15461 |
| 528 | Ga0495650_0044198 | 3300046471 | Bacteria | 1885 |
| 529 | Ga0495580_0070458 | 3300046472 | Bacteria | 2443 |
| 530 | Ga0495580_0404100 | 3300046472 | Bacteria | 921 |
| 531 | Ga0495639_0073083 | 3300046475 | Bacteria | 1587 |
| 532 | Ga0495639_0080665 | 3300046475 | Bacteria | 1515 |
| 533 | Ga0495639_0248718 | 3300046475 | Bacteria | 879 |
| 534 | Ga0495584_0084814 | 3300046491 | Bacteria | 1595 |
| 535 | Ga0495584_0227340 | 3300046491 | Bacteria | 948 |
| 536 | Ga0495584_0275155 | 3300046491 | Bacteria | 856 |
| 537 | Ga0495584_0327240 | 3300046491 | Bacteria | 778 |
| 538 | Ga0495585_0062573 | 3300046492 | Bacteria | 2044 |
| 539 | Ga0495585_0415798 | 3300046492 | Bacteria | 646 |
| 540 | Ga0495594_0207286 | 3300046499 | Bacteria | 1117 |
| 541 | Ga0495606_0000252 | 3300046507 | Bacteria | 94511 |
| 542 | Ga0495608_0030843 | 3300046511 | Bacteria | 3626 |
| 543 | Ga0495618_0520896 | 3300046514 | Bacteria | 715 |
| 544 | Ga0495620_0070873 | 3300046515 | Bacteria | 1427 |
| 545 | Ga0495628_0020336 | 3300046516 | Bacteria | 5478 |
| 546 | Ga0495630_0584040 | 3300046517 | Bacteria | 857 |
| 547 | Ga0495631_0046368 | 3300046518 | Bacteria | 1911 |
| 548 | Ga0495631_0138713 | 3300046518 | Bacteria | 1044 |
| 549 | Ga0495637_0090251 | 3300046520 | Bacteria | 1210 |
| 550 | Ga0495644_0077902 | 3300046523 | Bacteria | 1249 |
| 551 | Ga0495648_0000286 | 3300046524 | Bacteria | 57430 |
| 552 | Ga0495648_0046985 | 3300046524 | Bacteria | 2672 |
| 553 | Ga0495642_0145448 | 3300046528 | Bacteria | 1024 |
| 554 | Ga0495652_0018347 | 3300046529 | Bacteria | 6239 |
| 555 | Ga0495652_0098222 | 3300046529 | Bacteria | 2381 |
| 556 | Ga0495652_0553647 | 3300046529 | Bacteria | 790 |
| 557 | Ga0495640_0039130 | 3300046533 | Bacteria | 3330 |
| 558 | Ga0495586_0328230 | 3300046535 | Bacteria | 878 |
| 559 | Ga0495587_0023867 | 3300046536 | Bacteria | 3754 |
| 560 | Ga0495587_0068067 | 3300046536 | Bacteria | 2074 |
| 561 | Ga0495598_0088588 | 3300046537 | Bacteria | 1005 |
| 562 | Ga0495621_0096498 | 3300046539 | Bacteria | 1120 |
| 563 | Ga0495622_0049774 | 3300046557 | Bacteria | 1945 |
| 564 | Ga0495622_0075011 | 3300046557 | Bacteria | 1559 |
| 565 | Ga0495667_0002652 | 3300046559 | Bacteria | 11945 |
| 566 | Ga0495656_0034075 | 3300046615 | Bacteria | 2082 |
| 567 | Ga0495656_0416350 | 3300046615 | Bacteria | 705 |
| 568 | Ga0495668_0100889 | 3300046616 | Bacteria | 1579 |
| 569 | Ga0495668_0108076 | 3300046616 | Bacteria | 1521 |
| 570 | Ga0495634_0021849 | 3300046642 | Bacteria | 4516 |
| 571 | Ga0495634_0089382 | 3300046642 | Bacteria | 2002 |
| 572 | Ga0495625_0122049 | 3300046660 | Bacteria | 1772 |
| 573 | Ga0495625_0233480 | 3300046660 | Bacteria | 1200 |
| 574 | Ga0495625_0296762 | 3300046660 | Bacteria | 1035 |
| 575 | Ga0495635_0001078 | 3300046663 | Bacteria | 18109 |
| 576 | Ga0495661_0253461 | 3300046665 | Bacteria | 897 |
| 577 | Ga0495588_0146389 | 3300046674 | Bacteria | 1248 |
| 578 | Ga0495657_0010052 | 3300046675 | Bacteria | 7134 |
| 579 | Ga0495599_0001153 | 3300046678 | Bacteria | 14977 |
| 580 | Ga0495599_0093140 | 3300046678 | Bacteria | 1880 |
| 581 | Ga0495623_0016469 | 3300046679 | Bacteria | 4775 |
| 582 | Ga0495623_0062967 | 3300046679 | Bacteria | 2323 |
| 583 | Ga0495646_0004178 | 3300046680 | Bacteria | 9076 |
| 584 | Ga0495646_0127112 | 3300046680 | Bacteria | 1437 |
| 585 | Ga0495647_0011225 | 3300046681 | Bacteria | 3066 |
| 586 | Ga0495647_0097360 | 3300046681 | Bacteria | 1214 |
| 587 | Ga0495658_0018626 | 3300046683 | Bacteria | 3613 |
| 588 | Ga0495658_0618086 | 3300046683 | Bacteria | 694 |
| 589 | Ga0495669_0032781 | 3300046684 | Bacteria | 2284 |
| 590 | Ga0495613_0021524 | 3300046689 | Bacteria | 4805 |
| 591 | Ga0495613_0134706 | 3300046689 | Bacteria | 1768 |
| 592 | Ga0495613_0446315 | 3300046689 | Bacteria | 877 |
| 593 | Ga0495624_0118306 | 3300046690 | Bacteria | 1628 |
| 594 | Ga0495670_0435125 | 3300046691 | Bacteria | 710 |
| 595 | Ga0495600_0000311 | 3300046809 | Bacteria | 25806 |
| 596 | Ga0495600_0170914 | 3300046809 | Bacteria | 1403 |
| 597 | Ga0495660_0118977 | 3300046810 | Bacteria | 1339 |
| 598 | Ga0495581_0012670 | 3300047315 | Bacteria | 4886 |
| 599 | Ga0495581_0068323 | 3300047315 | Bacteria | 2055 |
| 600 | Ga0495581_0179658 | 3300047315 | Bacteria | 1237 |
| 601 | Ga0495604_0029213 | 3300047317 | Bacteria | 4385 |
| 602 | Ga0495604_0302957 | 3300047317 | Bacteria | 1073 |
| 603 | Ga0495636_0074437 | 3300047318 | Bacteria | 1455 |
| 604 | Ga0495636_0104856 | 3300047318 | Bacteria | 1239 |
| 605 | Ga0495636_0172527 | 3300047318 | Bacteria | 978 |
| 606 | Ga0495674_0010066 | 3300047319 | Bacteria | 8964 |
| 607 | Ga0495674_0153959 | 3300047319 | Bacteria | 1927 |
| 608 | Ga0495674_0590965 | 3300047319 | Bacteria | 880 |
| 609 | Ga0495672_0025202 | 3300047320 | Bacteria | 3813 |
| 610 | Ga0495672_0077897 | 3300047320 | Bacteria | 1856 |
| 611 | Ga0495672_0079700 | 3300047320 | Bacteria | 1828 |
| 612 | Ga0495672_0327498 | 3300047320 | Bacteria | 718 |
| 613 | Ga0495676_0095553 | 3300047321 | Bacteria | 2211 |
| 614 | Ga0495680_0015853 | 3300047322 | Bacteria | 6486 |
| 615 | Ga0495680_0104539 | 3300047322 | Bacteria | 2107 |
| 616 | Ga0495680_0296580 | 3300047322 | Bacteria | 1136 |
| 617 | Ga0495683_0339838 | 3300047323 | Bacteria | 636 |
| 618 | Ga0495675_0001437 | 3300047444 | Bacteria | 14419 |
| 619 | Ga0495675_0034682 | 3300047444 | Bacteria | 3221 |
| 620 | Ga0495677_0118251 | 3300047445 | Bacteria | 1010 |
| 621 | Ga0495673_0163463 | 3300047469 | Bacteria | 853 |
| 622 | Ga0495684_0000313 | 3300047471 | Bacteria | 39705 |
| 623 | Ga0495686_0088808 | 3300047472 | Bacteria | 1879 |
| 624 | Ga0495593_0000693 | 3300047673 | Bacteria | 19452 |
| 625 | Ga0495602_0002384 | 3300048088 | Bacteria | 19072 |
| 626 | Ga0495614_0149313 | 3300048089 | Bacteria | 1042 |
| 627 | Ga0495615_0130569 | 3300048090 | Bacteria | 734 |
| 628 | Ga0496100_0004117 | 3300048903 | Bacteria | 7668 |
| 629 | Ga0496100_0029796 | 3300048903 | Bacteria | 3379 |
| 630 | Ga0496100_0127025 | 3300048903 | Unclassified | 1791 |
| 631 | Ga0496101_0011916 | 3300048904 | Bacteria | 5791 |
| 632 | Ga0496101_0104409 | 3300048904 | Bacteria | 2125 |
| 633 | Ga0496101_0377482 | 3300048904 | Bacteria | 1115 |
| 634 | Ga0496102_0001314 | 3300048905 | Bacteria | 22298 |
| 635 | Ga0496102_0021069 | 3300048905 | Bacteria | 5765 |
| 636 | Ga0496102_0063855 | 3300048905 | Bacteria | 3372 |
| 637 | Ga0496102_0221475 | 3300048905 | Bacteria | 1784 |
| 638 | Ga0496102_0591648 | 3300048905 | Bacteria | 1032 |
| 639 | Ga0496102_0977100 | 3300048905 | Bacteria | 767 |
| 640 | Ga0496103_0028346 | 3300048906 | Bacteria | 3398 |
| 641 | Ga0496103_0234725 | 3300048906 | Bacteria | 1180 |
| 642 | Ga0496103_0537337 | 3300048906 | Bacteria | 747 |
| 643 | Ga0496103_0544326 | 3300048906 | Bacteria | 741 |
| 644 | Ga0496104_0016536 | 3300048907 | Bacteria | 6703 |
| 645 | Ga0496104_0110519 | 3300048907 | Bacteria | 2635 |
| 646 | Ga0496104_0114067 | 3300048907 | Unclassified | 2591 |
| 647 | Ga0496104_0433382 | 3300048907 | Bacteria | 1226 |
| 648 | Ga0496104_0471182 | 3300048907 | Bacteria | 1167 |
| 649 | Ga0496105_0014585 | 3300048908 | Bacteria | 6257 |
| 650 | Ga0496105_0258543 | 3300048908 | Bacteria | 1409 |
| 651 | Ga0496105_0520008 | 3300048908 | Bacteria | 932 |
| 652 | Ga0496106_0001014 | 3300048909 | Bacteria | 20581 |
| 653 | Ga0496106_0001270 | 3300048909 | Bacteria | 18908 |
| 654 | Ga0496106_0013577 | 3300048909 | Bacteria | 6012 |
| 655 | Ga0496106_0045060 | 3300048909 | Bacteria | 3312 |
| 656 | Ga0496106_0739610 | 3300048909 | Bacteria | 782 |
| 657 | Ga0496106_0952486 | 3300048909 | Bacteria | 676 |
| 658 | Ga0496107_0006262 | 3300048910 | Bacteria | 8180 |
| 659 | Ga0496107_0020391 | 3300048910 | Bacteria | 4681 |
| 660 | Ga0496107_0062092 | 3300048910 | Bacteria | 2706 |
| 661 | Ga0496107_0078321 | 3300048910 | Bacteria | 2408 |
| 662 | Ga0496107_0116730 | 3300048910 | Bacteria | 1965 |
| 663 | Ga0496107_0581617 | 3300048910 | Bacteria | 828 |
| 664 | Ga0496108_0000849 | 3300048911 | Bacteria | 23796 |
| 665 | Ga0496108_0012923 | 3300048911 | Bacteria | 6803 |
| 666 | Ga0496108_0034584 | 3300048911 | Bacteria | 4199 |
| 667 | Ga0496109_0000224 | 3300048912 | Bacteria | 55854 |
| 668 | Ga0496109_0064106 | 3300048912 | Bacteria | 3362 |
| 669 | Ga0496109_0100121 | 3300048912 | Bacteria | 2688 |
| 670 | Ga0496109_0133100 | 3300048912 | Unclassified | 2322 |
| 671 | Ga0496109_0184618 | 3300048912 | Bacteria | 1959 |
| 672 | Ga0496110_0023127 | 3300048913 | Bacteria | 5285 |
| 673 | Ga0496110_0026371 | 3300048913 | Bacteria | 4972 |
| 674 | Ga0496110_0046440 | 3300048913 | Bacteria | 3800 |
| 675 | Ga0496110_0058608 | 3300048913 | Bacteria | 3392 |
| 676 | Ga0496110_0093478 | 3300048913 | Bacteria | 2692 |
| 677 | Ga0496110_0150730 | 3300048913 | Bacteria | 2106 |
| 678 | Ga0496110_0269459 | 3300048913 | Bacteria | 1550 |
| 679 | Ga0496111_0035701 | 3300048914 | Bacteria | 3554 |
| 680 | Ga0496111_0144330 | 3300048914 | Bacteria | 1764 |
| 681 | Ga0496111_0176000 | 3300048914 | Bacteria | 1590 |
| 682 | Ga0496111_0390171 | 3300048914 | Bacteria | 1029 |
| 683 | Ga0496112_0000020 | 3300048915 | Bacteria | 169373 |
| 684 | Ga0496112_0001044 | 3300048915 | Bacteria | 20400 |
| 685 | Ga0496112_0067958 | 3300048915 | Bacteria | 3518 |
| 686 | Ga0496112_0227478 | 3300048915 | Unclassified | 1820 |
| 687 | Ga0496112_0233518 | 3300048915 | Bacteria | 1793 |
| 688 | Ga0496112_0263016 | 3300048915 | Bacteria | 1674 |
| 689 | Ga0496112_0414855 | 3300048915 | Bacteria | 1285 |
| 690 | Ga0496112_0618856 | 3300048915 | Bacteria | 1014 |
| 691 | Ga0496113_0008868 | 3300048916 | Bacteria | 6576 |
| 692 | Ga0496113_0025475 | 3300048916 | Bacteria | 4216 |
| 693 | Ga0496113_0060373 | 3300048916 | Bacteria | 2858 |
| 694 | Ga0496113_0147382 | 3300048916 | Bacteria | 1855 |
| 695 | Ga0496114_0022004 | 3300048917 | Bacteria | 5191 |
| 696 | Ga0496114_0079926 | 3300048917 | Bacteria | 2761 |
| 697 | Ga0496114_0109926 | 3300048917 | Bacteria | 2361 |
| 698 | Ga0496114_0161137 | 3300048917 | Bacteria | 1951 |
| 699 | Ga0496114_0332875 | 3300048917 | Bacteria | 1342 |
| 700 | Ga0496114_0483655 | 3300048917 | Bacteria | 1095 |
| 701 | Ga0496115_0006071 | 3300048918 | Bacteria | 8821 |
| 702 | Ga0496115_0027439 | 3300048918 | Bacteria | 4453 |
| 703 | Ga0496115_0071898 | 3300048918 | Bacteria | 2806 |
| 704 | Ga0496115_0151845 | 3300048918 | Bacteria | 1913 |
| 705 | Ga0496118_0003026 | 3300048921 | Bacteria | 21707 |
| 706 | Ga0496119_0155543 | 3300048922 | Bacteria | 1221 |
| 707 | Ga0496120_0055668 | 3300048923 | Bacteria | 2235 |
| 708 | Ga0496120_0278171 | 3300048923 | Bacteria | 775 |
| 709 | Ga0496121_0000270 | 3300048924 | Bacteria | 108787 |
| 710 | Ga0496121_0000370 | 3300048924 | Bacteria | 92397 |
| 711 | Ga0496121_0063812 | 3300048924 | Bacteria | 3006 |
| 712 | Ga0496121_0096674 | 3300048924 | Bacteria | 2291 |
| 713 | Ga0496121_0410221 | 3300048924 | Bacteria | 884 |
| 714 | Ga0496121_0431766 | 3300048924 | Bacteria | 854 |
| 715 | Ga0496121_0435343 | 3300048924 | Bacteria | 849 |
| 716 | Ga0496121_0444230 | 3300048924 | Bacteria | 837 |
| 717 | Ga0496121_0458429 | 3300048924 | Bacteria | 820 |
| 718 | Ga0496124_0009011 | 3300048927 | Bacteria | 10323 |
| 719 | Ga0496124_0137096 | 3300048927 | Bacteria | 1936 |
| 720 | Ga0496125_0023759 | 3300048928 | Bacteria | 5651 |
| 721 | Ga0496125_0057775 | 3300048928 | Bacteria | 3139 |
| 722 | Ga0496125_0150436 | 3300048928 | Bacteria | 1600 |
| 723 | Ga0496126_0012762 | 3300048929 | Bacteria | 8587 |
| 724 | Ga0496126_0022058 | 3300048929 | Bacteria | 6204 |
| 725 | Ga0496126_0069770 | 3300048929 | Bacteria | 3133 |
| 726 | Ga0496126_0252728 | 3300048929 | Bacteria | 1468 |
| 727 | Ga0496126_0265135 | 3300048929 | Bacteria | 1427 |
| 728 | Ga0496126_0435657 | 3300048929 | Bacteria | 1057 |
| 729 | Ga0496126_0877987 | 3300048929 | Bacteria | 682 |
| 730 | Ga0495682_0154637 | 3300049460 | Bacteria | 818 |
| 731 | Ga0495682_0174372 | 3300049460 | Bacteria | 765 |
| 732 | Ga0501031_0002683 | 3300049568 | Bacteria | 11328 |
| 733 | Ga0501031_0009291 | 3300049568 | Bacteria | 6390 |
| 734 | Ga0501031_0071293 | 3300049568 | Bacteria | 2263 |
| 735 | Ga0501032_0000475 | 3300049569 | Bacteria | 32423 |
| 736 | Ga0501032_0008230 | 3300049569 | Bacteria | 7602 |
| 737 | Ga0501032_0031443 | 3300049569 | Bacteria | 3640 |
| 738 | Ga0501032_0047597 | 3300049569 | Bacteria | 2895 |
| 739 | Ga0501033_0000440 | 3300049570 | Bacteria | 39822 |
| 740 | Ga0501033_0001499 | 3300049570 | Bacteria | 20673 |
| 741 | Ga0501033_0075636 | 3300049570 | Bacteria | 2471 |
| 742 | Ga0501033_0078940 | 3300049570 | Bacteria | 2415 |
| 743 | Ga0501033_0409966 | 3300049570 | Bacteria | 944 |
| 744 | Ga0501034_0000250 | 3300049571 | Bacteria | 99407 |
| 745 | Ga0501034_0497538 | 3300049571 | Bacteria | 1133 |
| 746 | Ga0501034_0721136 | 3300049571 | Bacteria | 894 |
| 747 | Ga0501036_0000098 | 3300049572 | Bacteria | 54252 |
| 748 | Ga0501036_0086684 | 3300049572 | Bacteria | 2646 |
| 749 | Ga0501036_0150031 | 3300049572 | Bacteria | 1966 |
| 750 | Ga0501036_0647484 | 3300049572 | Bacteria | 875 |
| 751 | Ga0501037_0000092 | 3300049573 | Bacteria | 83924 |
| 752 | Ga0501037_0006812 | 3300049573 | Bacteria | 8353 |
| 753 | Ga0501037_0130753 | 3300049573 | Bacteria | 1800 |
| 754 | Ga0501038_0000059 | 3300049574 | Bacteria | 92319 |
| 755 | Ga0501038_0024694 | 3300049574 | Bacteria | 5358 |
| 756 | Ga0501038_0053622 | 3300049574 | Bacteria | 3470 |
| 757 | Ga0501038_0659709 | 3300049574 | Bacteria | 787 |
| 758 | Ga0501039_0000085 | 3300049575 | Bacteria | 70306 |
| 759 | Ga0501039_0031807 | 3300049575 | Bacteria | 4068 |
| 760 | Ga0501039_0041308 | 3300049575 | Bacteria | 3561 |
| 761 | Ga0501039_0056725 | 3300049575 | Bacteria | 3034 |
| 762 | Ga0501039_0571167 | 3300049575 | Bacteria | 887 |
| 763 | Ga0501040_0007989 | 3300049576 | Bacteria | 6868 |
| 764 | Ga0501042_0007618 | 3300049578 | Bacteria | 7103 |
| 765 | Ga0501042_0023911 | 3300049578 | Bacteria | 4280 |
| 766 | Ga0501042_0366990 | 3300049578 | Bacteria | 1042 |
| 767 | Ga0501043_0001889 | 3300049579 | Bacteria | 17947 |
| 768 | Ga0501043_0012702 | 3300049579 | Bacteria | 6584 |
| 769 | Ga0501043_0035424 | 3300049579 | Bacteria | 3926 |
| 770 | Ga0501046_0000483 | 3300049580 | Bacteria | 39806 |
| 771 | Ga0501046_0150217 | 3300049580 | Bacteria | 1758 |
| 772 | Ga0501046_0424969 | 3300049580 | Bacteria | 958 |
| 773 | Ga0501047_0000022 | 3300049581 | Bacteria | 249062 |
| 774 | Ga0501047_0126511 | 3300049581 | Bacteria | 2436 |
| 775 | Ga0501047_0133801 | 3300049581 | Bacteria | 2359 |
| 776 | Ga0501047_0180989 | 3300049581 | Bacteria | 1974 |
| 777 | Ga0501047_0202195 | 3300049581 | Bacteria | 1847 |
| 778 | Ga0501047_0470642 | 3300049581 | Bacteria | 1085 |
| 779 | Ga0501047_0706463 | 3300049581 | Bacteria | 825 |
| 780 | Ga0501048_0000821 | 3300049582 | Bacteria | 22904 |
| 781 | Ga0501048_0004230 | 3300049582 | Bacteria | 10938 |
| 782 | Ga0501067_0000510 | 3300049583 | Bacteria | 21249 |
| 783 | Ga0501068_0001239 | 3300049584 | Bacteria | 13551 |
| 784 | Ga0501068_0025351 | 3300049584 | Bacteria | 3488 |
| 785 | Ga0501069_0000707 | 3300049585 | Bacteria | 15581 |
| 786 | Ga0501070_0003250 | 3300049586 | Bacteria | 14106 |
| 787 | Ga0501070_0033229 | 3300049586 | Bacteria | 4316 |
| 788 | Ga0501070_0107792 | 3300049586 | Bacteria | 2302 |
| 789 | Ga0501070_0140836 | 3300049586 | Bacteria | 1991 |
| 790 | Ga0501070_0379836 | 3300049586 | Bacteria | 1144 |
| 791 | Ga0501070_0610973 | 3300049586 | Bacteria | 868 |
| 792 | Ga0501071_0517096 | 3300049587 | Bacteria | 916 |
| 793 | Ga0501072_0001923 | 3300049588 | Bacteria | 15457 |
| 794 | Ga0501072_0004304 | 3300049588 | Bacteria | 10811 |
| 795 | Ga0501072_0680925 | 3300049588 | Bacteria | 809 |
| 796 | Ga0501073_0000955 | 3300049589 | Bacteria | 20800 |
| 797 | Ga0501073_0046636 | 3300049589 | Bacteria | 3047 |
| 798 | Ga0501074_0002275 | 3300049590 | Bacteria | 13361 |
| 799 | Ga0501074_0006843 | 3300049590 | Bacteria | 8236 |
| 800 | Ga0501074_0044615 | 3300049590 | Bacteria | 3209 |
| 801 | Ga0501077_0438941 | 3300049593 | Bacteria | 836 |
| 802 | Ga0501079_0003103 | 3300049741 | Bacteria | 12169 |
| 803 | Ga0501079_0055474 | 3300049741 | Bacteria | 3058 |
| 804 | Ga0501080_0009878 | 3300049742 | Bacteria | 8717 |
| 805 | Ga0501080_0022030 | 3300049742 | Bacteria | 5902 |
| 806 | Ga0501080_0079680 | 3300049742 | Bacteria | 3045 |
| 807 | Ga0501083_0000808 | 3300049744 | Bacteria | 20535 |
| 808 | Ga0501083_0013360 | 3300049744 | Bacteria | 5741 |
| 809 | Ga0501035_0000240 | 3300049822 | Bacteria | 65635 |
| 810 | Ga0501035_0005844 | 3300049822 | Bacteria | 11604 |
| 811 | Ga0501035_0047034 | 3300049822 | Bacteria | 3876 |
| 812 | Ga0501035_0166741 | 3300049822 | Bacteria | 1904 |
| 813 | Ga0501035_0207315 | 3300049822 | Bacteria | 1678 |
| 814 | Ga0501035_0285637 | 3300049822 | Bacteria | 1393 |
| 815 | Ga0501035_0375815 | 3300049822 | Bacteria | 1186 |
| 816 | Ga0501035_0381406 | 3300049822 | Bacteria | 1175 |
| 817 | Ga0501044_0000072 | 3300049823 | Bacteria | 124143 |
| 818 | Ga0501044_0056754 | 3300049823 | Bacteria | 4020 |
| 819 | Ga0501044_0058319 | 3300049823 | Bacteria | 3959 |
| 820 | Ga0501044_0100513 | 3300049823 | Bacteria | 2910 |
| 821 | Ga0501044_0204541 | 3300049823 | Bacteria | 1931 |
| 822 | Ga0501044_0214585 | 3300049823 | Bacteria | 1877 |
| 823 | Ga0501044_0331868 | 3300049823 | Bacteria | 1443 |
| 824 | Ga0501044_0533877 | 3300049823 | Bacteria | 1072 |
| 825 | Ga0501044_0842248 | 3300049823 | Bacteria | 794 |
| 826 | Ga0501044_0960558 | 3300049823 | Bacteria | 727 |
| 827 | Ga0501045_0027715 | 3300049824 | Bacteria | 4084 |
| 828 | Ga0501045_0097380 | 3300049824 | Bacteria | 2176 |
| 829 | Ga0501045_0413779 | 3300049824 | Bacteria | 1003 |
| 830 | Ga0501045_0447216 | 3300049824 | Bacteria | 961 |
| 831 | nmdc:mga03n38_195224_c1 | 3300050490 | Bacteria | 1045 |
| 832 | nmdc:mga00v17_143307_c1 | 3300050491 | Bacteria | 1533 |
| 833 | nmdc:mga00v17_321809_c1 | 3300050491 | Bacteria | 1005 |
| 834 | nmdc:mga00v17_96068_c1 | 3300050491 | Bacteria | 1866 |
| 835 | nmdc:mga0yw44_261271_c1 | 3300050492 | Bacteria | 1154 |
| 836 | nmdc:mga0yw44_298345_c1 | 3300050492 | Bacteria | 1079 |
| 837 | nmdc:mga0yw44_40724_c1 | 3300050492 | Bacteria | 2762 |
| 838 | nmdc:mga0yw44_577130_c1 | 3300050492 | Bacteria | 764 |
| 839 | nmdc:mga0k408_281081_c1 | 3300050493 | Bacteria | 993 |
| 840 | nmdc:mga0k408_30353_c1 | 3300050493 | Bacteria | 3082 |
| 841 | nmdc:mga06z11_103955_c1 | 3300050494 | Bacteria | 1563 |
| 842 | nmdc:mga06z11_146231_c1 | 3300050494 | Bacteria | 1340 |
| 843 | nmdc:mga06z11_2466_c1 | 3300050494 | Bacteria | 7069 |
| 844 | nmdc:mga06z11_302016_c1 | 3300050494 | Bacteria | 952 |
| 845 | nmdc:mga06z11_70041_c1 | 3300050494 | Bacteria | 1853 |
| 846 | nmdc:mga04h51_109257_c1 | 3300050495 | Bacteria | 1017 |
| 847 | nmdc:mga04h51_235645_c1 | 3300050495 | Bacteria | 729 |
| 848 | nmdc:mga07m45_15602_c1 | 3300050496 | Bacteria | 4057 |
| 849 | nmdc:mga07m45_37768_c1 | 3300050496 | Bacteria | 2694 |
| 850 | nmdc:mga05p37_187694_c1 | 3300050507 | Bacteria | 2512 |
| 851 | nmdc:mga05p37_36662_c1 | 3300050507 | Bacteria | 6014 |
| 852 | nmdc:mga06r32_423628_c1 | 3300050510 | Bacteria | 1312 |
| 853 | nmdc:mga08y16_148562_c1 | 3300050511 | Bacteria | 2436 |
| 854 | nmdc:mga08y16_31466_c1 | 3300050511 | Bacteria | 5580 |
| 855 | nmdc:mga08y16_784760_c1 | 3300050511 | Bacteria | 946 |
| 856 | nmdc:mga08y16_78483_c1 | 3300050511 | Bacteria | 3442 |
| 857 | nmdc:mga0n895_164106_c1 | 3300050512 | Bacteria | 2253 |
| 858 | nmdc:mga0n895_22473_c1 | 3300050512 | Bacteria | 5914 |
| 859 | nmdc:mga0n895_324823_c1 | 3300050512 | Bacteria | 1559 |
| 860 | nmdc:mga08x19_248275_c1 | 3300050514 | Bacteria | 1228 |
| 861 | nmdc:mga0a205_12409_c1 | 3300050515 | Bacteria | 7879 |
| 862 | nmdc:mga0a205_344890_c1 | 3300050515 | Bacteria | 1357 |
| 863 | nmdc:mga0sz30_276174_c1 | 3300050516 | Bacteria | 749 |
| 864 | nmdc:mga0sz30_99000_c1 | 3300050516 | Bacteria | 1273 |
| 865 | Ga0495601_0018323 | 3300053077 | Bacteria | 4259 |
| 866 | Ga0495601_0041282 | 3300053077 | Bacteria | 2891 |
| 867 | Ga0495601_0055007 | 3300053077 | Bacteria | 2519 |
| 868 | Ga0495612_0137207 | 3300053078 | Bacteria | 1059 |
| 869 | Ga0500635_0029344 | 3300053080 | Bacteria | 1765 |
| 870 | Ga0500635_0140925 | 3300053080 | Bacteria | 915 |
| 871 | Ga0495655_0010741 | 3300053083 | Bacteria | 1818 |
| 872 | Ga0495655_0035955 | 3300053083 | Bacteria | 1236 |
| 873 | Ga0495595_0044803 | 3300053084 | Bacteria | 2033 |
| 874 | Ga0495619_0000330 | 3300053085 | Bacteria | 33168 |
| 875 | Ga0495619_0056307 | 3300053085 | Bacteria | 2606 |
| 876 | Ga0495619_0255817 | 3300053085 | Bacteria | 1213 |
| 877 | Ga0500643_017666 | 3300053087 | Bacteria | 2384 |
| 878 | Ga0500647_0050713 | 3300053091 | Bacteria | 1996 |
| 879 | Ga0500583_0114522 | 3300053092 | Bacteria | 1330 |
| 880 | Ga0500651_0007402 | 3300053093 | Bacteria | 6409 |
| 881 | Ga0500566_0000151 | 3300053094 | Bacteria | 35674 |
| 882 | Ga0500566_0000236 | 3300053094 | Bacteria | 29461 |
| 883 | Ga0500566_0015485 | 3300053094 | Bacteria | 4476 |
| 884 | Ga0500566_0040552 | 3300053094 | Bacteria | 2691 |
| 885 | Ga0500566_0137183 | 3300053094 | Bacteria | 1302 |
| 886 | Ga0500640_030939 | 3300053095 | Bacteria | 2345 |
| 887 | Ga0500641_0006119 | 3300053096 | Bacteria | 4264 |
| 888 | Ga0500641_0050203 | 3300053096 | Bacteria | 1713 |
| 889 | Ga0500554_010701 | 3300053102 | Bacteria | 2246 |
| 890 | Ga0500555_033932 | 3300053103 | Bacteria | 1438 |
| 891 | Ga0500562_010226 | 3300053108 | Bacteria | 2376 |
| 892 | Ga0500569_132240 | 3300053109 | Bacteria | 836 |
| 893 | Ga0500592_056069 | 3300053116 | Bacteria | 643 |
| 894 | Ga0500594_0011933 | 3300053118 | Bacteria | 2037 |
| 895 | Ga0500595_006181 | 3300053119 | Bacteria | 5123 |
| 896 | Ga0500595_012681 | 3300053119 | Bacteria | 3250 |
| 897 | Ga0500595_020630 | 3300053119 | Bacteria | 2367 |
| 898 | Ga0500597_125671 | 3300053120 | Bacteria | 1110 |
| 899 | Ga0500608_127331 | 3300053122 | Bacteria | 1146 |
| 900 | Ga0500614_029481 | 3300053123 | Bacteria | 1332 |
| 901 | Ga0500642_0003645 | 3300053130 | Bacteria | 4687 |
| 902 | Ga0500559_0051627 | 3300053136 | Bacteria | 1816 |
| 903 | Ga0500559_0099915 | 3300053136 | Bacteria | 1336 |
| 904 | Ga0500568_0003071 | 3300053139 | Bacteria | 9536 |
| 905 | Ga0500577_0024840 | 3300053142 | Bacteria | 2020 |
| 906 | Ga0500579_146921 | 3300053143 | Bacteria | 1043 |
| 907 | Ga0500589_110375 | 3300053147 | Bacteria | 1180 |
| 908 | Ga0500589_128789 | 3300053147 | Bacteria | 1060 |
| 909 | Ga0500590_198111 | 3300053148 | Bacteria | 853 |
| 910 | Ga0500603_006788 | 3300053150 | Bacteria | 2495 |
| 911 | Ga0500603_125820 | 3300053150 | Bacteria | 780 |
| 912 | Ga0500619_083835 | 3300053154 | Bacteria | 1073 |
| 913 | Ga0500630_119921 | 3300053159 | Bacteria | 1167 |
| 914 | Ga0500633_0181165 | 3300053160 | Bacteria | 790 |
| 915 | Ga0500634_0156392 | 3300053161 | Bacteria | 1058 |
| 916 | Ga0500638_000539 | 3300053162 | Bacteria | 9511 |
| 917 | Ga0500638_022017 | 3300053162 | Bacteria | 3015 |
| 918 | Ga0500638_177190 | 3300053162 | Bacteria | 923 |
| 919 | Ga0500639_126782 | 3300053163 | Bacteria | 1216 |
| 920 | Ga0500636_0052823 | 3300053177 | Bacteria | 2386 |
| 921 | Ga0500636_0110427 | 3300053177 | Bacteria | 1554 |
| 922 | Ga0500637_0020243 | 3300053178 | Bacteria | 3600 |
| 923 | Ga0500637_0023445 | 3300053178 | Bacteria | 3375 |
| 924 | Ga0500576_169105 | 3300053725 | Bacteria | 789 |
| 925 | Ga0500611_005802 | 3300053727 | Bacteria | 1760 |
| 926 | Ga0500645_058681 | 3300053730 | Bacteria | 1114 |
| 927 | Ga0500645_084571 | 3300053730 | Bacteria | 903 |
| 928 | Ga0500609_013892 | 3300053731 | Bacteria | 1089 |
| 929 | Ga0500609_026979 | 3300053731 | Bacteria | 787 |
| 930 | Ga0500596_000909 | 3300053735 | Bacteria | 5920 |
| 931 | Ga0500596_026589 | 3300053735 | Bacteria | 886 |
| 932 | Ga0501084_0026071 | 3300054114 | Bacteria | 4876 |
| 933 | Ga0501084_0492873 | 3300054114 | Bacteria | 1035 |
| 934 | Ga0500661_000348 | 3300055283 | Bacteria | 8437 |
| 935 | Ga0501082_0001185 | 3300060353 | Bacteria | 22911 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025928 | Ga0207700_10342849 | Ga0207700_103428491 | 169 |
| 2 | 3300005435 | Ga0070714_100376877 | Ga0070714_1003768772 | 173 |
| 3 | 3300048929 | Ga0496126_0877987 | Ga0496126_0877987_100_666 | 179 |
| 4 | 3300039438 | Ga0436360_1064441 | Ga0436360_1064441_685_1227 | 180 |
| 5 | 3300047323 | Ga0495683_0339838 | Ga0495683_0339838_84_626 | 180 |
| 6 | 3300047444 | Ga0495675_0034682 | Ga0495675_0034682_2641_3207 | 180 |
| 7 | 3300049574 | Ga0501038_0659709 | Ga0501038_0659709_228_776 | 180 |
| 8 | 3300048913 | Ga0496110_0093478 | Ga0496110_0093478_1516_2115 | 183 |
| 9 | 3300004625 | Ga0055543_1009271 | Ga0055543_10092713 | 185 |
| 10 | 3300005262 | Ga0065165_1000365 | Ga0065165_100036511 | 185 |
| 11 | 3300049580 | Ga0501046_0150217 | Ga0501046_0150217_384_983 | 187 |
| 12 | 3300049581 | Ga0501047_0180989 | Ga0501047_0180989_1181_1780 | 187 |
| 13 | 3300049586 | Ga0501070_0003250 | Ga0501070_0003250_11701_12300 | 187 |
| 14 | 3300049589 | Ga0501073_0046636 | Ga0501073_0046636_186_785 | 187 |
| 15 | 3300049590 | Ga0501074_0044615 | Ga0501074_0044615_1346_1945 | 187 |
| 16 | 3300049823 | Ga0501044_0214585 | Ga0501044_0214585_428_1027 | 187 |
| 17 | 3300049823 | Ga0501044_0960558 | Ga0501044_0960558_145_708 | 187 |
| 18 | 3300009148 | Ga0105243_10506393 | Ga0105243_105063931 | 188 |
| 19 | 3300025913 | Ga0207695_10169815 | Ga0207695_101698153 | 188 |
| 20 | 3300025916 | Ga0207663_10197353 | Ga0207663_101973532 | 188 |
| 21 | 3300035086 | Ga0373934_0138358 | Ga0373934_0138358_198_797 | 188 |
| 22 | 3300035170 | Ga0373943_0134359 | Ga0373943_0134359_14_580 | 188 |
| 23 | 3300041459 | Ga0451800_0177409 | Ga0451800_0177409_95_661 | 188 |
| 24 | 3300046475 | Ga0495639_0073083 | Ga0495639_0073083_499_1065 | 188 |
| 25 | 3300046492 | Ga0495585_0415798 | Ga0495585_0415798_13_579 | 188 |
| 26 | 3300047315 | Ga0495581_0012670 | Ga0495581_0012670_23_589 | 188 |
| 27 | 3300047320 | Ga0495672_0327498 | Ga0495672_0327498_26_592 | 188 |
| 28 | 3300047322 | Ga0495680_0104539 | Ga0495680_0104539_228_827 | 188 |
| 29 | 3300048924 | Ga0496121_0458429 | Ga0496121_0458429_239_805 | 188 |
| 30 | 3300048929 | Ga0496126_0252728 | Ga0496126_0252728_193_759 | 188 |
| 31 | 3300049587 | Ga0501071_0517096 | Ga0501071_0517096_13_579 | 188 |
| 32 | 3300053080 | Ga0500635_0140925 | Ga0500635_0140925_27_593 | 188 |
| 33 | 3300053123 | Ga0500614_029481 | Ga0500614_029481_27_593 | 188 |
| 34 | 3300053154 | Ga0500619_083835 | Ga0500619_083835_482_1048 | 188 |
| 35 | 3300053162 | Ga0500638_177190 | Ga0500638_177190_343_909 | 188 |
| 36 | 3300053177 | Ga0500636_0110427 | Ga0500636_0110427_961_1527 | 188 |
| 37 | 3300053730 | Ga0500645_058681 | Ga0500645_058681_13_579 | 188 |
| 38 | 3300054114 | Ga0501084_0492873 | Ga0501084_0492873_453_1019 | 188 |
| 39 | 3300046660 | Ga0495625_0122049 | Ga0495625_0122049_100_699 | 189 |
| 40 | 3300048924 | Ga0496121_0444230 | Ga0496121_0444230_57_656 | 189 |
| 41 | 3300005436 | Ga0070713_100007994 | Ga0070713_1000079946 | 190 |
| 42 | 3300006028 | Ga0070717_10073218 | Ga0070717_100732184 | 190 |
| 43 | 3300049574 | Ga0501038_0024694 | Ga0501038_0024694_3476_4075 | 190 |
| 44 | 3300049575 | Ga0501039_0056725 | Ga0501039_0056725_736_1335 | 190 |
| 45 | 3300035120 | Ga0373957_0003010 | Ga0373957_0003010_364_963 | 191 |
| 46 | 3300035410 | Ga0373924_0059871 | Ga0373924_0059871_741_1340 | 191 |
| 47 | 3300035692 | Ga0373935_0317980 | Ga0373935_0317980_476_1075 | 191 |
| 48 | 3300035724 | Ga0373933_0063631 | Ga0373933_0063631_172_771 | 191 |
| 49 | 3300036401 | Ga0373937_0064731 | Ga0373937_0064731_2654_3253 | 191 |
| 50 | 3300046462 | Ga0495651_0113671 | Ga0495651_0113671_460_1059 | 191 |
| 51 | 3300046514 | Ga0495618_0520896 | Ga0495618_0520896_61_660 | 191 |
| 52 | 3300046516 | Ga0495628_0020336 | Ga0495628_0020336_3359_3958 | 191 |
| 53 | 3300046529 | Ga0495652_0553647 | Ga0495652_0553647_57_656 | 191 |
| 54 | 3300046536 | Ga0495587_0068067 | Ga0495587_0068067_225_824 | 191 |
| 55 | 3300046642 | Ga0495634_0089382 | Ga0495634_0089382_108_707 | 191 |
| 56 | 3300046679 | Ga0495623_0062967 | Ga0495623_0062967_337_936 | 191 |
| 57 | 3300046680 | Ga0495646_0127112 | Ga0495646_0127112_210_809 | 191 |
| 58 | 3300046689 | Ga0495613_0134706 | Ga0495613_0134706_807_1406 | 191 |
| 59 | 3300047319 | Ga0495674_0010066 | Ga0495674_0010066_5881_6480 | 191 |
| 60 | 3300053077 | Ga0495601_0041282 | Ga0495601_0041282_57_656 | 191 |
| 61 | 3300053085 | Ga0495619_0255817 | Ga0495619_0255817_299_898 | 191 |
| 62 | 3300006941 | Ga0099825_1031523 | Ga0099825_10315233 | 192 |
| 63 | 3300006942 | Ga0099824_1014228 | Ga0099824_10142282 | 192 |
| 64 | 3300006943 | Ga0099822_1000827 | Ga0099822_100082713 | 192 |
| 65 | 3300027357 | Ga0209589_1000021 | Ga0209589_1000021129 | 192 |
| 66 | 3300027361 | Ga0209489_100028 | Ga0209489_100028129 | 192 |
| 67 | 3300027363 | Ga0209700_100037 | Ga0209700_100037129 | 192 |
| 68 | 3300041511 | Ga0451855_0967751 | Ga0451855_0967751_131_715 | 192 |
| 69 | 3300005435 | Ga0070714_100067843 | Ga0070714_1000678432 | 193 |
| 70 | 3300025929 | Ga0207664_10051603 | Ga0207664_100516032 | 193 |
| 71 | 3300031238 | Ga0265332_10011743 | Ga0265332_100117433 | 193 |
| 72 | iso_pu_bacteria | 2839993093 | 2839993415 | 193 |
| 73 | 3300031235 | Ga0265330_10119124 | Ga0265330_101191242 | 194 |
| 74 | 3300031344 | Ga0265316_10153298 | Ga0265316_101532982 | 194 |
| 75 | 3300035086 | Ga0373934_0002347 | Ga0373934_0002347_5834_6433 | 194 |
| 76 | 3300035117 | Ga0373953_0009436 | Ga0373953_0009436_2489_3088 | 194 |
| 77 | 3300035118 | Ga0373954_0000883 | Ga0373954_0000883_2732_3331 | 194 |
| 78 | 3300035120 | Ga0373957_0001330 | Ga0373957_0001330_115_714 | 194 |
| 79 | 3300035172 | Ga0373955_0001067 | Ga0373955_0001067_5194_5793 | 194 |
| 80 | 3300035410 | Ga0373924_0005686 | Ga0373924_0005686_551_1150 | 194 |
| 81 | 3300035724 | Ga0373933_0001638 | Ga0373933_0001638_10230_10829 | 194 |
| 82 | 3300036401 | Ga0373937_0022664 | Ga0373937_0022664_1797_2396 | 194 |
| 83 | 3300046454 | Ga0495592_0003085 | Ga0495592_0003085_2443_3042 | 194 |
| 84 | 3300046459 | Ga0495629_0001972 | Ga0495629_0001972_3273_3872 | 194 |
| 85 | 3300046463 | Ga0495653_0002188 | Ga0495653_0002188_3538_4137 | 194 |
| 86 | 3300046511 | Ga0495608_0030843 | Ga0495608_0030843_766_1365 | 194 |
| 87 | 3300046529 | Ga0495652_0018347 | Ga0495652_0018347_719_1318 | 194 |
| 88 | 3300046533 | Ga0495640_0039130 | Ga0495640_0039130_199_798 | 194 |
| 89 | 3300046536 | Ga0495587_0023867 | Ga0495587_0023867_1606_2205 | 194 |
| 90 | 3300046559 | Ga0495667_0002652 | Ga0495667_0002652_4873_5472 | 194 |
| 91 | 3300046642 | Ga0495634_0021849 | Ga0495634_0021849_3296_3895 | 194 |
| 92 | 3300046663 | Ga0495635_0001078 | Ga0495635_0001078_4873_5472 | 194 |
| 93 | 3300046675 | Ga0495657_0010052 | Ga0495657_0010052_1663_2262 | 194 |
| 94 | 3300046678 | Ga0495599_0001153 | Ga0495599_0001153_2232_2831 | 194 |
| 95 | 3300046679 | Ga0495623_0016469 | Ga0495623_0016469_766_1365 | 194 |
| 96 | 3300046680 | Ga0495646_0004178 | Ga0495646_0004178_5044_5643 | 194 |
| 97 | 3300046689 | Ga0495613_0021524 | Ga0495613_0021524_580_1179 | 194 |
| 98 | 3300046809 | Ga0495600_0000311 | Ga0495600_0000311_471_1070 | 194 |
| 99 | 3300046810 | Ga0495660_0118977 | Ga0495660_0118977_150_734 | 194 |
| 100 | 3300047317 | Ga0495604_0029213 | Ga0495604_0029213_2237_2836 | 194 |
| 101 | 3300047322 | Ga0495680_0015853 | Ga0495680_0015853_4297_4896 | 194 |
| 102 | 3300047444 | Ga0495675_0001437 | Ga0495675_0001437_9679_10278 | 194 |
| 103 | 3300047471 | Ga0495684_0000313 | Ga0495684_0000313_5431_6030 | 194 |
| 104 | 3300047673 | Ga0495593_0000693 | Ga0495593_0000693_16944_17543 | 194 |
| 105 | 3300048088 | Ga0495602_0002384 | Ga0495602_0002384_3411_4010 | 194 |
| 106 | 3300053077 | Ga0495601_0018323 | Ga0495601_0018323_2669_3268 | 194 |
| 107 | 3300053085 | Ga0495619_0000330 | Ga0495619_0000330_10851_11450 | 194 |
| 108 | 3300013297 | Ga0157378_10407304 | Ga0157378_104073042 | 195 |
| 109 | 3300025914 | Ga0207671_10112870 | Ga0207671_101128702 | 195 |
| 110 | iso_pu_bacteria | 2507262055 | 2507505236 | 195 |
| 111 | iso_pu_bacteria | 2508501009 | 2508539157 | 195 |
| 112 | iso_pu_bacteria | 2508501042 | 2508695475 | 195 |
| 113 | iso_pu_bacteria | 2508501128 | 2509152624 | 195 |
| 114 | iso_pu_bacteria | 2511231028 | 2511395427 | 195 |
| 115 | iso_pu_bacteria | 2513237092 | 2513625336 | 195 |
| 116 | iso_pu_bacteria | 2513237095 | 2513651525 | 195 |
| 117 | iso_pu_bacteria | 2513237101 | 2513695101 | 195 |
| 118 | iso_pu_bacteria | 2513237104 | 2513720313 | 195 |
| 119 | iso_pu_bacteria | 2513237139 | 2513873537 | 195 |
| 120 | iso_pu_bacteria | 2513237141 | 2513888757 | 195 |
| 121 | iso_pu_bacteria | 2513237161 | 2514012476 | 195 |
| 122 | iso_pu_bacteria | 2515154112 | 2515627433 | 195 |
| 123 | iso_pu_bacteria | 2617270735 | 2617352389 | 195 |
| 124 | iso_pu_bacteria | 2617270741 | 2617373751 | 195 |
| 125 | iso_pu_bacteria | 2721755755 | 2723841633 | 195 |
| 126 | iso_pu_bacteria | 2791355199 | 2793082759 | 195 |
| 127 | iso_pu_bacteria | 2802429603 | 2805915621 | 195 |
| 128 | iso_pu_bacteria | 2816332527 | 2818237640 | 195 |
| 129 | iso_pu_bacteria | 2824671348 | 2824676634 | 195 |
| 130 | iso_pu_bacteria | 2824679649 | 2824684069 | 195 |
| 131 | iso_pu_bacteria | 2824687955 | 2824694692 | 195 |
| 132 | iso_pu_bacteria | 2824696289 | 2824703828 | 195 |
| 133 | iso_pu_bacteria | 2824704595 | 2824708938 | 195 |
| 134 | iso_pu_bacteria | 2824732956 | 2824739856 | 195 |
| 135 | iso_pu_bacteria | 2824753945 | 2824759965 | 195 |
| 136 | iso_pu_bacteria | 2824763712 | 2824770399 | 195 |
| 137 | iso_pu_bacteria | 2824773399 | 2824775531 | 195 |
| 138 | iso_pu_bacteria | 2838122688 | 2838124504 | 195 |
| 139 | iso_pu_bacteria | 2841941048 | 2841945190 | 195 |
| 140 | iso_pu_bacteria | 2841949485 | 2841951972 | 195 |
| 141 | iso_pu_bacteria | 2841966195 | 2841970633 | 195 |
| 142 | iso_pu_bacteria | 2841974524 | 2841979982 | 195 |
| 143 | iso_pu_bacteria | 2841983080 | 2841985161 | 195 |
| 144 | iso_pu_bacteria | 2842038055 | 2842043519 | 195 |
| 145 | iso_pu_bacteria | 2842045827 | 2842052491 | 195 |
| 146 | iso_pu_bacteria | 2847939898 | 2847942146 | 195 |
| 147 | iso_pu_bacteria | 2857524615 | 2857526362 | 195 |
| 148 | iso_pu_bacteria | 2874604998 | 2874608073 | 195 |
| 149 | iso_pu_bacteria | 2874612657 | 2874613445 | 195 |
| 150 | iso_pu_bacteria | 2874628541 | 2874628804 | 195 |
| 151 | iso_pu_bacteria | 2874645413 | 2874649809 | 195 |
| 152 | iso_pu_bacteria | 2876771140 | 2876773928 | 195 |
| 153 | iso_pu_bacteria | 2876808645 | 2876815514 | 195 |
| 154 | iso_pu_bacteria | 2876818435 | 2876821808 | 195 |
| 155 | iso_pu_bacteria | 2879074833 | 2879078348 | 195 |
| 156 | iso_pu_bacteria | 2879110137 | 2879112162 | 195 |
| 157 | iso_pu_bacteria | 2879127579 | 2879130609 | 195 |
| 158 | iso_pu_bacteria | 2879142872 | 2879147114 | 195 |
| 159 | iso_pu_bacteria | 2885409591 | 2885411671 | 195 |
| 160 | iso_pu_bacteria | 2888378607 | 2888379603 | 195 |
| 161 | iso_pu_bacteria | 2888388044 | 2888390691 | 195 |
| 162 | iso_pu_bacteria | 2889033259 | 2889035500 | 195 |
| 163 | iso_pu_bacteria | 2904711408 | 2904713169 | 195 |
| 164 | iso_pu_bacteria | 2919073203 | 2919073790 | 195 |
| 165 | iso_pu_bacteria | 2922361189 | 2922364009 | 195 |
| 166 | iso_pu_bacteria | 2922386360 | 2922392557 | 195 |
| 167 | iso_pu_bacteria | 2922393267 | 2922394230 | 195 |
| 168 | iso_pu_bacteria | 2932794094 | 2932794326 | 195 |
| 169 | iso_pu_bacteria | 2932801729 | 2932808080 | 195 |
| 170 | iso_pu_bacteria | 2935883170 | 2935890140 | 195 |
| 171 | iso_pu_bacteria | 2935975950 | 2935980713 | 195 |
| 172 | iso_pu_bacteria | 2936055302 | 2936056305 | 195 |
| 173 | iso_pu_bacteria | 2941531003 | 2941535524 | 195 |
| 174 | iso_pu_bacteria | 3005506211 | 3005509169 | 195 |
| 175 | iso_pu_bacteria | 3005587118 | 3005592220 | 195 |
| 176 | iso_pu_bacteria | 3005594810 | 3005595041 | 195 |
| 177 | iso_pu_bacteria | 3005710791 | 3005710989 | 195 |
| 178 | iso_pu_bacteria | 8006926726 | 8006927881 | 195 |
| 179 | iso_pu_bacteria | 8006984368 | 8006990913 | 195 |
| 180 | iso_pu_bacteria | 8006994254 | 8006996520 | 195 |
| 181 | iso_pu_bacteria | 8019619141 | 8019622960 | 195 |
| 182 | iso_pu_bacteria | 8019629233 | 8019630146 | 195 |
| 183 | iso_pu_bacteria | 8019638758 | 8019640465 | 195 |
| 184 | iso_pu_bacteria | 8056673599 | 8056675734 | 195 |
| 185 | 3300049572 | Ga0501036_0647484 | Ga0501036_0647484_208_813 | 196 |
| 186 | iso_pu_bacteria | 3005483717 | 3005489079 | 196 |
| 187 | 3300049571 | Ga0501034_0721136 | Ga0501034_0721136_102_698 | 197 |
| 188 | 3300049586 | Ga0501070_0610973 | Ga0501070_0610973_221_814 | 197 |
| 189 | 3300049823 | Ga0501044_0842248 | Ga0501044_0842248_17_610 | 197 |
| 190 | iso_pu_bacteria | 2908775508 | 2908776268 | 197 |
| 191 | 3300009094 | Ga0111539_10038919 | Ga0111539_100389198 | 198 |
| 192 | 3300025949 | Ga0207667_10901392 | Ga0207667_109013922 | 198 |
| 193 | 3300049568 | Ga0501031_0071293 | Ga0501031_0071293_1184_1801 | 198 |
| 194 | 3300049569 | Ga0501032_0047597 | Ga0501032_0047597_623_1219 | 198 |
| 195 | 3300050511 | nmdc:mga08y16_148562_c1 | nmdc:mga08y16_148562_c1_1385_1981 | 198 |
| 196 | 3300050512 | nmdc:mga0n895_164106_c1 | nmdc:mga0n895_164106_c1_802_1398 | 198 |
| 197 | 3300001979 | JGI24740J21852_10012640 | JGI24740J21852_100126405 | 199 |
| 198 | 3300003203 | JGI25406J46586_10000066 | JGI25406J46586_1000006635 | 199 |
| 199 | 3300003323 | rootH1_10247459 | rootH1_102474591 | 199 |
| 200 | 3300003659 | JGI25404J52841_10026242 | JGI25404J52841_100262422 | 199 |
| 201 | 3300005327 | Ga0070658_10086338 | Ga0070658_100863383 | 199 |
| 202 | 3300005329 | Ga0070683_100083743 | Ga0070683_1000837433 | 199 |
| 203 | 3300005330 | Ga0070690_100274280 | Ga0070690_1002742802 | 199 |
| 204 | 3300005330 | Ga0070690_100469775 | Ga0070690_1004697752 | 199 |
| 205 | 3300005331 | Ga0070670_100957109 | Ga0070670_1009571091 | 199 |
| 206 | 3300005334 | Ga0068869_100102947 | Ga0068869_1001029472 | 199 |
| 207 | 3300005334 | Ga0068869_100393970 | Ga0068869_1003939702 | 199 |
| 208 | 3300005336 | Ga0070680_100184111 | Ga0070680_1001841112 | 199 |
| 209 | 3300005336 | Ga0070680_100325980 | Ga0070680_1003259802 | 199 |
| 210 | 3300005337 | Ga0070682_100109183 | Ga0070682_1001091832 | 199 |
| 211 | 3300005338 | Ga0068868_100006458 | Ga0068868_1000064585 | 199 |
| 212 | 3300005339 | Ga0070660_100002843 | Ga0070660_1000028433 | 199 |
| 213 | 3300005344 | Ga0070661_100121771 | Ga0070661_1001217712 | 199 |
| 214 | 3300005344 | Ga0070661_100536953 | Ga0070661_1005369532 | 199 |
| 215 | 3300005345 | Ga0070692_10127817 | Ga0070692_101278171 | 199 |
| 216 | 3300005347 | Ga0070668_100015369 | Ga0070668_1000153694 | 199 |
| 217 | 3300005347 | Ga0070668_100033661 | Ga0070668_1000336615 | 199 |
| 218 | 3300005347 | Ga0070668_100117461 | Ga0070668_1001174612 | 199 |
| 219 | 3300005353 | Ga0070669_100365289 | Ga0070669_1003652892 | 199 |
| 220 | 3300005354 | Ga0070675_100508884 | Ga0070675_1005088842 | 199 |
| 221 | 3300005355 | Ga0070671_100090093 | Ga0070671_1000900933 | 199 |
| 222 | 3300005355 | Ga0070671_100097781 | Ga0070671_1000977811 | 199 |
| 223 | 3300005355 | Ga0070671_100158144 | Ga0070671_1001581442 | 199 |
| 224 | 3300005355 | Ga0070671_100472751 | Ga0070671_1004727512 | 199 |
| 225 | 3300005356 | Ga0070674_100043742 | Ga0070674_1000437422 | 199 |
| 226 | 3300005356 | Ga0070674_100095774 | Ga0070674_1000957743 | 199 |
| 227 | 3300005364 | Ga0070673_100366580 | Ga0070673_1003665801 | 199 |
| 228 | 3300005367 | Ga0070667_100202757 | Ga0070667_1002027571 | 199 |
| 229 | 3300005434 | Ga0070709_10000584 | Ga0070709_1000058410 | 199 |
| 230 | 3300005434 | Ga0070709_10067203 | Ga0070709_100672033 | 199 |
| 231 | 3300005435 | Ga0070714_100051084 | Ga0070714_1000510841 | 199 |
| 232 | 3300005435 | Ga0070714_100142313 | Ga0070714_1001423133 | 199 |
| 233 | 3300005435 | Ga0070714_100143476 | Ga0070714_1001434763 | 199 |
| 234 | 3300005436 | Ga0070713_100002764 | Ga0070713_10000276410 | 199 |
| 235 | 3300005436 | Ga0070713_100013200 | Ga0070713_1000132004 | 199 |
| 236 | 3300005436 | Ga0070713_100054190 | Ga0070713_1000541903 | 199 |
| 237 | 3300005436 | Ga0070713_100358213 | Ga0070713_1003582132 | 199 |
| 238 | 3300005437 | Ga0070710_10082864 | Ga0070710_100828642 | 199 |
| 239 | 3300005437 | Ga0070710_10642190 | Ga0070710_106421901 | 199 |
| 240 | 3300005439 | Ga0070711_100003385 | Ga0070711_1000033856 | 199 |
| 241 | 3300005439 | Ga0070711_100144560 | Ga0070711_1001445602 | 199 |
| 242 | 3300005441 | Ga0070700_100663904 | Ga0070700_1006639042 | 199 |
| 243 | 3300005445 | Ga0070708_100108643 | Ga0070708_1001086433 | 199 |
| 244 | 3300005455 | Ga0070663_100001666 | Ga0070663_10000166612 | 199 |
| 245 | 3300005455 | Ga0070663_100017648 | Ga0070663_1000176483 | 199 |
| 246 | 3300005455 | Ga0070663_100019459 | Ga0070663_1000194595 | 199 |
| 247 | 3300005455 | Ga0070663_100220296 | Ga0070663_1002202961 | 199 |
| 248 | 3300005456 | Ga0070678_100034858 | Ga0070678_1000348582 | 199 |
| 249 | 3300005456 | Ga0070678_100113296 | Ga0070678_1001132963 | 199 |
| 250 | 3300005456 | Ga0070678_100409613 | Ga0070678_1004096132 | 199 |
| 251 | 3300005456 | Ga0070678_100759381 | Ga0070678_1007593812 | 199 |
| 252 | 3300005457 | Ga0070662_100103444 | Ga0070662_1001034443 | 199 |
| 253 | 3300005457 | Ga0070662_100148304 | Ga0070662_1001483042 | 199 |
| 254 | 3300005457 | Ga0070662_100477577 | Ga0070662_1004775772 | 199 |
| 255 | 3300005458 | Ga0070681_10073556 | Ga0070681_100735562 | 199 |
| 256 | 3300005458 | Ga0070681_10204051 | Ga0070681_102040512 | 199 |
| 257 | 3300005467 | Ga0070706_100446936 | Ga0070706_1004469362 | 199 |
| 258 | 3300005468 | Ga0070707_100093433 | Ga0070707_1000934333 | 199 |
| 259 | 3300005471 | Ga0070698_100083350 | Ga0070698_1000833502 | 199 |
| 260 | 3300005471 | Ga0070698_100120907 | Ga0070698_1001209072 | 199 |
| 261 | 3300005530 | Ga0070679_100060657 | Ga0070679_1000606572 | 199 |
| 262 | 3300005530 | Ga0070679_100131887 | Ga0070679_1001318871 | 199 |
| 263 | 3300005530 | Ga0070679_100444319 | Ga0070679_1004443192 | 199 |
| 264 | 3300005535 | Ga0070684_100013695 | Ga0070684_1000136954 | 199 |
| 265 | 3300005535 | Ga0070684_100413367 | Ga0070684_1004133671 | 199 |
| 266 | 3300005536 | Ga0070697_100068173 | Ga0070697_1000681734 | 199 |
| 267 | 3300005536 | Ga0070697_100152523 | Ga0070697_1001525233 | 199 |
| 268 | 3300005539 | Ga0068853_100006442 | Ga0068853_1000064425 | 199 |
| 269 | 3300005539 | Ga0068853_100129133 | Ga0068853_1001291331 | 199 |
| 270 | 3300005539 | Ga0068853_100301700 | Ga0068853_1003017002 | 199 |
| 271 | 3300005539 | Ga0068853_100338895 | Ga0068853_1003388952 | 199 |
| 272 | 3300005539 | Ga0068853_100784119 | Ga0068853_1007841191 | 199 |
| 273 | 3300005539 | Ga0068853_101163117 | Ga0068853_1011631171 | 199 |
| 274 | 3300005543 | Ga0070672_100067814 | Ga0070672_1000678142 | 199 |
| 275 | 3300005543 | Ga0070672_100652780 | Ga0070672_1006527802 | 199 |
| 276 | 3300005548 | Ga0070665_100032806 | Ga0070665_1000328063 | 199 |
| 277 | 3300005548 | Ga0070665_100207596 | Ga0070665_1002075963 | 199 |
| 278 | 3300005548 | Ga0070665_100367340 | Ga0070665_1003673402 | 199 |
| 279 | 3300005548 | Ga0070665_100419032 | Ga0070665_1004190322 | 199 |
| 280 | 3300005548 | Ga0070665_100882380 | Ga0070665_1008823802 | 199 |
| 281 | 3300005549 | Ga0070704_100276365 | Ga0070704_1002763652 | 199 |
| 282 | 3300005563 | Ga0068855_100006336 | Ga0068855_10000633617 | 199 |
| 283 | 3300005563 | Ga0068855_100056640 | Ga0068855_1000566404 | 199 |
| 284 | 3300005563 | Ga0068855_100173061 | Ga0068855_1001730612 | 199 |
| 285 | 3300005563 | Ga0068855_100315296 | Ga0068855_1003152963 | 199 |
| 286 | 3300005563 | Ga0068855_100423764 | Ga0068855_1004237642 | 199 |
| 287 | 3300005564 | Ga0070664_100044154 | Ga0070664_1000441544 | 199 |
| 288 | 3300005564 | Ga0070664_100539176 | Ga0070664_1005391762 | 199 |
| 289 | 3300005564 | Ga0070664_100879467 | Ga0070664_1008794672 | 199 |
| 290 | 3300005577 | Ga0068857_100005001 | Ga0068857_1000050015 | 199 |
| 291 | 3300005577 | Ga0068857_100050370 | Ga0068857_1000503703 | 199 |
| 292 | 3300005577 | Ga0068857_100327325 | Ga0068857_1003273252 | 199 |
| 293 | 3300005577 | Ga0068857_100445182 | Ga0068857_1004451822 | 199 |
| 294 | 3300005578 | Ga0068854_100038575 | Ga0068854_1000385753 | 199 |
| 295 | 3300005578 | Ga0068854_100112686 | Ga0068854_1001126862 | 199 |
| 296 | 3300005614 | Ga0068856_100005232 | Ga0068856_1000052328 | 199 |
| 297 | 3300005614 | Ga0068856_100222530 | Ga0068856_1002225302 | 199 |
| 298 | 3300005615 | Ga0070702_100124149 | Ga0070702_1001241492 | 199 |
| 299 | 3300005615 | Ga0070702_100156062 | Ga0070702_1001560622 | 199 |
| 300 | 3300005616 | Ga0068852_100042907 | Ga0068852_1000429073 | 199 |
| 301 | 3300005616 | Ga0068852_100045014 | Ga0068852_1000450145 | 199 |
| 302 | 3300005616 | Ga0068852_100105825 | Ga0068852_1001058252 | 199 |
| 303 | 3300005616 | Ga0068852_101080807 | Ga0068852_1010808072 | 199 |
| 304 | 3300005617 | Ga0068859_100207816 | Ga0068859_1002078163 | 199 |
| 305 | 3300005617 | Ga0068859_100750661 | Ga0068859_1007506612 | 199 |
| 306 | 3300005618 | Ga0068864_100607919 | Ga0068864_1006079192 | 199 |
| 307 | 3300005618 | Ga0068864_101301282 | Ga0068864_1013012821 | 199 |
| 308 | 3300005719 | Ga0068861_100072794 | Ga0068861_1000727943 | 199 |
| 309 | 3300005834 | Ga0068851_10009214 | Ga0068851_100092142 | 199 |
| 310 | 3300005834 | Ga0068851_10225768 | Ga0068851_102257682 | 199 |
| 311 | 3300005840 | Ga0068870_10116859 | Ga0068870_101168592 | 199 |
| 312 | 3300005841 | Ga0068863_100032605 | Ga0068863_1000326052 | 199 |
| 313 | 3300005841 | Ga0068863_100269190 | Ga0068863_1002691902 | 199 |
| 314 | 3300005841 | Ga0068863_100557688 | Ga0068863_1005576882 | 199 |
| 315 | 3300005843 | Ga0068860_100004221 | Ga0068860_1000042219 | 199 |
| 316 | 3300005843 | Ga0068860_100104642 | Ga0068860_1001046423 | 199 |
| 317 | 3300005844 | Ga0068862_100072386 | Ga0068862_1000723865 | 199 |
| 318 | 3300005844 | Ga0068862_100133794 | Ga0068862_1001337943 | 199 |
| 319 | 3300005844 | Ga0068862_100192780 | Ga0068862_1001927803 | 199 |
| 320 | 3300005844 | Ga0068862_100221413 | Ga0068862_1002214131 | 199 |
| 321 | 3300005844 | Ga0068862_100628791 | Ga0068862_1006287912 | 199 |
| 322 | 3300005937 | Ga0081455_10041411 | Ga0081455_100414112 | 199 |
| 323 | 3300005983 | Ga0081540_1011590 | Ga0081540_10115904 | 199 |
| 324 | 3300005983 | Ga0081540_1033663 | Ga0081540_10336633 | 199 |
| 325 | 3300005983 | Ga0081540_1041776 | Ga0081540_10417763 | 199 |
| 326 | 3300005983 | Ga0081540_1059678 | Ga0081540_10596782 | 199 |
| 327 | 3300005983 | Ga0081540_1089461 | Ga0081540_10894612 | 199 |
| 328 | 3300005985 | Ga0081539_10000064 | Ga0081539_1000006461 | 199 |
| 329 | 3300006028 | Ga0070717_10000598 | Ga0070717_100005986 | 199 |
| 330 | 3300006028 | Ga0070717_10061554 | Ga0070717_100615542 | 199 |
| 331 | 3300006028 | Ga0070717_10248780 | Ga0070717_102487802 | 199 |
| 332 | 3300006038 | Ga0075365_10074787 | Ga0075365_100747873 | 199 |
| 333 | 3300006038 | Ga0075365_10278942 | Ga0075365_102789422 | 199 |
| 334 | 3300006042 | Ga0075368_10167082 | Ga0075368_101670821 | 199 |
| 335 | 3300006048 | Ga0075363_100001418 | Ga0075363_1000014182 | 199 |
| 336 | 3300006163 | Ga0070715_10172941 | Ga0070715_101729412 | 199 |
| 337 | 3300006173 | Ga0070716_100029244 | Ga0070716_1000292442 | 199 |
| 338 | 3300006175 | Ga0070712_100005171 | Ga0070712_1000051712 | 199 |
| 339 | 3300006175 | Ga0070712_100005584 | Ga0070712_1000055846 | 199 |
| 340 | 3300006177 | Ga0075362_10140243 | Ga0075362_101402432 | 199 |
| 341 | 3300006178 | Ga0075367_10027915 | Ga0075367_100279152 | 199 |
| 342 | 3300006178 | Ga0075367_10087525 | Ga0075367_100875252 | 199 |
| 343 | 3300006178 | Ga0075367_10144134 | Ga0075367_101441342 | 199 |
| 344 | 3300006178 | Ga0075367_10211278 | Ga0075367_102112782 | 199 |
| 345 | 3300006178 | Ga0075367_10345272 | Ga0075367_103452722 | 199 |
| 346 | 3300006186 | Ga0075369_10006992 | Ga0075369_100069923 | 199 |
| 347 | 3300006195 | Ga0075366_10265088 | Ga0075366_102650881 | 199 |
| 348 | 3300006237 | Ga0097621_100052686 | Ga0097621_1000526863 | 199 |
| 349 | 3300006237 | Ga0097621_100092813 | Ga0097621_1000928132 | 199 |
| 350 | 3300006353 | Ga0075370_10019651 | Ga0075370_100196513 | 199 |
| 351 | 3300006353 | Ga0075370_10041274 | Ga0075370_100412743 | 199 |
| 352 | 3300006353 | Ga0075370_10085718 | Ga0075370_100857182 | 199 |
| 353 | 3300006358 | Ga0068871_100227703 | Ga0068871_1002277032 | 199 |
| 354 | 3300006358 | Ga0068871_100514290 | Ga0068871_1005142902 | 199 |
| 355 | 3300006844 | Ga0075428_100251323 | Ga0075428_1002513232 | 199 |
| 356 | 3300006852 | Ga0075433_10031337 | Ga0075433_100313373 | 199 |
| 357 | 3300006871 | Ga0075434_100004035 | Ga0075434_1000040358 | 199 |
| 358 | 3300006881 | Ga0068865_100324292 | Ga0068865_1003242922 | 199 |
| 359 | 3300006931 | Ga0097620_100207824 | Ga0097620_1002078243 | 199 |
| 360 | 3300006931 | Ga0097620_100750707 | Ga0097620_1007507072 | 199 |
| 361 | 3300007076 | Ga0075435_100330395 | Ga0075435_1003303952 | 199 |
| 362 | 3300007265 | Ga0099794_10006977 | Ga0099794_100069773 | 199 |
| 363 | 3300007265 | Ga0099794_10028876 | Ga0099794_100288762 | 199 |
| 364 | 3300007265 | Ga0099794_10047829 | Ga0099794_100478292 | 199 |
| 365 | 3300007265 | Ga0099794_10087498 | Ga0099794_100874982 | 199 |
| 366 | 3300007788 | Ga0099795_10021988 | Ga0099795_100219883 | 199 |
| 367 | 3300007788 | Ga0099795_10100091 | Ga0099795_101000912 | 199 |
| 368 | 3300007788 | Ga0099795_10149576 | Ga0099795_101495762 | 199 |
| 369 | 3300007788 | Ga0099795_10156506 | Ga0099795_101565062 | 199 |
| 370 | 3300007788 | Ga0099795_10178223 | Ga0099795_101782232 | 199 |
| 371 | 3300009093 | Ga0105240_10019831 | Ga0105240_100198313 | 199 |
| 372 | 3300009093 | Ga0105240_10025163 | Ga0105240_100251634 | 199 |
| 373 | 3300009093 | Ga0105240_10232524 | Ga0105240_102325242 | 199 |
| 374 | 3300009093 | Ga0105240_10963732 | Ga0105240_109637321 | 199 |
| 375 | 3300009094 | Ga0111539_10046457 | Ga0111539_100464577 | 199 |
| 376 | 3300009094 | Ga0111539_10093169 | Ga0111539_100931695 | 199 |
| 377 | 3300009098 | Ga0105245_10042438 | Ga0105245_100424385 | 199 |
| 378 | 3300009098 | Ga0105245_10076458 | Ga0105245_100764583 | 199 |
| 379 | 3300009098 | Ga0105245_10409909 | Ga0105245_104099092 | 199 |
| 380 | 3300009098 | Ga0105245_10757004 | Ga0105245_107570041 | 199 |
| 381 | 3300009101 | Ga0105247_10065622 | Ga0105247_100656223 | 199 |
| 382 | 3300009101 | Ga0105247_10087391 | Ga0105247_100873912 | 199 |
| 383 | 3300009101 | Ga0105247_10133263 | Ga0105247_101332632 | 199 |
| 384 | 3300009101 | Ga0105247_10234758 | Ga0105247_102347582 | 199 |
| 385 | 3300009101 | Ga0105247_10276028 | Ga0105247_102760282 | 199 |
| 386 | 3300009147 | Ga0114129_10184351 | Ga0114129_101843512 | 199 |
| 387 | 3300009147 | Ga0114129_10278936 | Ga0114129_102789362 | 199 |
| 388 | 3300009148 | Ga0105243_10118967 | Ga0105243_101189672 | 199 |
| 389 | 3300009148 | Ga0105243_10143191 | Ga0105243_101431912 | 199 |
| 390 | 3300009174 | Ga0105241_10011853 | Ga0105241_100118536 | 199 |
| 391 | 3300009174 | Ga0105241_10055927 | Ga0105241_100559273 | 199 |
| 392 | 3300009174 | Ga0105241_10146258 | Ga0105241_101462582 | 199 |
| 393 | 3300009176 | Ga0105242_10128515 | Ga0105242_101285152 | 199 |
| 394 | 3300009176 | Ga0105242_10894548 | Ga0105242_108945481 | 199 |
| 395 | 3300009176 | Ga0105242_10946815 | Ga0105242_109468151 | 199 |
| 396 | 3300009177 | Ga0105248_10026101 | Ga0105248_100261017 | 199 |
| 397 | 3300009177 | Ga0105248_10539361 | Ga0105248_105393612 | 199 |
| 398 | 3300009177 | Ga0105248_10693439 | Ga0105248_106934392 | 199 |
| 399 | 3300009177 | Ga0105248_10994895 | Ga0105248_109948952 | 199 |
| 400 | 3300009545 | Ga0105237_10080675 | Ga0105237_100806752 | 199 |
| 401 | 3300009545 | Ga0105237_10094573 | Ga0105237_100945734 | 199 |
| 402 | 3300009545 | Ga0105237_10340724 | Ga0105237_103407243 | 199 |
| 403 | 3300009545 | Ga0105237_10344836 | Ga0105237_103448362 | 199 |
| 404 | 3300009551 | Ga0105238_10005518 | Ga0105238_100055187 | 199 |
| 405 | 3300009551 | Ga0105238_10008791 | Ga0105238_100087916 | 199 |
| 406 | 3300009551 | Ga0105238_10052809 | Ga0105238_100528094 | 199 |
| 407 | 3300009551 | Ga0105238_10249676 | Ga0105238_102496762 | 199 |
| 408 | 3300009551 | Ga0105238_10267289 | Ga0105238_102672892 | 199 |
| 409 | 3300009551 | Ga0105238_10350416 | Ga0105238_103504162 | 199 |
| 410 | 3300009551 | Ga0105238_10466557 | Ga0105238_104665572 | 199 |
| 411 | 3300009551 | Ga0105238_10482452 | Ga0105238_104824522 | 199 |
| 412 | 3300009553 | Ga0105249_10328780 | Ga0105249_103287803 | 199 |
| 413 | 3300009553 | Ga0105249_10656068 | Ga0105249_106560682 | 199 |
| 414 | 3300009553 | Ga0105249_10930699 | Ga0105249_109306991 | 199 |
| 415 | 3300010159 | Ga0099796_10099874 | Ga0099796_100998742 | 199 |
| 416 | 3300010375 | Ga0105239_10002519 | Ga0105239_1000251917 | 199 |
| 417 | 3300010375 | Ga0105239_10009940 | Ga0105239_100099405 | 199 |
| 418 | 3300010375 | Ga0105239_10104111 | Ga0105239_101041114 | 199 |
| 419 | 3300010375 | Ga0105239_10201950 | Ga0105239_102019503 | 199 |
| 420 | 3300010375 | Ga0105239_10342564 | Ga0105239_103425643 | 199 |
| 421 | 3300010375 | Ga0105239_11632647 | Ga0105239_116326471 | 199 |
| 422 | 3300011119 | Ga0105246_10005044 | Ga0105246_100050443 | 199 |
| 423 | 3300011119 | Ga0105246_10117613 | Ga0105246_101176133 | 199 |
| 424 | 3300011119 | Ga0105246_10214512 | Ga0105246_102145122 | 199 |
| 425 | 3300011119 | Ga0105246_10372388 | Ga0105246_103723883 | 199 |
| 426 | 3300011119 | Ga0105246_10842591 | Ga0105246_108425911 | 199 |
| 427 | 3300013100 | Ga0157373_10130680 | Ga0157373_101306802 | 199 |
| 428 | 3300013102 | Ga0157371_10037614 | Ga0157371_100376144 | 199 |
| 429 | 3300013104 | Ga0157370_10023260 | Ga0157370_100232604 | 199 |
| 430 | 3300013104 | Ga0157370_10079949 | Ga0157370_100799493 | 199 |
| 431 | 3300013104 | Ga0157370_10124200 | Ga0157370_101242003 | 199 |
| 432 | 3300013104 | Ga0157370_10140192 | Ga0157370_101401922 | 199 |
| 433 | 3300013105 | Ga0157369_10001511 | Ga0157369_1000151127 | 199 |
| 434 | 3300013296 | Ga0157374_10139727 | Ga0157374_101397273 | 199 |
| 435 | 3300013297 | Ga0157378_10351344 | Ga0157378_103513442 | 199 |
| 436 | 3300013297 | Ga0157378_10421925 | Ga0157378_104219252 | 199 |
| 437 | 3300013297 | Ga0157378_11208769 | Ga0157378_112087691 | 199 |
| 438 | 3300013306 | Ga0163162_10116570 | Ga0163162_101165703 | 199 |
| 439 | 3300013306 | Ga0163162_10166483 | Ga0163162_101664833 | 199 |
| 440 | 3300013306 | Ga0163162_10373550 | Ga0163162_103735502 | 199 |
| 441 | 3300013306 | Ga0163162_10650546 | Ga0163162_106505462 | 199 |
| 442 | 3300013307 | Ga0157372_10040215 | Ga0157372_100402154 | 199 |
| 443 | 3300013308 | Ga0157375_10231803 | Ga0157375_102318033 | 199 |
| 444 | 3300013308 | Ga0157375_10320471 | Ga0157375_103204713 | 199 |
| 445 | 3300014325 | Ga0163163_10264855 | Ga0163163_102648551 | 199 |
| 446 | 3300014325 | Ga0163163_10591191 | Ga0163163_105911912 | 199 |
| 447 | 3300014325 | Ga0163163_11050540 | Ga0163163_110505402 | 199 |
| 448 | 3300014326 | Ga0157380_10364798 | Ga0157380_103647982 | 199 |
| 449 | 3300014326 | Ga0157380_10404689 | Ga0157380_104046892 | 199 |
| 450 | 3300014326 | Ga0157380_10657898 | Ga0157380_106578982 | 199 |
| 451 | 3300014968 | Ga0157379_10549392 | Ga0157379_105493922 | 199 |
| 452 | 3300014968 | Ga0157379_10796082 | Ga0157379_107960822 | 199 |
| 453 | 3300014969 | Ga0157376_10558919 | Ga0157376_105589191 | 199 |
| 454 | 3300015262 | Ga0182007_10106263 | Ga0182007_101062631 | 199 |
| 455 | 3300017792 | Ga0163161_10170239 | Ga0163161_101702392 | 199 |
| 456 | 3300017792 | Ga0163161_10664779 | Ga0163161_106647792 | 199 |
| 457 | 3300021320 | Ga0214544_1000016 | Ga0214544_1000016178 | 199 |
| 458 | 3300021321 | Ga0214542_1000016 | Ga0214542_100001624 | 199 |
| 459 | 3300021324 | Ga0214545_1000008 | Ga0214545_100000830 | 199 |
| 460 | 3300021327 | Ga0214543_1001466 | Ga0214543_100146624 | 199 |
| 461 | 3300021361 | Ga0213872_10028176 | Ga0213872_100281762 | 199 |
| 462 | 3300021377 | Ga0213874_10006393 | Ga0213874_100063932 | 199 |
| 463 | 3300021377 | Ga0213874_10142192 | Ga0213874_101421921 | 199 |
| 464 | 3300025321 | Ga0207656_10040764 | Ga0207656_100407642 | 199 |
| 465 | 3300025321 | Ga0207656_10059443 | Ga0207656_100594432 | 199 |
| 466 | 3300025898 | Ga0207692_10046169 | Ga0207692_100461693 | 199 |
| 467 | 3300025899 | Ga0207642_10039639 | Ga0207642_100396392 | 199 |
| 468 | 3300025900 | Ga0207710_10048533 | Ga0207710_100485333 | 199 |
| 469 | 3300025900 | Ga0207710_10165869 | Ga0207710_101658692 | 199 |
| 470 | 3300025900 | Ga0207710_10346458 | Ga0207710_103464582 | 199 |
| 471 | 3300025901 | Ga0207688_10037124 | Ga0207688_100371242 | 199 |
| 472 | 3300025901 | Ga0207688_10112404 | Ga0207688_101124043 | 199 |
| 473 | 3300025901 | Ga0207688_10113812 | Ga0207688_101138123 | 199 |
| 474 | 3300025906 | Ga0207699_10003164 | Ga0207699_100031647 | 199 |
| 475 | 3300025906 | Ga0207699_10017915 | Ga0207699_100179152 | 199 |
| 476 | 3300025907 | Ga0207645_10084239 | Ga0207645_100842392 | 199 |
| 477 | 3300025908 | Ga0207643_10026615 | Ga0207643_100266152 | 199 |
| 478 | 3300025909 | Ga0207705_10592809 | Ga0207705_105928091 | 199 |
| 479 | 3300025909 | Ga0207705_10998734 | Ga0207705_109987341 | 199 |
| 480 | 3300025910 | Ga0207684_10108541 | Ga0207684_101085412 | 199 |
| 481 | 3300025911 | Ga0207654_10000058 | Ga0207654_1000005866 | 199 |
| 482 | 3300025911 | Ga0207654_10272128 | Ga0207654_102721282 | 199 |
| 483 | 3300025912 | Ga0207707_10004287 | Ga0207707_1000428716 | 199 |
| 484 | 3300025913 | Ga0207695_10000453 | Ga0207695_1000045351 | 199 |
| 485 | 3300025913 | Ga0207695_10015308 | Ga0207695_1001530810 | 199 |
| 486 | 3300025914 | Ga0207671_10230893 | Ga0207671_102308933 | 199 |
| 487 | 3300025914 | Ga0207671_10264270 | Ga0207671_102642702 | 199 |
| 488 | 3300025914 | Ga0207671_10406284 | Ga0207671_104062842 | 199 |
| 489 | 3300025915 | Ga0207693_10013676 | Ga0207693_100136762 | 199 |
| 490 | 3300025915 | Ga0207693_10028589 | Ga0207693_100285892 | 199 |
| 491 | 3300025915 | Ga0207693_10384341 | Ga0207693_103843412 | 199 |
| 492 | 3300025917 | Ga0207660_10001366 | Ga0207660_100013661 | 199 |
| 493 | 3300025919 | Ga0207657_10001686 | Ga0207657_100016865 | 199 |
| 494 | 3300025919 | Ga0207657_10247870 | Ga0207657_102478702 | 199 |
| 495 | 3300025920 | Ga0207649_10094472 | Ga0207649_100944722 | 199 |
| 496 | 3300025920 | Ga0207649_10583769 | Ga0207649_105837691 | 199 |
| 497 | 3300025921 | Ga0207652_10118808 | Ga0207652_101188082 | 199 |
| 498 | 3300025921 | Ga0207652_10318114 | Ga0207652_103181142 | 199 |
| 499 | 3300025922 | Ga0207646_10095001 | Ga0207646_100950013 | 199 |
| 500 | 3300025924 | Ga0207694_10001512 | Ga0207694_1000151220 | 199 |
| 501 | 3300025924 | Ga0207694_10053306 | Ga0207694_100533062 | 199 |
| 502 | 3300025926 | Ga0207659_10238898 | Ga0207659_102388982 | 199 |
| 503 | 3300025927 | Ga0207687_10012464 | Ga0207687_100124643 | 199 |
| 504 | 3300025927 | Ga0207687_10801348 | Ga0207687_108013481 | 199 |
| 505 | 3300025928 | Ga0207700_10001418 | Ga0207700_100014189 | 199 |
| 506 | 3300025928 | Ga0207700_10021571 | Ga0207700_100215713 | 199 |
| 507 | 3300025928 | Ga0207700_10061793 | Ga0207700_100617934 | 199 |
| 508 | 3300025928 | Ga0207700_10155228 | Ga0207700_101552282 | 199 |
| 509 | 3300025928 | Ga0207700_10850491 | Ga0207700_108504911 | 199 |
| 510 | 3300025929 | Ga0207664_10036266 | Ga0207664_100362665 | 199 |
| 511 | 3300025929 | Ga0207664_10192569 | Ga0207664_101925692 | 199 |
| 512 | 3300025931 | Ga0207644_10044608 | Ga0207644_100446083 | 199 |
| 513 | 3300025931 | Ga0207644_10113029 | Ga0207644_101130293 | 199 |
| 514 | 3300025931 | Ga0207644_10193983 | Ga0207644_101939832 | 199 |
| 515 | 3300025932 | Ga0207690_10344343 | Ga0207690_103443432 | 199 |
| 516 | 3300025933 | Ga0207706_10198707 | Ga0207706_101987072 | 199 |
| 517 | 3300025933 | Ga0207706_10275241 | Ga0207706_102752412 | 199 |
| 518 | 3300025933 | Ga0207706_10576759 | Ga0207706_105767592 | 199 |
| 519 | 3300025934 | Ga0207686_10352073 | Ga0207686_103520732 | 199 |
| 520 | 3300025935 | Ga0207709_10149746 | Ga0207709_101497462 | 199 |
| 521 | 3300025935 | Ga0207709_10507424 | Ga0207709_105074241 | 199 |
| 522 | 3300025935 | Ga0207709_10745270 | Ga0207709_107452702 | 199 |
| 523 | 3300025935 | Ga0207709_10929266 | Ga0207709_109292661 | 199 |
| 524 | 3300025936 | Ga0207670_10117959 | Ga0207670_101179593 | 199 |
| 525 | 3300025938 | Ga0207704_10131323 | Ga0207704_101313232 | 199 |
| 526 | 3300025938 | Ga0207704_10621507 | Ga0207704_106215071 | 199 |
| 527 | 3300025939 | Ga0207665_10006611 | Ga0207665_100066117 | 199 |
| 528 | 3300025939 | Ga0207665_10009684 | Ga0207665_100096845 | 199 |
| 529 | 3300025940 | Ga0207691_10040766 | Ga0207691_100407665 | 199 |
| 530 | 3300025940 | Ga0207691_10086631 | Ga0207691_100866313 | 199 |
| 531 | 3300025941 | Ga0207711_10074404 | Ga0207711_100744044 | 199 |
| 532 | 3300025941 | Ga0207711_10256754 | Ga0207711_102567543 | 199 |
| 533 | 3300025941 | Ga0207711_10272176 | Ga0207711_102721762 | 199 |
| 534 | 3300025942 | Ga0207689_10124850 | Ga0207689_101248502 | 199 |
| 535 | 3300025944 | Ga0207661_10063954 | Ga0207661_100639544 | 199 |
| 536 | 3300025944 | Ga0207661_11058632 | Ga0207661_110586321 | 199 |
| 537 | 3300025945 | Ga0207679_10505844 | Ga0207679_105058442 | 199 |
| 538 | 3300025949 | Ga0207667_10002324 | Ga0207667_1000232422 | 199 |
| 539 | 3300025949 | Ga0207667_10015224 | Ga0207667_100152246 | 199 |
| 540 | 3300025949 | Ga0207667_10033395 | Ga0207667_100333955 | 199 |
| 541 | 3300025949 | Ga0207667_10488784 | Ga0207667_104887841 | 199 |
| 542 | 3300025960 | Ga0207651_10933308 | Ga0207651_109333082 | 199 |
| 543 | 3300025961 | Ga0207712_10096412 | Ga0207712_100964123 | 199 |
| 544 | 3300025961 | Ga0207712_10462446 | Ga0207712_104624462 | 199 |
| 545 | 3300025972 | Ga0207668_10089525 | Ga0207668_100895253 | 199 |
| 546 | 3300025972 | Ga0207668_10125277 | Ga0207668_101252772 | 199 |
| 547 | 3300025972 | Ga0207668_10199380 | Ga0207668_101993802 | 199 |
| 548 | 3300025972 | Ga0207668_10215261 | Ga0207668_102152613 | 199 |
| 549 | 3300025981 | Ga0207640_10070630 | Ga0207640_100706303 | 199 |
| 550 | 3300025981 | Ga0207640_10076689 | Ga0207640_100766893 | 199 |
| 551 | 3300025986 | Ga0207658_10077192 | Ga0207658_100771923 | 199 |
| 552 | 3300025986 | Ga0207658_10843502 | Ga0207658_108435021 | 199 |
| 553 | 3300026023 | Ga0207677_10232797 | Ga0207677_102327971 | 199 |
| 554 | 3300026023 | Ga0207677_10774625 | Ga0207677_107746251 | 199 |
| 555 | 3300026035 | Ga0207703_10139249 | Ga0207703_101392494 | 199 |
| 556 | 3300026035 | Ga0207703_10151133 | Ga0207703_101511332 | 199 |
| 557 | 3300026035 | Ga0207703_10524942 | Ga0207703_105249422 | 199 |
| 558 | 3300026035 | Ga0207703_10700143 | Ga0207703_107001432 | 199 |
| 559 | 3300026041 | Ga0207639_10002317 | Ga0207639_1000231710 | 199 |
| 560 | 3300026041 | Ga0207639_10074649 | Ga0207639_100746493 | 199 |
| 561 | 3300026041 | Ga0207639_10260361 | Ga0207639_102603612 | 199 |
| 562 | 3300026041 | Ga0207639_10681899 | Ga0207639_106818991 | 199 |
| 563 | 3300026041 | Ga0207639_10893142 | Ga0207639_108931421 | 199 |
| 564 | 3300026067 | Ga0207678_10004832 | Ga0207678_100048325 | 199 |
| 565 | 3300026067 | Ga0207678_10033003 | Ga0207678_100330032 | 199 |
| 566 | 3300026067 | Ga0207678_10039914 | Ga0207678_100399143 | 199 |
| 567 | 3300026067 | Ga0207678_10051427 | Ga0207678_100514273 | 199 |
| 568 | 3300026067 | Ga0207678_10138078 | Ga0207678_101380782 | 199 |
| 569 | 3300026075 | Ga0207708_10160385 | Ga0207708_101603852 | 199 |
| 570 | 3300026075 | Ga0207708_10255758 | Ga0207708_102557582 | 199 |
| 571 | 3300026078 | Ga0207702_10000004 | Ga0207702_10000004249 | 199 |
| 572 | 3300026078 | Ga0207702_10001701 | Ga0207702_1000170111 | 199 |
| 573 | 3300026078 | Ga0207702_10246470 | Ga0207702_102464701 | 199 |
| 574 | 3300026078 | Ga0207702_10507957 | Ga0207702_105079572 | 199 |
| 575 | 3300026088 | Ga0207641_10130986 | Ga0207641_101309862 | 199 |
| 576 | 3300026089 | Ga0207648_10027306 | Ga0207648_100273064 | 199 |
| 577 | 3300026116 | Ga0207674_10046110 | Ga0207674_100461104 | 199 |
| 578 | 3300026116 | Ga0207674_10050784 | Ga0207674_100507843 | 199 |
| 579 | 3300026116 | Ga0207674_10175241 | Ga0207674_101752414 | 199 |
| 580 | 3300026118 | Ga0207675_100101390 | Ga0207675_1001013901 | 199 |
| 581 | 3300026118 | Ga0207675_100167244 | Ga0207675_1001672443 | 199 |
| 582 | 3300026118 | Ga0207675_100272050 | Ga0207675_1002720501 | 199 |
| 583 | 3300026121 | Ga0207683_10115556 | Ga0207683_101155562 | 199 |
| 584 | 3300026121 | Ga0207683_10125927 | Ga0207683_101259273 | 199 |
| 585 | 3300026121 | Ga0207683_10175440 | Ga0207683_101754402 | 199 |
| 586 | 3300026121 | Ga0207683_10310250 | Ga0207683_103102502 | 199 |
| 587 | 3300026121 | Ga0207683_10534210 | Ga0207683_105342102 | 199 |
| 588 | 3300026142 | Ga0207698_10495249 | Ga0207698_104952492 | 199 |
| 589 | 3300026142 | Ga0207698_10803187 | Ga0207698_108031872 | 199 |
| 590 | 3300027512 | Ga0209179_1030015 | Ga0209179_10300152 | 199 |
| 591 | 3300027671 | Ga0209588_1003941 | Ga0209588_10039415 | 199 |
| 592 | 3300027671 | Ga0209588_1048049 | Ga0209588_10480492 | 199 |
| 593 | 3300027907 | Ga0207428_10287250 | Ga0207428_102872502 | 199 |
| 594 | 3300028379 | Ga0268266_10001190 | Ga0268266_1000119011 | 199 |
| 595 | 3300028379 | Ga0268266_10026048 | Ga0268266_100260482 | 199 |
| 596 | 3300028379 | Ga0268266_10476481 | Ga0268266_104764812 | 199 |
| 597 | 3300028379 | Ga0268266_10700181 | Ga0268266_107001812 | 199 |
| 598 | 3300028379 | Ga0268266_10731636 | Ga0268266_107316362 | 199 |
| 599 | 3300028380 | Ga0268265_10154937 | Ga0268265_101549372 | 199 |
| 600 | 3300028380 | Ga0268265_10192622 | Ga0268265_101926222 | 199 |
| 601 | 3300028380 | Ga0268265_10332195 | Ga0268265_103321952 | 199 |
| 602 | 3300028380 | Ga0268265_10916809 | Ga0268265_109168092 | 199 |
| 603 | 3300028381 | Ga0268264_10000062 | Ga0268264_100000629 | 199 |
| 604 | 3300028381 | Ga0268264_10675374 | Ga0268264_106753742 | 199 |
| 605 | 3300031090 | Ga0265760_10108075 | Ga0265760_101080752 | 199 |
| 606 | 3300031235 | Ga0265330_10097393 | Ga0265330_100973932 | 199 |
| 607 | 3300031241 | Ga0265325_10010784 | Ga0265325_100107845 | 199 |
| 608 | 3300031249 | Ga0265339_10001062 | Ga0265339_100010625 | 199 |
| 609 | 3300031250 | Ga0265331_10242966 | Ga0265331_102429662 | 199 |
| 610 | 3300031344 | Ga0265316_10085292 | Ga0265316_100852923 | 199 |
| 611 | 3300031456 | Ga0307513_10530039 | Ga0307513_105300392 | 199 |
| 612 | 3300031507 | Ga0307509_10067311 | Ga0307509_100673113 | 199 |
| 613 | 3300031507 | Ga0307509_10080587 | Ga0307509_100805873 | 199 |
| 614 | 3300031507 | Ga0307509_10135766 | Ga0307509_101357662 | 199 |
| 615 | 3300031595 | Ga0265313_10036979 | Ga0265313_100369793 | 199 |
| 616 | 3300031616 | Ga0307508_10000002 | Ga0307508_1000000253 | 199 |
| 617 | 3300031616 | Ga0307508_10020190 | Ga0307508_100201906 | 199 |
| 618 | 3300031616 | Ga0307508_10234793 | Ga0307508_102347931 | 199 |
| 619 | 3300031616 | Ga0307508_10360973 | Ga0307508_103609731 | 199 |
| 620 | 3300031711 | Ga0265314_10042090 | Ga0265314_100420902 | 199 |
| 621 | 3300031711 | Ga0265314_10290674 | Ga0265314_102906742 | 199 |
| 622 | 3300031730 | Ga0307516_10008308 | Ga0307516_100083087 | 199 |
| 623 | 3300031730 | Ga0307516_10022504 | Ga0307516_100225045 | 199 |
| 624 | 3300031730 | Ga0307516_10093671 | Ga0307516_100936712 | 199 |
| 625 | 3300031730 | Ga0307516_10150525 | Ga0307516_101505254 | 199 |
| 626 | 3300031730 | Ga0307516_10258910 | Ga0307516_102589102 | 199 |
| 627 | 3300032002 | Ga0307416_100387171 | Ga0307416_1003871712 | 199 |
| 628 | 3300032002 | Ga0307416_100779764 | Ga0307416_1007797642 | 199 |
| 629 | 3300032004 | Ga0307414_10502419 | Ga0307414_105024192 | 199 |
| 630 | 3300032005 | Ga0307411_10334911 | Ga0307411_103349111 | 199 |
| 631 | 3300033179 | Ga0307507_10019178 | Ga0307507_100191783 | 199 |
| 632 | 3300033180 | Ga0307510_10001271 | Ga0307510_100012713 | 199 |
| 633 | 3300033180 | Ga0307510_10037056 | Ga0307510_100370564 | 199 |
| 634 | 3300033180 | Ga0307510_10257573 | Ga0307510_102575732 | 199 |
| 635 | 3300033180 | Ga0307510_10352771 | Ga0307510_103527711 | 199 |
| 636 | 3300033544 | Ga0316215_1016178 | Ga0316215_10161781 | 199 |
| 637 | 3300035085 | Ga0373929_0025129 | Ga0373929_0025129_214_813 | 199 |
| 638 | 3300035121 | Ga0373960_0045134 | Ga0373960_0045134_578_1177 | 199 |
| 639 | 3300035170 | Ga0373943_0050697 | Ga0373943_0050697_486_1085 | 199 |
| 640 | 3300035207 | Ga0373942_0010998 | Ga0373942_0010998_1314_1913 | 199 |
| 641 | 3300035241 | Ga0373961_0028592 | Ga0373961_0028592_656_1255 | 199 |
| 642 | 3300035691 | Ga0373931_0004670 | Ga0373931_0004670_1891_2490 | 199 |
| 643 | 3300035691 | Ga0373931_0017858 | Ga0373931_0017858_262_861 | 199 |
| 644 | 3300035691 | Ga0373931_0191093 | Ga0373931_0191093_62_661 | 199 |
| 645 | 3300035695 | Ga0373927_0029245 | Ga0373927_0029245_766_1365 | 199 |
| 646 | 3300035695 | Ga0373927_0114291 | Ga0373927_0114291_607_1206 | 199 |
| 647 | 3300035695 | Ga0373927_0125611 | Ga0373927_0125611_448_1047 | 199 |
| 648 | 3300035724 | Ga0373933_0000031 | Ga0373933_0000031_37972_38601 | 199 |
| 649 | 3300035725 | Ga0373947_0177924 | Ga0373947_0177924_87_686 | 199 |
| 650 | 3300036401 | Ga0373937_0728202 | Ga0373937_0728202_90_689 | 199 |
| 651 | 3300037068 | Ga0373925_0011818 | Ga0373925_0011818_4746_5345 | 199 |
| 652 | 3300037068 | Ga0373925_0021659 | Ga0373925_0021659_1885_2484 | 199 |
| 653 | 3300037068 | Ga0373925_0045376 | Ga0373925_0045376_2378_2977 | 199 |
| 654 | 3300037068 | Ga0373925_0205311 | Ga0373925_0205311_759_1358 | 199 |
| 655 | 3300037068 | Ga0373925_0254469 | Ga0373925_0254469_106_705 | 199 |
| 656 | 3300037312 | Ga0395899_0157553 | Ga0395899_0157553_684_1283 | 199 |
| 657 | 3300037418 | Ga0395900_0010780 | Ga0395900_0010780_7252_7851 | 199 |
| 658 | 3300037466 | Ga0395898_0157786 | Ga0395898_0157786_1454_2053 | 199 |
| 659 | 3300037471 | Ga0395905_0707422 | Ga0395905_0707422_140_745 | 199 |
| 660 | 3300038443 | Ga0395901_0246919 | Ga0395901_0246919_1170_1769 | 199 |
| 661 | 3300039437 | Ga0436365_1482520 | Ga0436365_1482520_130_729 | 199 |
| 662 | 3300039438 | Ga0436360_0322292 | Ga0436360_0322292_94_693 | 199 |
| 663 | 3300039447 | Ga0436361_0097947 | Ga0436361_0097947_502_1101 | 199 |
| 664 | 3300039447 | Ga0436361_0681508 | Ga0436361_0681508_743_1342 | 199 |
| 665 | 3300039447 | Ga0436361_0875210 | Ga0436361_0875210_998_1606 | 199 |
| 666 | 3300039450 | Ga0436363_0863782 | Ga0436363_0863782_2474_3073 | 199 |
| 667 | 3300039450 | Ga0436363_1043665 | Ga0436363_1043665_2867_3502 | 199 |
| 668 | 3300039450 | Ga0436363_1148766 | Ga0436363_1148766_1308_1907 | 199 |
| 669 | 3300039453 | Ga0436362_1113554 | Ga0436362_1113554_480_1079 | 199 |
| 670 | 3300041456 | Ga0451795_0763978 | Ga0451795_0763978_91_690 | 199 |
| 671 | 3300044765 | Ga0466970_0080158 | Ga0466970_0080158_384_983 | 199 |
| 672 | 3300046455 | Ga0495603_0022882 | Ga0495603_0022882_1148_1747 | 199 |
| 673 | 3300046455 | Ga0495603_0041392 | Ga0495603_0041392_590_1189 | 199 |
| 674 | 3300046455 | Ga0495603_0228551 | Ga0495603_0228551_201_800 | 199 |
| 675 | 3300046459 | Ga0495629_0291853 | Ga0495629_0291853_422_1021 | 199 |
| 676 | 3300046460 | Ga0495638_0165373 | Ga0495638_0165373_278_877 | 199 |
| 677 | 3300046460 | Ga0495638_0420853 | Ga0495638_0420853_49_648 | 199 |
| 678 | 3300046471 | Ga0495650_0044198 | Ga0495650_0044198_111_710 | 199 |
| 679 | 3300046472 | Ga0495580_0070458 | Ga0495580_0070458_681_1280 | 199 |
| 680 | 3300046472 | Ga0495580_0404100 | Ga0495580_0404100_26_625 | 199 |
| 681 | 3300046475 | Ga0495639_0080665 | Ga0495639_0080665_257_856 | 199 |
| 682 | 3300046475 | Ga0495639_0248718 | Ga0495639_0248718_88_687 | 199 |
| 683 | 3300046491 | Ga0495584_0084814 | Ga0495584_0084814_566_1165 | 199 |
| 684 | 3300046491 | Ga0495584_0227340 | Ga0495584_0227340_332_931 | 199 |
| 685 | 3300046491 | Ga0495584_0275155 | Ga0495584_0275155_176_793 | 199 |
| 686 | 3300046491 | Ga0495584_0327240 | Ga0495584_0327240_88_687 | 199 |
| 687 | 3300046492 | Ga0495585_0062573 | Ga0495585_0062573_461_1060 | 199 |
| 688 | 3300046499 | Ga0495594_0207286 | Ga0495594_0207286_22_621 | 199 |
| 689 | 3300046507 | Ga0495606_0000252 | Ga0495606_0000252_62526_63125 | 199 |
| 690 | 3300046515 | Ga0495620_0070873 | Ga0495620_0070873_113_712 | 199 |
| 691 | 3300046517 | Ga0495630_0584040 | Ga0495630_0584040_173_772 | 199 |
| 692 | 3300046518 | Ga0495631_0046368 | Ga0495631_0046368_1017_1616 | 199 |
| 693 | 3300046518 | Ga0495631_0138713 | Ga0495631_0138713_208_807 | 199 |
| 694 | 3300046520 | Ga0495637_0090251 | Ga0495637_0090251_102_701 | 199 |
| 695 | 3300046523 | Ga0495644_0077902 | Ga0495644_0077902_168_767 | 199 |
| 696 | 3300046524 | Ga0495648_0000286 | Ga0495648_0000286_23735_24334 | 199 |
| 697 | 3300046524 | Ga0495648_0046985 | Ga0495648_0046985_636_1235 | 199 |
| 698 | 3300046528 | Ga0495642_0145448 | Ga0495642_0145448_129_728 | 199 |
| 699 | 3300046529 | Ga0495652_0098222 | Ga0495652_0098222_509_1108 | 199 |
| 700 | 3300046535 | Ga0495586_0328230 | Ga0495586_0328230_130_729 | 199 |
| 701 | 3300046537 | Ga0495598_0088588 | Ga0495598_0088588_338_937 | 199 |
| 702 | 3300046539 | Ga0495621_0096498 | Ga0495621_0096498_152_751 | 199 |
| 703 | 3300046557 | Ga0495622_0049774 | Ga0495622_0049774_37_636 | 199 |
| 704 | 3300046557 | Ga0495622_0075011 | Ga0495622_0075011_780_1379 | 199 |
| 705 | 3300046615 | Ga0495656_0034075 | Ga0495656_0034075_147_746 | 199 |
| 706 | 3300046615 | Ga0495656_0416350 | Ga0495656_0416350_70_669 | 199 |
| 707 | 3300046616 | Ga0495668_0100889 | Ga0495668_0100889_794_1393 | 199 |
| 708 | 3300046616 | Ga0495668_0108076 | Ga0495668_0108076_864_1463 | 199 |
| 709 | 3300046660 | Ga0495625_0233480 | Ga0495625_0233480_159_758 | 199 |
| 710 | 3300046660 | Ga0495625_0296762 | Ga0495625_0296762_153_752 | 199 |
| 711 | 3300046665 | Ga0495661_0253461 | Ga0495661_0253461_22_621 | 199 |
| 712 | 3300046674 | Ga0495588_0146389 | Ga0495588_0146389_604_1203 | 199 |
| 713 | 3300046678 | Ga0495599_0093140 | Ga0495599_0093140_230_829 | 199 |
| 714 | 3300046681 | Ga0495647_0011225 | Ga0495647_0011225_690_1289 | 199 |
| 715 | 3300046681 | Ga0495647_0097360 | Ga0495647_0097360_195_794 | 199 |
| 716 | 3300046683 | Ga0495658_0018626 | Ga0495658_0018626_2503_3102 | 199 |
| 717 | 3300046683 | Ga0495658_0618086 | Ga0495658_0618086_60_659 | 199 |
| 718 | 3300046684 | Ga0495669_0032781 | Ga0495669_0032781_1004_1603 | 199 |
| 719 | 3300046689 | Ga0495613_0446315 | Ga0495613_0446315_48_704 | 199 |
| 720 | 3300046690 | Ga0495624_0118306 | Ga0495624_0118306_439_1038 | 199 |
| 721 | 3300046691 | Ga0495670_0435125 | Ga0495670_0435125_28_627 | 199 |
| 722 | 3300046809 | Ga0495600_0170914 | Ga0495600_0170914_773_1372 | 199 |
| 723 | 3300047315 | Ga0495581_0068323 | Ga0495581_0068323_107_706 | 199 |
| 724 | 3300047315 | Ga0495581_0179658 | Ga0495581_0179658_366_965 | 199 |
| 725 | 3300047317 | Ga0495604_0302957 | Ga0495604_0302957_145_744 | 199 |
| 726 | 3300047318 | Ga0495636_0074437 | Ga0495636_0074437_438_1037 | 199 |
| 727 | 3300047318 | Ga0495636_0104856 | Ga0495636_0104856_447_1046 | 199 |
| 728 | 3300047318 | Ga0495636_0172527 | Ga0495636_0172527_198_797 | 199 |
| 729 | 3300047319 | Ga0495674_0153959 | Ga0495674_0153959_149_748 | 199 |
| 730 | 3300047319 | Ga0495674_0590965 | Ga0495674_0590965_70_669 | 199 |
| 731 | 3300047320 | Ga0495672_0025202 | Ga0495672_0025202_1900_2499 | 199 |
| 732 | 3300047320 | Ga0495672_0077897 | Ga0495672_0077897_174_773 | 199 |
| 733 | 3300047320 | Ga0495672_0079700 | Ga0495672_0079700_373_972 | 199 |
| 734 | 3300047321 | Ga0495676_0095553 | Ga0495676_0095553_327_926 | 199 |
| 735 | 3300047322 | Ga0495680_0296580 | Ga0495680_0296580_311_910 | 199 |
| 736 | 3300047445 | Ga0495677_0118251 | Ga0495677_0118251_212_811 | 199 |
| 737 | 3300047469 | Ga0495673_0163463 | Ga0495673_0163463_43_642 | 199 |
| 738 | 3300047472 | Ga0495686_0088808 | Ga0495686_0088808_155_754 | 199 |
| 739 | 3300048089 | Ga0495614_0149313 | Ga0495614_0149313_75_674 | 199 |
| 740 | 3300048090 | Ga0495615_0130569 | Ga0495615_0130569_93_692 | 199 |
| 741 | 3300048903 | Ga0496100_0004117 | Ga0496100_0004117_3030_3629 | 199 |
| 742 | 3300048903 | Ga0496100_0029796 | Ga0496100_0029796_2516_3115 | 199 |
| 743 | 3300048903 | Ga0496100_0127025 | Ga0496100_0127025_75_689 | 199 |
| 744 | 3300048904 | Ga0496101_0011916 | Ga0496101_0011916_1114_1713 | 199 |
| 745 | 3300048904 | Ga0496101_0104409 | Ga0496101_0104409_1382_1981 | 199 |
| 746 | 3300048904 | Ga0496101_0377482 | Ga0496101_0377482_200_799 | 199 |
| 747 | 3300048905 | Ga0496102_0001314 | Ga0496102_0001314_20128_20727 | 199 |
| 748 | 3300048905 | Ga0496102_0021069 | Ga0496102_0021069_3424_4023 | 199 |
| 749 | 3300048905 | Ga0496102_0063855 | Ga0496102_0063855_2172_2786 | 199 |
| 750 | 3300048905 | Ga0496102_0221475 | Ga0496102_0221475_1143_1742 | 199 |
| 751 | 3300048905 | Ga0496102_0591648 | Ga0496102_0591648_401_1000 | 199 |
| 752 | 3300048905 | Ga0496102_0977100 | Ga0496102_0977100_32_631 | 199 |
| 753 | 3300048906 | Ga0496103_0028346 | Ga0496103_0028346_1128_1727 | 199 |
| 754 | 3300048906 | Ga0496103_0234725 | Ga0496103_0234725_100_699 | 199 |
| 755 | 3300048906 | Ga0496103_0537337 | Ga0496103_0537337_138_737 | 199 |
| 756 | 3300048906 | Ga0496103_0544326 | Ga0496103_0544326_102_701 | 199 |
| 757 | 3300048907 | Ga0496104_0016536 | Ga0496104_0016536_157_756 | 199 |
| 758 | 3300048907 | Ga0496104_0110519 | Ga0496104_0110519_979_1578 | 199 |
| 759 | 3300048907 | Ga0496104_0114067 | Ga0496104_0114067_985_1599 | 199 |
| 760 | 3300048907 | Ga0496104_0433382 | Ga0496104_0433382_582_1181 | 199 |
| 761 | 3300048907 | Ga0496104_0471182 | Ga0496104_0471182_39_638 | 199 |
| 762 | 3300048908 | Ga0496105_0014585 | Ga0496105_0014585_4708_5307 | 199 |
| 763 | 3300048908 | Ga0496105_0258543 | Ga0496105_0258543_51_650 | 199 |
| 764 | 3300048908 | Ga0496105_0520008 | Ga0496105_0520008_285_884 | 199 |
| 765 | 3300048909 | Ga0496106_0001014 | Ga0496106_0001014_17288_17887 | 199 |
| 766 | 3300048909 | Ga0496106_0001270 | Ga0496106_0001270_17173_17772 | 199 |
| 767 | 3300048909 | Ga0496106_0013577 | Ga0496106_0013577_242_841 | 199 |
| 768 | 3300048909 | Ga0496106_0045060 | Ga0496106_0045060_378_977 | 199 |
| 769 | 3300048909 | Ga0496106_0739610 | Ga0496106_0739610_73_672 | 199 |
| 770 | 3300048909 | Ga0496106_0952486 | Ga0496106_0952486_24_623 | 199 |
| 771 | 3300048910 | Ga0496107_0006262 | Ga0496107_0006262_4662_5261 | 199 |
| 772 | 3300048910 | Ga0496107_0020391 | Ga0496107_0020391_1022_1621 | 199 |
| 773 | 3300048910 | Ga0496107_0062092 | Ga0496107_0062092_2025_2624 | 199 |
| 774 | 3300048910 | Ga0496107_0078321 | Ga0496107_0078321_364_963 | 199 |
| 775 | 3300048910 | Ga0496107_0116730 | Ga0496107_0116730_1160_1774 | 199 |
| 776 | 3300048910 | Ga0496107_0581617 | Ga0496107_0581617_95_694 | 199 |
| 777 | 3300048911 | Ga0496108_0000849 | Ga0496108_0000849_7776_8375 | 199 |
| 778 | 3300048911 | Ga0496108_0012923 | Ga0496108_0012923_2605_3204 | 199 |
| 779 | 3300048911 | Ga0496108_0034584 | Ga0496108_0034584_238_837 | 199 |
| 780 | 3300048912 | Ga0496109_0000224 | Ga0496109_0000224_9560_10159 | 199 |
| 781 | 3300048912 | Ga0496109_0064106 | Ga0496109_0064106_1595_2194 | 199 |
| 782 | 3300048912 | Ga0496109_0100121 | Ga0496109_0100121_1757_2356 | 199 |
| 783 | 3300048912 | Ga0496109_0133100 | Ga0496109_0133100_879_1493 | 199 |
| 784 | 3300048912 | Ga0496109_0184618 | Ga0496109_0184618_1178_1777 | 199 |
| 785 | 3300048913 | Ga0496110_0023127 | Ga0496110_0023127_3986_4585 | 199 |
| 786 | 3300048913 | Ga0496110_0026371 | Ga0496110_0026371_4106_4705 | 199 |
| 787 | 3300048913 | Ga0496110_0046440 | Ga0496110_0046440_1811_2410 | 199 |
| 788 | 3300048913 | Ga0496110_0058608 | Ga0496110_0058608_1042_1641 | 199 |
| 789 | 3300048913 | Ga0496110_0150730 | Ga0496110_0150730_614_1213 | 199 |
| 790 | 3300048913 | Ga0496110_0269459 | Ga0496110_0269459_652_1251 | 199 |
| 791 | 3300048914 | Ga0496111_0035701 | Ga0496111_0035701_2220_2819 | 199 |
| 792 | 3300048914 | Ga0496111_0144330 | Ga0496111_0144330_686_1285 | 199 |
| 793 | 3300048914 | Ga0496111_0176000 | Ga0496111_0176000_437_1036 | 199 |
| 794 | 3300048914 | Ga0496111_0390171 | Ga0496111_0390171_147_746 | 199 |
| 795 | 3300048915 | Ga0496112_0000020 | Ga0496112_0000020_65962_66561 | 199 |
| 796 | 3300048915 | Ga0496112_0001044 | Ga0496112_0001044_14952_15551 | 199 |
| 797 | 3300048915 | Ga0496112_0067958 | Ga0496112_0067958_1596_2195 | 199 |
| 798 | 3300048915 | Ga0496112_0227478 | Ga0496112_0227478_1063_1677 | 199 |
| 799 | 3300048915 | Ga0496112_0233518 | Ga0496112_0233518_749_1348 | 199 |
| 800 | 3300048915 | Ga0496112_0263016 | Ga0496112_0263016_271_870 | 199 |
| 801 | 3300048915 | Ga0496112_0414855 | Ga0496112_0414855_271_870 | 199 |
| 802 | 3300048915 | Ga0496112_0618856 | Ga0496112_0618856_47_646 | 199 |
| 803 | 3300048916 | Ga0496113_0008868 | Ga0496113_0008868_3003_3602 | 199 |
| 804 | 3300048916 | Ga0496113_0025475 | Ga0496113_0025475_3199_3798 | 199 |
| 805 | 3300048916 | Ga0496113_0060373 | Ga0496113_0060373_1815_2414 | 199 |
| 806 | 3300048916 | Ga0496113_0147382 | Ga0496113_0147382_72_671 | 199 |
| 807 | 3300048917 | Ga0496114_0022004 | Ga0496114_0022004_3001_3600 | 199 |
| 808 | 3300048917 | Ga0496114_0079926 | Ga0496114_0079926_976_1575 | 199 |
| 809 | 3300048917 | Ga0496114_0109926 | Ga0496114_0109926_1427_2026 | 199 |
| 810 | 3300048917 | Ga0496114_0161137 | Ga0496114_0161137_463_1062 | 199 |
| 811 | 3300048917 | Ga0496114_0332875 | Ga0496114_0332875_221_820 | 199 |
| 812 | 3300048917 | Ga0496114_0483655 | Ga0496114_0483655_428_1027 | 199 |
| 813 | 3300048918 | Ga0496115_0006071 | Ga0496115_0006071_2233_2832 | 199 |
| 814 | 3300048918 | Ga0496115_0027439 | Ga0496115_0027439_3664_4263 | 199 |
| 815 | 3300048918 | Ga0496115_0071898 | Ga0496115_0071898_1186_1785 | 199 |
| 816 | 3300048918 | Ga0496115_0151845 | Ga0496115_0151845_421_1020 | 199 |
| 817 | 3300048921 | Ga0496118_0003026 | Ga0496118_0003026_15992_16591 | 199 |
| 818 | 3300048922 | Ga0496119_0155543 | Ga0496119_0155543_302_901 | 199 |
| 819 | 3300048923 | Ga0496120_0055668 | Ga0496120_0055668_1193_1792 | 199 |
| 820 | 3300048923 | Ga0496120_0278171 | Ga0496120_0278171_122_721 | 199 |
| 821 | 3300048924 | Ga0496121_0000270 | Ga0496121_0000270_10480_11079 | 199 |
| 822 | 3300048924 | Ga0496121_0000370 | Ga0496121_0000370_6325_6924 | 199 |
| 823 | 3300048924 | Ga0496121_0063812 | Ga0496121_0063812_712_1311 | 199 |
| 824 | 3300048924 | Ga0496121_0096674 | Ga0496121_0096674_608_1222 | 199 |
| 825 | 3300048924 | Ga0496121_0410221 | Ga0496121_0410221_157_756 | 199 |
| 826 | 3300048924 | Ga0496121_0431766 | Ga0496121_0431766_26_643 | 199 |
| 827 | 3300048924 | Ga0496121_0435343 | Ga0496121_0435343_17_616 | 199 |
| 828 | 3300048927 | Ga0496124_0009011 | Ga0496124_0009011_182_781 | 199 |
| 829 | 3300048927 | Ga0496124_0137096 | Ga0496124_0137096_318_917 | 199 |
| 830 | 3300048928 | Ga0496125_0023759 | Ga0496125_0023759_1236_1835 | 199 |
| 831 | 3300048928 | Ga0496125_0057775 | Ga0496125_0057775_2230_2829 | 199 |
| 832 | 3300048928 | Ga0496125_0150436 | Ga0496125_0150436_902_1501 | 199 |
| 833 | 3300048929 | Ga0496126_0012762 | Ga0496126_0012762_1135_1734 | 199 |
| 834 | 3300048929 | Ga0496126_0022058 | Ga0496126_0022058_2600_3199 | 199 |
| 835 | 3300048929 | Ga0496126_0069770 | Ga0496126_0069770_1859_2458 | 199 |
| 836 | 3300048929 | Ga0496126_0265135 | Ga0496126_0265135_720_1319 | 199 |
| 837 | 3300048929 | Ga0496126_0435657 | Ga0496126_0435657_375_974 | 199 |
| 838 | 3300049460 | Ga0495682_0154637 | Ga0495682_0154637_164_763 | 199 |
| 839 | 3300049460 | Ga0495682_0174372 | Ga0495682_0174372_59_658 | 199 |
| 840 | 3300049568 | Ga0501031_0002683 | Ga0501031_0002683_1317_1916 | 199 |
| 841 | 3300049568 | Ga0501031_0009291 | Ga0501031_0009291_5186_5785 | 199 |
| 842 | 3300049569 | Ga0501032_0000475 | Ga0501032_0000475_25414_26013 | 199 |
| 843 | 3300049569 | Ga0501032_0008230 | Ga0501032_0008230_4508_5107 | 199 |
| 844 | 3300049569 | Ga0501032_0031443 | Ga0501032_0031443_1248_1847 | 199 |
| 845 | 3300049570 | Ga0501033_0000440 | Ga0501033_0000440_11840_12439 | 199 |
| 846 | 3300049570 | Ga0501033_0001499 | Ga0501033_0001499_16572_17171 | 199 |
| 847 | 3300049570 | Ga0501033_0075636 | Ga0501033_0075636_1389_1988 | 199 |
| 848 | 3300049570 | Ga0501033_0078940 | Ga0501033_0078940_1110_1709 | 199 |
| 849 | 3300049570 | Ga0501033_0409966 | Ga0501033_0409966_217_816 | 199 |
| 850 | 3300049571 | Ga0501034_0000250 | Ga0501034_0000250_31904_32503 | 199 |
| 851 | 3300049571 | Ga0501034_0497538 | Ga0501034_0497538_458_1057 | 199 |
| 852 | 3300049572 | Ga0501036_0000098 | Ga0501036_0000098_10648_11247 | 199 |
| 853 | 3300049572 | Ga0501036_0086684 | Ga0501036_0086684_172_771 | 199 |
| 854 | 3300049572 | Ga0501036_0150031 | Ga0501036_0150031_809_1408 | 199 |
| 855 | 3300049573 | Ga0501037_0000092 | Ga0501037_0000092_63134_63733 | 199 |
| 856 | 3300049573 | Ga0501037_0006812 | Ga0501037_0006812_3277_3876 | 199 |
| 857 | 3300049573 | Ga0501037_0130753 | Ga0501037_0130753_913_1512 | 199 |
| 858 | 3300049574 | Ga0501038_0000059 | Ga0501038_0000059_34170_34769 | 199 |
| 859 | 3300049574 | Ga0501038_0053622 | Ga0501038_0053622_1987_2586 | 199 |
| 860 | 3300049575 | Ga0501039_0000085 | Ga0501039_0000085_65024_65623 | 199 |
| 861 | 3300049575 | Ga0501039_0031807 | Ga0501039_0031807_1267_1866 | 199 |
| 862 | 3300049575 | Ga0501039_0041308 | Ga0501039_0041308_1059_1658 | 199 |
| 863 | 3300049575 | Ga0501039_0571167 | Ga0501039_0571167_59_658 | 199 |
| 864 | 3300049576 | Ga0501040_0007989 | Ga0501040_0007989_132_731 | 199 |
| 865 | 3300049578 | Ga0501042_0007618 | Ga0501042_0007618_5574_6173 | 199 |
| 866 | 3300049578 | Ga0501042_0023911 | Ga0501042_0023911_1480_2079 | 199 |
| 867 | 3300049578 | Ga0501042_0366990 | Ga0501042_0366990_289_888 | 199 |
| 868 | 3300049579 | Ga0501043_0001889 | Ga0501043_0001889_1837_2436 | 199 |
| 869 | 3300049579 | Ga0501043_0012702 | Ga0501043_0012702_754_1353 | 199 |
| 870 | 3300049579 | Ga0501043_0035424 | Ga0501043_0035424_1818_2417 | 199 |
| 871 | 3300049580 | Ga0501046_0000483 | Ga0501046_0000483_16798_17397 | 199 |
| 872 | 3300049580 | Ga0501046_0424969 | Ga0501046_0424969_302_901 | 199 |
| 873 | 3300049581 | Ga0501047_0000022 | Ga0501047_0000022_137937_138536 | 199 |
| 874 | 3300049581 | Ga0501047_0126511 | Ga0501047_0126511_1683_2282 | 199 |
| 875 | 3300049581 | Ga0501047_0133801 | Ga0501047_0133801_701_1300 | 199 |
| 876 | 3300049581 | Ga0501047_0202195 | Ga0501047_0202195_613_1212 | 199 |
| 877 | 3300049581 | Ga0501047_0470642 | Ga0501047_0470642_219_818 | 199 |
| 878 | 3300049581 | Ga0501047_0706463 | Ga0501047_0706463_154_753 | 199 |
| 879 | 3300049582 | Ga0501048_0000821 | Ga0501048_0000821_2803_3402 | 199 |
| 880 | 3300049582 | Ga0501048_0004230 | Ga0501048_0004230_4541_5140 | 199 |
| 881 | 3300049583 | Ga0501067_0000510 | Ga0501067_0000510_4782_5381 | 199 |
| 882 | 3300049584 | Ga0501068_0001239 | Ga0501068_0001239_3348_3947 | 199 |
| 883 | 3300049584 | Ga0501068_0025351 | Ga0501068_0025351_553_1152 | 199 |
| 884 | 3300049585 | Ga0501069_0000707 | Ga0501069_0000707_6007_6606 | 199 |
| 885 | 3300049586 | Ga0501070_0033229 | Ga0501070_0033229_3352_3951 | 199 |
| 886 | 3300049586 | Ga0501070_0107792 | Ga0501070_0107792_914_1513 | 199 |
| 887 | 3300049586 | Ga0501070_0140836 | Ga0501070_0140836_1027_1626 | 199 |
| 888 | 3300049586 | Ga0501070_0379836 | Ga0501070_0379836_484_1083 | 199 |
| 889 | 3300049588 | Ga0501072_0001923 | Ga0501072_0001923_13182_13781 | 199 |
| 890 | 3300049588 | Ga0501072_0004304 | Ga0501072_0004304_9897_10496 | 199 |
| 891 | 3300049588 | Ga0501072_0680925 | Ga0501072_0680925_138_737 | 199 |
| 892 | 3300049589 | Ga0501073_0000955 | Ga0501073_0000955_7593_8192 | 199 |
| 893 | 3300049590 | Ga0501074_0002275 | Ga0501074_0002275_11513_12112 | 199 |
| 894 | 3300049590 | Ga0501074_0006843 | Ga0501074_0006843_5022_5621 | 199 |
| 895 | 3300049593 | Ga0501077_0438941 | Ga0501077_0438941_183_782 | 199 |
| 896 | 3300049741 | Ga0501079_0003103 | Ga0501079_0003103_3302_3901 | 199 |
| 897 | 3300049741 | Ga0501079_0055474 | Ga0501079_0055474_140_739 | 199 |
| 898 | 3300049742 | Ga0501080_0009878 | Ga0501080_0009878_4428_5027 | 199 |
| 899 | 3300049742 | Ga0501080_0022030 | Ga0501080_0022030_5255_5854 | 199 |
| 900 | 3300049742 | Ga0501080_0079680 | Ga0501080_0079680_1899_2498 | 199 |
| 901 | 3300049744 | Ga0501083_0000808 | Ga0501083_0000808_2811_3410 | 199 |
| 902 | 3300049744 | Ga0501083_0013360 | Ga0501083_0013360_4288_4887 | 199 |
| 903 | 3300049822 | Ga0501035_0000240 | Ga0501035_0000240_7802_8401 | 199 |
| 904 | 3300049822 | Ga0501035_0005844 | Ga0501035_0005844_1340_1939 | 199 |
| 905 | 3300049822 | Ga0501035_0047034 | Ga0501035_0047034_2975_3574 | 199 |
| 906 | 3300049822 | Ga0501035_0166741 | Ga0501035_0166741_149_748 | 199 |
| 907 | 3300049822 | Ga0501035_0207315 | Ga0501035_0207315_584_1183 | 199 |
| 908 | 3300049822 | Ga0501035_0285637 | Ga0501035_0285637_588_1187 | 199 |
| 909 | 3300049822 | Ga0501035_0375815 | Ga0501035_0375815_387_986 | 199 |
| 910 | 3300049822 | Ga0501035_0381406 | Ga0501035_0381406_258_857 | 199 |
| 911 | 3300049823 | Ga0501044_0000072 | Ga0501044_0000072_24534_25133 | 199 |
| 912 | 3300049823 | Ga0501044_0056754 | Ga0501044_0056754_1523_2122 | 199 |
| 913 | 3300049823 | Ga0501044_0058319 | Ga0501044_0058319_1776_2375 | 199 |
| 914 | 3300049823 | Ga0501044_0100513 | Ga0501044_0100513_119_718 | 199 |
| 915 | 3300049823 | Ga0501044_0204541 | Ga0501044_0204541_55_654 | 199 |
| 916 | 3300049823 | Ga0501044_0331868 | Ga0501044_0331868_277_876 | 199 |
| 917 | 3300049823 | Ga0501044_0533877 | Ga0501044_0533877_25_624 | 199 |
| 918 | 3300049824 | Ga0501045_0027715 | Ga0501045_0027715_1657_2256 | 199 |
| 919 | 3300049824 | Ga0501045_0097380 | Ga0501045_0097380_1187_1786 | 199 |
| 920 | 3300049824 | Ga0501045_0413779 | Ga0501045_0413779_383_982 | 199 |
| 921 | 3300049824 | Ga0501045_0447216 | Ga0501045_0447216_59_658 | 199 |
| 922 | 3300050490 | nmdc:mga03n38_195224_c1 | nmdc:mga03n38_195224_c1_148_747 | 199 |
| 923 | 3300050491 | nmdc:mga00v17_143307_c1 | nmdc:mga00v17_143307_c1_406_1005 | 199 |
| 924 | 3300050491 | nmdc:mga00v17_321809_c1 | nmdc:mga00v17_321809_c1_275_874 | 199 |
| 925 | 3300050491 | nmdc:mga00v17_96068_c1 | nmdc:mga00v17_96068_c1_524_1123 | 199 |
| 926 | 3300050492 | nmdc:mga0yw44_261271_c1 | nmdc:mga0yw44_261271_c1_434_1033 | 199 |
| 927 | 3300050492 | nmdc:mga0yw44_298345_c1 | nmdc:mga0yw44_298345_c1_462_1064 | 199 |
| 928 | 3300050492 | nmdc:mga0yw44_40724_c1 | nmdc:mga0yw44_40724_c1_1075_1674 | 199 |
| 929 | 3300050492 | nmdc:mga0yw44_577130_c1 | nmdc:mga0yw44_577130_c1_132_731 | 199 |
| 930 | 3300050493 | nmdc:mga0k408_281081_c1 | nmdc:mga0k408_281081_c1_23_688 | 199 |
| 931 | 3300050493 | nmdc:mga0k408_30353_c1 | nmdc:mga0k408_30353_c1_2200_2799 | 199 |
| 932 | 3300050494 | nmdc:mga06z11_103955_c1 | nmdc:mga06z11_103955_c1_71_670 | 199 |
| 933 | 3300050494 | nmdc:mga06z11_146231_c1 | nmdc:mga06z11_146231_c1_553_1152 | 199 |
| 934 | 3300050494 | nmdc:mga06z11_2466_c1 | nmdc:mga06z11_2466_c1_770_1369 | 199 |
| 935 | 3300050494 | nmdc:mga06z11_302016_c1 | nmdc:mga06z11_302016_c1_105_707 | 199 |
| 936 | 3300050494 | nmdc:mga06z11_70041_c1 | nmdc:mga06z11_70041_c1_320_919 | 199 |
| 937 | 3300050495 | nmdc:mga04h51_109257_c1 | nmdc:mga04h51_109257_c1_144_743 | 199 |
| 938 | 3300050495 | nmdc:mga04h51_235645_c1 | nmdc:mga04h51_235645_c1_106_705 | 199 |
| 939 | 3300050496 | nmdc:mga07m45_15602_c1 | nmdc:mga07m45_15602_c1_244_843 | 199 |
| 940 | 3300050496 | nmdc:mga07m45_37768_c1 | nmdc:mga07m45_37768_c1_1464_2063 | 199 |
| 941 | 3300050507 | nmdc:mga05p37_187694_c1 | nmdc:mga05p37_187694_c1_795_1394 | 199 |
| 942 | 3300050507 | nmdc:mga05p37_36662_c1 | nmdc:mga05p37_36662_c1_3322_3921 | 199 |
| 943 | 3300050510 | nmdc:mga06r32_423628_c1 | nmdc:mga06r32_423628_c1_119_718 | 199 |
| 944 | 3300050511 | nmdc:mga08y16_31466_c1 | nmdc:mga08y16_31466_c1_27_626 | 199 |
| 945 | 3300050511 | nmdc:mga08y16_784760_c1 | nmdc:mga08y16_784760_c1_269_868 | 199 |
| 946 | 3300050511 | nmdc:mga08y16_78483_c1 | nmdc:mga08y16_78483_c1_2274_2873 | 199 |
| 947 | 3300050512 | nmdc:mga0n895_22473_c1 | nmdc:mga0n895_22473_c1_3725_4324 | 199 |
| 948 | 3300050512 | nmdc:mga0n895_324823_c1 | nmdc:mga0n895_324823_c1_545_1144 | 199 |
| 949 | 3300050514 | nmdc:mga08x19_248275_c1 | nmdc:mga08x19_248275_c1_355_954 | 199 |
| 950 | 3300050515 | nmdc:mga0a205_12409_c1 | nmdc:mga0a205_12409_c1_4734_5333 | 199 |
| 951 | 3300050515 | nmdc:mga0a205_344890_c1 | nmdc:mga0a205_344890_c1_335_934 | 199 |
| 952 | 3300050516 | nmdc:mga0sz30_276174_c1 | nmdc:mga0sz30_276174_c1_100_699 | 199 |
| 953 | 3300050516 | nmdc:mga0sz30_99000_c1 | nmdc:mga0sz30_99000_c1_166_765 | 199 |
| 954 | 3300053077 | Ga0495601_0055007 | Ga0495601_0055007_974_1585 | 199 |
| 955 | 3300053078 | Ga0495612_0137207 | Ga0495612_0137207_74_673 | 199 |
| 956 | 3300053080 | Ga0500635_0029344 | Ga0500635_0029344_839_1438 | 199 |
| 957 | 3300053083 | Ga0495655_0010741 | Ga0495655_0010741_1185_1784 | 199 |
| 958 | 3300053083 | Ga0495655_0035955 | Ga0495655_0035955_137_736 | 199 |
| 959 | 3300053084 | Ga0495595_0044803 | Ga0495595_0044803_554_1165 | 199 |
| 960 | 3300053085 | Ga0495619_0056307 | Ga0495619_0056307_128_739 | 199 |
| 961 | 3300053087 | Ga0500643_017666 | Ga0500643_017666_1314_1913 | 199 |
| 962 | 3300053091 | Ga0500647_0050713 | Ga0500647_0050713_29_628 | 199 |
| 963 | 3300053092 | Ga0500583_0114522 | Ga0500583_0114522_472_1071 | 199 |
| 964 | 3300053093 | Ga0500651_0007402 | Ga0500651_0007402_3093_3692 | 199 |
| 965 | 3300053094 | Ga0500566_0000151 | Ga0500566_0000151_31380_31979 | 199 |
| 966 | 3300053094 | Ga0500566_0000236 | Ga0500566_0000236_3210_3809 | 199 |
| 967 | 3300053094 | Ga0500566_0015485 | Ga0500566_0015485_656_1255 | 199 |
| 968 | 3300053094 | Ga0500566_0040552 | Ga0500566_0040552_1982_2581 | 199 |
| 969 | 3300053094 | Ga0500566_0137183 | Ga0500566_0137183_574_1173 | 199 |
| 970 | 3300053095 | Ga0500640_030939 | Ga0500640_030939_1450_2049 | 199 |
| 971 | 3300053096 | Ga0500641_0006119 | Ga0500641_0006119_2625_3224 | 199 |
| 972 | 3300053096 | Ga0500641_0050203 | Ga0500641_0050203_373_975 | 199 |
| 973 | 3300053102 | Ga0500554_010701 | Ga0500554_010701_1200_1799 | 199 |
| 974 | 3300053103 | Ga0500555_033932 | Ga0500555_033932_194_793 | 199 |
| 975 | 3300053108 | Ga0500562_010226 | Ga0500562_010226_689_1288 | 199 |
| 976 | 3300053109 | Ga0500569_132240 | Ga0500569_132240_197_796 | 199 |
| 977 | 3300053116 | Ga0500592_056069 | Ga0500592_056069_20_619 | 199 |
| 978 | 3300053118 | Ga0500594_0011933 | Ga0500594_0011933_560_1159 | 199 |
| 979 | 3300053119 | Ga0500595_006181 | Ga0500595_006181_1059_1673 | 199 |
| 980 | 3300053119 | Ga0500595_012681 | Ga0500595_012681_1896_2495 | 199 |
| 981 | 3300053119 | Ga0500595_020630 | Ga0500595_020630_828_1427 | 199 |
| 982 | 3300053120 | Ga0500597_125671 | Ga0500597_125671_147_806 | 199 |
| 983 | 3300053122 | Ga0500608_127331 | Ga0500608_127331_159_758 | 199 |
| 984 | 3300053130 | Ga0500642_0003645 | Ga0500642_0003645_1210_1809 | 199 |
| 985 | 3300053136 | Ga0500559_0051627 | Ga0500559_0051627_744_1343 | 199 |
| 986 | 3300053136 | Ga0500559_0099915 | Ga0500559_0099915_239_838 | 199 |
| 987 | 3300053139 | Ga0500568_0003071 | Ga0500568_0003071_1766_2365 | 199 |
| 988 | 3300053142 | Ga0500577_0024840 | Ga0500577_0024840_394_993 | 199 |
| 989 | 3300053143 | Ga0500579_146921 | Ga0500579_146921_86_685 | 199 |
| 990 | 3300053147 | Ga0500589_110375 | Ga0500589_110375_77_676 | 199 |
| 991 | 3300053147 | Ga0500589_128789 | Ga0500589_128789_264_863 | 199 |
| 992 | 3300053148 | Ga0500590_198111 | Ga0500590_198111_154_753 | 199 |
| 993 | 3300053150 | Ga0500603_006788 | Ga0500603_006788_397_996 | 199 |
| 994 | 3300053150 | Ga0500603_125820 | Ga0500603_125820_146_745 | 199 |
| 995 | 3300053159 | Ga0500630_119921 | Ga0500630_119921_17_616 | 199 |
| 996 | 3300053160 | Ga0500633_0181165 | Ga0500633_0181165_121_720 | 199 |
| 997 | 3300053161 | Ga0500634_0156392 | Ga0500634_0156392_305_904 | 199 |
| 998 | 3300053162 | Ga0500638_000539 | Ga0500638_000539_3392_3991 | 199 |
| 999 | 3300053162 | Ga0500638_022017 | Ga0500638_022017_641_1240 | 199 |
| 1000 | 3300053163 | Ga0500639_126782 | Ga0500639_126782_600_1199 | 199 |
| 1001 | 3300053177 | Ga0500636_0052823 | Ga0500636_0052823_33_632 | 199 |
| 1002 | 3300053178 | Ga0500637_0020243 | Ga0500637_0020243_1617_2216 | 199 |
| 1003 | 3300053178 | Ga0500637_0023445 | Ga0500637_0023445_231_830 | 199 |
| 1004 | 3300053725 | Ga0500576_169105 | Ga0500576_169105_77_676 | 199 |
| 1005 | 3300053727 | Ga0500611_005802 | Ga0500611_005802_227_826 | 199 |
| 1006 | 3300053730 | Ga0500645_084571 | Ga0500645_084571_61_660 | 199 |
| 1007 | 3300053731 | Ga0500609_013892 | Ga0500609_013892_227_826 | 199 |
| 1008 | 3300053731 | Ga0500609_026979 | Ga0500609_026979_175_774 | 199 |
| 1009 | 3300053735 | Ga0500596_000909 | Ga0500596_000909_2559_3158 | 199 |
| 1010 | 3300053735 | Ga0500596_026589 | Ga0500596_026589_143_742 | 199 |
| 1011 | 3300054114 | Ga0501084_0026071 | Ga0501084_0026071_1660_2259 | 199 |
| 1012 | 3300055283 | Ga0500661_000348 | Ga0500661_000348_3330_3929 | 199 |
| 1013 | 3300060353 | Ga0501082_0001185 | Ga0501082_0001185_11831_12430 | 199 |
| 1014 | iso_pu_bacteria | 2791355196 | 2793062033 | 199 |
| 1015 | iso_pu_bacteria | 2849076700 | 2849083026 | 199 |
| 1016 | iso_pu_bacteria | 2874590934 | 2874594436 | 199 |
| 1017 | iso_pu_bacteria | 2874620515 | 2874624772 | 199 |
| 1018 | iso_pu_bacteria | 2876761206 | 2876768918 | 199 |
| 1019 | iso_pu_bacteria | 2904666416 | 2904670273 | 199 |
| 1020 | iso_pu_bacteria | 2906626472 | 2906628966 | 199 |
| 1021 | iso_pu_bacteria | 2935608549 | 2935615735 | 199 |
| 1022 | iso_pu_bacteria | 2935684952 | 2935690014 | 199 |
| 1023 | iso_pu_bacteria | 2935713505 | 2935717533 | 199 |
| 1024 | iso_pu_bacteria | 2935722832 | 2935723797 | 199 |
| 1025 | iso_pu_bacteria | 2935732158 | 2935740006 | 199 |
| 1026 | iso_pu_bacteria | 2935741537 | 2935749269 | 199 |
| 1027 | iso_pu_bacteria | 2935750917 | 2935757368 | 199 |
| 1028 | iso_pu_bacteria | 2935819856 | 2935825467 | 199 |
| 1029 | iso_pu_bacteria | 2935847175 | 2935853256 | 199 |
| 1030 | iso_pu_bacteria | 2935959822 | 2935962627 | 199 |
| 1031 | iso_pu_bacteria | 2940556831 | 2940563281 | 199 |
| 1032 | iso_pu_bacteria | 8019648815 | 8019652479 | 199 |
| 1033 | iso_pu_bacteria | 8019659431 | 8019666980 | 199 |
| 1034 | iso_pu_bacteria | 8019668869 | 8019676737 | 199 |
| 1035 | iso_pu_bacteria | 8019678201 | 8019679254 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1uf9-assembly3.cif.gz_C | crystal structure of tt1252 from thermus thermophilus | 0.8789 | 2 | 191 |
| 1vhl-assembly2.cif.gz_B | crystal structure of dephospho-coa kinase with adenosine-5'-diphosphate | 0.8774 | 2 | 194 |
| 2if2-assembly2.cif.gz_B | crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. | 0.8757 | 1 | 193 |
| 6n39-assembly1.cif.gz_A | crystal structure of an dephospho-coa kinase coae from mycobacterium paratuberculosis | 0.8714 | 1 | 189 |
| 2if2-assembly2.cif.gz_B | crystal structure of the putative dephospho-coa kinase from aquifex aeolicus, northeast structural genomics target qr72. | 0.8674 | 1 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8WVC6_1_203_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9322 | 1 | 194 | 3.40.50.300 |
| af_O74414_1_201_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9143 | 1 | 195 | 3.40.50.300 |
| af_A4I012_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9133 | 1 | 195 | 3.40.50.300 |
| af_P34558_5_214_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9075 | 2 | 194 | 3.40.50.300 |
| af_Q8WVC6_1_203_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9056 | 1 | 194 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z2SNU2-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.9956 | 1 | 197 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-Q89WN9-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.99 | 1 | 199 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-Q21CL5-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.9868 | 1 | 199 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-P58100-F1-model_v4 | Dephospho-CoA kinase (EC 2.7.1.24) (Dephosphocoenzyme A kinase) | 0.984 | 1 | 191 |
GO:0004140
GO:0005524 GO:0005737 GO:0015937 |
| AF-A0A2V0PL51-F1-model_v4 | Dephospho-kinase | 0.9817 | 2 | 190 |
GO:0004140
GO:0005524 GO:0015937 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar