F488703

General Info

Members Datasets Scaffolds Average Seq Length
1035 808 2070 428

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_000055|Ga0500618_000055_52136_53644
Length 502
Sequence MPRPEQGLPFEPNTKGRRKAPLLHLRAAAPCLPLSPVASGALSKNAGGGYAPFHARHFPGLNEFLQTTRSTAMARALGLDFGTTNTVLALADGGNTTHSMRFSSSAGETDSMRTALSFMKDAQLGAQALKVEAGQAAIRQFIDNPGDARFLQSIKTFAASAVFQGTLVFARRHTFEDLMEIFLKRLKVYADGHWPSDVSRLVAGRPVHFAGASPDEKLATDRYNEALTRLGFPEIHYVYEPVAAAYYFAQTLKSDANVLVADFGGGTTDYSLIRFERVAGKLTAKPIGHSGVGIAGDHFDARMIERLVAPEIGKGTFFKSFDKLLEVPSSYYANFSRWNQLSIFKTTREFNDLKSLVRSAVDPDKLELFIDLVEHDEGYPLYQAISATKMALSAAEEAEFNFSPLGKAGRKVVKRADFETWIADDLARIEGALDDVLTKTNTAPADVDKVFLTGGTSFVPAVRRIFTERFDASKIESGGELLSIAHGLALIGESDNAGEWAA

Samples

Sample ID Description Type Environment
1 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
64 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
76 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
77 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
78 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
79 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
80 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
81 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
121 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
126 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
136 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
140 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
141 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
142 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
143 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
146 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
158 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
162 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
218 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
231 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
232 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
233 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
234 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
235 2509276019 Ensifer aridi TW10 Isolate Nodule
236 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
237 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
238 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
239 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
240 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
241 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
242 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
243 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
244 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
245 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
246 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
247 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
248 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
249 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
250 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
251 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
252 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
253 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
254 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
255 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
256 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
257 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
258 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
259 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
260 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
261 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
262 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
263 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
264 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
265 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
266 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
267 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
268 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
269 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
270 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
271 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
272 2516143018 Ensifer sp. BR816 Isolate Nodule
273 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
274 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
275 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
276 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
277 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
278 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
279 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
280 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
281 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
282 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
283 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
284 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
285 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
286 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
287 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
288 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
289 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
290 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
291 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
292 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
293 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
294 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
295 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
296 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
297 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
298 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
299 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
300 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
301 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
302 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
303 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
304 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
305 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
306 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
307 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
308 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
309 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
310 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
311 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
312 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
313 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
314 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
315 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
316 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
317 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
318 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
319 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
320 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
321 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
322 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
323 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
324 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
325 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
326 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
327 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
328 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
329 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
330 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
331 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
332 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
333 2643221557 Ensifer sp. Root558 Isolate Unclassified
334 2643221558 Rhizobium sp. Root149 Isolate Unclassified
335 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
336 2643221568 Rhizobium sp. Root564 Isolate Unclassified
337 2643221582 Rhizobium sp. Root651 Isolate Unclassified
338 2643221599 Rhizobium sp. Root708 Isolate Unclassified
339 2643221607 Rhizobium sp. Root73 Isolate Unclassified
340 2643221610 Ensifer sp. Root74 Isolate Unclassified
341 2643221618 Ensifer sp. Root231 Isolate Unclassified
342 2643221626 Ensifer sp. Root31 Isolate Unclassified
343 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
344 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
345 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
346 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
347 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
348 2643221655 Ensifer sp. Root1252 Isolate Unclassified
349 2643221659 Ensifer sp. Root127 Isolate Unclassified
350 2643221668 Ensifer sp. Root423 Isolate Unclassified
351 2643221675 Ensifer sp. Root1298 Isolate Unclassified
352 2643221680 Ensifer sp. Root1312 Isolate Unclassified
353 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
354 2643221688 Rhizobium sp. Root482 Isolate Unclassified
355 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
356 2643221693 Rhizobium sp. Root491 Isolate Unclassified
357 2643221698 Ensifer sp. Root142 Isolate Unclassified
358 2643221712 Ensifer sp. Root258 Isolate Unclassified
359 2643221718 Rhizobium sp. Root268 Isolate Unclassified
360 2643221719 Rhizobium sp. Root274 Isolate Unclassified
361 2643221723 Ensifer sp. Root278 Isolate Unclassified
362 2643221726 Ensifer sp. Root954 Isolate Unclassified
363 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
364 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
365 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
366 2718217927 Rhizobium sp. N324 Isolate Nodule
367 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
368 2718218009 Rhizobium sp. N561 Isolate Nodule
369 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
370 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
371 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
372 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
373 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
374 2718218363 Rhizobium sp. N113 Isolate Nodule
375 2718218365 Rhizobium sp. N731 Isolate Nodule
376 2718218366 Rhizobium sp. N621 Isolate Nodule
377 2718218423 Rhizobium sp. N941 Isolate Nodule
378 2721755514 Rhizobium sp. N6212 Isolate Nodule
379 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
380 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
381 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
382 2721755809 Rhizobium sp. N541 Isolate Nodule
383 2721755810 Rhizobium sp. N871 Isolate Nodule
384 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
385 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
386 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
387 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
388 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
389 2728369365 Rhizobium sp. N1341 Isolate Nodule
390 2728369397 Rhizobium sp. N1314 Isolate Nodule
391 2738541293 Rhizobium sp. GV031 Isolate Unclassified
392 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
393 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
394 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
395 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
396 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
397 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
398 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
399 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
400 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
401 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
402 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
403 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
404 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
405 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
406 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
407 2791355256 Rhizobium sp. M10 Isolate Nodule
408 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
409 2791355261 Rhizobium sp. J15 Isolate Nodule
410 2791355262 Rhizobium sp. M1 Isolate Nodule
411 2791355263 Rhizobium chutanense C5 Isolate Nodule
412 2791355264 Rhizobium sp. S9 Isolate Nodule
413 2791355265 Rhizobium sp. H4 Isolate Nodule
414 2791355266 Rhizobium sp. L43 Isolate Nodule
415 2791355267 Rhizobium sp. L18 Isolate Nodule
416 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
417 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
418 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
419 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
420 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
421 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
422 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
423 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
424 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
425 2802429633 Rhizobium anhuiense J3 Isolate Nodule
426 2802429634 Rhizobium anhuiense S10 Isolate Nodule
427 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
428 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
429 2802429637 Rhizobium anhuiense C15 Isolate Nodule
430 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
431 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
432 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
433 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
434 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
435 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
436 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
437 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
438 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
439 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
440 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
441 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
442 2838048938 Rhizobium pisi 27/80 Isolate Nodule
443 2838061910 Rhizobium phaseoli L15 Isolate Nodule
444 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
445 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
446 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
447 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
448 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
449 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
450 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
451 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
452 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
453 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
454 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
455 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
456 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
457 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
458 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
459 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
460 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
461 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
462 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
463 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
464 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
465 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
466 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
467 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
468 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
469 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
470 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
471 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
472 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
473 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
474 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
475 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
476 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
477 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
478 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
479 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
480 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
481 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
482 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
483 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
484 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
485 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
486 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
487 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
488 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
489 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
490 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
491 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
492 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
493 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
494 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
495 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
496 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
497 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
498 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
499 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
500 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
501 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
502 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
503 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
504 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
505 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
506 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
507 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
508 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
509 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
510 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
511 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
512 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
513 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
514 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
515 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
516 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
517 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
518 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
519 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
520 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
521 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
522 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
523 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
524 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
525 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
526 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
527 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
528 2844163670 Ensifer sp. 1H6 Isolate Unclassified
529 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
530 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
531 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
532 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
533 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
534 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
535 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
536 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
537 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
538 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
539 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
540 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
541 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
542 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
543 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
544 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
545 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
546 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
547 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
548 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
549 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
550 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
551 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
552 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
553 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
554 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
555 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
556 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
557 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
558 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
559 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
560 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
561 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
562 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
563 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
564 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
565 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
566 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
567 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
568 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
569 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
570 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
571 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
572 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
573 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
574 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
575 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
576 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
577 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
578 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
579 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
580 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
581 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
582 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
583 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
584 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
585 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
586 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
587 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
588 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
589 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
590 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
591 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
592 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
593 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
594 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
595 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
596 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
597 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
598 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
599 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
600 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
601 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
602 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
603 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
604 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
605 2933599457 Rhizobium phaseoli M3 Isolate Nodule
606 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
607 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
608 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
609 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
610 2936381700 Rhizobium chutanense C16 Isolate Unclassified
611 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
612 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
613 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
614 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
615 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
616 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
617 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
618 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
619 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
620 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
621 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
622 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
623 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
624 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
625 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
626 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
627 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
628 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
629 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
630 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
631 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
632 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
633 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
634 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
635 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
636 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
637 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
638 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
639 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
640 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
641 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
642 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
643 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
644 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
645 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
646 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
647 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
648 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
649 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
650 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
651 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
652 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
653 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
654 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
655 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
656 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
657 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
658 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
659 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
660 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
661 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
662 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
663 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
664 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
665 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
666 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
667 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
668 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
669 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
670 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
671 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
672 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
673 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
674 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
675 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
676 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
677 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
678 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
679 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
680 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
681 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
682 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
683 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
684 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
685 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
686 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
687 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
688 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
689 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
690 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
691 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
692 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
693 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
694 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
695 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
696 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
697 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
698 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
699 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
700 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
701 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
702 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
703 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
704 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
705 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
706 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
707 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
708 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
709 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
710 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
711 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
712 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
713 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
714 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
715 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
716 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
717 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
718 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
719 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
720 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
721 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
722 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
723 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
724 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
725 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
726 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
727 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
728 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
729 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
730 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
731 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
732 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
733 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
734 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
735 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
736 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
737 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
738 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
739 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
740 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
741 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
742 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
743 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
744 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
745 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
746 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
747 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
748 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
749 2996887358 Rhizobium sp. R711 Isolate Nodule
750 2996893221 Rhizobium sp. R635 Isolate Nodule
751 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
752 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
753 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
754 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
755 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
756 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
757 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
758 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
759 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
760 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
761 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
762 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
763 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
764 8005258706 Rhizobium sp. R693 Isolate Nodule
765 8005275841 Rhizobium sp. N4311 Isolate Nodule
766 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
767 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
768 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
769 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
770 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
771 8005321885 Rhizobium sp. R72 Isolate Nodule
772 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
773 8005382845 Rhizobium sp. R634 Isolate Nodule
774 8005395548 Rhizobium sp. R339 Isolate Nodule
775 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
776 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
777 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
778 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
779 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
780 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
781 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
782 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
783 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
784 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
785 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
786 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
787 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
788 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
789 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
790 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
791 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
792 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
793 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
794 8018176218 Rhizobium sp. N122 Isolate Nodule
795 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
796 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
797 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
798 8024501048 Rhizobium sp. H4 Isolate Nodule
799 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
800 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
801 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
802 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
803 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
804 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
805 8056382006 Rhizobium croatiense 13T Isolate Nodule
806 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
807 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
808 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.44
Metatranscriptomes 0
Isolates 55.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 16.23
Nodule 41.35
Rhizoplane 1.74
Rhizosphere 22.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500618_000055 3300053125 Bacteria 99876
2 JGI24740J21852_10000602 3300001979 Bacteria 15553
3 JGI25155J39150_1000072 3300002704 Bacteria 64012
4 JGI25156J39149_1000086 3300002705 Bacteria 69106
5 JGI25162J39368_1000956 3300002737 Bacteria 18449
6 JGI25162J39368_1001709 3300002737 Bacteria 10670
7 JGI25154J39366_1000205 3300002738 Bacteria 42445
8 JGI25157J39369_1000113 3300002741 Bacteria 69106
9 JGI25152J39213_1000959 3300002773 Bacteria 14079
10 JGI25150J39212_1000031 3300002774 Bacteria 100456
11 JGI25159J45721_1000001 3300002987 Bacteria 303489
12 JGI25159J45721_1000064 3300002987 Bacteria 51766
13 JGI25159J45721_1001419 3300002987 Bacteria 9950
14 JGI25151J46595_10000062 3300003187 Bacteria 146687
15 JGI25151J46595_10007169 3300003187 Bacteria 5495
16 JGI25151J46595_10018956 3300003187 Bacteria 2937
17 JGI25165J46597_1001014 3300003214 Bacteria 18522
18 JGI25165J46597_1001037 3300003214 Bacteria 18135
19 JGI25153J46596_10000312 3300003215 Bacteria 35785
20 JGI25153J46596_10005340 3300003215 Bacteria 6750
21 rootL2_10113901 3300003322 Bacteria 5126
22 rootH1_10015315 3300003323 Bacteria 2160
23 JGI25160J50197_1000002 3300003354 Bacteria 561707
24 JGI25160J50197_1000052 3300003354 Bacteria 127795
25 JGI25160J50197_1024650 3300003354 Bacteria 1701
26 JGI25161J50226_1000073 3300003374 Bacteria 86555
27 JGI25161J50226_1000153 3300003374 Bacteria 47896
28 JGI25161J50226_1003967 3300003374 Bacteria 3215
29 Ga0055526_1002168 3300003771 Bacteria 13463
30 Ga0055526_1003266 3300003771 Bacteria 10411
31 Ga0055526_1003657 3300003771 Bacteria 9623
32 Ga0055526_1005117 3300003771 Bacteria 7648
33 Ga0055526_1014304 3300003771 Bacteria 3275
34 Ga0055526_1015152 3300003771 Bacteria 3111
35 Ga0055526_1020618 3300003771 Bacteria 2334
36 Ga0055524_1003026 3300003775 Bacteria 8324
37 Ga0055524_1005073 3300003775 Bacteria 5956
38 Ga0055524_1006865 3300003775 Bacteria 4908
39 Ga0055524_1017546 3300003775 Bacteria 2522
40 Ga0055536_1000427 3300003781 Bacteria 30054
41 Ga0055536_1003558 3300003781 Bacteria 8331
42 Ga0055536_1005875 3300003781 Bacteria 5885
43 Ga0055536_1008275 3300003781 Bacteria 4498
44 Ga0055528_1000097 3300003790 Bacteria 70021
45 Ga0055528_1000413 3300003790 Bacteria 34511
46 Ga0055528_1007933 3300003790 Bacteria 4628
47 Ga0055540_1000234 3300003792 Bacteria 50741
48 Ga0055540_1003105 3300003792 Bacteria 8243
49 Ga0055531_10024536 3300003794 Bacteria 2221
50 Ga0055543_1000035 3300004625 Bacteria 127833
51 Ga0055543_1001724 3300004625 Bacteria 8207
52 Ga0065165_1000004 3300005262 Bacteria 377081
53 Ga0065165_1001373 3300005262 Bacteria 26778
54 Ga0065165_1001548 3300005262 Bacteria 23977
55 Ga0065165_1001869 3300005262 Bacteria 20423
56 Ga0065165_1006808 3300005262 Bacteria 5836
57 Ga0065165_1010060 3300005262 Bacteria 4151
58 Ga0065165_1010294 3300005262 Bacteria 4063
59 Ga0070658_10015409 3300005327 Bacteria 6117
60 Ga0070658_10016053 3300005327 Bacteria 5990
61 Ga0070658_10165504 3300005327 Bacteria 1856
62 Ga0070670_100000347 3300005331 Bacteria 38928
63 Ga0070671_100025768 3300005355 Bacteria 4828
64 Ga0070674_100040340 3300005356 Bacteria 3158
65 Ga0070659_100028862 3300005366 Bacteria 4286
66 Ga0070681_10111950 3300005458 Bacteria 2669
67 Ga0070679_100012408 3300005530 Bacteria 8143
68 Ga0070684_100036084 3300005535 Bacteria 4236
69 Ga0070665_100002410 3300005548 Bacteria 20612
70 Ga0070665_100192518 3300005548 Bacteria 2040
71 Ga0070665_100196685 3300005548 Bacteria 2017
72 Ga0068855_100010038 3300005563 Bacteria 11413
73 Ga0068855_100010543 3300005563 Bacteria 11146
74 Ga0068857_100178708 3300005577 Bacteria 1931
75 Ga0068856_100018126 3300005614 Bacteria 6826
76 Ga0068856_100046094 3300005614 Bacteria 4294
77 Ga0068856_100199246 3300005614 Bacteria 2017
78 Ga0068852_100024682 3300005616 Bacteria 4862
79 Ga0068852_100038488 3300005616 Bacteria 4020
80 Ga0068851_10005049 3300005834 Bacteria 5986
81 Ga0075365_10012052 3300006038 Bacteria 5115
82 Ga0075368_10015374 3300006042 Bacteria 2839
83 Ga0075363_100008956 3300006048 Bacteria 4687
84 Ga0075364_10000177 3300006051 Bacteria 28741
85 Ga0070712_100064141 3300006175 Bacteria 2604
86 Ga0075367_10006431 3300006178 Bacteria 5934
87 Ga0075367_10007923 3300006178 Bacteria 5474
88 Ga0075367_10021879 3300006178 Bacteria 3580
89 Ga0075369_10023091 3300006186 Bacteria 2569
90 Ga0075369_10041985 3300006186 Bacteria 1959
91 Ga0075366_10004489 3300006195 Bacteria 7486
92 Ga0097621_100010551 3300006237 Bacteria 6767
93 Ga0075370_10092350 3300006353 Bacteria 1747
94 Ga0068871_100052091 3300006358 Bacteria 3314
95 Ga0079104_1000010 3300006946 Bacteria 366021
96 Ga0079104_1002175 3300006946 Bacteria 11070
97 Ga0079104_1010103 3300006946 Bacteria 3136
98 Ga0099826_10000838 3300006948 Bacteria 16616
99 Ga0099826_10085596 3300006948 Bacteria 1946
100 Ga0099795_10000284 3300007788 Bacteria 9080
101 Ga0105251_10010972 3300009011 Bacteria 5209
102 Ga0105240_10000027 3300009093 Bacteria 348486
103 Ga0105240_10011173 3300009093 Bacteria 12533
104 Ga0105240_10049005 3300009093 Bacteria 5335
105 Ga0105245_10122532 3300009098 Bacteria 2430
106 Ga0105243_10013570 3300009148 Bacteria 6163
107 Ga0105241_10007637 3300009174 Bacteria 7947
108 Ga0105242_10085818 3300009176 Bacteria 2641
109 Ga0105248_10004763 3300009177 Bacteria 15015
110 Ga0105248_10280267 3300009177 Bacteria 1877
111 Ga0105237_10004420 3300009545 Bacteria 16294
112 Ga0105238_10019957 3300009551 Bacteria 6823
113 Ga0123341_1000006 3300009765 Bacteria 149197
114 Ga0123342_1009880 3300009766 Bacteria 11179
115 Ga0099796_10004798 3300010159 Bacteria 3309
116 Ga0105239_10010623 3300010375 Bacteria 10298
117 Ga0157373_10005723 3300013100 Bacteria 9314
118 Ga0157371_10000307 3300013102 Bacteria 63760
119 Ga0157370_10000223 3300013104 Bacteria 72025
120 Ga0157370_10000577 3300013104 Bacteria 45697
121 Ga0157370_10018273 3300013104 Bacteria 7052
122 Ga0157369_10000908 3300013105 Bacteria 37806
123 Ga0157369_10068607 3300013105 Bacteria 3810
124 Ga0157369_10109759 3300013105 Bacteria 2933
125 Ga0157369_10199134 3300013105 Bacteria 2103
126 Ga0157372_10001580 3300013307 Bacteria 24846
127 Ga0163163_10087840 3300014325 Bacteria 3120
128 Ga0182007_10009549 3300015262 Bacteria 3906
129 Ga0182005_1001113 3300015265 Bacteria 11231
130 Ga0183363_1089 3300015690 Bacteria 27581
131 Ga0214544_1000008 3300021320 Bacteria 326027
132 Ga0214542_1008369 3300021321 Bacteria 17166
133 Ga0214542_1010138 3300021321 Bacteria 13991
134 Ga0214543_1000003 3300021327 Bacteria 692327
135 Ga0214543_1000004 3300021327 Bacteria 527190
136 Ga0228711_1000001 3300022739 Bacteria 357377
137 Ga0228710_1000001 3300022740 Bacteria 314328
138 Ga0209435_100036 3300025206 Bacteria 126970
139 Ga0209436_100047 3300025208 Bacteria 68393
140 Ga0209436_102304 3300025208 Bacteria 5851
141 Ga0209672_103187 3300025228 Bacteria 3505
142 Ga0209437_100033 3300025233 Bacteria 512520
143 Ga0209437_100036 3300025233 Bacteria 469153
144 Ga0207425_1000031 3300025245 Bacteria 261181
145 Ga0207425_1001110 3300025245 Bacteria 12159
146 Ga0207425_1010137 3300025245 Bacteria 2307
147 Ga0209646_1000132 3300025246 Bacteria 126859
148 Ga0209026_1000236 3300025250 Bacteria 73740
149 Ga0209759_1000269 3300025256 Bacteria 73740
150 Ga0209129_1000053 3300025258 Bacteria 262823
151 Ga0209129_1000125 3300025258 Bacteria 133506
152 Ga0209129_1000611 3300025258 Bacteria 24129
153 Ga0209129_1001053 3300025258 Bacteria 16286
154 Ga0209129_1001178 3300025258 Bacteria 15052
155 Ga0209129_1001568 3300025258 Bacteria 12550
156 Ga0209129_1003548 3300025258 Bacteria 6714
157 Ga0209233_1000056 3300025261 Bacteria 438104
158 Ga0209233_1000064 3300025261 Bacteria 392156
159 Ga0209233_1000152 3300025261 Bacteria 175910
160 Ga0209455_1008421 3300025272 Bacteria 2805
161 Ga0209673_1000122 3300025273 Bacteria 170443
162 Ga0209673_1000409 3300025273 Bacteria 75876
163 Ga0209673_1001508 3300025273 Bacteria 21458
164 Ga0209673_1001874 3300025273 Bacteria 16993
165 Ga0209673_1001941 3300025273 Bacteria 16313
166 Ga0209673_1002296 3300025273 Bacteria 13630
167 Ga0209673_1006574 3300025273 Bacteria 5570
168 Ga0209130_1000006 3300025284 Bacteria 596528
169 Ga0209130_1000008 3300025284 Bacteria 581232
170 Ga0209130_1015165 3300025284 Bacteria 1908
171 Ga0209676_1001841 3300025292 Bacteria 17525
172 Ga0209676_1002222 3300025292 Bacteria 14418
173 Ga0209676_1012750 3300025292 Bacteria 3273
174 Ga0209025_1000074 3300025294 Bacteria 277445
175 Ga0209025_1000080 3300025294 Bacteria 267244
176 Ga0209025_1000087 3300025294 Bacteria 261181
177 Ga0209025_1000100 3300025294 Bacteria 229182
178 Ga0209025_1000165 3300025294 Bacteria 164692
179 Ga0209025_1000900 3300025294 Bacteria 46091
180 Ga0209025_1001226 3300025294 Bacteria 35815
181 Ga0209025_1001688 3300025294 Bacteria 26980
182 Ga0209025_1007426 3300025294 Bacteria 8179
183 Ga0209025_1012756 3300025294 Bacteria 5353
184 Ga0209025_1033604 3300025294 Bacteria 2366
185 Ga0209564_1000104 3300025295 Bacteria 219017
186 Ga0209564_1000853 3300025295 Bacteria 40719
187 Ga0209564_1001099 3300025295 Bacteria 32101
188 Ga0209564_1001645 3300025295 Bacteria 21556
189 Ga0209564_1005387 3300025295 Bacteria 7331
190 Ga0209758_1000081 3300025297 Bacteria 261181
191 Ga0209758_1000121 3300025297 Bacteria 192028
192 Ga0209758_1000313 3300025297 Bacteria 93883
193 Ga0209758_1000624 3300025297 Bacteria 54349
194 Ga0209758_1003467 3300025297 Bacteria 14302
195 Ga0209758_1008055 3300025297 Bacteria 6955
196 Ga0209758_1014909 3300025297 Bacteria 4079
197 Ga0209050_1001263 3300025298 Bacteria 29191
198 Ga0209050_1012778 3300025298 Bacteria 3810
199 Ga0209256_1000351 3300025299 Bacteria 74921
200 Ga0209256_1001199 3300025299 Bacteria 29031
201 Ga0209256_1001393 3300025299 Bacteria 25215
202 Ga0209256_1001494 3300025299 Bacteria 23770
203 Ga0209256_1002645 3300025299 Bacteria 14095
204 Ga0209256_1003108 3300025299 Bacteria 12147
205 Ga0209256_1003692 3300025299 Bacteria 10407
206 Ga0209256_1008356 3300025299 Bacteria 4822
207 Ga0207426_1000016 3300025302 Bacteria 581232
208 Ga0207426_1000044 3300025302 Bacteria 428043
209 Ga0207426_1000106 3300025302 Bacteria 244368
210 Ga0207426_1000743 3300025302 Bacteria 36635
211 Ga0207426_1001023 3300025302 Bacteria 26852
212 Ga0209051_1000339 3300025303 Bacteria 70136
213 Ga0209051_1000918 3300025303 Bacteria 29277
214 Ga0209051_1001825 3300025303 Bacteria 16844
215 Ga0209051_1014302 3300025303 Bacteria 3712
216 Ga0209257_1001790 3300025304 Bacteria 23629
217 Ga0209257_1002795 3300025304 Bacteria 16446
218 Ga0209257_1002847 3300025304 Bacteria 16197
219 Ga0209257_1003481 3300025304 Bacteria 13438
220 Ga0207705_10029588 3300025909 Bacteria 3904
221 Ga0207707_10111347 3300025912 Bacteria 2393
222 Ga0207695_10000024 3300025913 Bacteria 632311
223 Ga0207695_10018654 3300025913 Bacteria 8014
224 Ga0207695_10025079 3300025913 Bacteria 6688
225 Ga0207671_10000986 3300025914 Bacteria 35178
226 Ga0207660_10193806 3300025917 Bacteria 1584
227 Ga0207652_10044177 3300025921 Bacteria 3795
228 Ga0207681_10113687 3300025923 Bacteria 1974
229 Ga0207650_10000567 3300025925 Bacteria 30017
230 Ga0207664_10172947 3300025929 Bacteria 1850
231 Ga0207644_10079078 3300025931 Bacteria 2425
232 Ga0207711_10036636 3300025941 Bacteria 4163
233 Ga0207667_10031906 3300025949 Bacteria 5681
234 Ga0207677_10006032 3300026023 Bacteria 6607
235 Ga0207708_10117069 3300026075 Bacteria 2073
236 Ga0207702_10164056 3300026078 Bacteria 2031
237 Ga0207683_10137732 3300026121 Bacteria 2198
238 Ga0207698_10005638 3300026142 Bacteria 7750
239 Ga0207698_10028833 3300026142 Bacteria 3965
240 Ga0209281_1000053 3300027111 Bacteria 309587
241 Ga0209281_1000164 3300027111 Bacteria 157372
242 Ga0209281_1000377 3300027111 Bacteria 71243
243 Ga0209371_1000009 3300027312 Bacteria 963030
244 Ga0209371_1001175 3300027312 Bacteria 19137
245 Ga0209371_1005859 3300027312 Bacteria 4732
246 Ga0209282_1000007 3300027666 Bacteria 254917
247 Ga0209282_1000715 3300027666 Bacteria 16612
248 Ga0209282_1071011 3300027666 Bacteria 1896
249 Ga0268266_10032452 3300028379 Bacteria 4436
250 Ga0268266_10110435 3300028379 Bacteria 2436
251 Ga0307515_10000115 3300028794 Bacteria 193697
252 Ga0307515_10001359 3300028794 Bacteria 55373
253 Ga0307515_10002710 3300028794 Bacteria 37898
254 Ga0268256_1000010 3300030500 Bacteria 963034
255 Ga0268256_1005834 3300030500 Bacteria 4732
256 Ga0316181_1002016 3300030744 Bacteria 2554
257 Ga0265327_10000778 3300031251 Bacteria 49242
258 Ga0265327_10001708 3300031251 Bacteria 26225
259 Ga0265327_10024281 3300031251 Bacteria 3567
260 Ga0265316_10006286 3300031344 Bacteria 11374
261 Ga0307513_10008680 3300031456 Bacteria 12948
262 Ga0307513_10014591 3300031456 Bacteria 9566
263 Ga0307410_10095821 3300031852 Bacteria 2117
264 Ga0307412_10001806 3300031911 Bacteria 11834
265 Ga0307412_10079261 3300031911 Bacteria 2265
266 Ga0315914_1000006 3300031967 Bacteria 239817
267 Ga0307416_100153035 3300032002 Bacteria 2119
268 Ga0307414_10002909 3300032004 Bacteria 9058
269 Ga0315913_1000002 3300033430 Bacteria 241452
270 Ga0315915_1000001 3300033464 Bacteria 481518
271 Ga0373927_0000780 3300035695 Bacteria 24278
272 Ga0395905_0007143 3300037471 Bacteria 11167
273 Ga0395905_0008439 3300037471 Bacteria 10157
274 Ga0395905_0127507 3300037471 Bacteria 2393
275 Ga0237819_00516 3300038705 Bacteria 12975
276 Ga0237816_01893 3300039145 Bacteria 1661
277 Ga0439436_0025113 3300041404 Bacteria 1753
278 Ga0439439_0021887 3300041406 Bacteria 1595
279 Ga0439465_0004088 3300041413 Bacteria 4744
280 Ga0439465_0017163 3300041413 Bacteria 2259
281 Ga0439465_0020090 3300041413 Bacteria 2090
282 Ga0451837_1135412 3300041494 Bacteria 2422
283 Ga0451839_0324124 3300041496 Bacteria 2537
284 Ga0439431_0013507 3300041997 Bacteria 1885
285 Ga0439432_033106 3300042006 Bacteria 1664
286 Ga0439449_0006077 3300042007 Bacteria 4617
287 Ga0451576_0025375 3300045051 Bacteria 6384
288 Ga0451576_0244129 3300045051 Bacteria 1876
289 Ga0466958_0014567 3300045836 Bacteria 4489
290 Ga0495592_0074268 3300046454 Bacteria 2470
291 Ga0495629_0014314 3300046459 Bacteria 5708
292 Ga0495638_0000854 3300046460 Bacteria 31738
293 Ga0495638_0043878 3300046460 Bacteria 2819
294 Ga0495650_0000461 3300046471 Bacteria 63382
295 Ga0495650_0053217 3300046471 Bacteria 1659
296 Ga0495605_0000331 3300046474 Bacteria 47522
297 Ga0495662_0049991 3300046476 Bacteria 2018
298 Ga0495585_0062382 3300046492 Bacteria 2047
299 Ga0495607_0026847 3300046501 Bacteria 3569
300 Ga0495583_0008582 3300046506 Bacteria 6225
301 Ga0495583_0008848 3300046506 Bacteria 6091
302 Ga0495606_0003594 3300046507 Bacteria 16331
303 Ga0495606_0029980 3300046507 Bacteria 3809
304 Ga0495610_0012464 3300046512 Bacteria 5116
305 Ga0495616_0021617 3300046513 Bacteria 3480
306 Ga0495620_0010432 3300046515 Bacteria 4903
307 Ga0495620_0047972 3300046515 Bacteria 1835
308 Ga0495631_0003782 3300046518 Bacteria 8235
309 Ga0495631_0027381 3300046518 Bacteria 2609
310 Ga0495632_0002635 3300046519 Bacteria 13509
311 Ga0495632_0006079 3300046519 Bacteria 7832
312 Ga0495643_0019999 3300046522 Bacteria 3867
313 Ga0495643_0035161 3300046522 Bacteria 2760
314 Ga0495643_0106004 3300046522 Bacteria 1435
315 Ga0495648_0051940 3300046524 Bacteria 2494
316 Ga0495652_0040107 3300046529 Bacteria 4047
317 Ga0495654_0000130 3300046530 Bacteria 81643
318 Ga0495587_0017692 3300046536 Bacteria 4426
319 Ga0495609_0031792 3300046538 Bacteria 2398
320 Ga0495622_0012970 3300046557 Bacteria 3867
321 Ga0495633_0008112 3300046558 Bacteria 5956
322 Ga0495668_0007613 3300046616 Bacteria 6901
323 Ga0495668_0023282 3300046616 Bacteria 3535
324 Ga0495625_0000726 3300046660 Bacteria 46277
325 Ga0495625_0001965 3300046660 Bacteria 23208
326 Ga0495625_0077921 3300046660 Bacteria 2314
327 Ga0495661_0106826 3300046665 Bacteria 1566
328 Ga0495657_0033534 3300046675 Bacteria 3574
329 Ga0495600_0024098 3300046809 Bacteria 3916
330 Ga0495660_0007221 3300046810 Bacteria 6539
331 Ga0495673_0050131 3300047469 Bacteria 1834
332 Ga0495681_0004767 3300047470 Bacteria 9187
333 Ga0495681_0058420 3300047470 Bacteria 1787
334 Ga0495686_0000238 3300047472 Bacteria 99919
335 Ga0495686_0000613 3300047472 Bacteria 49253
336 Ga0495686_0012665 3300047472 Bacteria 5894
337 Ga0495686_0128339 3300047472 Bacteria 1506
338 Ga0496100_0187288 3300048903 Bacteria 1500
339 Ga0496102_0023580 3300048905 Bacteria 5467
340 Ga0496104_0238028 3300048907 Bacteria 1732
341 Ga0496106_0001004 3300048909 Bacteria 20640
342 Ga0496110_0106678 3300048913 Bacteria 2514
343 Ga0496113_0035330 3300048916 Bacteria 3654
344 Ga0496114_0120299 3300048917 Bacteria 2258
345 Ga0496116_0000036 3300048919 Bacteria 388508
346 Ga0496116_0001619 3300048919 Bacteria 24766
347 Ga0496116_0002976 3300048919 Bacteria 17219
348 Ga0496116_0010396 3300048919 Bacteria 7802
349 Ga0496116_0017233 3300048919 Bacteria 5617
350 Ga0496116_0100819 3300048919 Bacteria 1725
351 Ga0496117_0000002 3300048920 Bacteria 2483758
352 Ga0496117_0006548 3300048920 Bacteria 11726
353 Ga0496117_0007855 3300048920 Bacteria 10264
354 Ga0496117_0036258 3300048920 Bacteria 3693
355 Ga0496117_0046076 3300048920 Bacteria 3141
356 Ga0496117_0051153 3300048920 Bacteria 2923
357 Ga0496117_0071672 3300048920 Bacteria 2320
358 Ga0496118_0000084 3300048921 Bacteria 181733
359 Ga0496118_0000396 3300048921 Bacteria 73830
360 Ga0496118_0002631 3300048921 Bacteria 23807
361 Ga0496118_0006506 3300048921 Bacteria 12806
362 Ga0496118_0092593 3300048921 Bacteria 2074
363 Ga0496119_0010878 3300048922 Bacteria 7604
364 Ga0496119_0019985 3300048922 Bacteria 4904
365 Ga0496119_0029046 3300048922 Bacteria 3760
366 Ga0496119_0032929 3300048922 Bacteria 3447
367 Ga0496119_0051426 3300048922 Bacteria 2532
368 Ga0496120_0000087 3300048923 Bacteria 152857
369 Ga0496120_0004845 3300048923 Bacteria 11003
370 Ga0496120_0028306 3300048923 Bacteria 3435
371 Ga0496121_0000001 3300048924 Bacteria 1830318
372 Ga0496121_0001141 3300048924 Bacteria 46594
373 Ga0496121_0005778 3300048924 Bacteria 15693
374 Ga0496121_0009367 3300048924 Bacteria 11279
375 Ga0496121_0010484 3300048924 Bacteria 10447
376 Ga0496121_0015300 3300048924 Bacteria 8055
377 Ga0496121_0020840 3300048924 Bacteria 6459
378 Ga0496121_0046720 3300048924 Bacteria 3702
379 Ga0496121_0050304 3300048924 Bacteria 3522
380 Ga0496121_0109694 3300048924 Bacteria 2108
381 Ga0496121_0125056 3300048924 Bacteria 1935
382 Ga0496122_0000001 3300048925 Bacteria 1827766
383 Ga0496122_0000009 3300048925 Bacteria 584024
384 Ga0496122_0000205 3300048925 Bacteria 131755
385 Ga0496122_0014055 3300048925 Bacteria 7771
386 Ga0496122_0017027 3300048925 Bacteria 6824
387 Ga0496122_0018436 3300048925 Bacteria 6448
388 Ga0496122_0086661 3300048925 Bacteria 2154
389 Ga0496123_0000001 3300048926 Bacteria 1831497
390 Ga0496123_0000034 3300048926 Bacteria 274836
391 Ga0496123_0000103 3300048926 Bacteria 168232
392 Ga0496123_0007399 3300048926 Bacteria 10363
393 Ga0496123_0008628 3300048926 Bacteria 9322
394 Ga0496123_0009779 3300048926 Bacteria 8571
395 Ga0496123_0010695 3300048926 Bacteria 8067
396 Ga0496124_0000133 3300048927 Bacteria 154328
397 Ga0496124_0000854 3300048927 Bacteria 49730
398 Ga0496124_0001267 3300048927 Bacteria 38458
399 Ga0496124_0009898 3300048927 Bacteria 9746
400 Ga0496124_0013954 3300048927 Bacteria 7804
401 Ga0496124_0025344 3300048927 Bacteria 5373
402 Ga0496124_0035983 3300048927 Bacteria 4325
403 Ga0496124_0100955 3300048927 Bacteria 2338
404 Ga0496124_0109217 3300048927 Bacteria 2230
405 Ga0496125_0000001 3300048928 Bacteria 1766138
406 Ga0496125_0000385 3300048928 Bacteria 82113
407 Ga0496125_0013299 3300048928 Bacteria 8097
408 Ga0496125_0018668 3300048928 Bacteria 6578
409 Ga0496126_0000597 3300048929 Bacteria 68119
410 Ga0496126_0001488 3300048929 Bacteria 36340
411 Ga0496126_0018669 3300048929 Bacteria 6863
412 Ga0496126_0122689 3300048929 Bacteria 2251
413 Ga0501033_0000038 3300049570 Bacteria 144438
414 Ga0501033_0021895 3300049570 Bacteria 4823
415 Ga0501034_0003022 3300049571 Bacteria 19460
416 Ga0501034_0312590 3300049571 Bacteria 1505
417 Ga0501037_0057845 3300049573 Bacteria 2830
418 Ga0501038_0167137 3300049574 Bacteria 1784
419 Ga0501043_0058918 3300049579 Bacteria 3013
420 Ga0501047_0001955 3300049581 Bacteria 19810
421 Ga0501047_0178982 3300049581 Bacteria 1987
422 Ga0501068_0098395 3300049584 Bacteria 1811
423 Ga0501069_0004546 3300049585 Bacteria 7171
424 Ga0501070_0001389 3300049586 Bacteria 21681
425 Ga0501072_0204362 3300049588 Bacteria 1575
426 Ga0501073_0000206 3300049589 Bacteria 38869
427 Ga0501074_0000330 3300049590 Bacteria 27501
428 Ga0501083_0000293 3300049744 Bacteria 31385
429 Ga0501083_0064521 3300049744 Bacteria 2440
430 Ga0501035_0000326 3300049822 Bacteria 55174
431 Ga0501035_0170579 3300049822 Bacteria 1880
432 Ga0501044_0034308 3300049823 Bacteria 5322
433 nmdc:mga03683_51004_c1 3300050489 Bacteria 1726
434 nmdc:mga00v17_13054_c1 3300050491 Bacteria 4603
435 nmdc:mga00v17_201_c1 3300050491 Bacteria 36027
436 nmdc:mga00v17_52_c1 3300050491 Bacteria 72738
437 nmdc:mga0yw44_4284_c1 3300050492 Bacteria 6510
438 nmdc:mga07m45_84678_c1 3300050496 Bacteria 1812
439 Ga0500643_032572 3300053087 Bacteria 1582
440 Ga0500566_0002633 3300053094 Bacteria 10687
441 Ga0500560_000407 3300053107 Bacteria 5854
442 Ga0500595_004324 3300053119 Bacteria 6398
443 Ga0500618_000616 3300053125 Bacteria 21736
444 Ga0500618_002635 3300053125 Bacteria 6609
445 Ga0500618_004048 3300053125 Bacteria 4813
446 Ga0500618_014196 3300053125 Bacteria 2040
447 Ga0500658_0001240 3300053134 Bacteria 10358
448 Ga0500561_0000114 3300053137 Bacteria 15576
449 Ga0500568_0001799 3300053139 Bacteria 13200
450 Ga0500573_0048611 3300053140 Bacteria 2441
451 Ga0500616_0000224 3300053153 Bacteria 88293
452 Ga0500616_0000328 3300053153 Bacteria 68215
453 Ga0500616_0062932 3300053153 Bacteria 1915
454 Ga0500622_0000919 3300053156 Bacteria 25030
455 Ga0500622_0001161 3300053156 Bacteria 21882
456 Ga0500624_000161 3300053157 Bacteria 27520
457 Ga0500633_0000113 3300053160 Bacteria 10869
458 Ga0500634_0014495 3300053161 Bacteria 4160
459 Ga0500636_0000004 3300053177 Bacteria 202392
460 Ga0500636_0045907 3300053177 Bacteria 2576
461 2509107461 2508501122 Bacteria 6292184
462 2509374547 2509276019 Bacteria 6802256
463 2509387828 2509276021 Bacteria 7634384
464 2509443446 2509276033 Bacteria 7180565
465 2510132192 2510065019 Bacteria 6903379
466 2510304464 2510065057 Bacteria 6649661
467 2510840978 2510461069 Bacteria 5505000
468 2510898526 2510461076 Bacteria 8618824
469 2511133601 2510917022 Bacteria 6504556
470 2511171853 2510917026 Bacteria 7046020
471 2511182129 2510917028 Bacteria 6185411
472 2511199581 2510917030 Bacteria 7460662
473 2511390381 2511231027 Bacteria 5013807
474 2511500918 2511231052 Bacteria 6974333
475 2512532340 2512047086 Bacteria 6850303
476 2512972331 2512875026 Bacteria 6861065
477 2513569026 2513237084 Bacteria 7231967
478 2513580053 2513237085 Bacteria 7695351
479 2513583544 2513237086 Bacteria 7265287
480 2513596142 2513237088 Bacteria 6927906
481 2513603410 2513237089 Bacteria 6553624
482 2513617529 2513237091 Bacteria 6900273
483 2513635680 2513237093 Bacteria 7545552
484 2513709315 2513237103 Bacteria 7647401
485 2513865732 2513237138 Bacteria 7368160
486 2513882757 2513237140 Bacteria 7076289
487 2513905302 2513237143 Bacteria 6664116
488 2513907633 2513237144 Bacteria 7530820
489 2513925603 2513237146 Bacteria 7166346
490 2513999462 2513237159 Bacteria 6810126
491 2514004865 2513237160 Bacteria 6650282
492 2514023108 2513237162 Bacteria 7468464
493 2515111172 2515075009 Bacteria 7288508
494 2515608043 2515154107 Bacteria 6795637
495 2515636040 2515154113 Bacteria 7807172
496 2515642692 2515154114 Bacteria 7848616
497 2515658791 2515154116 Bacteria 7552979
498 2515743897 2515154134 Bacteria 7220242
499 2516208796 2516143018 Bacteria 6951533
500 2516892195 2516653046 Bacteria 6989037
501 2517039817 2516653077 Bacteria 7555578
502 2517075339 2516653085 Bacteria 7346596
503 2517093943 2517093000 Bacteria 7412387
504 2517405758 2517287029 Bacteria 6905599
505 2517569004 2517487022 Bacteria 7227575
506 2524450241 2524023207 Bacteria 6813453
507 2524457913 2524023209 Bacteria 6679728
508 2530644003 2529292951 Bacteria 6916614
509 2535515611 2534681796 Bacteria 7146037
510 2537877064 2537561587 Bacteria 5425293
511 2551676378 2551306084 Bacteria 8942552
512 2551687485 2551306085 Bacteria 7347181
513 2551699171 2551306087 Bacteria 7351905
514 2551719052 2551306090 Bacteria 7953713
515 2551730330 2551306091 Bacteria 7086830
516 2551738827 2551306092 Bacteria 6992595
517 2551745388 2551306093 Bacteria 7064773
518 2554247015 2554235003 Bacteria 5877155
519 2558863575 2558860100 Bacteria 8458965
520 2559294240 2558860242 Bacteria 5568029
521 2561465974 2558860983 Bacteria 4133860
522 2585165457 2582581283 Bacteria 6030556
523 2585202976 2582581294 Bacteria 6626667
524 2585220876 2582581298 Bacteria 7315509
525 2585230517 2582581299 Bacteria 6518058
526 2585256710 2582581304 Bacteria 5831370
527 2585266281 2582581306 Bacteria 6450535
528 2585275752 2582581307 Bacteria 6597605
529 2585278801 2582581308 Bacteria 7413247
530 2585325585 2582581315 Bacteria 7318924
531 2585329740 2582581316 Bacteria 7774528
532 2585387282 2582581865 Bacteria 6644329
533 2585397785 2582581866 Bacteria 6859583
534 2585400253 2582581867 Bacteria 7184437
535 2585525530 2585427526 Bacteria 7258840
536 2585535911 2585427527 Bacteria 7273426
537 2585543823 2585427528 Bacteria 6842387
538 2585550025 2585427529 Bacteria 7395659
539 2585554006 2585427530 Bacteria 7383882
540 2585559329 2585427531 Bacteria 6992870
541 2585822977 2585427590 Bacteria 6824633
542 2585839310 2585427593 Bacteria 7141551
543 2585847313 2585427594 Bacteria 6180594
544 2585901204 2585427608 Bacteria 6544331
545 2585905294 2585427609 Bacteria 6667127
546 2585994989 2585427633 Bacteria 6413184
547 2585999531 2585427634 Bacteria 6455027
548 2587979591 2585428125 Bacteria 6662905
549 2599333883 2599185156 Bacteria 5403036
550 2599418698 2599185170 Bacteria 7295545
551 2599603425 2599185210 Bacteria 5624189
552 2599724217 2599185236 Bacteria 6875203
553 2600191843 2599185352 Bacteria 7228948
554 2600375171 2600254933 Bacteria 4750527
555 2601608776 2600255279 Bacteria 5605316
556 2601745550 2600255308 Bacteria 5611129
557 2616305925 2615840626 Bacteria 7921970
558 2616553830 2615840698 Bacteria 7319877
559 2617381924 2617270742 Bacteria 6808054
560 2643807295 2643221557 Bacteria 7184309
561 2643810092 2643221558 Bacteria 5460675
562 2643820667 2643221560 Bacteria 4801179
563 2643855990 2643221568 Bacteria 5187270
564 2643918611 2643221582 Bacteria 5804683
565 2644007818 2643221599 Bacteria 6292121
566 2644046676 2643221607 Bacteria 6314006
567 2644069707 2643221610 Bacteria 7480339
568 2644109086 2643221618 Bacteria 7717186
569 2644151606 2643221626 Bacteria 8069654
570 2644191079 2643221634 Bacteria 6705461
571 2644202383 2643221636 Bacteria 6583769
572 2644206299 2643221637 Bacteria 5345260
573 2644242786 2643221643 Bacteria 5749658
574 2644296947 2643221653 Bacteria 4569637
575 2644311742 2643221655 Bacteria 7722067
576 2644330013 2643221659 Bacteria 7890716
577 2644380678 2643221668 Bacteria 7306521
578 2644414583 2643221675 Bacteria 7473456
579 2644448240 2643221680 Bacteria 7473610
580 2644479465 2643221686 Bacteria 6310811
581 2644493487 2643221688 Bacteria 5260751
582 2644500906 2643221689 Bacteria 6042950
583 2644518844 2643221693 Bacteria 5513853
584 2644543233 2643221698 Bacteria 7756764
585 2644617540 2643221712 Bacteria 7729434
586 2644649947 2643221718 Bacteria 5345506
587 2644655201 2643221719 Bacteria 4568197
588 2644673640 2643221723 Bacteria 7095460
589 2644689453 2643221726 Bacteria 7455827
590 2657682229 2657244999 Bacteria 5946535
591 2671112757 2667528174 Bacteria 6435400
592 2692316909 2690316117 Bacteria 6800650
593 2719384745 2718217927 Bacteria 6972593
594 2719664505 2718217997 Bacteria 6740740
595 2719730897 2718218009 Bacteria 6478651
596 2720490925 2718218199 Bacteria 6740745
597 2720612289 2718218232 Bacteria 6720332
598 2720619127 2718218233 Bacteria 6662049
599 2720630529 2718218235 Bacteria 6630699
600 2720774222 2718218269 Bacteria 6906114
601 2721146241 2718218363 Bacteria 6524337
602 2721157762 2718218365 Bacteria 6274507
603 2721163121 2718218366 Bacteria 6425255
604 2721398456 2718218423 Bacteria 6438183
605 2722839291 2721755514 Bacteria 6424414
606 2723025947 2721755556 Bacteria 6745503
607 2723559493 2721755684 Bacteria 6859907
608 2723566110 2721755685 Bacteria 6704835
609 2724037269 2721755809 Bacteria 6438790
610 2724043653 2721755810 Bacteria 6479005
611 2724088829 2721755819 Bacteria 6906405
612 2724103375 2721755822 Bacteria 6726041
613 2724109213 2721755823 Bacteria 6752556
614 2725951080 2724679232 Bacteria 7646494
615 2730106883 2728369352 Bacteria 6745171
616 2730163385 2728369365 Bacteria 6555560
617 2730297394 2728369397 Bacteria 6274511
618 2738803638 2738541293 Bacteria 7065685
619 2738948795 2738541317 Bacteria 5340176
620 2739039068 2738541333 Bacteria 7106503
621 2753458885 2751185821 Bacteria 6189929
622 2765466322 2765235802 Bacteria 5618596
623 2766067714 2765235942 Bacteria 7445910
624 2770198957 2767802442 Bacteria 5747986
625 2776270217 2775506902 Bacteria 6208009
626 2776285056 2775506904 Bacteria 5954060
627 2776912651 2775507049 Bacteria 6284736
628 2778177360 2775507266 Bacteria 7392367
629 2792584077 2791355082 Bacteria 5973319
630 2792622122 2791355091 Bacteria 6135441
631 2792628313 2791355092 Bacteria 6248105
632 2792638428 2791355094 Bacteria 7011481
633 2793282834 2791355253 Bacteria 5171699
634 2793299746 2791355256 Bacteria 6798008
635 2793316917 2791355259 Bacteria 7254731
636 2793329346 2791355261 Bacteria 6661293
637 2793336149 2791355262 Bacteria 6774204
638 2793339909 2791355263 Bacteria 6872478
639 2793350081 2791355264 Bacteria 6429314
640 2793353463 2791355265 Bacteria 6539969
641 2793358785 2791355266 Bacteria 7116587
642 2793370495 2791355267 Bacteria 7222458
643 2802717647 2802428858 Bacteria 6636079
644 2802723426 2802428859 Bacteria 6667919
645 2802731124 2802428860 Bacteria 6525526
646 2802736130 2802428861 Bacteria 6534206
647 2802743659 2802428862 Bacteria 6633353
648 2802750629 2802428863 Bacteria 6410669
649 2804751248 2802429268 Bacteria 6094027
650 2805930413 2802429605 Bacteria 6875453
651 2805936163 2802429606 Bacteria 6346811
652 2806049487 2802429633 Bacteria 7341974
653 2806056582 2802429634 Bacteria 7083200
654 2806063640 2802429635 Bacteria 7650140
655 2806067637 2802429636 Bacteria 7597525
656 2806077977 2802429637 Bacteria 7067217
657 2808985984 2808606387 Bacteria 5697198
658 2819242662 2818991272 Bacteria 4622173
659 2819556106 2818991439 Bacteria 6907412
660 2819613643 2818991448 Bacteria 6772224
661 2819639354 2818991453 Bacteria 7181617
662 2819684267 2818991461 Bacteria 7026071
663 2821124144 2821123053 Bacteria 7836056
664 2838017174 2838016132 Bacteria 6577831
665 2838026922 2838022645 Bacteria 6494267
666 2838031309 2838029111 Bacteria 6603031
667 2838037611 2838035591 Bacteria 7166484
668 2838047043 2838042994 Bacteria 6046894
669 2838049342 2838048938 Bacteria 6044578
670 2838067231 2838061910 Bacteria 6794874
671 2838073221 2838068647 Bacteria 6208656
672 2838076354 2838074704 Bacteria 6785777
673 2838662619 2838661181 Bacteria 7385261
674 2838670742 2838668709 Bacteria 6671819
675 2838676832 2838675328 Bacteria 4909118
676 2838681210 2838680041 Bacteria 6545511
677 2838688744 2838686498 Bacteria 7807632
678 2838694756 2838694306 Bacteria 6853137
679 2838703113 2838701080 Bacteria 6669771
680 2838708133 2838707686 Bacteria 6619912
681 2838715716 2838714209 Bacteria 5525906
682 2838720483 2838719591 Bacteria 5523910
683 2838726472 2838724970 Bacteria 4908691
684 2838731039 2838729681 Bacteria 7400765
685 2838738832 2838736955 Bacteria 5760694
686 2838744067 2838742623 Bacteria 7396178
687 2839998337 2839993093 Bacteria 5512535
688 2840765930 2840764183 Bacteria 6358399
689 2841842731 2841840854 Bacteria 5761912
690 2841847413 2841846520 Bacteria 5345850
691 2841856967 2841851746 Bacteria 7532261
692 2841860048 2841859092 Bacteria 5436171
693 2841870404 2841864319 Bacteria 6742987
694 2842080635 2842077413 Bacteria 6508645
695 2842116004 2842110456 Bacteria 7656360
696 2842121254 2842118031 Bacteria 7033875
697 2842126557 2842124991 Bacteria 5346824
698 2842131725 2842130223 Bacteria 4909145
699 2842142511 2842140634 Bacteria 5759631
700 2842147663 2842146304 Bacteria 5957337
701 2842153106 2842152218 Bacteria 4908957
702 2842159918 2842156927 Bacteria 6894975
703 2842168161 2842163707 Bacteria 6916235
704 2842171960 2842170452 Bacteria 5525737
705 2842176725 2842175837 Bacteria 4908771
706 2842183465 2842180545 Bacteria 6888678
707 2842188825 2842187318 Bacteria 5524014
708 2842193547 2842192696 Bacteria 6147454
709 2842202526 2842198810 Bacteria 6608673
710 2842207804 2842205361 Bacteria 6340321
711 2842213136 2842211629 Bacteria 5523832
712 2842220694 2842217011 Bacteria 7497767
713 2842225245 2842224351 Bacteria 5524473
714 2842234055 2842229732 Bacteria 7475766
715 2842237545 2842237096 Bacteria 6620661
716 2842245531 2842243621 Bacteria 7421798
717 2842252729 2842250916 Bacteria 6579627
718 2842259819 2842257432 Bacteria 7401195
719 2842269228 2842264693 Bacteria 6472963
720 2842274658 2842271015 Bacteria 7807131
721 2842281401 2842278818 Bacteria 6340002
722 2842287227 2842285085 Bacteria 6011953
723 2842294292 2842291075 Bacteria 7076806
724 2842300469 2842298080 Bacteria 6123127
725 2842306903 2842304105 Bacteria 7023636
726 2842314565 2842311132 Bacteria 6616990
727 2842318757 2842317721 Bacteria 6793725
728 2842343712 2842341865 Bacteria 7003929
729 2842358413 2842357229 Bacteria 6485165
730 2842365060 2842363717 Bacteria 6844742
731 2842371673 2842370503 Bacteria 7038661
732 2842380689 2842377471 Bacteria 7140707
733 2842387760 2842384541 Bacteria 7057858
734 2842400845 2842395702 Bacteria 6780583
735 2842404495 2842402390 Bacteria 6681310
736 2842410820 2842409023 Bacteria 6687331
737 2842417724 2842415677 Bacteria 6596907
738 2842426606 2842422224 Bacteria 6239196
739 2842433289 2842428310 Bacteria 6767288
740 2842439714 2842434925 Bacteria 6502746
741 2842446343 2842441272 Bacteria 6769273
742 2842453481 2842447887 Bacteria 6754142
743 2842467611 2842462802 Bacteria 6588055
744 2842474226 2842469257 Bacteria 6752936
745 2842478096 2842475841 Bacteria 6603183
746 2842482748 2842482326 Bacteria 7212537
747 2842494870 2842489311 Bacteria 6620893
748 2842497392 2842495871 Bacteria 6820686
749 2842504905 2842502639 Bacteria 6604161
750 2842509620 2842509118 Bacteria 6850950
751 2842516833 2842515876 Bacteria 5436280
752 2842525255 2842521101 Bacteria 6569494
753 2842872350 2842871566 Bacteria 4827117
754 2842923718 2842922631 Bacteria 5824079
755 2844163909 2844163670 Bacteria 7266046
756 2844455269 2844454524 Bacteria 7952546
757 2847418023 2847417321 Bacteria 6913799
758 2848992999 2848992105 Bacteria 6810864
759 2850080385 2850079185 Bacteria 6848280
760 2852388960 2852387548 Bacteria 8025568
761 2854898772 2854896431 Bacteria 5869725
762 2854921644 2854916844 Bacteria 5725939
763 2855831269 2855825444 Bacteria 6785811
764 2855840394 2855839649 Bacteria 7135830
765 2855879061 2855872281 Bacteria 6964271
766 2857520403 2857516855 Bacteria 7787325
767 2857531725 2857531043 Bacteria 6754041
768 2858800923 2858800743 Bacteria 6603254
769 2891376580 2891373044 Bacteria 5202277
770 2894654985 2894652903 Bacteria 4587256
771 2896386556 2896384573 Bacteria 7700774
772 2899792116 2899792073 Bacteria 4926588
773 2899806098 2899803654 Bacteria 5577784
774 2899846306 2899845264 Bacteria 5672268
775 2904582312 2904578770 Bacteria 5302906
776 2913311065 2913308742 Bacteria 5350706
777 2915986126 2915980308 Bacteria 6624279
778 2915989992 2915986958 Bacteria 6739310
779 2915996547 2915993759 Bacteria 7016183
780 2916005850 2916000859 Bacteria 6865702
781 2916010873 2916007675 Bacteria 6898660
782 2916020946 2916014648 Bacteria 6946486
783 2916027500 2916021584 Bacteria 6854472
784 2916028866 2916028427 Bacteria 6748433
785 2916035365 2916035215 Bacteria 6755766
786 2916043067 2916041962 Bacteria 6820487
787 2916054708 2916048683 Bacteria 6543552
788 2916061407 2916055098 Bacteria 6758838
789 2916068026 2916061851 Bacteria 6737736
790 2916072047 2916068649 Bacteria 6943657
791 2919103714 2919100787 Bacteria 7710546
792 2919115919 2919114240 Bacteria 5700270
793 2919122898 2919119836 Bacteria 5208557
794 2919167244 2919166419 Bacteria 4952238
795 2919171554 2919171160 Bacteria 6499771
796 2919409196 2919408235 Bacteria 6149349
797 2920762959 2920760137 Bacteria 7427611
798 2920823761 2920822456 Bacteria 6897201
799 2921204299 2921201388 Bacteria 6926299
800 2921215162 2921208531 Bacteria 6745326
801 2921243942 2921237296 Bacteria 6876710
802 2921245979 2921244191 Bacteria 6568419
803 2921250910 2921250672 Bacteria 6677771
804 2921261556 2921257292 Bacteria 6808382
805 2921269368 2921263974 Bacteria 6864552
806 2921288024 2921282425 Bacteria 6826397
807 2921290184 2921289301 Bacteria 7316391
808 2921303564 2921296804 Bacteria 7176999
809 2923557682 2923556063 Bacteria 6793593
810 2924146909 2924144063 Bacteria 6883928
811 2924153302 2924150972 Bacteria 7169444
812 2924160519 2924158325 Bacteria 7188855
813 2924166833 2924165586 Bacteria 7260590
814 2924178536 2924172951 Bacteria 6749356
815 2924181479 2924179722 Bacteria 6843264
816 2924190303 2924186466 Bacteria 6876637
817 2924204376 2924200457 Bacteria 6757188
818 2924209856 2924207177 Bacteria 6917007
819 2924216446 2924214083 Bacteria 7080103
820 2924224422 2924221636 Bacteria 7113495
821 2924234882 2924228884 Bacteria 6633132
822 2926756873 2926754445 Bacteria 5964435
823 2926761098 2926760298 Bacteria 5505990
824 2928524249 2928521798 Bacteria 4960112
825 2929139332 2929138655 Bacteria 5810547
826 2933007749 2933006813 Bacteria 4912075
827 2933012525 2933011516 Bacteria 5439334
828 2933018763 2933016740 Bacteria 6355406
829 2933572982 2933570622 Bacteria 7023390
830 2933592037 2933586486 Bacteria 7667493
831 2933594964 2933594066 Bacteria 5594265
832 2933603414 2933599457 Bacteria 5858799
833 2935895279 2935894831 Bacteria 6620579
834 2935904266 2935901341 Bacteria 7341747
835 2936368236 2936367885 Bacteria 7324495
836 2936378891 2936375103 Bacteria 6652732
837 2936386823 2936381700 Bacteria 7006523
838 2937000473 2936996657 Bacteria 6298727
839 2937009569 2937002841 Bacteria 6934057
840 2937010833 2937009748 Bacteria 6746052
841 2937022045 2937016420 Bacteria 6782579
842 2937027978 2937023124 Bacteria 6815156
843 2937029912 2937029754 Bacteria 6424026
844 2937041575 2937036028 Bacteria 6846469
845 2937046006 2937042894 Bacteria 6741576
846 2937050292 2937049772 Bacteria 6757901
847 2937061587 2937056579 Bacteria 7107896
848 2937066466 2937063883 Bacteria 7199456
849 2937073826 2937071275 Bacteria 6984483
850 2937083019 2937078374 Bacteria 6610289
851 2937091578 2937084907 Bacteria 6618516
852 2937098938 2937091812 Bacteria 6979387
853 2937103689 2937098957 Bacteria 7249374
854 2937113008 2937106411 Bacteria 6947143
855 2937118227 2937113482 Bacteria 6505872
856 2937121132 2937119839 Bacteria 6597547
857 2937130139 2937126314 Bacteria 6771275
858 2941500307 2941499720 Bacteria 7599444
859 2954013199 2954011201 Bacteria 4762601
860 2957380071 2957375807 Bacteria 6425588
861 2957385122 2957382221 Bacteria 6737050
862 2957389185 2957388812 Bacteria 6778072
863 2957398651 2957395598 Bacteria 6822399
864 2957405501 2957402308 Bacteria 6741770
865 2957415226 2957408893 Bacteria 6558585
866 2957418033 2957415311 Bacteria 6991633
867 2957426802 2957422303 Bacteria 7172205
868 2957433128 2957430029 Bacteria 7022557
869 2957438952 2957437181 Bacteria 6568994
870 2957446705 2957443900 Bacteria 6869977
871 2957453493 2957450854 Bacteria 6765715
872 2957457813 2957457609 Bacteria 6967680
873 2957466461 2957464669 Bacteria 6568877
874 2957473967 2957471148 Bacteria 6797643
875 2957483716 2957478035 Bacteria 6756658
876 2957485843 2957484790 Bacteria 6703082
877 2957495942 2957491536 Bacteria 6695180
878 2957511488 2957505466 Bacteria 7253085
879 2960590036 2960584000 Bacteria 6864594
880 2960595526 2960591022 Bacteria 6622873
881 2960600628 2960597568 Bacteria 6550735
882 2960609405 2960603979 Bacteria 6898737
883 2960617075 2960610863 Bacteria 6691244
884 2960617652 2960617483 Bacteria 6727748
885 2960626110 2960624210 Bacteria 6875384
886 2960633273 2960631154 Bacteria 6732508
887 2960645336 2960637947 Bacteria 7296468
888 2960648781 2960645483 Bacteria 7211087
889 2960653739 2960652885 Bacteria 7083688
890 2960662329 2960660292 Bacteria 7041660
891 2960673872 2960667422 Bacteria 6763020
892 2960676842 2960674078 Bacteria 6609048
893 2960684116 2960680706 Bacteria 6624464
894 2960688890 2960687367 Bacteria 6535474
895 2960696327 2960693952 Bacteria 6749742
896 2964613001 2964607997 Bacteria 7101408
897 2964617629 2964615318 Bacteria 6809089
898 2964627894 2964621998 Bacteria 6834995
899 2964633170 2964628898 Bacteria 7083044
900 2964642208 2964636051 Bacteria 7091832
901 2964648757 2964643177 Bacteria 6820887
902 2964653049 2964649959 Bacteria 6675118
903 2964661081 2964656573 Bacteria 7100150
904 2964666026 2964663802 Bacteria 7019362
905 2964671786 2964670856 Bacteria 6851364
906 2964684475 2964678106 Bacteria 6792020
907 2964685409 2964685014 Bacteria 6839111
908 2964695788 2964691889 Bacteria 6802758
909 2964699552 2964698721 Bacteria 6765331
910 2964712375 2964705432 Bacteria 7114648
911 2964718482 2964712639 Bacteria 6695970
912 2964725776 2964719344 Bacteria 7286602
913 2967667317 2967664464 Bacteria 6948836
914 2967672197 2967671571 Bacteria 7021409
915 2967678871 2967678726 Bacteria 7264382
916 2967686369 2967686174 Bacteria 6678622
917 2967693192 2967693043 Bacteria 6804451
918 2967701767 2967699805 Bacteria 6854538
919 2967709220 2967706974 Bacteria 7186053
920 2967716583 2967714385 Bacteria 7000047
921 2967724805 2967721400 Bacteria 7073753
922 2967734781 2967728569 Bacteria 6641507
923 2967740951 2967735183 Bacteria 6827012
924 2967742320 2967742019 Bacteria 6794534
925 2967752158 2967748971 Bacteria 6733771
926 2967757681 2967755722 Bacteria 6814706
927 2967763766 2967762386 Bacteria 6923502
928 2967774413 2967769361 Bacteria 6587838
929 2967777179 2967775926 Bacteria 6738189
930 2970026017 2970019648 Bacteria 7072033
931 2970032864 2970026789 Bacteria 6785236
932 2970037182 2970033650 Bacteria 7118744
933 2970043338 2970040964 Bacteria 6731123
934 2970049972 2970047711 Bacteria 7088379
935 2970059661 2970054988 Bacteria 6611507
936 2970065348 2970061556 Bacteria 7099761
937 2970074028 2970068827 Bacteria 7123112
938 2970077021 2970076120 Bacteria 6697332
939 2970085700 2970082768 Bacteria 6183754
940 2970093255 2970088815 Bacteria 6933825
941 2970101657 2970095765 Bacteria 6936963
942 2970108511 2970102677 Bacteria 6812532
943 2970109872 2970109326 Bacteria 6863976
944 2970118021 2970116247 Bacteria 6501857
945 2970128225 2970122695 Bacteria 6625855
946 2970129465 2970129317 Bacteria 6806560
947 2970136974 2970136068 Bacteria 7207982
948 2970149097 2970143518 Bacteria 6446480
949 2970153867 2970149975 Bacteria 6779706
950 2970162397 2970156795 Bacteria 7168044
951 2970167451 2970164137 Bacteria 6861252
952 2970171740 2970170962 Bacteria 6876229
953 2970179222 2970177841 Bacteria 6768001
954 2970189409 2970184632 Bacteria 7054431
955 2970198377 2970191845 Bacteria 7032787
956 2977520904 2977516862 Bacteria 6940108
957 2977527222 2977523885 Bacteria 6960446
958 2977537936 2977537788 Bacteria 6929320
959 2977544885 2977544691 Bacteria 6875412
960 2977551933 2977551784 Bacteria 7125765
961 2977563145 2977558990 Bacteria 6863948
962 2977568896 2977565890 Bacteria 6901543
963 2977579014 2977572785 Bacteria 6763888
964 2977581547 2977579622 Bacteria 6772100
965 2978973677 2978969890 Bacteria 5400756
966 2979093619 2979089926 Bacteria 5670289
967 2979098994 2979095461 Bacteria 5669583
968 2979105598 2979100975 Bacteria 5423623
969 2984512555 2984509177 Bacteria 5274802
970 2984521084 2984518228 Bacteria 5277463
971 2984540378 2984537506 Bacteria 5277481
972 2984591951 2984587000 Bacteria 5263363
973 2984602575 2984601300 Bacteria 5455244
974 2989354283 2989349275 Bacteria 6349068
975 2989778071 2989776772 Bacteria 4843317
976 2996890861 2996887358 Bacteria 5795980
977 2996895402 2996893221 Bacteria 5823108
978 3002146180 3002141150 Bacteria 5254435
979 3005412287 3005409236 Bacteria 7188837
980 3005417036 3005416602 Bacteria 7064308
981 3005446652 3005445848 Bacteria 6906074
982 3005453336 3005452660 Bacteria 5889319
983 639647328 639633055 Bacteria 7751309
984 643825000 643692032 Bacteria 6891900
985 648740550 648276728 Bacteria 6968865
986 650739431 650716007 Bacteria 5573770
987 8003570473 8003570095 Bacteria 5747666
988 8003992810 8003992118 Bacteria 7266902
989 8004000136 8003999396 Bacteria 7063185
990 8005246685 8005246636 Bacteria 4933972
991 8005262115 8005258706 Bacteria 6184835
992 8005279463 8005275841 Bacteria 6929066
993 8005287104 8005282627 Bacteria 6675747
994 8005292687 8005289223 Bacteria 6634003
995 8005304457 8005301065 Bacteria 6614431
996 8005309038 8005307578 Bacteria 7395396
997 8005315097 8005314921 Bacteria 7072929
998 8005325388 8005321885 Bacteria 5795980
999 8005376725 8005376324 Bacteria 6590079
1000 8005386108 8005382845 Bacteria 6732062
1001 8005397494 8005395548 Bacteria 6806915
1002 8005435410 8005430974 Bacteria 6689030
1003 8005461813 8005460587 Bacteria 7157962
1004 8005485732 8005484373 Bacteria 6297373
1005 8005499220 8005497431 Bacteria 6477605
1006 8005544241 8005542996 Bacteria 7077758
1007 8005563028 8005556819 Bacteria 6908598
1008 8005570325 8005563573 Bacteria 7153261
1009 8005574054 8005570704 Bacteria 6957481
1010 8005620413 8005619151 Bacteria 7030230
1011 8005629036 8005626139 Bacteria 6534237
1012 8005648124 8005645114 Bacteria 6950293
1013 8005660070 8005658619 Bacteria 4500593
1014 8005670636 8005668836 Bacteria 6953162
1015 8005684706 8005682033 Bacteria 6726518
1016 8005690878 8005688590 Bacteria 6610080
1017 8005698904 8005695170 Bacteria 6912330
1018 8018131184 8018127388 Bacteria 7351159
1019 8018153760 8018150411 Bacteria 5549903
1020 8018168287 8018163183 Bacteria 7277977
1021 8018177364 8018176218 Bacteria 6896178
1022 8023687110 8023680758 Bacteria 7729763
1023 8024480992 8024479707 Bacteria 6954785
1024 8024489853 8024486573 Bacteria 6540512
1025 8024503369 8024501048 Bacteria 6427847
1026 8046767562 8046767195 Bacteria 7547379
1027 8049293830 8049293176 Bacteria 6128433
1028 8054461784 8054460903 Bacteria 4872905
1029 8054558764 8054558443 Bacteria 5204801
1030 8055434070 8055431914 Bacteria 4551896
1031 8056379456 8056375014 Bacteria 7006639
1032 8056384864 8056382006 Bacteria 6408074
1033 8056880026 8056875544 Bacteria 4355797
1034 8057579091 8057575449 Bacteria 7367519
1035 8057879632 8057874678 Bacteria 7494653
1036 Ga0500618_000055
1037 JGI24740J21852_10000602
1038 JGI25155J39150_1000072
1039 JGI25156J39149_1000086
1040 JGI25162J39368_1000956
1041 JGI25162J39368_1001709
1042 JGI25154J39366_1000205
1043 JGI25157J39369_1000113
1044 JGI25152J39213_1000959
1045 JGI25150J39212_1000031
1046 JGI25159J45721_1000001
1047 JGI25159J45721_1000064
1048 JGI25159J45721_1001419
1049 JGI25151J46595_10000062
1050 JGI25151J46595_10007169
1051 JGI25151J46595_10018956
1052 JGI25165J46597_1001014
1053 JGI25165J46597_1001037
1054 JGI25153J46596_10000312
1055 JGI25153J46596_10005340
1056 rootL2_10113901
1057 rootH1_10015315
1058 JGI25160J50197_1000002
1059 JGI25160J50197_1000052
1060 JGI25160J50197_1024650
1061 JGI25161J50226_1000073
1062 JGI25161J50226_1000153
1063 JGI25161J50226_1003967
1064 Ga0055526_1002168
1065 Ga0055526_1003266
1066 Ga0055526_1003657
1067 Ga0055526_1005117
1068 Ga0055526_1014304
1069 Ga0055526_1015152
1070 Ga0055526_1020618
1071 Ga0055524_1003026
1072 Ga0055524_1005073
1073 Ga0055524_1006865
1074 Ga0055524_1017546
1075 Ga0055536_1000427
1076 Ga0055536_1003558
1077 Ga0055536_1005875
1078 Ga0055536_1008275
1079 Ga0055528_1000097
1080 Ga0055528_1000413
1081 Ga0055528_1007933
1082 Ga0055540_1000234
1083 Ga0055540_1003105
1084 Ga0055531_10024536
1085 Ga0055543_1000035
1086 Ga0055543_1001724
1087 Ga0065165_1000004
1088 Ga0065165_1001373
1089 Ga0065165_1001548
1090 Ga0065165_1001869
1091 Ga0065165_1006808
1092 Ga0065165_1010060
1093 Ga0065165_1010294
1094 Ga0070658_10015409
1095 Ga0070658_10016053
1096 Ga0070658_10165504
1097 Ga0070670_100000347
1098 Ga0070671_100025768
1099 Ga0070674_100040340
1100 Ga0070659_100028862
1101 Ga0070681_10111950
1102 Ga0070679_100012408
1103 Ga0070684_100036084
1104 Ga0070665_100002410
1105 Ga0070665_100192518
1106 Ga0070665_100196685
1107 Ga0068855_100010038
1108 Ga0068855_100010543
1109 Ga0068857_100178708
1110 Ga0068856_100018126
1111 Ga0068856_100046094
1112 Ga0068856_100199246
1113 Ga0068852_100024682
1114 Ga0068852_100038488
1115 Ga0068851_10005049
1116 Ga0075365_10012052
1117 Ga0075368_10015374
1118 Ga0075363_100008956
1119 Ga0075364_10000177
1120 Ga0070712_100064141
1121 Ga0075367_10006431
1122 Ga0075367_10007923
1123 Ga0075367_10021879
1124 Ga0075369_10023091
1125 Ga0075369_10041985
1126 Ga0075366_10004489
1127 Ga0097621_100010551
1128 Ga0075370_10092350
1129 Ga0068871_100052091
1130 Ga0079104_1000010
1131 Ga0079104_1002175
1132 Ga0079104_1010103
1133 Ga0099826_10000838
1134 Ga0099826_10085596
1135 Ga0099795_10000284
1136 Ga0105251_10010972
1137 Ga0105240_10000027
1138 Ga0105240_10011173
1139 Ga0105240_10049005
1140 Ga0105245_10122532
1141 Ga0105243_10013570
1142 Ga0105241_10007637
1143 Ga0105242_10085818
1144 Ga0105248_10004763
1145 Ga0105248_10280267
1146 Ga0105237_10004420
1147 Ga0105238_10019957
1148 Ga0123341_1000006
1149 Ga0123342_1009880
1150 Ga0099796_10004798
1151 Ga0105239_10010623
1152 Ga0157373_10005723
1153 Ga0157371_10000307
1154 Ga0157370_10000223
1155 Ga0157370_10000577
1156 Ga0157370_10018273
1157 Ga0157369_10000908
1158 Ga0157369_10068607
1159 Ga0157369_10109759
1160 Ga0157369_10199134
1161 Ga0157372_10001580
1162 Ga0163163_10087840
1163 Ga0182007_10009549
1164 Ga0182005_1001113
1165 Ga0183363_1089
1166 Ga0214544_1000008
1167 Ga0214542_1008369
1168 Ga0214542_1010138
1169 Ga0214543_1000003
1170 Ga0214543_1000004
1171 Ga0228711_1000001
1172 Ga0228710_1000001
1173 Ga0209435_100036
1174 Ga0209436_100047
1175 Ga0209436_102304
1176 Ga0209672_103187
1177 Ga0209437_100033
1178 Ga0209437_100036
1179 Ga0207425_1000031
1180 Ga0207425_1001110
1181 Ga0207425_1010137
1182 Ga0209646_1000132
1183 Ga0209026_1000236
1184 Ga0209759_1000269
1185 Ga0209129_1000053
1186 Ga0209129_1000125
1187 Ga0209129_1000611
1188 Ga0209129_1001053
1189 Ga0209129_1001178
1190 Ga0209129_1001568
1191 Ga0209129_1003548
1192 Ga0209233_1000056
1193 Ga0209233_1000064
1194 Ga0209233_1000152
1195 Ga0209455_1008421
1196 Ga0209673_1000122
1197 Ga0209673_1000409
1198 Ga0209673_1001508
1199 Ga0209673_1001874
1200 Ga0209673_1001941
1201 Ga0209673_1002296
1202 Ga0209673_1006574
1203 Ga0209130_1000006
1204 Ga0209130_1000008
1205 Ga0209130_1015165
1206 Ga0209676_1001841
1207 Ga0209676_1002222
1208 Ga0209676_1012750
1209 Ga0209025_1000074
1210 Ga0209025_1000080
1211 Ga0209025_1000087
1212 Ga0209025_1000100
1213 Ga0209025_1000165
1214 Ga0209025_1000900
1215 Ga0209025_1001226
1216 Ga0209025_1001688
1217 Ga0209025_1007426
1218 Ga0209025_1012756
1219 Ga0209025_1033604
1220 Ga0209564_1000104
1221 Ga0209564_1000853
1222 Ga0209564_1001099
1223 Ga0209564_1001645
1224 Ga0209564_1005387
1225 Ga0209758_1000081
1226 Ga0209758_1000121
1227 Ga0209758_1000313
1228 Ga0209758_1000624
1229 Ga0209758_1003467
1230 Ga0209758_1008055
1231 Ga0209758_1014909
1232 Ga0209050_1001263
1233 Ga0209050_1012778
1234 Ga0209256_1000351
1235 Ga0209256_1001199
1236 Ga0209256_1001393
1237 Ga0209256_1001494
1238 Ga0209256_1002645
1239 Ga0209256_1003108
1240 Ga0209256_1003692
1241 Ga0209256_1008356
1242 Ga0207426_1000016
1243 Ga0207426_1000044
1244 Ga0207426_1000106
1245 Ga0207426_1000743
1246 Ga0207426_1001023
1247 Ga0209051_1000339
1248 Ga0209051_1000918
1249 Ga0209051_1001825
1250 Ga0209051_1014302
1251 Ga0209257_1001790
1252 Ga0209257_1002795
1253 Ga0209257_1002847
1254 Ga0209257_1003481
1255 Ga0207705_10029588
1256 Ga0207707_10111347
1257 Ga0207695_10000024
1258 Ga0207695_10018654
1259 Ga0207695_10025079
1260 Ga0207671_10000986
1261 Ga0207660_10193806
1262 Ga0207652_10044177
1263 Ga0207681_10113687
1264 Ga0207650_10000567
1265 Ga0207664_10172947
1266 Ga0207644_10079078
1267 Ga0207711_10036636
1268 Ga0207667_10031906
1269 Ga0207677_10006032
1270 Ga0207708_10117069
1271 Ga0207702_10164056
1272 Ga0207683_10137732
1273 Ga0207698_10005638
1274 Ga0207698_10028833
1275 Ga0209281_1000053
1276 Ga0209281_1000164
1277 Ga0209281_1000377
1278 Ga0209371_1000009
1279 Ga0209371_1001175
1280 Ga0209371_1005859
1281 Ga0209282_1000007
1282 Ga0209282_1000715
1283 Ga0209282_1071011
1284 Ga0268266_10032452
1285 Ga0268266_10110435
1286 Ga0307515_10000115
1287 Ga0307515_10001359
1288 Ga0307515_10002710
1289 Ga0268256_1000010
1290 Ga0268256_1005834
1291 Ga0316181_1002016
1292 Ga0265327_10000778
1293 Ga0265327_10001708
1294 Ga0265327_10024281
1295 Ga0265316_10006286
1296 Ga0307513_10008680
1297 Ga0307513_10014591
1298 Ga0307410_10095821
1299 Ga0307412_10001806
1300 Ga0307412_10079261
1301 Ga0315914_1000006
1302 Ga0307416_100153035
1303 Ga0307414_10002909
1304 Ga0315913_1000002
1305 Ga0315915_1000001
1306 Ga0373927_0000780
1307 Ga0395905_0007143
1308 Ga0395905_0008439
1309 Ga0395905_0127507
1310 Ga0237819_00516
1311 Ga0237816_01893
1312 Ga0439436_0025113
1313 Ga0439439_0021887
1314 Ga0439465_0004088
1315 Ga0439465_0017163
1316 Ga0439465_0020090
1317 Ga0451837_1135412
1318 Ga0451839_0324124
1319 Ga0439431_0013507
1320 Ga0439432_033106
1321 Ga0439449_0006077
1322 Ga0451576_0025375
1323 Ga0451576_0244129
1324 Ga0466958_0014567
1325 Ga0495592_0074268
1326 Ga0495629_0014314
1327 Ga0495638_0000854
1328 Ga0495638_0043878
1329 Ga0495650_0000461
1330 Ga0495650_0053217
1331 Ga0495605_0000331
1332 Ga0495662_0049991
1333 Ga0495585_0062382
1334 Ga0495607_0026847
1335 Ga0495583_0008582
1336 Ga0495583_0008848
1337 Ga0495606_0003594
1338 Ga0495606_0029980
1339 Ga0495610_0012464
1340 Ga0495616_0021617
1341 Ga0495620_0010432
1342 Ga0495620_0047972
1343 Ga0495631_0003782
1344 Ga0495631_0027381
1345 Ga0495632_0002635
1346 Ga0495632_0006079
1347 Ga0495643_0019999
1348 Ga0495643_0035161
1349 Ga0495643_0106004
1350 Ga0495648_0051940
1351 Ga0495652_0040107
1352 Ga0495654_0000130
1353 Ga0495587_0017692
1354 Ga0495609_0031792
1355 Ga0495622_0012970
1356 Ga0495633_0008112
1357 Ga0495668_0007613
1358 Ga0495668_0023282
1359 Ga0495625_0000726
1360 Ga0495625_0001965
1361 Ga0495625_0077921
1362 Ga0495661_0106826
1363 Ga0495657_0033534
1364 Ga0495600_0024098
1365 Ga0495660_0007221
1366 Ga0495673_0050131
1367 Ga0495681_0004767
1368 Ga0495681_0058420
1369 Ga0495686_0000238
1370 Ga0495686_0000613
1371 Ga0495686_0012665
1372 Ga0495686_0128339
1373 Ga0496100_0187288
1374 Ga0496102_0023580
1375 Ga0496104_0238028
1376 Ga0496106_0001004
1377 Ga0496110_0106678
1378 Ga0496113_0035330
1379 Ga0496114_0120299
1380 Ga0496116_0000036
1381 Ga0496116_0001619
1382 Ga0496116_0002976
1383 Ga0496116_0010396
1384 Ga0496116_0017233
1385 Ga0496116_0100819
1386 Ga0496117_0000002
1387 Ga0496117_0006548
1388 Ga0496117_0007855
1389 Ga0496117_0036258
1390 Ga0496117_0046076
1391 Ga0496117_0051153
1392 Ga0496117_0071672
1393 Ga0496118_0000084
1394 Ga0496118_0000396
1395 Ga0496118_0002631
1396 Ga0496118_0006506
1397 Ga0496118_0092593
1398 Ga0496119_0010878
1399 Ga0496119_0019985
1400 Ga0496119_0029046
1401 Ga0496119_0032929
1402 Ga0496119_0051426
1403 Ga0496120_0000087
1404 Ga0496120_0004845
1405 Ga0496120_0028306
1406 Ga0496121_0000001
1407 Ga0496121_0001141
1408 Ga0496121_0005778
1409 Ga0496121_0009367
1410 Ga0496121_0010484
1411 Ga0496121_0015300
1412 Ga0496121_0020840
1413 Ga0496121_0046720
1414 Ga0496121_0050304
1415 Ga0496121_0109694
1416 Ga0496121_0125056
1417 Ga0496122_0000001
1418 Ga0496122_0000009
1419 Ga0496122_0000205
1420 Ga0496122_0014055
1421 Ga0496122_0017027
1422 Ga0496122_0018436
1423 Ga0496122_0086661
1424 Ga0496123_0000001
1425 Ga0496123_0000034
1426 Ga0496123_0000103
1427 Ga0496123_0007399
1428 Ga0496123_0008628
1429 Ga0496123_0009779
1430 Ga0496123_0010695
1431 Ga0496124_0000133
1432 Ga0496124_0000854
1433 Ga0496124_0001267
1434 Ga0496124_0009898
1435 Ga0496124_0013954
1436 Ga0496124_0025344
1437 Ga0496124_0035983
1438 Ga0496124_0100955
1439 Ga0496124_0109217
1440 Ga0496125_0000001
1441 Ga0496125_0000385
1442 Ga0496125_0013299
1443 Ga0496125_0018668
1444 Ga0496126_0000597
1445 Ga0496126_0001488
1446 Ga0496126_0018669
1447 Ga0496126_0122689
1448 Ga0501033_0000038
1449 Ga0501033_0021895
1450 Ga0501034_0003022
1451 Ga0501034_0312590
1452 Ga0501037_0057845
1453 Ga0501038_0167137
1454 Ga0501043_0058918
1455 Ga0501047_0001955
1456 Ga0501047_0178982
1457 Ga0501068_0098395
1458 Ga0501069_0004546
1459 Ga0501070_0001389
1460 Ga0501072_0204362
1461 Ga0501073_0000206
1462 Ga0501074_0000330
1463 Ga0501083_0000293
1464 Ga0501083_0064521
1465 Ga0501035_0000326
1466 Ga0501035_0170579
1467 Ga0501044_0034308
1468 nmdc:mga03683_51004_c1
1469 nmdc:mga00v17_13054_c1
1470 nmdc:mga00v17_201_c1
1471 nmdc:mga00v17_52_c1
1472 nmdc:mga0yw44_4284_c1
1473 nmdc:mga07m45_84678_c1
1474 Ga0500643_032572
1475 Ga0500566_0002633
1476 Ga0500560_000407
1477 Ga0500595_004324
1478 Ga0500618_000616
1479 Ga0500618_002635
1480 Ga0500618_004048
1481 Ga0500618_014196
1482 Ga0500658_0001240
1483 Ga0500561_0000114
1484 Ga0500568_0001799
1485 Ga0500573_0048611
1486 Ga0500616_0000224
1487 Ga0500616_0000328
1488 Ga0500616_0062932
1489 Ga0500622_0000919
1490 Ga0500622_0001161
1491 Ga0500624_000161
1492 Ga0500633_0000113
1493 Ga0500634_0014495
1494 Ga0500636_0000004
1495 Ga0500636_0045907
1496 2509107461
1497 2509374547
1498 2509387828
1499 2509443446
1500 2510132192
1501 2510304464
1502 2510840978
1503 2510898526
1504 2511133601
1505 2511171853
1506 2511182129
1507 2511199581
1508 2511390381
1509 2511500918
1510 2512532340
1511 2512972331
1512 2513569026
1513 2513580053
1514 2513583544
1515 2513596142
1516 2513603410
1517 2513617529
1518 2513635680
1519 2513709315
1520 2513865732
1521 2513882757
1522 2513905302
1523 2513907633
1524 2513925603
1525 2513999462
1526 2514004865
1527 2514023108
1528 2515111172
1529 2515608043
1530 2515636040
1531 2515642692
1532 2515658791
1533 2515743897
1534 2516208796
1535 2516892195
1536 2517039817
1537 2517075339
1538 2517093943
1539 2517405758
1540 2517569004
1541 2524450241
1542 2524457913
1543 2530644003
1544 2535515611
1545 2537877064
1546 2551676378
1547 2551687485
1548 2551699171
1549 2551719052
1550 2551730330
1551 2551738827
1552 2551745388
1553 2554247015
1554 2558863575
1555 2559294240
1556 2561465974
1557 2585165457
1558 2585202976
1559 2585220876
1560 2585230517
1561 2585256710
1562 2585266281
1563 2585275752
1564 2585278801
1565 2585325585
1566 2585329740
1567 2585387282
1568 2585397785
1569 2585400253
1570 2585525530
1571 2585535911
1572 2585543823
1573 2585550025
1574 2585554006
1575 2585559329
1576 2585822977
1577 2585839310
1578 2585847313
1579 2585901204
1580 2585905294
1581 2585994989
1582 2585999531
1583 2587979591
1584 2599333883
1585 2599418698
1586 2599603425
1587 2599724217
1588 2600191843
1589 2600375171
1590 2601608776
1591 2601745550
1592 2616305925
1593 2616553830
1594 2617381924
1595 2643807295
1596 2643810092
1597 2643820667
1598 2643855990
1599 2643918611
1600 2644007818
1601 2644046676
1602 2644069707
1603 2644109086
1604 2644151606
1605 2644191079
1606 2644202383
1607 2644206299
1608 2644242786
1609 2644296947
1610 2644311742
1611 2644330013
1612 2644380678
1613 2644414583
1614 2644448240
1615 2644479465
1616 2644493487
1617 2644500906
1618 2644518844
1619 2644543233
1620 2644617540
1621 2644649947
1622 2644655201
1623 2644673640
1624 2644689453
1625 2657682229
1626 2671112757
1627 2692316909
1628 2719384745
1629 2719664505
1630 2719730897
1631 2720490925
1632 2720612289
1633 2720619127
1634 2720630529
1635 2720774222
1636 2721146241
1637 2721157762
1638 2721163121
1639 2721398456
1640 2722839291
1641 2723025947
1642 2723559493
1643 2723566110
1644 2724037269
1645 2724043653
1646 2724088829
1647 2724103375
1648 2724109213
1649 2725951080
1650 2730106883
1651 2730163385
1652 2730297394
1653 2738803638
1654 2738948795
1655 2739039068
1656 2753458885
1657 2765466322
1658 2766067714
1659 2770198957
1660 2776270217
1661 2776285056
1662 2776912651
1663 2778177360
1664 2792584077
1665 2792622122
1666 2792628313
1667 2792638428
1668 2793282834
1669 2793299746
1670 2793316917
1671 2793329346
1672 2793336149
1673 2793339909
1674 2793350081
1675 2793353463
1676 2793358785
1677 2793370495
1678 2802717647
1679 2802723426
1680 2802731124
1681 2802736130
1682 2802743659
1683 2802750629
1684 2804751248
1685 2805930413
1686 2805936163
1687 2806049487
1688 2806056582
1689 2806063640
1690 2806067637
1691 2806077977
1692 2808985984
1693 2819242662
1694 2819556106
1695 2819613643
1696 2819639354
1697 2819684267
1698 2821124144
1699 2838017174
1700 2838026922
1701 2838031309
1702 2838037611
1703 2838047043
1704 2838049342
1705 2838067231
1706 2838073221
1707 2838076354
1708 2838662619
1709 2838670742
1710 2838676832
1711 2838681210
1712 2838688744
1713 2838694756
1714 2838703113
1715 2838708133
1716 2838715716
1717 2838720483
1718 2838726472
1719 2838731039
1720 2838738832
1721 2838744067
1722 2839998337
1723 2840765930
1724 2841842731
1725 2841847413
1726 2841856967
1727 2841860048
1728 2841870404
1729 2842080635
1730 2842116004
1731 2842121254
1732 2842126557
1733 2842131725
1734 2842142511
1735 2842147663
1736 2842153106
1737 2842159918
1738 2842168161
1739 2842171960
1740 2842176725
1741 2842183465
1742 2842188825
1743 2842193547
1744 2842202526
1745 2842207804
1746 2842213136
1747 2842220694
1748 2842225245
1749 2842234055
1750 2842237545
1751 2842245531
1752 2842252729
1753 2842259819
1754 2842269228
1755 2842274658
1756 2842281401
1757 2842287227
1758 2842294292
1759 2842300469
1760 2842306903
1761 2842314565
1762 2842318757
1763 2842343712
1764 2842358413
1765 2842365060
1766 2842371673
1767 2842380689
1768 2842387760
1769 2842400845
1770 2842404495
1771 2842410820
1772 2842417724
1773 2842426606
1774 2842433289
1775 2842439714
1776 2842446343
1777 2842453481
1778 2842467611
1779 2842474226
1780 2842478096
1781 2842482748
1782 2842494870
1783 2842497392
1784 2842504905
1785 2842509620
1786 2842516833
1787 2842525255
1788 2842872350
1789 2842923718
1790 2844163909
1791 2844455269
1792 2847418023
1793 2848992999
1794 2850080385
1795 2852388960
1796 2854898772
1797 2854921644
1798 2855831269
1799 2855840394
1800 2855879061
1801 2857520403
1802 2857531725
1803 2858800923
1804 2891376580
1805 2894654985
1806 2896386556
1807 2899792116
1808 2899806098
1809 2899846306
1810 2904582312
1811 2913311065
1812 2915986126
1813 2915989992
1814 2915996547
1815 2916005850
1816 2916010873
1817 2916020946
1818 2916027500
1819 2916028866
1820 2916035365
1821 2916043067
1822 2916054708
1823 2916061407
1824 2916068026
1825 2916072047
1826 2919103714
1827 2919115919
1828 2919122898
1829 2919167244
1830 2919171554
1831 2919409196
1832 2920762959
1833 2920823761
1834 2921204299
1835 2921215162
1836 2921243942
1837 2921245979
1838 2921250910
1839 2921261556
1840 2921269368
1841 2921288024
1842 2921290184
1843 2921303564
1844 2923557682
1845 2924146909
1846 2924153302
1847 2924160519
1848 2924166833
1849 2924178536
1850 2924181479
1851 2924190303
1852 2924204376
1853 2924209856
1854 2924216446
1855 2924224422
1856 2924234882
1857 2926756873
1858 2926761098
1859 2928524249
1860 2929139332
1861 2933007749
1862 2933012525
1863 2933018763
1864 2933572982
1865 2933592037
1866 2933594964
1867 2933603414
1868 2935895279
1869 2935904266
1870 2936368236
1871 2936378891
1872 2936386823
1873 2937000473
1874 2937009569
1875 2937010833
1876 2937022045
1877 2937027978
1878 2937029912
1879 2937041575
1880 2937046006
1881 2937050292
1882 2937061587
1883 2937066466
1884 2937073826
1885 2937083019
1886 2937091578
1887 2937098938
1888 2937103689
1889 2937113008
1890 2937118227
1891 2937121132
1892 2937130139
1893 2941500307
1894 2954013199
1895 2957380071
1896 2957385122
1897 2957389185
1898 2957398651
1899 2957405501
1900 2957415226
1901 2957418033
1902 2957426802
1903 2957433128
1904 2957438952
1905 2957446705
1906 2957453493
1907 2957457813
1908 2957466461
1909 2957473967
1910 2957483716
1911 2957485843
1912 2957495942
1913 2957511488
1914 2960590036
1915 2960595526
1916 2960600628
1917 2960609405
1918 2960617075
1919 2960617652
1920 2960626110
1921 2960633273
1922 2960645336
1923 2960648781
1924 2960653739
1925 2960662329
1926 2960673872
1927 2960676842
1928 2960684116
1929 2960688890
1930 2960696327
1931 2964613001
1932 2964617629
1933 2964627894
1934 2964633170
1935 2964642208
1936 2964648757
1937 2964653049
1938 2964661081
1939 2964666026
1940 2964671786
1941 2964684475
1942 2964685409
1943 2964695788
1944 2964699552
1945 2964712375
1946 2964718482
1947 2964725776
1948 2967667317
1949 2967672197
1950 2967678871
1951 2967686369
1952 2967693192
1953 2967701767
1954 2967709220
1955 2967716583
1956 2967724805
1957 2967734781
1958 2967740951
1959 2967742320
1960 2967752158
1961 2967757681
1962 2967763766
1963 2967774413
1964 2967777179
1965 2970026017
1966 2970032864
1967 2970037182
1968 2970043338
1969 2970049972
1970 2970059661
1971 2970065348
1972 2970074028
1973 2970077021
1974 2970085700
1975 2970093255
1976 2970101657
1977 2970108511
1978 2970109872
1979 2970118021
1980 2970128225
1981 2970129465
1982 2970136974
1983 2970149097
1984 2970153867
1985 2970162397
1986 2970167451
1987 2970171740
1988 2970179222
1989 2970189409
1990 2970198377
1991 2977520904
1992 2977527222
1993 2977537936
1994 2977544885
1995 2977551933
1996 2977563145
1997 2977568896
1998 2977579014
1999 2977581547
2000 2978973677
2001 2979093619
2002 2979098994
2003 2979105598
2004 2984512555
2005 2984521084
2006 2984540378
2007 2984591951
2008 2984602575
2009 2989354283
2010 2989778071
2011 2996890861
2012 2996895402
2013 3002146180
2014 3005412287
2015 3005417036
2016 3005446652
2017 3005453336
2018 639647328
2019 643825000
2020 648740550
2021 650739431
2022 8003570473
2023 8003992810
2024 8004000136
2025 8005246685
2026 8005262115
2027 8005279463
2028 8005287104
2029 8005292687
2030 8005304457
2031 8005309038
2032 8005315097
2033 8005325388
2034 8005376725
2035 8005386108
2036 8005397494
2037 8005435410
2038 8005461813
2039 8005485732
2040 8005499220
2041 8005544241
2042 8005563028
2043 8005570325
2044 8005574054
2045 8005620413
2046 8005629036
2047 8005648124
2048 8005660070
2049 8005670636
2050 8005684706
2051 8005690878
2052 8005698904
2053 8018131184
2054 8018153760
2055 8018168287
2056 8018177364
2057 8023687110
2058 8024480992
2059 8024489853
2060 8024503369
2061 8046767562
2062 8049293830
2063 8054461784
2064 8054558764
2065 8055434070
2066 8056379456
2067 8056384864
2068 8056880026
2069 8057579091
2070 8057879632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00012

HSP70

Hsp70 protein

355

493

0.86

PF00012

HSP70

Hsp70 protein

76

316

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rtf-assembly1.cif.gz_D crystal structure of molecular chaperone dnak from mycobacterium tuberculosis h37rv 0.8184 3 417
4rtf-assembly1.cif.gz_D crystal structure of molecular chaperone dnak from mycobacterium tuberculosis h37rv 0.8033 3 417
5oby-assembly1.cif.gz_A mycoplasma genitalium dnak-nbd in complex with amp-pnp 0.7925 3 419
6w6e-assembly1.cif.gz_I the mycobacterium tuberculosis clpb disaggregase hexamer structure with a locally refined clpb middle domain and a dnak nucleotide binding domain 0.7907 1 415
5obv-assembly1.cif.gz_A mycoplasma genitalium dnak deletion mutant lacking sbdalpha in complex with adp and pi. 0.7894 1 426
ID Description Score Start End Superfamily
af_P36928_307_378_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8703 280 347 3.30.420.40
4rtfD03 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 0.8598 305 354 3.90.640.10
af_O07239_201_278_3.90.640.10 Alpha Beta;Alpha-Beta Complex;Actin; Chain A, domain 4;ATPase, substrate binding domain, subdomain 4 0.8417 303 349 3.90.640.10
4rtfD01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8366 3 175 3.30.420.40
af_P36928_307_378_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8173 280 347 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A520JBI4-F1-model_v4 Hsp70 family protein 0.9624 191 429 GO:0005524
GO:0140662
AF-A0A520JBI4-F1-model_v4 Hsp70 family protein 0.9546 191 429 GO:0005524
GO:0140662
AF-A0A839EQ70-F1-model_v4 Putative chaperone protein 0.9541 1 429 GO:0005524
GO:0140662
AF-A0A2A2M2Q2-F1-model_v4 Uncharacterized protein 0.9527 237 429 GO:0005524
GO:0005634
GO:0005829
GO:0140662
AF-A0A259I9A7-F1-model_v4 deleted 0.9498 281 429

Map