F488722
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1036 | 233 | 2072 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300031824|Ga0307413_10003680|Ga0307413_100036809 |
| Length | 328 |
| Sequence | MRFFSDNAAAACPQVIEALQAANRLDTAYDGDQWSERLDGAFSNLFGKPVRALWVATGTAANCLGLATLCPPHGAILCHEVAHIEVDEAGAPGFFTHGAKLTLLPGPEIVDEACGRVRADVHQVQPSALSITNATEYGLSYRADEVAALGDLAKRRGLGFHLDGARFANAVAFTGASPAELTWRAGVEVMSFGFVKNGGMNAEALIFFNPDKAEEVPRLRKRAGHLQSKGRFLAAQILAMLDGDLWLNNARAANAAXXXLAEAAGPDRLIYPVEANELFVRMTAEEAATLRSQGYDFYDWAPDEVRFVTSWDQDLAAVGQLAAAIRAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 177 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 180 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 181 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 182 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 183 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 184 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 185 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 186 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 187 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 188 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 189 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 190 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 191 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 192 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 193 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 225 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 226 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 227 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 229 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 231 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 233 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.19 |
| Nodule | 0 |
| Rhizoplane | 5.02 |
| Rhizosphere | 94.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307413_10003680 | 3300031824 | Bacteria | 6513 |
| 2 | JGI24736J21556_1000081 | 3300001904 | Bacteria | 15740 |
| 3 | JGI24740J21852_10012509 | 3300001979 | Bacteria | 3197 |
| 4 | JGI24739J22299_10005774 | 3300001989 | Bacteria | 4690 |
| 5 | JGI24739J22299_10010582 | 3300001989 | Bacteria | 3423 |
| 6 | JGI24737J22298_10000548 | 3300001990 | Bacteria | 13144 |
| 7 | JGI24735J21928_10012264 | 3300002067 | Bacteria | 2711 |
| 8 | JGI24738J21930_10004476 | 3300002075 | Bacteria | 3419 |
| 9 | rootH1_10041045 | 3300003323 | Bacteria | 2631 |
| 10 | Ga0070658_10000220 | 3300005327 | Bacteria | 50700 |
| 11 | Ga0070658_10002137 | 3300005327 | Bacteria | 16586 |
| 12 | Ga0070658_10015611 | 3300005327 | Bacteria | 6073 |
| 13 | Ga0070658_10021629 | 3300005327 | Bacteria | 5154 |
| 14 | Ga0070658_10022864 | 3300005327 | Bacteria | 5018 |
| 15 | Ga0070658_10025048 | 3300005327 | Bacteria | 4783 |
| 16 | Ga0070658_10033600 | 3300005327 | Bacteria | 4128 |
| 17 | Ga0070658_10056961 | 3300005327 | Bacteria | 3178 |
| 18 | Ga0070658_10066204 | 3300005327 | Bacteria | 2951 |
| 19 | Ga0070658_10094834 | 3300005327 | Bacteria | 2462 |
| 20 | Ga0070658_10101754 | 3300005327 | Bacteria | 2375 |
| 21 | Ga0070658_10105680 | 3300005327 | Bacteria | 2329 |
| 22 | Ga0070658_10109872 | 3300005327 | Unclassified | 2283 |
| 23 | Ga0070658_10196194 | 3300005327 | Bacteria | 1702 |
| 24 | Ga0070658_10297151 | 3300005327 | Bacteria | 1377 |
| 25 | Ga0070658_10349985 | 3300005327 | Bacteria | 1264 |
| 26 | Ga0070676_10142434 | 3300005328 | Bacteria | 1527 |
| 27 | Ga0070676_10273469 | 3300005328 | Bacteria | 1135 |
| 28 | Ga0070683_100009023 | 3300005329 | Bacteria | 8507 |
| 29 | Ga0070683_100011883 | 3300005329 | Bacteria | 7548 |
| 30 | Ga0070683_100024950 | 3300005329 | Bacteria | 5362 |
| 31 | Ga0070683_100027944 | 3300005329 | Bacteria | 5093 |
| 32 | Ga0070683_100047304 | 3300005329 | Bacteria | 3974 |
| 33 | Ga0070683_100066192 | 3300005329 | Bacteria | 3365 |
| 34 | Ga0070683_100114764 | 3300005329 | Bacteria | 2542 |
| 35 | Ga0070683_100299183 | 3300005329 | Bacteria | 1531 |
| 36 | Ga0070690_100004857 | 3300005330 | Bacteria | 7507 |
| 37 | Ga0070690_100010488 | 3300005330 | Bacteria | 5395 |
| 38 | Ga0070670_100001097 | 3300005331 | Bacteria | 21505 |
| 39 | Ga0070670_100010697 | 3300005331 | Bacteria | 7840 |
| 40 | Ga0070670_100021908 | 3300005331 | Bacteria | 5498 |
| 41 | Ga0070670_100026503 | 3300005331 | Bacteria | 4986 |
| 42 | Ga0070670_100027834 | 3300005331 | Bacteria | 4863 |
| 43 | Ga0070670_100055842 | 3300005331 | Bacteria | 3389 |
| 44 | Ga0070670_100236340 | 3300005331 | Bacteria | 1591 |
| 45 | Ga0070677_10038448 | 3300005333 | Bacteria | 1873 |
| 46 | Ga0068869_100208356 | 3300005334 | Bacteria | 1544 |
| 47 | Ga0070666_10000175 | 3300005335 | Bacteria | 43927 |
| 48 | Ga0070666_10001568 | 3300005335 | Bacteria | 13884 |
| 49 | Ga0070666_10003562 | 3300005335 | Bacteria | 9442 |
| 50 | Ga0070666_10205969 | 3300005335 | Bacteria | 1384 |
| 51 | Ga0070680_100000406 | 3300005336 | Bacteria | 29408 |
| 52 | Ga0070680_100002258 | 3300005336 | Bacteria | 14240 |
| 53 | Ga0070680_100008960 | 3300005336 | Bacteria | 7670 |
| 54 | Ga0070680_100041783 | 3300005336 | Bacteria | 3718 |
| 55 | Ga0070680_100092810 | 3300005336 | Bacteria | 2500 |
| 56 | Ga0070680_100151425 | 3300005336 | Bacteria | 1947 |
| 57 | Ga0070680_100260567 | 3300005336 | Bacteria | 1467 |
| 58 | Ga0070682_100024036 | 3300005337 | Bacteria | 3623 |
| 59 | Ga0068868_100000365 | 3300005338 | Bacteria | 30746 |
| 60 | Ga0068868_100014746 | 3300005338 | Bacteria | 5766 |
| 61 | Ga0068868_100077629 | 3300005338 | Bacteria | 2657 |
| 62 | Ga0068868_100439603 | 3300005338 | Bacteria | 1132 |
| 63 | Ga0070660_100000218 | 3300005339 | Bacteria | 37921 |
| 64 | Ga0070660_100002146 | 3300005339 | Bacteria | 13612 |
| 65 | Ga0070660_100004243 | 3300005339 | Bacteria | 9898 |
| 66 | Ga0070660_100008260 | 3300005339 | Bacteria | 7276 |
| 67 | Ga0070660_100022850 | 3300005339 | Bacteria | 4630 |
| 68 | Ga0070660_100031743 | 3300005339 | Bacteria | 3969 |
| 69 | Ga0070660_100035191 | 3300005339 | Bacteria | 3790 |
| 70 | Ga0070660_100069223 | 3300005339 | Bacteria | 2751 |
| 71 | Ga0070660_100149145 | 3300005339 | Bacteria | 1880 |
| 72 | Ga0070660_100217731 | 3300005339 | Bacteria | 1551 |
| 73 | Ga0070660_100224100 | 3300005339 | Bacteria | 1529 |
| 74 | Ga0070691_10005670 | 3300005341 | Bacteria | 5694 |
| 75 | Ga0070687_100141029 | 3300005343 | Bacteria | 1404 |
| 76 | Ga0070661_100000181 | 3300005344 | Bacteria | 52052 |
| 77 | Ga0070661_100005835 | 3300005344 | Bacteria | 8468 |
| 78 | Ga0070661_100017614 | 3300005344 | Bacteria | 5070 |
| 79 | Ga0070661_100050829 | 3300005344 | Bacteria | 3033 |
| 80 | Ga0070661_100078228 | 3300005344 | Bacteria | 2439 |
| 81 | Ga0070661_100081898 | 3300005344 | Bacteria | 2383 |
| 82 | Ga0070661_100095217 | 3300005344 | Bacteria | 2208 |
| 83 | Ga0070661_100107220 | 3300005344 | Bacteria | 2083 |
| 84 | Ga0070661_100116367 | 3300005344 | Bacteria | 2000 |
| 85 | Ga0070661_100118323 | 3300005344 | Bacteria | 1982 |
| 86 | Ga0070661_100168068 | 3300005344 | Bacteria | 1664 |
| 87 | Ga0070661_100198629 | 3300005344 | Bacteria | 1531 |
| 88 | Ga0070661_100273018 | 3300005344 | Bacteria | 1310 |
| 89 | Ga0070661_100347195 | 3300005344 | Bacteria | 1163 |
| 90 | Ga0070692_10018470 | 3300005345 | Bacteria | 3355 |
| 91 | Ga0070692_10025051 | 3300005345 | Bacteria | 2938 |
| 92 | Ga0070692_10032906 | 3300005345 | Bacteria | 2610 |
| 93 | Ga0070668_100105949 | 3300005347 | Bacteria | 2233 |
| 94 | Ga0070668_100136101 | 3300005347 | Bacteria | 1976 |
| 95 | Ga0070669_100069609 | 3300005353 | Bacteria | 2599 |
| 96 | Ga0070675_100001099 | 3300005354 | Bacteria | 19481 |
| 97 | Ga0070671_100001190 | 3300005355 | Bacteria | 19496 |
| 98 | Ga0070671_100008660 | 3300005355 | Bacteria | 8163 |
| 99 | Ga0070671_100010875 | 3300005355 | Bacteria | 7306 |
| 100 | Ga0070671_100015779 | 3300005355 | Bacteria | 6104 |
| 101 | Ga0070671_100025110 | 3300005355 | Bacteria | 4886 |
| 102 | Ga0070671_100051357 | 3300005355 | Bacteria | 3429 |
| 103 | Ga0070671_100236635 | 3300005355 | Bacteria | 1550 |
| 104 | Ga0070674_100032098 | 3300005356 | Bacteria | 3486 |
| 105 | Ga0070674_100116240 | 3300005356 | Bacteria | 1973 |
| 106 | Ga0070674_100130712 | 3300005356 | Bacteria | 1871 |
| 107 | Ga0070674_100268828 | 3300005356 | Bacteria | 1346 |
| 108 | Ga0070673_100005945 | 3300005364 | Bacteria | 7888 |
| 109 | Ga0070673_100037810 | 3300005364 | Bacteria | 3680 |
| 110 | Ga0070673_100094443 | 3300005364 | Bacteria | 2451 |
| 111 | Ga0070673_100110848 | 3300005364 | Bacteria | 2276 |
| 112 | Ga0070673_100120700 | 3300005364 | Bacteria | 2186 |
| 113 | Ga0070673_100143971 | 3300005364 | Bacteria | 2013 |
| 114 | Ga0070673_100367636 | 3300005364 | Bacteria | 1280 |
| 115 | Ga0070659_100000310 | 3300005366 | Bacteria | 37921 |
| 116 | Ga0070659_100013944 | 3300005366 | Bacteria | 5998 |
| 117 | Ga0070659_100022760 | 3300005366 | Bacteria | 4787 |
| 118 | Ga0070659_100029126 | 3300005366 | Bacteria | 4266 |
| 119 | Ga0070659_100032433 | 3300005366 | Bacteria | 4051 |
| 120 | Ga0070659_100038062 | 3300005366 | Bacteria | 3750 |
| 121 | Ga0070659_100074385 | 3300005366 | Bacteria | 2706 |
| 122 | Ga0070659_100108234 | 3300005366 | Bacteria | 2242 |
| 123 | Ga0070659_100166773 | 3300005366 | Bacteria | 1802 |
| 124 | Ga0070659_100172246 | 3300005366 | Bacteria | 1774 |
| 125 | Ga0070659_100181407 | 3300005366 | Bacteria | 1728 |
| 126 | Ga0070659_100385505 | 3300005366 | Bacteria | 1181 |
| 127 | Ga0070659_100478326 | 3300005366 | Bacteria | 1059 |
| 128 | Ga0070667_100001531 | 3300005367 | Bacteria | 20687 |
| 129 | Ga0070667_100006278 | 3300005367 | Bacteria | 9880 |
| 130 | Ga0070667_100011572 | 3300005367 | Bacteria | 7293 |
| 131 | Ga0070667_100018020 | 3300005367 | Bacteria | 5852 |
| 132 | Ga0070667_100022597 | 3300005367 | Bacteria | 5214 |
| 133 | Ga0070667_100043668 | 3300005367 | Bacteria | 3762 |
| 134 | Ga0070667_100050656 | 3300005367 | Bacteria | 3500 |
| 135 | Ga0070714_100092186 | 3300005435 | Bacteria | 2655 |
| 136 | Ga0070714_100160827 | 3300005435 | Bacteria | 2032 |
| 137 | Ga0070714_100181631 | 3300005435 | Bacteria | 1915 |
| 138 | Ga0070713_100020766 | 3300005436 | Bacteria | 5041 |
| 139 | Ga0070713_100175981 | 3300005436 | Bacteria | 1920 |
| 140 | Ga0070713_100178194 | 3300005436 | Bacteria | 1908 |
| 141 | Ga0070713_100179574 | 3300005436 | Bacteria | 1901 |
| 142 | Ga0070663_100008110 | 3300005455 | Bacteria | 6443 |
| 143 | Ga0070663_100018504 | 3300005455 | Bacteria | 4570 |
| 144 | Ga0070663_100026151 | 3300005455 | Bacteria | 3949 |
| 145 | Ga0070663_100082322 | 3300005455 | Bacteria | 2368 |
| 146 | Ga0070663_100083679 | 3300005455 | Bacteria | 2350 |
| 147 | Ga0070663_100114112 | 3300005455 | Bacteria | 2034 |
| 148 | Ga0070663_100238820 | 3300005455 | Bacteria | 1433 |
| 149 | Ga0070678_100008105 | 3300005456 | Bacteria | 6275 |
| 150 | Ga0070678_100011928 | 3300005456 | Bacteria | 5380 |
| 151 | Ga0070678_100026734 | 3300005456 | Bacteria | 3908 |
| 152 | Ga0070678_100030475 | 3300005456 | Bacteria | 3708 |
| 153 | Ga0070678_100102822 | 3300005456 | Bacteria | 2218 |
| 154 | Ga0070662_100000080 | 3300005457 | Bacteria | 53280 |
| 155 | Ga0070662_100013688 | 3300005457 | Bacteria | 5401 |
| 156 | Ga0070662_100033786 | 3300005457 | Bacteria | 3603 |
| 157 | Ga0070662_100105379 | 3300005457 | Bacteria | 2140 |
| 158 | Ga0070662_100162001 | 3300005457 | Bacteria | 1750 |
| 159 | Ga0070662_100312015 | 3300005457 | Bacteria | 1280 |
| 160 | Ga0070681_10050424 | 3300005458 | Bacteria | 4153 |
| 161 | Ga0070681_10107162 | 3300005458 | Bacteria | 2735 |
| 162 | Ga0070681_10236546 | 3300005458 | Bacteria | 1740 |
| 163 | Ga0068867_100015524 | 3300005459 | Bacteria | 5402 |
| 164 | Ga0068867_100026399 | 3300005459 | Bacteria | 4170 |
| 165 | Ga0070679_100034325 | 3300005530 | Bacteria | 5027 |
| 166 | Ga0070679_100043684 | 3300005530 | Bacteria | 4463 |
| 167 | Ga0070679_100046664 | 3300005530 | Bacteria | 4318 |
| 168 | Ga0070679_100175492 | 3300005530 | Bacteria | 2115 |
| 169 | Ga0070679_100248971 | 3300005530 | Bacteria | 1733 |
| 170 | Ga0070679_100323045 | 3300005530 | Bacteria | 1492 |
| 171 | Ga0070679_100398932 | 3300005530 | Bacteria | 1321 |
| 172 | Ga0070684_100012874 | 3300005535 | Bacteria | 6723 |
| 173 | Ga0070684_100022403 | 3300005535 | Bacteria | 5269 |
| 174 | Ga0070684_100286293 | 3300005535 | Bacteria | 1510 |
| 175 | Ga0068853_100000134 | 3300005539 | Bacteria | 50184 |
| 176 | Ga0068853_100026016 | 3300005539 | Bacteria | 4912 |
| 177 | Ga0068853_100067254 | 3300005539 | Bacteria | 3112 |
| 178 | Ga0068853_100073374 | 3300005539 | Bacteria | 2984 |
| 179 | Ga0068853_100092886 | 3300005539 | Bacteria | 2655 |
| 180 | Ga0068853_100162945 | 3300005539 | Bacteria | 2013 |
| 181 | Ga0068853_100178769 | 3300005539 | Bacteria | 1923 |
| 182 | Ga0068853_100424916 | 3300005539 | Bacteria | 1247 |
| 183 | Ga0070672_100004673 | 3300005543 | Bacteria | 8979 |
| 184 | Ga0070672_100013814 | 3300005543 | Bacteria | 5709 |
| 185 | Ga0070672_100016534 | 3300005543 | Bacteria | 5283 |
| 186 | Ga0070672_100019311 | 3300005543 | Bacteria | 4944 |
| 187 | Ga0070672_100042291 | 3300005543 | Bacteria | 3508 |
| 188 | Ga0070672_100101877 | 3300005543 | Bacteria | 2330 |
| 189 | Ga0070672_100107530 | 3300005543 | Bacteria | 2270 |
| 190 | Ga0070672_100124946 | 3300005543 | Bacteria | 2109 |
| 191 | Ga0070686_100024547 | 3300005544 | Bacteria | 3615 |
| 192 | Ga0070686_100147984 | 3300005544 | Bacteria | 1642 |
| 193 | Ga0070693_100000536 | 3300005547 | Bacteria | 17016 |
| 194 | Ga0070693_100029700 | 3300005547 | Bacteria | 2983 |
| 195 | Ga0070665_100003354 | 3300005548 | Bacteria | 17135 |
| 196 | Ga0070665_100007916 | 3300005548 | Bacteria | 10775 |
| 197 | Ga0070665_100024266 | 3300005548 | Bacteria | 6106 |
| 198 | Ga0070665_100069692 | 3300005548 | Bacteria | 3525 |
| 199 | Ga0068855_100000129 | 3300005563 | Bacteria | 96519 |
| 200 | Ga0068855_100043926 | 3300005563 | Bacteria | 5291 |
| 201 | Ga0068855_100047304 | 3300005563 | Bacteria | 5082 |
| 202 | Ga0068855_100058997 | 3300005563 | Bacteria | 4491 |
| 203 | Ga0068855_100064651 | 3300005563 | Bacteria | 4267 |
| 204 | Ga0068855_100070838 | 3300005563 | Bacteria | 4055 |
| 205 | Ga0068855_100105896 | 3300005563 | Bacteria | 3233 |
| 206 | Ga0068855_100165119 | 3300005563 | Bacteria | 2511 |
| 207 | Ga0068855_100173700 | 3300005563 | Bacteria | 2439 |
| 208 | Ga0068855_100252986 | 3300005563 | Bacteria | 1964 |
| 209 | Ga0068855_100272361 | 3300005563 | Bacteria | 1882 |
| 210 | Ga0068855_100445109 | 3300005563 | Bacteria | 1414 |
| 211 | Ga0068855_100485934 | 3300005563 | Bacteria | 1344 |
| 212 | Ga0068855_100600842 | 3300005563 | Bacteria | 1186 |
| 213 | Ga0070664_100000047 | 3300005564 | Bacteria | 73560 |
| 214 | Ga0070664_100010815 | 3300005564 | Bacteria | 7400 |
| 215 | Ga0070664_100012298 | 3300005564 | Bacteria | 6955 |
| 216 | Ga0070664_100012457 | 3300005564 | Bacteria | 6913 |
| 217 | Ga0070664_100016602 | 3300005564 | Bacteria | 6039 |
| 218 | Ga0070664_100022020 | 3300005564 | Bacteria | 5255 |
| 219 | Ga0070664_100056709 | 3300005564 | Bacteria | 3328 |
| 220 | Ga0070664_100061750 | 3300005564 | Bacteria | 3194 |
| 221 | Ga0070664_100092874 | 3300005564 | Bacteria | 2614 |
| 222 | Ga0070664_100210668 | 3300005564 | Bacteria | 1737 |
| 223 | Ga0068857_100007558 | 3300005577 | Bacteria | 9355 |
| 224 | Ga0068857_100023330 | 3300005577 | Bacteria | 5445 |
| 225 | Ga0068857_100048702 | 3300005577 | Bacteria | 3761 |
| 226 | Ga0068857_100131257 | 3300005577 | Bacteria | 2260 |
| 227 | Ga0068854_100042047 | 3300005578 | Bacteria | 3232 |
| 228 | Ga0068854_100056663 | 3300005578 | Bacteria | 2825 |
| 229 | Ga0068854_100090089 | 3300005578 | Bacteria | 2280 |
| 230 | Ga0068854_100106817 | 3300005578 | Bacteria | 2106 |
| 231 | Ga0068854_100129396 | 3300005578 | Bacteria | 1926 |
| 232 | Ga0068854_100161331 | 3300005578 | Bacteria | 1736 |
| 233 | Ga0068854_100259987 | 3300005578 | Bacteria | 1390 |
| 234 | Ga0068854_100298338 | 3300005578 | Bacteria | 1303 |
| 235 | Ga0068856_100053555 | 3300005614 | Bacteria | 3978 |
| 236 | Ga0068856_100100749 | 3300005614 | Bacteria | 2881 |
| 237 | Ga0068856_100106276 | 3300005614 | Bacteria | 2801 |
| 238 | Ga0068856_100170480 | 3300005614 | Bacteria | 2188 |
| 239 | Ga0068856_100187457 | 3300005614 | Bacteria | 2082 |
| 240 | Ga0068856_100188100 | 3300005614 | Bacteria | 2078 |
| 241 | Ga0068856_100258890 | 3300005614 | Bacteria | 1755 |
| 242 | Ga0068856_100349773 | 3300005614 | Bacteria | 1496 |
| 243 | Ga0068852_100002050 | 3300005616 | Bacteria | 13737 |
| 244 | Ga0068852_100002749 | 3300005616 | Bacteria | 12181 |
| 245 | Ga0068852_100014063 | 3300005616 | Bacteria | 6143 |
| 246 | Ga0068852_100015243 | 3300005616 | Bacteria | 5952 |
| 247 | Ga0068852_100027804 | 3300005616 | Bacteria | 4616 |
| 248 | Ga0068852_100080118 | 3300005616 | Bacteria | 2894 |
| 249 | Ga0068852_100086526 | 3300005616 | Bacteria | 2794 |
| 250 | Ga0068852_100109279 | 3300005616 | Bacteria | 2511 |
| 251 | Ga0068852_100153795 | 3300005616 | Bacteria | 2141 |
| 252 | Ga0068852_100556602 | 3300005616 | Bacteria | 1148 |
| 253 | Ga0068859_100004653 | 3300005617 | Bacteria | 13976 |
| 254 | Ga0068859_100023023 | 3300005617 | Bacteria | 6248 |
| 255 | Ga0068859_100080891 | 3300005617 | Bacteria | 3290 |
| 256 | Ga0068859_100121550 | 3300005617 | Bacteria | 2678 |
| 257 | Ga0068859_100178856 | 3300005617 | Bacteria | 2203 |
| 258 | Ga0068859_100208382 | 3300005617 | Bacteria | 2041 |
| 259 | Ga0068864_100000676 | 3300005618 | Bacteria | 28515 |
| 260 | Ga0068864_100001327 | 3300005618 | Bacteria | 20582 |
| 261 | Ga0068864_100019782 | 3300005618 | Bacteria | 5629 |
| 262 | Ga0068864_100023668 | 3300005618 | Bacteria | 5159 |
| 263 | Ga0068864_100024510 | 3300005618 | Bacteria | 5077 |
| 264 | Ga0068864_100114719 | 3300005618 | Bacteria | 2402 |
| 265 | Ga0068866_10009210 | 3300005718 | Bacteria | 4186 |
| 266 | Ga0068851_10036675 | 3300005834 | Bacteria | 2455 |
| 267 | Ga0068851_10157279 | 3300005834 | Bacteria | 1246 |
| 268 | Ga0068870_10191028 | 3300005840 | Bacteria | 1236 |
| 269 | Ga0068863_100001937 | 3300005841 | Bacteria | 20557 |
| 270 | Ga0068863_100004897 | 3300005841 | Bacteria | 13196 |
| 271 | Ga0068863_100017598 | 3300005841 | Bacteria | 6847 |
| 272 | Ga0068863_100062442 | 3300005841 | Bacteria | 3523 |
| 273 | Ga0068863_100143109 | 3300005841 | Bacteria | 2286 |
| 274 | Ga0068858_100001465 | 3300005842 | Bacteria | 24278 |
| 275 | Ga0068858_100002115 | 3300005842 | Bacteria | 20151 |
| 276 | Ga0068858_100023710 | 3300005842 | Bacteria | 5717 |
| 277 | Ga0068858_100054432 | 3300005842 | Bacteria | 3700 |
| 278 | Ga0068858_100120874 | 3300005842 | Bacteria | 2449 |
| 279 | Ga0068860_100002483 | 3300005843 | Bacteria | 19348 |
| 280 | Ga0068860_100038056 | 3300005843 | Bacteria | 4603 |
| 281 | Ga0068860_100059374 | 3300005843 | Bacteria | 3636 |
| 282 | Ga0068860_100141171 | 3300005843 | Bacteria | 2315 |
| 283 | Ga0068862_100028159 | 3300005844 | Bacteria | 4731 |
| 284 | Ga0068862_100053035 | 3300005844 | Bacteria | 3471 |
| 285 | Ga0081539_10013055 | 3300005985 | Bacteria | 6301 |
| 286 | Ga0070717_10082833 | 3300006028 | Bacteria | 2697 |
| 287 | Ga0075364_10063581 | 3300006051 | Bacteria | 2423 |
| 288 | Ga0097621_100073378 | 3300006237 | Bacteria | 2833 |
| 289 | Ga0097621_100101195 | 3300006237 | Bacteria | 2424 |
| 290 | Ga0097621_100107980 | 3300006237 | Bacteria | 2349 |
| 291 | Ga0068871_100003598 | 3300006358 | Bacteria | 10648 |
| 292 | Ga0068871_100014050 | 3300006358 | Bacteria | 5955 |
| 293 | Ga0068871_100158767 | 3300006358 | Bacteria | 1932 |
| 294 | Ga0068871_100352176 | 3300006358 | Bacteria | 1303 |
| 295 | Ga0068865_100006314 | 3300006881 | Bacteria | 7220 |
| 296 | Ga0097620_100004654 | 3300006931 | Bacteria | 13976 |
| 297 | Ga0097620_100023023 | 3300006931 | Bacteria | 6248 |
| 298 | Ga0097620_100080898 | 3300006931 | Bacteria | 3290 |
| 299 | Ga0097620_100121537 | 3300006931 | Bacteria | 2678 |
| 300 | Ga0097620_100178857 | 3300006931 | Bacteria | 2203 |
| 301 | Ga0097620_100208381 | 3300006931 | Bacteria | 2041 |
| 302 | Ga0105250_10008349 | 3300009092 | Bacteria | 4404 |
| 303 | Ga0105240_10010591 | 3300009093 | Bacteria | 12956 |
| 304 | Ga0105240_10013759 | 3300009093 | Bacteria | 11088 |
| 305 | Ga0105240_10025464 | 3300009093 | Bacteria | 7773 |
| 306 | Ga0105240_10171781 | 3300009093 | Bacteria | 2567 |
| 307 | Ga0105245_10008586 | 3300009098 | Bacteria | 8908 |
| 308 | Ga0105245_10052292 | 3300009098 | Bacteria | 3664 |
| 309 | Ga0105245_10297155 | 3300009098 | Bacteria | 1583 |
| 310 | Ga0105247_10205709 | 3300009101 | Bacteria | 1325 |
| 311 | Ga0105243_10164369 | 3300009148 | Bacteria | 1917 |
| 312 | Ga0105242_10047404 | 3300009176 | Bacteria | 3489 |
| 313 | Ga0105242_10298324 | 3300009176 | Bacteria | 1470 |
| 314 | Ga0105248_10000276 | 3300009177 | Bacteria | 60451 |
| 315 | Ga0105248_10000818 | 3300009177 | Bacteria | 34897 |
| 316 | Ga0105248_10001339 | 3300009177 | Bacteria | 27438 |
| 317 | Ga0105248_10002382 | 3300009177 | Bacteria | 20883 |
| 318 | Ga0105248_10018004 | 3300009177 | Bacteria | 7798 |
| 319 | Ga0105248_10040529 | 3300009177 | Bacteria | 5221 |
| 320 | Ga0105248_10042715 | 3300009177 | Bacteria | 5084 |
| 321 | Ga0105248_10048181 | 3300009177 | Bacteria | 4780 |
| 322 | Ga0105248_10067021 | 3300009177 | Bacteria | 4030 |
| 323 | Ga0105248_10081466 | 3300009177 | Bacteria | 3638 |
| 324 | Ga0105248_10093690 | 3300009177 | Bacteria | 3383 |
| 325 | Ga0105248_10201148 | 3300009177 | Bacteria | 2244 |
| 326 | Ga0105248_10237616 | 3300009177 | Bacteria | 2051 |
| 327 | Ga0105248_10246284 | 3300009177 | Bacteria | 2012 |
| 328 | Ga0105248_10250853 | 3300009177 | Bacteria | 1992 |
| 329 | Ga0105248_10487503 | 3300009177 | Bacteria | 1389 |
| 330 | Ga0105237_10059550 | 3300009545 | Bacteria | 3820 |
| 331 | Ga0105237_10139974 | 3300009545 | Bacteria | 2414 |
| 332 | Ga0105237_10237134 | 3300009545 | Bacteria | 1825 |
| 333 | Ga0105238_10009452 | 3300009551 | Bacteria | 9757 |
| 334 | Ga0105238_10072401 | 3300009551 | Bacteria | 3442 |
| 335 | Ga0105238_10121332 | 3300009551 | Bacteria | 2593 |
| 336 | Ga0105238_10263266 | 3300009551 | Bacteria | 1704 |
| 337 | Ga0105238_10388497 | 3300009551 | Bacteria | 1388 |
| 338 | Ga0105238_10434620 | 3300009551 | Bacteria | 1308 |
| 339 | Ga0105238_10504985 | 3300009551 | Unclassified | 1210 |
| 340 | Ga0105239_10586783 | 3300010375 | Bacteria | 1271 |
| 341 | Ga0105246_10072786 | 3300011119 | Bacteria | 2424 |
| 342 | Ga0157373_10007891 | 3300013100 | Bacteria | 7920 |
| 343 | Ga0157373_10029928 | 3300013100 | Bacteria | 3920 |
| 344 | Ga0157373_10079029 | 3300013100 | Bacteria | 2320 |
| 345 | Ga0157373_10098452 | 3300013100 | Bacteria | 2058 |
| 346 | Ga0157373_10101130 | 3300013100 | Bacteria | 2028 |
| 347 | Ga0157373_10177841 | 3300013100 | Bacteria | 1498 |
| 348 | Ga0157373_10247644 | 3300013100 | Bacteria | 1260 |
| 349 | Ga0157371_10000854 | 3300013102 | Bacteria | 34812 |
| 350 | Ga0157371_10004446 | 3300013102 | Bacteria | 12231 |
| 351 | Ga0157371_10005070 | 3300013102 | Bacteria | 11251 |
| 352 | Ga0157371_10054627 | 3300013102 | Bacteria | 2836 |
| 353 | Ga0157371_10058350 | 3300013102 | Bacteria | 2738 |
| 354 | Ga0157371_10089939 | 3300013102 | Bacteria | 2175 |
| 355 | Ga0157371_10133031 | 3300013102 | Bacteria | 1770 |
| 356 | Ga0157371_10134506 | 3300013102 | Bacteria | 1760 |
| 357 | Ga0157370_10020725 | 3300013104 | Bacteria | 6560 |
| 358 | Ga0157370_10093050 | 3300013104 | Bacteria | 2829 |
| 359 | Ga0157370_10115546 | 3300013104 | Bacteria | 2507 |
| 360 | Ga0157370_10169425 | 3300013104 | Bacteria | 2030 |
| 361 | Ga0157370_10350299 | 3300013104 | Bacteria | 1361 |
| 362 | Ga0157370_10532810 | 3300013104 | Bacteria | 1077 |
| 363 | Ga0157369_10000238 | 3300013105 | Bacteria | 76209 |
| 364 | Ga0157369_10001611 | 3300013105 | Bacteria | 27624 |
| 365 | Ga0157369_10018907 | 3300013105 | Bacteria | 7720 |
| 366 | Ga0157369_10051493 | 3300013105 | Bacteria | 4456 |
| 367 | Ga0157369_10119754 | 3300013105 | Bacteria | 2793 |
| 368 | Ga0157369_10255924 | 3300013105 | Bacteria | 1827 |
| 369 | Ga0157369_10306410 | 3300013105 | Bacteria | 1652 |
| 370 | Ga0157369_10403408 | 3300013105 | Bacteria | 1418 |
| 371 | Ga0157369_10426551 | 3300013105 | Bacteria | 1375 |
| 372 | Ga0157369_10500864 | 3300013105 | Bacteria | 1257 |
| 373 | Ga0157369_10698596 | 3300013105 | Bacteria | 1045 |
| 374 | Ga0157374_10003243 | 3300013296 | Bacteria | 13668 |
| 375 | Ga0157374_10004605 | 3300013296 | Bacteria | 11567 |
| 376 | Ga0157374_10007006 | 3300013296 | Bacteria | 9595 |
| 377 | Ga0157374_10077596 | 3300013296 | Bacteria | 3144 |
| 378 | Ga0157374_10106220 | 3300013296 | Bacteria | 2697 |
| 379 | Ga0157374_10263228 | 3300013296 | Bacteria | 1699 |
| 380 | Ga0157374_10398866 | 3300013296 | Bacteria | 1372 |
| 381 | Ga0157374_10414221 | 3300013296 | Bacteria | 1345 |
| 382 | Ga0157378_10088970 | 3300013297 | Bacteria | 2803 |
| 383 | Ga0157378_10103837 | 3300013297 | Bacteria | 2597 |
| 384 | Ga0157378_10240585 | 3300013297 | Bacteria | 1729 |
| 385 | Ga0157372_10115873 | 3300013307 | Bacteria | 3072 |
| 386 | Ga0157372_10158317 | 3300013307 | Bacteria | 2616 |
| 387 | Ga0157372_10350291 | 3300013307 | Bacteria | 1720 |
| 388 | Ga0157372_10632121 | 3300013307 | Bacteria | 1247 |
| 389 | Ga0157372_10717001 | 3300013307 | Bacteria | 1163 |
| 390 | Ga0157375_10029766 | 3300013308 | Bacteria | 5140 |
| 391 | Ga0157375_10116099 | 3300013308 | Bacteria | 2780 |
| 392 | Ga0157375_10786135 | 3300013308 | Bacteria | 1101 |
| 393 | Ga0163163_10000139 | 3300014325 | Bacteria | 75197 |
| 394 | Ga0163163_10001248 | 3300014325 | Bacteria | 21440 |
| 395 | Ga0163163_10499946 | 3300014325 | Bacteria | 1278 |
| 396 | Ga0157380_10101657 | 3300014326 | Bacteria | 2396 |
| 397 | Ga0182008_10030176 | 3300014497 | Bacteria | 2734 |
| 398 | Ga0157379_10019524 | 3300014968 | Bacteria | 5987 |
| 399 | Ga0157379_10025413 | 3300014968 | Bacteria | 5261 |
| 400 | Ga0157379_10034131 | 3300014968 | Bacteria | 4535 |
| 401 | Ga0157376_10002695 | 3300014969 | Bacteria | 12086 |
| 402 | Ga0163161_10038215 | 3300017792 | Bacteria | 3443 |
| 403 | Ga0213876_10141492 | 3300021384 | Bacteria | 1279 |
| 404 | Ga0207656_10024065 | 3300025321 | Bacteria | 2458 |
| 405 | Ga0207656_10070851 | 3300025321 | Bacteria | 1549 |
| 406 | Ga0207696_1005750 | 3300025711 | Bacteria | 5098 |
| 407 | Ga0207682_10069758 | 3300025893 | Bacteria | 1487 |
| 408 | Ga0207642_10012036 | 3300025899 | Bacteria | 3110 |
| 409 | Ga0207688_10017529 | 3300025901 | Bacteria | 3892 |
| 410 | Ga0207688_10063087 | 3300025901 | Bacteria | 2090 |
| 411 | Ga0207680_10001894 | 3300025903 | Bacteria | 9819 |
| 412 | Ga0207680_10002818 | 3300025903 | Bacteria | 8142 |
| 413 | Ga0207680_10012072 | 3300025903 | Bacteria | 4390 |
| 414 | Ga0207680_10026601 | 3300025903 | Bacteria | 3209 |
| 415 | Ga0207680_10119225 | 3300025903 | Bacteria | 1723 |
| 416 | Ga0207647_10004972 | 3300025904 | Bacteria | 9802 |
| 417 | Ga0207647_10007015 | 3300025904 | Bacteria | 8171 |
| 418 | Ga0207647_10020499 | 3300025904 | Bacteria | 4431 |
| 419 | Ga0207647_10061614 | 3300025904 | Bacteria | 2288 |
| 420 | Ga0207647_10098285 | 3300025904 | Bacteria | 1739 |
| 421 | Ga0207645_10075252 | 3300025907 | Bacteria | 2161 |
| 422 | Ga0207645_10139429 | 3300025907 | Bacteria | 1580 |
| 423 | Ga0207645_10141302 | 3300025907 | Bacteria | 1569 |
| 424 | Ga0207705_10000030 | 3300025909 | Bacteria | 239341 |
| 425 | Ga0207705_10000164 | 3300025909 | Bacteria | 71606 |
| 426 | Ga0207705_10000382 | 3300025909 | Bacteria | 39603 |
| 427 | Ga0207705_10000942 | 3300025909 | Bacteria | 23772 |
| 428 | Ga0207705_10005132 | 3300025909 | Bacteria | 9819 |
| 429 | Ga0207705_10010076 | 3300025909 | Bacteria | 6879 |
| 430 | Ga0207705_10015942 | 3300025909 | Bacteria | 5395 |
| 431 | Ga0207705_10016160 | 3300025909 | Bacteria | 5356 |
| 432 | Ga0207705_10021265 | 3300025909 | Bacteria | 4628 |
| 433 | Ga0207705_10030078 | 3300025909 | Bacteria | 3873 |
| 434 | Ga0207705_10035904 | 3300025909 | Bacteria | 3547 |
| 435 | Ga0207705_10038622 | 3300025909 | Bacteria | 3419 |
| 436 | Ga0207705_10051974 | 3300025909 | Bacteria | 2949 |
| 437 | Ga0207705_10063938 | 3300025909 | Bacteria | 2659 |
| 438 | Ga0207705_10066566 | 3300025909 | Bacteria | 2606 |
| 439 | Ga0207705_10078123 | 3300025909 | Bacteria | 2408 |
| 440 | Ga0207705_10087342 | 3300025909 | Bacteria | 2280 |
| 441 | Ga0207705_10099941 | 3300025909 | Bacteria | 2133 |
| 442 | Ga0207705_10102351 | 3300025909 | Bacteria | 2108 |
| 443 | Ga0207705_10105883 | 3300025909 | Bacteria | 2073 |
| 444 | Ga0207705_10170710 | 3300025909 | Bacteria | 1637 |
| 445 | Ga0207705_10179755 | 3300025909 | Bacteria | 1596 |
| 446 | Ga0207705_10186037 | 3300025909 | Bacteria | 1569 |
| 447 | Ga0207705_10320922 | 3300025909 | Bacteria | 1190 |
| 448 | Ga0207705_10362150 | 3300025909 | Bacteria | 1118 |
| 449 | Ga0207707_10036574 | 3300025912 | Bacteria | 4291 |
| 450 | Ga0207707_10046105 | 3300025912 | Bacteria | 3796 |
| 451 | Ga0207707_10073172 | 3300025912 | Bacteria | 2988 |
| 452 | Ga0207695_10001533 | 3300025913 | Bacteria | 38143 |
| 453 | Ga0207695_10003681 | 3300025913 | Bacteria | 21353 |
| 454 | Ga0207695_10046225 | 3300025913 | Bacteria | 4615 |
| 455 | Ga0207695_10144859 | 3300025913 | Bacteria | 2321 |
| 456 | Ga0207671_10017683 | 3300025914 | Bacteria | 5492 |
| 457 | Ga0207671_10263374 | 3300025914 | Bacteria | 1357 |
| 458 | Ga0207693_10162539 | 3300025915 | Bacteria | 1757 |
| 459 | Ga0207660_10000515 | 3300025917 | Bacteria | 25797 |
| 460 | Ga0207660_10001062 | 3300025917 | Bacteria | 18218 |
| 461 | Ga0207660_10004418 | 3300025917 | Bacteria | 9165 |
| 462 | Ga0207660_10075178 | 3300025917 | Bacteria | 2467 |
| 463 | Ga0207660_10104450 | 3300025917 | Bacteria | 2121 |
| 464 | Ga0207662_10125957 | 3300025918 | Bacteria | 1611 |
| 465 | Ga0207657_10000090 | 3300025919 | Bacteria | 86852 |
| 466 | Ga0207657_10000966 | 3300025919 | Bacteria | 30468 |
| 467 | Ga0207657_10002608 | 3300025919 | Bacteria | 19479 |
| 468 | Ga0207657_10005871 | 3300025919 | Bacteria | 12790 |
| 469 | Ga0207657_10009774 | 3300025919 | Bacteria | 9615 |
| 470 | Ga0207657_10013994 | 3300025919 | Bacteria | 7851 |
| 471 | Ga0207657_10024390 | 3300025919 | Bacteria | 5602 |
| 472 | Ga0207657_10031034 | 3300025919 | Bacteria | 4845 |
| 473 | Ga0207657_10040221 | 3300025919 | Bacteria | 4145 |
| 474 | Ga0207657_10046172 | 3300025919 | Bacteria | 3816 |
| 475 | Ga0207657_10046487 | 3300025919 | Bacteria | 3801 |
| 476 | Ga0207657_10047434 | 3300025919 | Bacteria | 3756 |
| 477 | Ga0207657_10069456 | 3300025919 | Bacteria | 2989 |
| 478 | Ga0207657_10074895 | 3300025919 | Bacteria | 2857 |
| 479 | Ga0207657_10077604 | 3300025919 | Bacteria | 2799 |
| 480 | Ga0207657_10118920 | 3300025919 | Bacteria | 2175 |
| 481 | Ga0207657_10180539 | 3300025919 | Bacteria | 1706 |
| 482 | Ga0207657_10181001 | 3300025919 | Bacteria | 1704 |
| 483 | Ga0207649_10000324 | 3300025920 | Bacteria | 36296 |
| 484 | Ga0207649_10000538 | 3300025920 | Bacteria | 26239 |
| 485 | Ga0207649_10012021 | 3300025920 | Bacteria | 4788 |
| 486 | Ga0207649_10023549 | 3300025920 | Bacteria | 3567 |
| 487 | Ga0207649_10073374 | 3300025920 | Bacteria | 2192 |
| 488 | Ga0207649_10073951 | 3300025920 | Bacteria | 2185 |
| 489 | Ga0207649_10090079 | 3300025920 | Bacteria | 2007 |
| 490 | Ga0207649_10319371 | 3300025920 | Bacteria | 1140 |
| 491 | Ga0207652_10063960 | 3300025921 | Bacteria | 3183 |
| 492 | Ga0207652_10164871 | 3300025921 | Bacteria | 1987 |
| 493 | Ga0207652_10388280 | 3300025921 | Bacteria | 1260 |
| 494 | Ga0207681_10011975 | 3300025923 | Bacteria | 5341 |
| 495 | Ga0207681_10078186 | 3300025923 | Bacteria | 2328 |
| 496 | Ga0207681_10207884 | 3300025923 | Bacteria | 1507 |
| 497 | Ga0207681_10330368 | 3300025923 | Bacteria | 1215 |
| 498 | Ga0207694_10002074 | 3300025924 | Bacteria | 16573 |
| 499 | Ga0207650_10002851 | 3300025925 | Bacteria | 11936 |
| 500 | Ga0207650_10035624 | 3300025925 | Bacteria | 3616 |
| 501 | Ga0207650_10037065 | 3300025925 | Bacteria | 3551 |
| 502 | Ga0207650_10177459 | 3300025925 | Bacteria | 1696 |
| 503 | Ga0207650_10441381 | 3300025925 | Bacteria | 1082 |
| 504 | Ga0207659_10002373 | 3300025926 | Bacteria | 11211 |
| 505 | Ga0207659_10150123 | 3300025926 | Bacteria | 1819 |
| 506 | Ga0207659_10447504 | 3300025926 | Bacteria | 1087 |
| 507 | Ga0207700_10123269 | 3300025928 | Bacteria | 2104 |
| 508 | Ga0207700_10525148 | 3300025928 | Bacteria | 1049 |
| 509 | Ga0207664_10093688 | 3300025929 | Bacteria | 2467 |
| 510 | Ga0207664_10155395 | 3300025929 | Bacteria | 1947 |
| 511 | Ga0207644_10000960 | 3300025931 | Bacteria | 18405 |
| 512 | Ga0207644_10001690 | 3300025931 | Bacteria | 14227 |
| 513 | Ga0207644_10002366 | 3300025931 | Bacteria | 12173 |
| 514 | Ga0207644_10003068 | 3300025931 | Bacteria | 10758 |
| 515 | Ga0207644_10003537 | 3300025931 | Bacteria | 10118 |
| 516 | Ga0207644_10004646 | 3300025931 | Bacteria | 8925 |
| 517 | Ga0207644_10018964 | 3300025931 | Bacteria | 4663 |
| 518 | Ga0207644_10033993 | 3300025931 | Bacteria | 3567 |
| 519 | Ga0207644_10151561 | 3300025931 | Bacteria | 1794 |
| 520 | Ga0207644_10157552 | 3300025931 | Bacteria | 1762 |
| 521 | Ga0207644_10204830 | 3300025931 | Bacteria | 1557 |
| 522 | Ga0207644_10275054 | 3300025931 | Bacteria | 1351 |
| 523 | Ga0207644_10351131 | 3300025931 | Bacteria | 1197 |
| 524 | Ga0207690_10000184 | 3300025932 | Bacteria | 48035 |
| 525 | Ga0207690_10004224 | 3300025932 | Bacteria | 8491 |
| 526 | Ga0207690_10020485 | 3300025932 | Bacteria | 4088 |
| 527 | Ga0207690_10048302 | 3300025932 | Bacteria | 2829 |
| 528 | Ga0207690_10064444 | 3300025932 | Bacteria | 2502 |
| 529 | Ga0207690_10071478 | 3300025932 | Bacteria | 2393 |
| 530 | Ga0207690_10189875 | 3300025932 | Bacteria | 1553 |
| 531 | Ga0207690_10254442 | 3300025932 | Bacteria | 1358 |
| 532 | Ga0207690_10276177 | 3300025932 | Bacteria | 1307 |
| 533 | Ga0207706_10000110 | 3300025933 | Bacteria | 87522 |
| 534 | Ga0207706_10003529 | 3300025933 | Bacteria | 14934 |
| 535 | Ga0207706_10012607 | 3300025933 | Bacteria | 7698 |
| 536 | Ga0207706_10014651 | 3300025933 | Bacteria | 7100 |
| 537 | Ga0207706_10033216 | 3300025933 | Bacteria | 4593 |
| 538 | Ga0207706_10052977 | 3300025933 | Bacteria | 3582 |
| 539 | Ga0207706_10063101 | 3300025933 | Bacteria | 3263 |
| 540 | Ga0207706_10088897 | 3300025933 | Bacteria | 2716 |
| 541 | Ga0207706_10110311 | 3300025933 | Bacteria | 2421 |
| 542 | Ga0207706_10177736 | 3300025933 | Bacteria | 1870 |
| 543 | Ga0207706_10180314 | 3300025933 | Bacteria | 1855 |
| 544 | Ga0207706_10246046 | 3300025933 | Bacteria | 1563 |
| 545 | Ga0207686_10010692 | 3300025934 | Bacteria | 4999 |
| 546 | Ga0207669_10023069 | 3300025937 | Bacteria | 3317 |
| 547 | Ga0207669_10096415 | 3300025937 | Bacteria | 1941 |
| 548 | Ga0207669_10229901 | 3300025937 | Bacteria | 1367 |
| 549 | Ga0207704_10043056 | 3300025938 | Bacteria | 2662 |
| 550 | Ga0207704_10055350 | 3300025938 | Bacteria | 2424 |
| 551 | Ga0207665_10110099 | 3300025939 | Bacteria | 1934 |
| 552 | Ga0207691_10003020 | 3300025940 | Bacteria | 16424 |
| 553 | Ga0207691_10009755 | 3300025940 | Bacteria | 9216 |
| 554 | Ga0207691_10019100 | 3300025940 | Bacteria | 6490 |
| 555 | Ga0207691_10021940 | 3300025940 | Bacteria | 6025 |
| 556 | Ga0207691_10042518 | 3300025940 | Bacteria | 4189 |
| 557 | Ga0207691_10049172 | 3300025940 | Bacteria | 3864 |
| 558 | Ga0207691_10051014 | 3300025940 | Bacteria | 3785 |
| 559 | Ga0207691_10062761 | 3300025940 | Bacteria | 3371 |
| 560 | Ga0207691_10117597 | 3300025940 | Bacteria | 2358 |
| 561 | Ga0207691_10208084 | 3300025940 | Bacteria | 1700 |
| 562 | Ga0207691_10295848 | 3300025940 | Bacteria | 1391 |
| 563 | Ga0207711_10000193 | 3300025941 | Bacteria | 65165 |
| 564 | Ga0207711_10000258 | 3300025941 | Bacteria | 57473 |
| 565 | Ga0207711_10000586 | 3300025941 | Bacteria | 36944 |
| 566 | Ga0207711_10000922 | 3300025941 | Bacteria | 28344 |
| 567 | Ga0207711_10002671 | 3300025941 | Bacteria | 15769 |
| 568 | Ga0207711_10009528 | 3300025941 | Bacteria | 8100 |
| 569 | Ga0207711_10014091 | 3300025941 | Bacteria | 6643 |
| 570 | Ga0207711_10016607 | 3300025941 | Bacteria | 6113 |
| 571 | Ga0207711_10060666 | 3300025941 | Bacteria | 3260 |
| 572 | Ga0207711_10067636 | 3300025941 | Bacteria | 3093 |
| 573 | Ga0207711_10073463 | 3300025941 | Bacteria | 2972 |
| 574 | Ga0207711_10239315 | 3300025941 | Bacteria | 1664 |
| 575 | Ga0207711_10467043 | 3300025941 | Bacteria | 1175 |
| 576 | Ga0207661_10000179 | 3300025944 | Bacteria | 40861 |
| 577 | Ga0207661_10001420 | 3300025944 | Bacteria | 16133 |
| 578 | Ga0207661_10022584 | 3300025944 | Bacteria | 4741 |
| 579 | Ga0207661_10037622 | 3300025944 | Bacteria | 3786 |
| 580 | Ga0207679_10000329 | 3300025945 | Bacteria | 35247 |
| 581 | Ga0207679_10003556 | 3300025945 | Bacteria | 9654 |
| 582 | Ga0207679_10012146 | 3300025945 | Bacteria | 5607 |
| 583 | Ga0207679_10033853 | 3300025945 | Bacteria | 3599 |
| 584 | Ga0207679_10091643 | 3300025945 | Bacteria | 2352 |
| 585 | Ga0207679_10102816 | 3300025945 | Bacteria | 2238 |
| 586 | Ga0207679_10122799 | 3300025945 | Bacteria | 2070 |
| 587 | Ga0207679_10147989 | 3300025945 | Bacteria | 1907 |
| 588 | Ga0207667_10000303 | 3300025949 | Bacteria | 68209 |
| 589 | Ga0207667_10002493 | 3300025949 | Bacteria | 22937 |
| 590 | Ga0207667_10002920 | 3300025949 | Bacteria | 21220 |
| 591 | Ga0207667_10008859 | 3300025949 | Bacteria | 11909 |
| 592 | Ga0207667_10042277 | 3300025949 | Bacteria | 4845 |
| 593 | Ga0207667_10042772 | 3300025949 | Bacteria | 4813 |
| 594 | Ga0207667_10099634 | 3300025949 | Bacteria | 2998 |
| 595 | Ga0207667_10123262 | 3300025949 | Bacteria | 2670 |
| 596 | Ga0207667_10141559 | 3300025949 | Bacteria | 2476 |
| 597 | Ga0207667_10148711 | 3300025949 | Bacteria | 2411 |
| 598 | Ga0207667_10233205 | 3300025949 | Bacteria | 1884 |
| 599 | Ga0207667_10459095 | 3300025949 | Bacteria | 1294 |
| 600 | Ga0207651_10003060 | 3300025960 | Bacteria | 8119 |
| 601 | Ga0207651_10003074 | 3300025960 | Bacteria | 8104 |
| 602 | Ga0207651_10007393 | 3300025960 | Bacteria | 5850 |
| 603 | Ga0207651_10059368 | 3300025960 | Bacteria | 2649 |
| 604 | Ga0207651_10316314 | 3300025960 | Bacteria | 1303 |
| 605 | Ga0207651_10356466 | 3300025960 | Bacteria | 1233 |
| 606 | Ga0207640_10000774 | 3300025981 | Bacteria | 18167 |
| 607 | Ga0207640_10008965 | 3300025981 | Bacteria | 5575 |
| 608 | Ga0207640_10018373 | 3300025981 | Bacteria | 4109 |
| 609 | Ga0207640_10041381 | 3300025981 | Bacteria | 2930 |
| 610 | Ga0207640_10041824 | 3300025981 | Bacteria | 2917 |
| 611 | Ga0207640_10163264 | 3300025981 | Bacteria | 1651 |
| 612 | Ga0207640_10169092 | 3300025981 | Bacteria | 1627 |
| 613 | Ga0207658_10007580 | 3300025986 | Bacteria | 7393 |
| 614 | Ga0207658_10008291 | 3300025986 | Bacteria | 7077 |
| 615 | Ga0207658_10008679 | 3300025986 | Bacteria | 6903 |
| 616 | Ga0207658_10011777 | 3300025986 | Bacteria | 5957 |
| 617 | Ga0207658_10018839 | 3300025986 | Bacteria | 4774 |
| 618 | Ga0207658_10021768 | 3300025986 | Bacteria | 4455 |
| 619 | Ga0207658_10050692 | 3300025986 | Bacteria | 3055 |
| 620 | Ga0207658_10093700 | 3300025986 | Bacteria | 2335 |
| 621 | Ga0207677_10000866 | 3300026023 | Bacteria | 17249 |
| 622 | Ga0207677_10012218 | 3300026023 | Bacteria | 4927 |
| 623 | Ga0207703_10006890 | 3300026035 | Bacteria | 9048 |
| 624 | Ga0207703_10015909 | 3300026035 | Bacteria | 5867 |
| 625 | Ga0207703_10062243 | 3300026035 | Bacteria | 3057 |
| 626 | Ga0207639_10000458 | 3300026041 | Bacteria | 28145 |
| 627 | Ga0207639_10013643 | 3300026041 | Bacteria | 5696 |
| 628 | Ga0207639_10066770 | 3300026041 | Bacteria | 2797 |
| 629 | Ga0207639_10068174 | 3300026041 | Bacteria | 2771 |
| 630 | Ga0207639_10119548 | 3300026041 | Bacteria | 2162 |
| 631 | Ga0207639_10292925 | 3300026041 | Bacteria | 1436 |
| 632 | Ga0207678_10003366 | 3300026067 | Bacteria | 14426 |
| 633 | Ga0207678_10006673 | 3300026067 | Bacteria | 10231 |
| 634 | Ga0207678_10013063 | 3300026067 | Bacteria | 7285 |
| 635 | Ga0207678_10013092 | 3300026067 | Bacteria | 7277 |
| 636 | Ga0207678_10023449 | 3300026067 | Bacteria | 5397 |
| 637 | Ga0207678_10059601 | 3300026067 | Bacteria | 3284 |
| 638 | Ga0207678_10101308 | 3300026067 | Bacteria | 2459 |
| 639 | Ga0207678_10137208 | 3300026067 | Bacteria | 2087 |
| 640 | Ga0207678_10227757 | 3300026067 | Bacteria | 1596 |
| 641 | Ga0207678_10228459 | 3300026067 | Bacteria | 1593 |
| 642 | Ga0207702_10000391 | 3300026078 | Bacteria | 49957 |
| 643 | Ga0207702_10029339 | 3300026078 | Bacteria | 4577 |
| 644 | Ga0207702_10041377 | 3300026078 | Bacteria | 3864 |
| 645 | Ga0207702_10043227 | 3300026078 | Bacteria | 3783 |
| 646 | Ga0207702_10059874 | 3300026078 | Bacteria | 3245 |
| 647 | Ga0207702_10129656 | 3300026078 | Unclassified | 2268 |
| 648 | Ga0207702_10203645 | 3300026078 | Bacteria | 1836 |
| 649 | Ga0207702_10238826 | 3300026078 | Bacteria | 1702 |
| 650 | Ga0207641_10003418 | 3300026088 | Bacteria | 14066 |
| 651 | Ga0207641_10042984 | 3300026088 | Bacteria | 3792 |
| 652 | Ga0207641_10077915 | 3300026088 | Bacteria | 2869 |
| 653 | Ga0207641_10185074 | 3300026088 | Bacteria | 1910 |
| 654 | Ga0207641_10196187 | 3300026088 | Bacteria | 1858 |
| 655 | Ga0207648_10003776 | 3300026089 | Bacteria | 15828 |
| 656 | Ga0207648_10027466 | 3300026089 | Bacteria | 5051 |
| 657 | Ga0207676_10001889 | 3300026095 | Bacteria | 15314 |
| 658 | Ga0207676_10002064 | 3300026095 | Bacteria | 14583 |
| 659 | Ga0207676_10011706 | 3300026095 | Bacteria | 6276 |
| 660 | Ga0207676_10057033 | 3300026095 | Bacteria | 3074 |
| 661 | Ga0207676_10072447 | 3300026095 | Bacteria | 2769 |
| 662 | Ga0207676_10103091 | 3300026095 | Bacteria | 2370 |
| 663 | Ga0207676_10104091 | 3300026095 | Bacteria | 2360 |
| 664 | Ga0207674_10001888 | 3300026116 | Bacteria | 26661 |
| 665 | Ga0207674_10004883 | 3300026116 | Bacteria | 16049 |
| 666 | Ga0207674_10006854 | 3300026116 | Bacteria | 13359 |
| 667 | Ga0207674_10010088 | 3300026116 | Bacteria | 10740 |
| 668 | Ga0207674_10018165 | 3300026116 | Bacteria | 7651 |
| 669 | Ga0207674_10019371 | 3300026116 | Bacteria | 7372 |
| 670 | Ga0207674_10060594 | 3300026116 | Bacteria | 3826 |
| 671 | Ga0207674_10165865 | 3300026116 | Bacteria | 2163 |
| 672 | Ga0207674_10239272 | 3300026116 | Bacteria | 1762 |
| 673 | Ga0207674_10417873 | 3300026116 | Bacteria | 1296 |
| 674 | Ga0207674_10444634 | 3300026116 | Bacteria | 1253 |
| 675 | Ga0207683_10007231 | 3300026121 | Bacteria | 9518 |
| 676 | Ga0207683_10013235 | 3300026121 | Bacteria | 7034 |
| 677 | Ga0207683_10014399 | 3300026121 | Bacteria | 6734 |
| 678 | Ga0207683_10046319 | 3300026121 | Bacteria | 3805 |
| 679 | Ga0207683_10263263 | 3300026121 | Bacteria | 1574 |
| 680 | Ga0207698_10001169 | 3300026142 | Bacteria | 15304 |
| 681 | Ga0207698_10008265 | 3300026142 | Bacteria | 6570 |
| 682 | Ga0207698_10008788 | 3300026142 | Bacteria | 6405 |
| 683 | Ga0207698_10019555 | 3300026142 | Bacteria | 4639 |
| 684 | Ga0207698_10019682 | 3300026142 | Bacteria | 4626 |
| 685 | Ga0207698_10026496 | 3300026142 | Bacteria | 4102 |
| 686 | Ga0207698_10077076 | 3300026142 | Bacteria | 2671 |
| 687 | Ga0207698_10087951 | 3300026142 | Bacteria | 2532 |
| 688 | Ga0207698_10105040 | 3300026142 | Bacteria | 2352 |
| 689 | Ga0207698_10146490 | 3300026142 | Bacteria | 2043 |
| 690 | Ga0207698_10156424 | 3300026142 | Bacteria | 1987 |
| 691 | Ga0207698_10210395 | 3300026142 | Bacteria | 1749 |
| 692 | Ga0207698_10446986 | 3300026142 | Bacteria | 1247 |
| 693 | Ga0268266_10013748 | 3300028379 | Bacteria | 6970 |
| 694 | Ga0268266_10149110 | 3300028379 | Bacteria | 2106 |
| 695 | Ga0268265_10005643 | 3300028380 | Bacteria | 8550 |
| 696 | Ga0268265_10056043 | 3300028380 | Bacteria | 2997 |
| 697 | Ga0268264_10001981 | 3300028381 | Bacteria | 18421 |
| 698 | Ga0268264_10016391 | 3300028381 | Bacteria | 6066 |
| 699 | Ga0268264_10102413 | 3300028381 | Bacteria | 2491 |
| 700 | Ga0307408_100112019 | 3300031548 | Bacteria | 2097 |
| 701 | Ga0307405_10087732 | 3300031731 | Bacteria | 2051 |
| 702 | Ga0307410_10006754 | 3300031852 | Bacteria | 6222 |
| 703 | Ga0307410_10008462 | 3300031852 | Bacteria | 5705 |
| 704 | Ga0307410_10049488 | 3300031852 | Bacteria | 2821 |
| 705 | Ga0307410_10057500 | 3300031852 | Bacteria | 2648 |
| 706 | Ga0307410_10196528 | 3300031852 | Bacteria | 1537 |
| 707 | Ga0307406_10002764 | 3300031901 | Bacteria | 9575 |
| 708 | Ga0307407_10300161 | 3300031903 | Bacteria | 1119 |
| 709 | Ga0307412_10034719 | 3300031911 | Bacteria | 3216 |
| 710 | Ga0307412_10051476 | 3300031911 | Bacteria | 2721 |
| 711 | Ga0307412_10147223 | 3300031911 | Bacteria | 1733 |
| 712 | Ga0307409_100024297 | 3300031995 | Bacteria | 4224 |
| 713 | Ga0307409_100034290 | 3300031995 | Bacteria | 3705 |
| 714 | Ga0307409_100133978 | 3300031995 | Bacteria | 2122 |
| 715 | Ga0307409_100177804 | 3300031995 | Bacteria | 1880 |
| 716 | Ga0307409_100430419 | 3300031995 | Bacteria | 1268 |
| 717 | Ga0307416_100070402 | 3300032002 | Bacteria | 2900 |
| 718 | Ga0307416_100133019 | 3300032002 | Bacteria | 2243 |
| 719 | Ga0307414_10159607 | 3300032004 | Bacteria | 1789 |
| 720 | Ga0307411_10000751 | 3300032005 | Bacteria | 11970 |
| 721 | Ga0307411_10082287 | 3300032005 | Bacteria | 2219 |
| 722 | Ga0307411_10138565 | 3300032005 | Bacteria | 1790 |
| 723 | Ga0307411_10200014 | 3300032005 | Bacteria | 1533 |
| 724 | Ga0307415_100036666 | 3300032126 | Bacteria | 3215 |
| 725 | Ga0307415_100047617 | 3300032126 | Bacteria | 2886 |
| 726 | Ga0307415_100056242 | 3300032126 | Bacteria | 2696 |
| 727 | Ga0307415_100057685 | 3300032126 | Bacteria | 2669 |
| 728 | Ga0307415_100227318 | 3300032126 | Bacteria | 1500 |
| 729 | Ga0307415_100237677 | 3300032126 | Bacteria | 1471 |
| 730 | Ga0307415_100348086 | 3300032126 | Bacteria | 1246 |
| 731 | Ga0373930_0002803 | 3300034816 | Bacteria | 2727 |
| 732 | Ga0373923_0072150 | 3300035111 | Bacteria | 1484 |
| 733 | Ga0373932_0070742 | 3300035112 | Bacteria | 1082 |
| 734 | Ga0373957_0020896 | 3300035120 | Bacteria | 2318 |
| 735 | Ga0373943_0027808 | 3300035170 | Bacteria | 2660 |
| 736 | Ga0373955_0002452 | 3300035172 | Bacteria | 8098 |
| 737 | Ga0373961_0059606 | 3300035241 | Bacteria | 1154 |
| 738 | Ga0373931_0053388 | 3300035691 | Bacteria | 2156 |
| 739 | Ga0373931_0166085 | 3300035691 | Bacteria | 1297 |
| 740 | Ga0373935_0049087 | 3300035692 | Bacteria | 2674 |
| 741 | Ga0373935_0058305 | 3300035692 | Bacteria | 2466 |
| 742 | Ga0373927_0076274 | 3300035695 | Bacteria | 2171 |
| 743 | Ga0373933_0053550 | 3300035724 | Bacteria | 2417 |
| 744 | Ga0373937_0001514 | 3300036401 | Bacteria | 19522 |
| 745 | Ga0373925_0188761 | 3300037068 | Bacteria | 1634 |
| 746 | Ga0395899_0000732 | 3300037312 | Bacteria | 32768 |
| 747 | Ga0395899_0001019 | 3300037312 | Bacteria | 25588 |
| 748 | Ga0395899_0002681 | 3300037312 | Bacteria | 14350 |
| 749 | Ga0395899_0008955 | 3300037312 | Bacteria | 7701 |
| 750 | Ga0395899_0012197 | 3300037312 | Bacteria | 6580 |
| 751 | Ga0395899_0016732 | 3300037312 | Bacteria | 5590 |
| 752 | Ga0395899_0017969 | 3300037312 | Bacteria | 5381 |
| 753 | Ga0395899_0020601 | 3300037312 | Bacteria | 4999 |
| 754 | Ga0395899_0028045 | 3300037312 | Bacteria | 4240 |
| 755 | Ga0395899_0030893 | 3300037312 | Bacteria | 4027 |
| 756 | Ga0395899_0038635 | 3300037312 | Bacteria | 3574 |
| 757 | Ga0395899_0045720 | 3300037312 | Bacteria | 3261 |
| 758 | Ga0395899_0061012 | 3300037312 | Bacteria | 2777 |
| 759 | Ga0395899_0063752 | 3300037312 | Bacteria | 2710 |
| 760 | Ga0395899_0069193 | 3300037312 | Bacteria | 2585 |
| 761 | Ga0395899_0070520 | 3300037312 | Bacteria | 2558 |
| 762 | Ga0395899_0070568 | 3300037312 | Bacteria | 2557 |
| 763 | Ga0395899_0075179 | 3300037312 | Bacteria | 2467 |
| 764 | Ga0395899_0093904 | 3300037312 | Bacteria | 2171 |
| 765 | Ga0395899_0095756 | 3300037312 | Bacteria | 2147 |
| 766 | Ga0395899_0099480 | 3300037312 | Bacteria | 2101 |
| 767 | Ga0395899_0101018 | 3300037312 | Bacteria | 2082 |
| 768 | Ga0395899_0110567 | 3300037312 | Bacteria | 1976 |
| 769 | Ga0395899_0120473 | 3300037312 | Bacteria | 1880 |
| 770 | Ga0395899_0135490 | 3300037312 | Bacteria | 1755 |
| 771 | Ga0395899_0178412 | 3300037312 | Bacteria | 1492 |
| 772 | Ga0395899_0213298 | 3300037312 | Bacteria | 1340 |
| 773 | Ga0395899_0254253 | 3300037312 | Bacteria | 1204 |
| 774 | Ga0395899_0267402 | 3300037312 | Unclassified | 1167 |
| 775 | Ga0395900_0000289 | 3300037418 | Bacteria | 75525 |
| 776 | Ga0395900_0000336 | 3300037418 | Bacteria | 69212 |
| 777 | Ga0395900_0000840 | 3300037418 | Bacteria | 40454 |
| 778 | Ga0395900_0005450 | 3300037418 | Bacteria | 13332 |
| 779 | Ga0395900_0009867 | 3300037418 | Bacteria | 9780 |
| 780 | Ga0395900_0010465 | 3300037418 | Bacteria | 9487 |
| 781 | Ga0395900_0012023 | 3300037418 | Bacteria | 8849 |
| 782 | Ga0395900_0012599 | 3300037418 | Bacteria | 8651 |
| 783 | Ga0395900_0021363 | 3300037418 | Bacteria | 6617 |
| 784 | Ga0395900_0022848 | 3300037418 | Bacteria | 6398 |
| 785 | Ga0395900_0032126 | 3300037418 | Bacteria | 5396 |
| 786 | Ga0395900_0053674 | 3300037418 | Bacteria | 4148 |
| 787 | Ga0395900_0055299 | 3300037418 | Bacteria | 4087 |
| 788 | Ga0395900_0062978 | 3300037418 | Bacteria | 3812 |
| 789 | Ga0395900_0074972 | 3300037418 | Bacteria | 3477 |
| 790 | Ga0395900_0075036 | 3300037418 | Bacteria | 3476 |
| 791 | Ga0395900_0084504 | 3300037418 | Bacteria | 3261 |
| 792 | Ga0395900_0122407 | 3300037418 | Bacteria | 2669 |
| 793 | Ga0395900_0129689 | 3300037418 | Bacteria | 2585 |
| 794 | Ga0395900_0142793 | 3300037418 | Bacteria | 2450 |
| 795 | Ga0395900_0144201 | 3300037418 | Unclassified | 2436 |
| 796 | Ga0395900_0150091 | 3300037418 | Bacteria | 2381 |
| 797 | Ga0395900_0170182 | 3300037418 | Bacteria | 2218 |
| 798 | Ga0395900_0182935 | 3300037418 | Bacteria | 2129 |
| 799 | Ga0395900_0244765 | 3300037418 | Bacteria | 1797 |
| 800 | Ga0395900_0266367 | 3300037418 | Bacteria | 1709 |
| 801 | Ga0395900_0283102 | 3300037418 | Bacteria | 1649 |
| 802 | Ga0395900_0333032 | 3300037418 | Bacteria | 1495 |
| 803 | Ga0395900_0414094 | 3300037418 | Bacteria | 1309 |
| 804 | Ga0395900_0424744 | 3300037418 | Bacteria | 1289 |
| 805 | Ga0395900_0497208 | 3300037418 | Bacteria | 1170 |
| 806 | Ga0395898_0000055 | 3300037466 | Bacteria | 278557 |
| 807 | Ga0395898_0000898 | 3300037466 | Bacteria | 47961 |
| 808 | Ga0395898_0011944 | 3300037466 | Bacteria | 8994 |
| 809 | Ga0395898_0039097 | 3300037466 | Bacteria | 4697 |
| 810 | Ga0395898_0039654 | 3300037466 | Bacteria | 4660 |
| 811 | Ga0395898_0064249 | 3300037466 | Bacteria | 3560 |
| 812 | Ga0395898_0064692 | 3300037466 | Bacteria | 3547 |
| 813 | Ga0395898_0071979 | 3300037466 | Bacteria | 3340 |
| 814 | Ga0395898_0088781 | 3300037466 | Bacteria | 2975 |
| 815 | Ga0395898_0117995 | 3300037466 | Bacteria | 2542 |
| 816 | Ga0395898_0135434 | 3300037466 | Unclassified | 2358 |
| 817 | Ga0395898_0140590 | 3300037466 | Bacteria | 2311 |
| 818 | Ga0395898_0178190 | 3300037466 | Bacteria | 2031 |
| 819 | Ga0395898_0199579 | 3300037466 | Bacteria | 1910 |
| 820 | Ga0395898_0245040 | 3300037466 | Bacteria | 1709 |
| 821 | Ga0395905_0000067 | 3300037471 | Bacteria | 181887 |
| 822 | Ga0395905_0000204 | 3300037471 | Bacteria | 92152 |
| 823 | Ga0395905_0001128 | 3300037471 | Bacteria | 33451 |
| 824 | Ga0395905_0009949 | 3300037471 | Bacteria | 9266 |
| 825 | Ga0395905_0011713 | 3300037471 | Bacteria | 8465 |
| 826 | Ga0395905_0012098 | 3300037471 | Bacteria | 8313 |
| 827 | Ga0395905_0012136 | 3300037471 | Bacteria | 8300 |
| 828 | Ga0395905_0012837 | 3300037471 | Bacteria | 8054 |
| 829 | Ga0395905_0013828 | 3300037471 | Bacteria | 7722 |
| 830 | Ga0395905_0014777 | 3300037471 | Bacteria | 7443 |
| 831 | Ga0395905_0015799 | 3300037471 | Bacteria | 7171 |
| 832 | Ga0395905_0016270 | 3300037471 | Bacteria | 7066 |
| 833 | Ga0395905_0021093 | 3300037471 | Bacteria | 6169 |
| 834 | Ga0395905_0023138 | 3300037471 | Bacteria | 5874 |
| 835 | Ga0395905_0032662 | 3300037471 | Bacteria | 4894 |
| 836 | Ga0395905_0038551 | 3300037471 | Bacteria | 4484 |
| 837 | Ga0395905_0044661 | 3300037471 | Bacteria | 4157 |
| 838 | Ga0395905_0061770 | 3300037471 | Bacteria | 3505 |
| 839 | Ga0395905_0073390 | 3300037471 | Bacteria | 3207 |
| 840 | Ga0395905_0083554 | 3300037471 | Bacteria | 2991 |
| 841 | Ga0395905_0123482 | 3300037471 | Bacteria | 2434 |
| 842 | Ga0395905_0124151 | 3300037471 | Bacteria | 2427 |
| 843 | Ga0395905_0181250 | 3300037471 | Bacteria | 1977 |
| 844 | Ga0395905_0233426 | 3300037471 | Bacteria | 1720 |
| 845 | Ga0395905_0248742 | 3300037471 | Bacteria | 1661 |
| 846 | Ga0395905_0317234 | 3300037471 | Bacteria | 1448 |
| 847 | Ga0395905_0317895 | 3300037471 | Bacteria | 1446 |
| 848 | Ga0395905_0413317 | 3300037471 | Bacteria | 1244 |
| 849 | Ga0395905_0470585 | 3300037471 | Bacteria | 1155 |
| 850 | Ga0436364_1481755 | 3300037853 | Bacteria | 15521 |
| 851 | Ga0395901_0000208 | 3300038443 | Bacteria | 73874 |
| 852 | Ga0395901_0000648 | 3300038443 | Bacteria | 40227 |
| 853 | Ga0395901_0000770 | 3300038443 | Bacteria | 35923 |
| 854 | Ga0395901_0001244 | 3300038443 | Bacteria | 27197 |
| 855 | Ga0395901_0002867 | 3300038443 | Bacteria | 17407 |
| 856 | Ga0395901_0005184 | 3300038443 | Bacteria | 13153 |
| 857 | Ga0395901_0009196 | 3300038443 | Bacteria | 10011 |
| 858 | Ga0395901_0011794 | 3300038443 | Bacteria | 8862 |
| 859 | Ga0395901_0013298 | 3300038443 | Bacteria | 8360 |
| 860 | Ga0395901_0016747 | 3300038443 | Bacteria | 7469 |
| 861 | Ga0395901_0020624 | 3300038443 | Bacteria | 6745 |
| 862 | Ga0395901_0027515 | 3300038443 | Bacteria | 5843 |
| 863 | Ga0395901_0074765 | 3300038443 | Bacteria | 3534 |
| 864 | Ga0395901_0098854 | 3300038443 | Bacteria | 3059 |
| 865 | Ga0395901_0100918 | 3300038443 | Bacteria | 3028 |
| 866 | Ga0395901_0127830 | 3300038443 | Bacteria | 2671 |
| 867 | Ga0395901_0131169 | 3300038443 | Bacteria | 2633 |
| 868 | Ga0395901_0135699 | 3300038443 | Bacteria | 2586 |
| 869 | Ga0395901_0136373 | 3300038443 | Bacteria | 2579 |
| 870 | Ga0395901_0163100 | 3300038443 | Bacteria | 2340 |
| 871 | Ga0395901_0175144 | 3300038443 | Bacteria | 2250 |
| 872 | Ga0395901_0217937 | 3300038443 | Bacteria | 1995 |
| 873 | Ga0395901_0272348 | 3300038443 | Bacteria | 1760 |
| 874 | Ga0395901_0321598 | 3300038443 | Bacteria | 1600 |
| 875 | Ga0395901_0337089 | 3300038443 | Bacteria | 1558 |
| 876 | Ga0395901_0339354 | 3300038443 | Bacteria | 1552 |
| 877 | Ga0395901_0393175 | 3300038443 | Bacteria | 1425 |
| 878 | Ga0395901_0395011 | 3300038443 | Bacteria | 1421 |
| 879 | Ga0395901_0468921 | 3300038443 | Bacteria | 1285 |
| 880 | Ga0395901_0530190 | 3300038443 | Bacteria | 1195 |
| 881 | Ga0436365_0125660 | 3300039437 | Bacteria | 1640 |
| 882 | Ga0439445_0011268 | 3300042004 | Bacteria | 2130 |
| 883 | Ga0439448_0007869 | 3300042005 | Bacteria | 3101 |
| 884 | Ga0439432_040184 | 3300042006 | Bacteria | 1484 |
| 885 | Ga0439449_0021256 | 3300042007 | Bacteria | 2430 |
| 886 | Ga0439458_0001396 | 3300042157 | Bacteria | 6101 |
| 887 | Ga0439458_0002081 | 3300042157 | Bacteria | 4966 |
| 888 | Ga0439464_0000729 | 3300042439 | Bacteria | 7153 |
| 889 | Ga0466969_0041854 | 3300044656 | Bacteria | 2290 |
| 890 | Ga0466972_0035920 | 3300044658 | Bacteria | 2426 |
| 891 | Ga0466972_0042133 | 3300044658 | Bacteria | 2221 |
| 892 | Ga0466966_0000301 | 3300044684 | Bacteria | 32475 |
| 893 | Ga0466966_0014734 | 3300044684 | Bacteria | 5173 |
| 894 | Ga0466966_0028577 | 3300044684 | Bacteria | 3631 |
| 895 | Ga0466961_0009376 | 3300044693 | Bacteria | 6235 |
| 896 | Ga0466961_0014220 | 3300044693 | Bacteria | 5108 |
| 897 | Ga0466961_0047231 | 3300044693 | Bacteria | 2753 |
| 898 | Ga0466961_0073174 | 3300044693 | Bacteria | 2173 |
| 899 | Ga0466961_0082316 | 3300044693 | Bacteria | 2036 |
| 900 | Ga0466961_0163618 | 3300044693 | Bacteria | 1386 |
| 901 | Ga0466963_0012060 | 3300044694 | Bacteria | 5280 |
| 902 | Ga0466963_0016937 | 3300044694 | Bacteria | 4540 |
| 903 | Ga0466963_0019403 | 3300044694 | Bacteria | 4264 |
| 904 | Ga0466963_0021807 | 3300044694 | Bacteria | 4046 |
| 905 | Ga0466963_0024312 | 3300044694 | Bacteria | 3856 |
| 906 | Ga0466963_0039699 | 3300044694 | Bacteria | 3083 |
| 907 | Ga0466963_0273661 | 3300044694 | Bacteria | 1186 |
| 908 | Ga0466964_0027010 | 3300044706 | Bacteria | 2251 |
| 909 | Ga0466971_0006087 | 3300044719 | Bacteria | 5249 |
| 910 | Ga0466971_0027424 | 3300044719 | Bacteria | 2551 |
| 911 | Ga0466971_0040971 | 3300044719 | Bacteria | 2080 |
| 912 | Ga0466971_0080942 | 3300044719 | Bacteria | 1481 |
| 913 | Ga0466968_0004855 | 3300044735 | Bacteria | 5032 |
| 914 | Ga0466970_0004034 | 3300044765 | Bacteria | 7207 |
| 915 | Ga0466970_0015259 | 3300044765 | Bacteria | 3950 |
| 916 | Ga0466970_0049038 | 3300044765 | Bacteria | 2252 |
| 917 | Ga0466970_0166266 | 3300044765 | Bacteria | 1221 |
| 918 | Ga0466957_0000787 | 3300044842 | Bacteria | 16194 |
| 919 | Ga0466957_0003763 | 3300044842 | Bacteria | 8385 |
| 920 | Ga0466957_0013236 | 3300044842 | Bacteria | 4785 |
| 921 | Ga0466957_0212326 | 3300044842 | Bacteria | 1275 |
| 922 | Ga0466960_0013380 | 3300044901 | Bacteria | 3485 |
| 923 | Ga0466959_0041141 | 3300045049 | Bacteria | 3412 |
| 924 | Ga0466959_0058210 | 3300045049 | Bacteria | 2814 |
| 925 | Ga0466959_0109859 | 3300045049 | Bacteria | 1968 |
| 926 | Ga0466959_0153955 | 3300045049 | Bacteria | 1619 |
| 927 | Ga0466959_0272683 | 3300045049 | Bacteria | 1162 |
| 928 | Ga0466958_0002930 | 3300045836 | Bacteria | 8721 |
| 929 | Ga0466958_0004323 | 3300045836 | Bacteria | 7485 |
| 930 | Ga0466958_0008549 | 3300045836 | Bacteria | 5683 |
| 931 | Ga0466958_0020162 | 3300045836 | Bacteria | 3886 |
| 932 | Ga0466958_0187646 | 3300045836 | Bacteria | 1313 |
| 933 | Ga0466967_0000409 | 3300045976 | Bacteria | 20274 |
| 934 | Ga0466967_0011305 | 3300045976 | Bacteria | 6751 |
| 935 | Ga0466967_0011339 | 3300045976 | Bacteria | 6743 |
| 936 | Ga0466967_0051882 | 3300045976 | Bacteria | 3597 |
| 937 | Ga0466967_0060090 | 3300045976 | Bacteria | 3367 |
| 938 | Ga0466967_0069018 | 3300045976 | Bacteria | 3158 |
| 939 | Ga0466967_0071927 | 3300045976 | Bacteria | 3098 |
| 940 | Ga0466967_0100391 | 3300045976 | Bacteria | 2644 |
| 941 | Ga0466967_0153516 | 3300045976 | Bacteria | 2154 |
| 942 | Ga0466967_0492967 | 3300045976 | Bacteria | 1201 |
| 943 | Ga0495596_0104336 | 3300046500 | Bacteria | 1101 |
| 944 | Ga0495663_0004385 | 3300046525 | Bacteria | 3973 |
| 945 | Ga0495598_0000215 | 3300046537 | Bacteria | 10173 |
| 946 | Ga0495621_0000088 | 3300046539 | Bacteria | 18635 |
| 947 | Ga0495621_0000383 | 3300046539 | Bacteria | 10843 |
| 948 | Ga0495621_0009036 | 3300046539 | Bacteria | 3010 |
| 949 | Ga0495621_0020788 | 3300046539 | Bacteria | 2158 |
| 950 | Ga0495621_0045054 | 3300046539 | Bacteria | 1561 |
| 951 | Ga0495633_0004015 | 3300046558 | Bacteria | 9522 |
| 952 | Ga0495633_0042200 | 3300046558 | Bacteria | 2168 |
| 953 | Ga0495668_0008618 | 3300046616 | Bacteria | 6341 |
| 954 | Ga0495668_0010128 | 3300046616 | Bacteria | 5733 |
| 955 | Ga0495668_0012707 | 3300046616 | Bacteria | 4987 |
| 956 | Ga0495668_0030166 | 3300046616 | Bacteria | 3063 |
| 957 | Ga0495661_0029425 | 3300046665 | Bacteria | 3506 |
| 958 | Ga0495669_0000090 | 3300046684 | Bacteria | 60222 |
| 959 | Ga0495669_0002359 | 3300046684 | Bacteria | 7745 |
| 960 | Ga0495669_0004776 | 3300046684 | Bacteria | 5622 |
| 961 | Ga0495669_0012852 | 3300046684 | Bacteria | 3564 |
| 962 | Ga0495669_0019471 | 3300046684 | Bacteria | 2929 |
| 963 | Ga0495669_0019493 | 3300046684 | Bacteria | 2928 |
| 964 | Ga0495669_0020876 | 3300046684 | Bacteria | 2837 |
| 965 | Ga0495669_0022508 | 3300046684 | Bacteria | 2737 |
| 966 | Ga0495669_0138203 | 3300046684 | Bacteria | 1149 |
| 967 | Ga0495670_0000192 | 3300046691 | Bacteria | 27204 |
| 968 | Ga0495670_0021504 | 3300046691 | Bacteria | 3182 |
| 969 | Ga0495670_0197625 | 3300046691 | Bacteria | 1064 |
| 970 | Ga0495677_0008553 | 3300047445 | Bacteria | 3801 |
| 971 | Ga0495677_0018667 | 3300047445 | Bacteria | 2514 |
| 972 | Ga0495677_0027255 | 3300047445 | Bacteria | 2073 |
| 973 | Ga0495685_044475 | 3300047447 | Bacteria | 1514 |
| 974 | Ga0495602_0041409 | 3300048088 | Bacteria | 4208 |
| 975 | Ga0496100_0030609 | 3300048903 | Bacteria | 3340 |
| 976 | Ga0496100_0089871 | 3300048903 | Bacteria | 2093 |
| 977 | Ga0496101_0001673 | 3300048904 | Bacteria | 13299 |
| 978 | Ga0496101_0008722 | 3300048904 | Bacteria | 6629 |
| 979 | Ga0496101_0247180 | 3300048904 | Bacteria | 1389 |
| 980 | Ga0496102_0169260 | 3300048905 | Bacteria | 2057 |
| 981 | Ga0496103_0022756 | 3300048906 | Bacteria | 3775 |
| 982 | Ga0496104_0040729 | 3300048907 | Bacteria | 4355 |
| 983 | Ga0496105_0089162 | 3300048908 | Bacteria | 2548 |
| 984 | Ga0496106_0005495 | 3300048909 | Bacteria | 9373 |
| 985 | Ga0496106_0018948 | 3300048909 | Bacteria | 5099 |
| 986 | Ga0496107_0006177 | 3300048910 | Bacteria | 8229 |
| 987 | Ga0496107_0058239 | 3300048910 | Bacteria | 2793 |
| 988 | Ga0496107_0262388 | 3300048910 | Bacteria | 1285 |
| 989 | Ga0496108_0032006 | 3300048911 | Bacteria | 4365 |
| 990 | Ga0496108_0099203 | 3300048911 | Bacteria | 2482 |
| 991 | Ga0496108_0144181 | 3300048911 | Bacteria | 2052 |
| 992 | Ga0496109_0002106 | 3300048912 | Bacteria | 16540 |
| 993 | Ga0496109_0011910 | 3300048912 | Bacteria | 7488 |
| 994 | Ga0496109_0013949 | 3300048912 | Bacteria | 6988 |
| 995 | Ga0496109_0026337 | 3300048912 | Bacteria | 5185 |
| 996 | Ga0496109_0039480 | 3300048912 | Bacteria | 4273 |
| 997 | Ga0496109_0064824 | 3300048912 | Bacteria | 3343 |
| 998 | Ga0496109_0160802 | 3300048912 | Bacteria | 2104 |
| 999 | Ga0496109_0252014 | 3300048912 | Bacteria | 1662 |
| 1000 | Ga0496110_0001399 | 3300048913 | Bacteria | 17437 |
| 1001 | Ga0496110_0002580 | 3300048913 | Bacteria | 13627 |
| 1002 | Ga0496110_0009250 | 3300048913 | Bacteria | 7963 |
| 1003 | Ga0496110_0009949 | 3300048913 | Bacteria | 7711 |
| 1004 | Ga0496110_0022339 | 3300048913 | Bacteria | 5370 |
| 1005 | Ga0496110_0452627 | 3300048913 | Bacteria | 1170 |
| 1006 | Ga0496111_0002383 | 3300048914 | Bacteria | 11326 |
| 1007 | Ga0496111_0007825 | 3300048914 | Bacteria | 7039 |
| 1008 | Ga0496111_0053092 | 3300048914 | Bacteria | 2927 |
| 1009 | Ga0496111_0078113 | 3300048914 | Bacteria | 2413 |
| 1010 | Ga0496112_0000546 | 3300048915 | Bacteria | 25800 |
| 1011 | Ga0496112_0015905 | 3300048915 | Bacteria | 7031 |
| 1012 | Ga0496112_0018449 | 3300048915 | Bacteria | 6569 |
| 1013 | Ga0496112_0019602 | 3300048915 | Bacteria | 6387 |
| 1014 | Ga0496112_0028872 | 3300048915 | Bacteria | 5359 |
| 1015 | Ga0496112_0040392 | 3300048915 | Bacteria | 4561 |
| 1016 | Ga0496112_0044417 | 3300048915 | Bacteria | 4353 |
| 1017 | Ga0496112_0268946 | 3300048915 | Bacteria | 1653 |
| 1018 | Ga0496112_0438572 | 3300048915 | Bacteria | 1244 |
| 1019 | Ga0496113_0004928 | 3300048916 | Bacteria | 8269 |
| 1020 | Ga0496113_0006309 | 3300048916 | Bacteria | 7500 |
| 1021 | Ga0496113_0006545 | 3300048916 | Bacteria | 7396 |
| 1022 | Ga0496113_0011840 | 3300048916 | Bacteria | 5844 |
| 1023 | Ga0496113_0480664 | 3300048916 | Bacteria | 998 |
| 1024 | Ga0496114_0229609 | 3300048917 | Bacteria | 1630 |
| 1025 | Ga0496115_0013299 | 3300048918 | Bacteria | 6223 |
| 1026 | Ga0496115_0024534 | 3300048918 | Bacteria | 4689 |
| 1027 | Ga0501067_0040652 | 3300049583 | Bacteria | 2582 |
| 1028 | Ga0501230_014707 | 3300049667 | Bacteria | 1289 |
| 1029 | Ga0501234_004369 | 3300049707 | Bacteria | 2221 |
| 1030 | Ga0501263_005167 | 3300049760 | Bacteria | 1464 |
| 1031 | Ga0495655_0008567 | 3300053083 | Bacteria | 1949 |
| 1032 | Ga0500658_0000049 | 3300053134 | Bacteria | 65535 |
| 1033 | Ga0466962_0003934 | 3300061719 | Bacteria | 7107 |
| 1034 | Ga0466962_0005486 | 3300061719 | Bacteria | 6096 |
| 1035 | Ga0466962_0039444 | 3300061719 | Bacteria | 2261 |
| 1036 | Ga0466962_0107789 | 3300061719 | Bacteria | 1340 |
| 1037 | Ga0307413_10003680 | |||
| 1038 | JGI24736J21556_1000081 | |||
| 1039 | JGI24740J21852_10012509 | |||
| 1040 | JGI24739J22299_10005774 | |||
| 1041 | JGI24739J22299_10010582 | |||
| 1042 | JGI24737J22298_10000548 | |||
| 1043 | JGI24735J21928_10012264 | |||
| 1044 | JGI24738J21930_10004476 | |||
| 1045 | rootH1_10041045 | |||
| 1046 | Ga0070658_10000220 | |||
| 1047 | Ga0070658_10002137 | |||
| 1048 | Ga0070658_10015611 | |||
| 1049 | Ga0070658_10021629 | |||
| 1050 | Ga0070658_10022864 | |||
| 1051 | Ga0070658_10025048 | |||
| 1052 | Ga0070658_10033600 | |||
| 1053 | Ga0070658_10056961 | |||
| 1054 | Ga0070658_10066204 | |||
| 1055 | Ga0070658_10094834 | |||
| 1056 | Ga0070658_10101754 | |||
| 1057 | Ga0070658_10105680 | |||
| 1058 | Ga0070658_10109872 | |||
| 1059 | Ga0070658_10196194 | |||
| 1060 | Ga0070658_10297151 | |||
| 1061 | Ga0070658_10349985 | |||
| 1062 | Ga0070676_10142434 | |||
| 1063 | Ga0070676_10273469 | |||
| 1064 | Ga0070683_100009023 | |||
| 1065 | Ga0070683_100011883 | |||
| 1066 | Ga0070683_100024950 | |||
| 1067 | Ga0070683_100027944 | |||
| 1068 | Ga0070683_100047304 | |||
| 1069 | Ga0070683_100066192 | |||
| 1070 | Ga0070683_100114764 | |||
| 1071 | Ga0070683_100299183 | |||
| 1072 | Ga0070690_100004857 | |||
| 1073 | Ga0070690_100010488 | |||
| 1074 | Ga0070670_100001097 | |||
| 1075 | Ga0070670_100010697 | |||
| 1076 | Ga0070670_100021908 | |||
| 1077 | Ga0070670_100026503 | |||
| 1078 | Ga0070670_100027834 | |||
| 1079 | Ga0070670_100055842 | |||
| 1080 | Ga0070670_100236340 | |||
| 1081 | Ga0070677_10038448 | |||
| 1082 | Ga0068869_100208356 | |||
| 1083 | Ga0070666_10000175 | |||
| 1084 | Ga0070666_10001568 | |||
| 1085 | Ga0070666_10003562 | |||
| 1086 | Ga0070666_10205969 | |||
| 1087 | Ga0070680_100000406 | |||
| 1088 | Ga0070680_100002258 | |||
| 1089 | Ga0070680_100008960 | |||
| 1090 | Ga0070680_100041783 | |||
| 1091 | Ga0070680_100092810 | |||
| 1092 | Ga0070680_100151425 | |||
| 1093 | Ga0070680_100260567 | |||
| 1094 | Ga0070682_100024036 | |||
| 1095 | Ga0068868_100000365 | |||
| 1096 | Ga0068868_100014746 | |||
| 1097 | Ga0068868_100077629 | |||
| 1098 | Ga0068868_100439603 | |||
| 1099 | Ga0070660_100000218 | |||
| 1100 | Ga0070660_100002146 | |||
| 1101 | Ga0070660_100004243 | |||
| 1102 | Ga0070660_100008260 | |||
| 1103 | Ga0070660_100022850 | |||
| 1104 | Ga0070660_100031743 | |||
| 1105 | Ga0070660_100035191 | |||
| 1106 | Ga0070660_100069223 | |||
| 1107 | Ga0070660_100149145 | |||
| 1108 | Ga0070660_100217731 | |||
| 1109 | Ga0070660_100224100 | |||
| 1110 | Ga0070691_10005670 | |||
| 1111 | Ga0070687_100141029 | |||
| 1112 | Ga0070661_100000181 | |||
| 1113 | Ga0070661_100005835 | |||
| 1114 | Ga0070661_100017614 | |||
| 1115 | Ga0070661_100050829 | |||
| 1116 | Ga0070661_100078228 | |||
| 1117 | Ga0070661_100081898 | |||
| 1118 | Ga0070661_100095217 | |||
| 1119 | Ga0070661_100107220 | |||
| 1120 | Ga0070661_100116367 | |||
| 1121 | Ga0070661_100118323 | |||
| 1122 | Ga0070661_100168068 | |||
| 1123 | Ga0070661_100198629 | |||
| 1124 | Ga0070661_100273018 | |||
| 1125 | Ga0070661_100347195 | |||
| 1126 | Ga0070692_10018470 | |||
| 1127 | Ga0070692_10025051 | |||
| 1128 | Ga0070692_10032906 | |||
| 1129 | Ga0070668_100105949 | |||
| 1130 | Ga0070668_100136101 | |||
| 1131 | Ga0070669_100069609 | |||
| 1132 | Ga0070675_100001099 | |||
| 1133 | Ga0070671_100001190 | |||
| 1134 | Ga0070671_100008660 | |||
| 1135 | Ga0070671_100010875 | |||
| 1136 | Ga0070671_100015779 | |||
| 1137 | Ga0070671_100025110 | |||
| 1138 | Ga0070671_100051357 | |||
| 1139 | Ga0070671_100236635 | |||
| 1140 | Ga0070674_100032098 | |||
| 1141 | Ga0070674_100116240 | |||
| 1142 | Ga0070674_100130712 | |||
| 1143 | Ga0070674_100268828 | |||
| 1144 | Ga0070673_100005945 | |||
| 1145 | Ga0070673_100037810 | |||
| 1146 | Ga0070673_100094443 | |||
| 1147 | Ga0070673_100110848 | |||
| 1148 | Ga0070673_100120700 | |||
| 1149 | Ga0070673_100143971 | |||
| 1150 | Ga0070673_100367636 | |||
| 1151 | Ga0070659_100000310 | |||
| 1152 | Ga0070659_100013944 | |||
| 1153 | Ga0070659_100022760 | |||
| 1154 | Ga0070659_100029126 | |||
| 1155 | Ga0070659_100032433 | |||
| 1156 | Ga0070659_100038062 | |||
| 1157 | Ga0070659_100074385 | |||
| 1158 | Ga0070659_100108234 | |||
| 1159 | Ga0070659_100166773 | |||
| 1160 | Ga0070659_100172246 | |||
| 1161 | Ga0070659_100181407 | |||
| 1162 | Ga0070659_100385505 | |||
| 1163 | Ga0070659_100478326 | |||
| 1164 | Ga0070667_100001531 | |||
| 1165 | Ga0070667_100006278 | |||
| 1166 | Ga0070667_100011572 | |||
| 1167 | Ga0070667_100018020 | |||
| 1168 | Ga0070667_100022597 | |||
| 1169 | Ga0070667_100043668 | |||
| 1170 | Ga0070667_100050656 | |||
| 1171 | Ga0070714_100092186 | |||
| 1172 | Ga0070714_100160827 | |||
| 1173 | Ga0070714_100181631 | |||
| 1174 | Ga0070713_100020766 | |||
| 1175 | Ga0070713_100175981 | |||
| 1176 | Ga0070713_100178194 | |||
| 1177 | Ga0070713_100179574 | |||
| 1178 | Ga0070663_100008110 | |||
| 1179 | Ga0070663_100018504 | |||
| 1180 | Ga0070663_100026151 | |||
| 1181 | Ga0070663_100082322 | |||
| 1182 | Ga0070663_100083679 | |||
| 1183 | Ga0070663_100114112 | |||
| 1184 | Ga0070663_100238820 | |||
| 1185 | Ga0070678_100008105 | |||
| 1186 | Ga0070678_100011928 | |||
| 1187 | Ga0070678_100026734 | |||
| 1188 | Ga0070678_100030475 | |||
| 1189 | Ga0070678_100102822 | |||
| 1190 | Ga0070662_100000080 | |||
| 1191 | Ga0070662_100013688 | |||
| 1192 | Ga0070662_100033786 | |||
| 1193 | Ga0070662_100105379 | |||
| 1194 | Ga0070662_100162001 | |||
| 1195 | Ga0070662_100312015 | |||
| 1196 | Ga0070681_10050424 | |||
| 1197 | Ga0070681_10107162 | |||
| 1198 | Ga0070681_10236546 | |||
| 1199 | Ga0068867_100015524 | |||
| 1200 | Ga0068867_100026399 | |||
| 1201 | Ga0070679_100034325 | |||
| 1202 | Ga0070679_100043684 | |||
| 1203 | Ga0070679_100046664 | |||
| 1204 | Ga0070679_100175492 | |||
| 1205 | Ga0070679_100248971 | |||
| 1206 | Ga0070679_100323045 | |||
| 1207 | Ga0070679_100398932 | |||
| 1208 | Ga0070684_100012874 | |||
| 1209 | Ga0070684_100022403 | |||
| 1210 | Ga0070684_100286293 | |||
| 1211 | Ga0068853_100000134 | |||
| 1212 | Ga0068853_100026016 | |||
| 1213 | Ga0068853_100067254 | |||
| 1214 | Ga0068853_100073374 | |||
| 1215 | Ga0068853_100092886 | |||
| 1216 | Ga0068853_100162945 | |||
| 1217 | Ga0068853_100178769 | |||
| 1218 | Ga0068853_100424916 | |||
| 1219 | Ga0070672_100004673 | |||
| 1220 | Ga0070672_100013814 | |||
| 1221 | Ga0070672_100016534 | |||
| 1222 | Ga0070672_100019311 | |||
| 1223 | Ga0070672_100042291 | |||
| 1224 | Ga0070672_100101877 | |||
| 1225 | Ga0070672_100107530 | |||
| 1226 | Ga0070672_100124946 | |||
| 1227 | Ga0070686_100024547 | |||
| 1228 | Ga0070686_100147984 | |||
| 1229 | Ga0070693_100000536 | |||
| 1230 | Ga0070693_100029700 | |||
| 1231 | Ga0070665_100003354 | |||
| 1232 | Ga0070665_100007916 | |||
| 1233 | Ga0070665_100024266 | |||
| 1234 | Ga0070665_100069692 | |||
| 1235 | Ga0068855_100000129 | |||
| 1236 | Ga0068855_100043926 | |||
| 1237 | Ga0068855_100047304 | |||
| 1238 | Ga0068855_100058997 | |||
| 1239 | Ga0068855_100064651 | |||
| 1240 | Ga0068855_100070838 | |||
| 1241 | Ga0068855_100105896 | |||
| 1242 | Ga0068855_100165119 | |||
| 1243 | Ga0068855_100173700 | |||
| 1244 | Ga0068855_100252986 | |||
| 1245 | Ga0068855_100272361 | |||
| 1246 | Ga0068855_100445109 | |||
| 1247 | Ga0068855_100485934 | |||
| 1248 | Ga0068855_100600842 | |||
| 1249 | Ga0070664_100000047 | |||
| 1250 | Ga0070664_100010815 | |||
| 1251 | Ga0070664_100012298 | |||
| 1252 | Ga0070664_100012457 | |||
| 1253 | Ga0070664_100016602 | |||
| 1254 | Ga0070664_100022020 | |||
| 1255 | Ga0070664_100056709 | |||
| 1256 | Ga0070664_100061750 | |||
| 1257 | Ga0070664_100092874 | |||
| 1258 | Ga0070664_100210668 | |||
| 1259 | Ga0068857_100007558 | |||
| 1260 | Ga0068857_100023330 | |||
| 1261 | Ga0068857_100048702 | |||
| 1262 | Ga0068857_100131257 | |||
| 1263 | Ga0068854_100042047 | |||
| 1264 | Ga0068854_100056663 | |||
| 1265 | Ga0068854_100090089 | |||
| 1266 | Ga0068854_100106817 | |||
| 1267 | Ga0068854_100129396 | |||
| 1268 | Ga0068854_100161331 | |||
| 1269 | Ga0068854_100259987 | |||
| 1270 | Ga0068854_100298338 | |||
| 1271 | Ga0068856_100053555 | |||
| 1272 | Ga0068856_100100749 | |||
| 1273 | Ga0068856_100106276 | |||
| 1274 | Ga0068856_100170480 | |||
| 1275 | Ga0068856_100187457 | |||
| 1276 | Ga0068856_100188100 | |||
| 1277 | Ga0068856_100258890 | |||
| 1278 | Ga0068856_100349773 | |||
| 1279 | Ga0068852_100002050 | |||
| 1280 | Ga0068852_100002749 | |||
| 1281 | Ga0068852_100014063 | |||
| 1282 | Ga0068852_100015243 | |||
| 1283 | Ga0068852_100027804 | |||
| 1284 | Ga0068852_100080118 | |||
| 1285 | Ga0068852_100086526 | |||
| 1286 | Ga0068852_100109279 | |||
| 1287 | Ga0068852_100153795 | |||
| 1288 | Ga0068852_100556602 | |||
| 1289 | Ga0068859_100004653 | |||
| 1290 | Ga0068859_100023023 | |||
| 1291 | Ga0068859_100080891 | |||
| 1292 | Ga0068859_100121550 | |||
| 1293 | Ga0068859_100178856 | |||
| 1294 | Ga0068859_100208382 | |||
| 1295 | Ga0068864_100000676 | |||
| 1296 | Ga0068864_100001327 | |||
| 1297 | Ga0068864_100019782 | |||
| 1298 | Ga0068864_100023668 | |||
| 1299 | Ga0068864_100024510 | |||
| 1300 | Ga0068864_100114719 | |||
| 1301 | Ga0068866_10009210 | |||
| 1302 | Ga0068851_10036675 | |||
| 1303 | Ga0068851_10157279 | |||
| 1304 | Ga0068870_10191028 | |||
| 1305 | Ga0068863_100001937 | |||
| 1306 | Ga0068863_100004897 | |||
| 1307 | Ga0068863_100017598 | |||
| 1308 | Ga0068863_100062442 | |||
| 1309 | Ga0068863_100143109 | |||
| 1310 | Ga0068858_100001465 | |||
| 1311 | Ga0068858_100002115 | |||
| 1312 | Ga0068858_100023710 | |||
| 1313 | Ga0068858_100054432 | |||
| 1314 | Ga0068858_100120874 | |||
| 1315 | Ga0068860_100002483 | |||
| 1316 | Ga0068860_100038056 | |||
| 1317 | Ga0068860_100059374 | |||
| 1318 | Ga0068860_100141171 | |||
| 1319 | Ga0068862_100028159 | |||
| 1320 | Ga0068862_100053035 | |||
| 1321 | Ga0081539_10013055 | |||
| 1322 | Ga0070717_10082833 | |||
| 1323 | Ga0075364_10063581 | |||
| 1324 | Ga0097621_100073378 | |||
| 1325 | Ga0097621_100101195 | |||
| 1326 | Ga0097621_100107980 | |||
| 1327 | Ga0068871_100003598 | |||
| 1328 | Ga0068871_100014050 | |||
| 1329 | Ga0068871_100158767 | |||
| 1330 | Ga0068871_100352176 | |||
| 1331 | Ga0068865_100006314 | |||
| 1332 | Ga0097620_100004654 | |||
| 1333 | Ga0097620_100023023 | |||
| 1334 | Ga0097620_100080898 | |||
| 1335 | Ga0097620_100121537 | |||
| 1336 | Ga0097620_100178857 | |||
| 1337 | Ga0097620_100208381 | |||
| 1338 | Ga0105250_10008349 | |||
| 1339 | Ga0105240_10010591 | |||
| 1340 | Ga0105240_10013759 | |||
| 1341 | Ga0105240_10025464 | |||
| 1342 | Ga0105240_10171781 | |||
| 1343 | Ga0105245_10008586 | |||
| 1344 | Ga0105245_10052292 | |||
| 1345 | Ga0105245_10297155 | |||
| 1346 | Ga0105247_10205709 | |||
| 1347 | Ga0105243_10164369 | |||
| 1348 | Ga0105242_10047404 | |||
| 1349 | Ga0105242_10298324 | |||
| 1350 | Ga0105248_10000276 | |||
| 1351 | Ga0105248_10000818 | |||
| 1352 | Ga0105248_10001339 | |||
| 1353 | Ga0105248_10002382 | |||
| 1354 | Ga0105248_10018004 | |||
| 1355 | Ga0105248_10040529 | |||
| 1356 | Ga0105248_10042715 | |||
| 1357 | Ga0105248_10048181 | |||
| 1358 | Ga0105248_10067021 | |||
| 1359 | Ga0105248_10081466 | |||
| 1360 | Ga0105248_10093690 | |||
| 1361 | Ga0105248_10201148 | |||
| 1362 | Ga0105248_10237616 | |||
| 1363 | Ga0105248_10246284 | |||
| 1364 | Ga0105248_10250853 | |||
| 1365 | Ga0105248_10487503 | |||
| 1366 | Ga0105237_10059550 | |||
| 1367 | Ga0105237_10139974 | |||
| 1368 | Ga0105237_10237134 | |||
| 1369 | Ga0105238_10009452 | |||
| 1370 | Ga0105238_10072401 | |||
| 1371 | Ga0105238_10121332 | |||
| 1372 | Ga0105238_10263266 | |||
| 1373 | Ga0105238_10388497 | |||
| 1374 | Ga0105238_10434620 | |||
| 1375 | Ga0105238_10504985 | |||
| 1376 | Ga0105239_10586783 | |||
| 1377 | Ga0105246_10072786 | |||
| 1378 | Ga0157373_10007891 | |||
| 1379 | Ga0157373_10029928 | |||
| 1380 | Ga0157373_10079029 | |||
| 1381 | Ga0157373_10098452 | |||
| 1382 | Ga0157373_10101130 | |||
| 1383 | Ga0157373_10177841 | |||
| 1384 | Ga0157373_10247644 | |||
| 1385 | Ga0157371_10000854 | |||
| 1386 | Ga0157371_10004446 | |||
| 1387 | Ga0157371_10005070 | |||
| 1388 | Ga0157371_10054627 | |||
| 1389 | Ga0157371_10058350 | |||
| 1390 | Ga0157371_10089939 | |||
| 1391 | Ga0157371_10133031 | |||
| 1392 | Ga0157371_10134506 | |||
| 1393 | Ga0157370_10020725 | |||
| 1394 | Ga0157370_10093050 | |||
| 1395 | Ga0157370_10115546 | |||
| 1396 | Ga0157370_10169425 | |||
| 1397 | Ga0157370_10350299 | |||
| 1398 | Ga0157370_10532810 | |||
| 1399 | Ga0157369_10000238 | |||
| 1400 | Ga0157369_10001611 | |||
| 1401 | Ga0157369_10018907 | |||
| 1402 | Ga0157369_10051493 | |||
| 1403 | Ga0157369_10119754 | |||
| 1404 | Ga0157369_10255924 | |||
| 1405 | Ga0157369_10306410 | |||
| 1406 | Ga0157369_10403408 | |||
| 1407 | Ga0157369_10426551 | |||
| 1408 | Ga0157369_10500864 | |||
| 1409 | Ga0157369_10698596 | |||
| 1410 | Ga0157374_10003243 | |||
| 1411 | Ga0157374_10004605 | |||
| 1412 | Ga0157374_10007006 | |||
| 1413 | Ga0157374_10077596 | |||
| 1414 | Ga0157374_10106220 | |||
| 1415 | Ga0157374_10263228 | |||
| 1416 | Ga0157374_10398866 | |||
| 1417 | Ga0157374_10414221 | |||
| 1418 | Ga0157378_10088970 | |||
| 1419 | Ga0157378_10103837 | |||
| 1420 | Ga0157378_10240585 | |||
| 1421 | Ga0157372_10115873 | |||
| 1422 | Ga0157372_10158317 | |||
| 1423 | Ga0157372_10350291 | |||
| 1424 | Ga0157372_10632121 | |||
| 1425 | Ga0157372_10717001 | |||
| 1426 | Ga0157375_10029766 | |||
| 1427 | Ga0157375_10116099 | |||
| 1428 | Ga0157375_10786135 | |||
| 1429 | Ga0163163_10000139 | |||
| 1430 | Ga0163163_10001248 | |||
| 1431 | Ga0163163_10499946 | |||
| 1432 | Ga0157380_10101657 | |||
| 1433 | Ga0182008_10030176 | |||
| 1434 | Ga0157379_10019524 | |||
| 1435 | Ga0157379_10025413 | |||
| 1436 | Ga0157379_10034131 | |||
| 1437 | Ga0157376_10002695 | |||
| 1438 | Ga0163161_10038215 | |||
| 1439 | Ga0213876_10141492 | |||
| 1440 | Ga0207656_10024065 | |||
| 1441 | Ga0207656_10070851 | |||
| 1442 | Ga0207696_1005750 | |||
| 1443 | Ga0207682_10069758 | |||
| 1444 | Ga0207642_10012036 | |||
| 1445 | Ga0207688_10017529 | |||
| 1446 | Ga0207688_10063087 | |||
| 1447 | Ga0207680_10001894 | |||
| 1448 | Ga0207680_10002818 | |||
| 1449 | Ga0207680_10012072 | |||
| 1450 | Ga0207680_10026601 | |||
| 1451 | Ga0207680_10119225 | |||
| 1452 | Ga0207647_10004972 | |||
| 1453 | Ga0207647_10007015 | |||
| 1454 | Ga0207647_10020499 | |||
| 1455 | Ga0207647_10061614 | |||
| 1456 | Ga0207647_10098285 | |||
| 1457 | Ga0207645_10075252 | |||
| 1458 | Ga0207645_10139429 | |||
| 1459 | Ga0207645_10141302 | |||
| 1460 | Ga0207705_10000030 | |||
| 1461 | Ga0207705_10000164 | |||
| 1462 | Ga0207705_10000382 | |||
| 1463 | Ga0207705_10000942 | |||
| 1464 | Ga0207705_10005132 | |||
| 1465 | Ga0207705_10010076 | |||
| 1466 | Ga0207705_10015942 | |||
| 1467 | Ga0207705_10016160 | |||
| 1468 | Ga0207705_10021265 | |||
| 1469 | Ga0207705_10030078 | |||
| 1470 | Ga0207705_10035904 | |||
| 1471 | Ga0207705_10038622 | |||
| 1472 | Ga0207705_10051974 | |||
| 1473 | Ga0207705_10063938 | |||
| 1474 | Ga0207705_10066566 | |||
| 1475 | Ga0207705_10078123 | |||
| 1476 | Ga0207705_10087342 | |||
| 1477 | Ga0207705_10099941 | |||
| 1478 | Ga0207705_10102351 | |||
| 1479 | Ga0207705_10105883 | |||
| 1480 | Ga0207705_10170710 | |||
| 1481 | Ga0207705_10179755 | |||
| 1482 | Ga0207705_10186037 | |||
| 1483 | Ga0207705_10320922 | |||
| 1484 | Ga0207705_10362150 | |||
| 1485 | Ga0207707_10036574 | |||
| 1486 | Ga0207707_10046105 | |||
| 1487 | Ga0207707_10073172 | |||
| 1488 | Ga0207695_10001533 | |||
| 1489 | Ga0207695_10003681 | |||
| 1490 | Ga0207695_10046225 | |||
| 1491 | Ga0207695_10144859 | |||
| 1492 | Ga0207671_10017683 | |||
| 1493 | Ga0207671_10263374 | |||
| 1494 | Ga0207693_10162539 | |||
| 1495 | Ga0207660_10000515 | |||
| 1496 | Ga0207660_10001062 | |||
| 1497 | Ga0207660_10004418 | |||
| 1498 | Ga0207660_10075178 | |||
| 1499 | Ga0207660_10104450 | |||
| 1500 | Ga0207662_10125957 | |||
| 1501 | Ga0207657_10000090 | |||
| 1502 | Ga0207657_10000966 | |||
| 1503 | Ga0207657_10002608 | |||
| 1504 | Ga0207657_10005871 | |||
| 1505 | Ga0207657_10009774 | |||
| 1506 | Ga0207657_10013994 | |||
| 1507 | Ga0207657_10024390 | |||
| 1508 | Ga0207657_10031034 | |||
| 1509 | Ga0207657_10040221 | |||
| 1510 | Ga0207657_10046172 | |||
| 1511 | Ga0207657_10046487 | |||
| 1512 | Ga0207657_10047434 | |||
| 1513 | Ga0207657_10069456 | |||
| 1514 | Ga0207657_10074895 | |||
| 1515 | Ga0207657_10077604 | |||
| 1516 | Ga0207657_10118920 | |||
| 1517 | Ga0207657_10180539 | |||
| 1518 | Ga0207657_10181001 | |||
| 1519 | Ga0207649_10000324 | |||
| 1520 | Ga0207649_10000538 | |||
| 1521 | Ga0207649_10012021 | |||
| 1522 | Ga0207649_10023549 | |||
| 1523 | Ga0207649_10073374 | |||
| 1524 | Ga0207649_10073951 | |||
| 1525 | Ga0207649_10090079 | |||
| 1526 | Ga0207649_10319371 | |||
| 1527 | Ga0207652_10063960 | |||
| 1528 | Ga0207652_10164871 | |||
| 1529 | Ga0207652_10388280 | |||
| 1530 | Ga0207681_10011975 | |||
| 1531 | Ga0207681_10078186 | |||
| 1532 | Ga0207681_10207884 | |||
| 1533 | Ga0207681_10330368 | |||
| 1534 | Ga0207694_10002074 | |||
| 1535 | Ga0207650_10002851 | |||
| 1536 | Ga0207650_10035624 | |||
| 1537 | Ga0207650_10037065 | |||
| 1538 | Ga0207650_10177459 | |||
| 1539 | Ga0207650_10441381 | |||
| 1540 | Ga0207659_10002373 | |||
| 1541 | Ga0207659_10150123 | |||
| 1542 | Ga0207659_10447504 | |||
| 1543 | Ga0207700_10123269 | |||
| 1544 | Ga0207700_10525148 | |||
| 1545 | Ga0207664_10093688 | |||
| 1546 | Ga0207664_10155395 | |||
| 1547 | Ga0207644_10000960 | |||
| 1548 | Ga0207644_10001690 | |||
| 1549 | Ga0207644_10002366 | |||
| 1550 | Ga0207644_10003068 | |||
| 1551 | Ga0207644_10003537 | |||
| 1552 | Ga0207644_10004646 | |||
| 1553 | Ga0207644_10018964 | |||
| 1554 | Ga0207644_10033993 | |||
| 1555 | Ga0207644_10151561 | |||
| 1556 | Ga0207644_10157552 | |||
| 1557 | Ga0207644_10204830 | |||
| 1558 | Ga0207644_10275054 | |||
| 1559 | Ga0207644_10351131 | |||
| 1560 | Ga0207690_10000184 | |||
| 1561 | Ga0207690_10004224 | |||
| 1562 | Ga0207690_10020485 | |||
| 1563 | Ga0207690_10048302 | |||
| 1564 | Ga0207690_10064444 | |||
| 1565 | Ga0207690_10071478 | |||
| 1566 | Ga0207690_10189875 | |||
| 1567 | Ga0207690_10254442 | |||
| 1568 | Ga0207690_10276177 | |||
| 1569 | Ga0207706_10000110 | |||
| 1570 | Ga0207706_10003529 | |||
| 1571 | Ga0207706_10012607 | |||
| 1572 | Ga0207706_10014651 | |||
| 1573 | Ga0207706_10033216 | |||
| 1574 | Ga0207706_10052977 | |||
| 1575 | Ga0207706_10063101 | |||
| 1576 | Ga0207706_10088897 | |||
| 1577 | Ga0207706_10110311 | |||
| 1578 | Ga0207706_10177736 | |||
| 1579 | Ga0207706_10180314 | |||
| 1580 | Ga0207706_10246046 | |||
| 1581 | Ga0207686_10010692 | |||
| 1582 | Ga0207669_10023069 | |||
| 1583 | Ga0207669_10096415 | |||
| 1584 | Ga0207669_10229901 | |||
| 1585 | Ga0207704_10043056 | |||
| 1586 | Ga0207704_10055350 | |||
| 1587 | Ga0207665_10110099 | |||
| 1588 | Ga0207691_10003020 | |||
| 1589 | Ga0207691_10009755 | |||
| 1590 | Ga0207691_10019100 | |||
| 1591 | Ga0207691_10021940 | |||
| 1592 | Ga0207691_10042518 | |||
| 1593 | Ga0207691_10049172 | |||
| 1594 | Ga0207691_10051014 | |||
| 1595 | Ga0207691_10062761 | |||
| 1596 | Ga0207691_10117597 | |||
| 1597 | Ga0207691_10208084 | |||
| 1598 | Ga0207691_10295848 | |||
| 1599 | Ga0207711_10000193 | |||
| 1600 | Ga0207711_10000258 | |||
| 1601 | Ga0207711_10000586 | |||
| 1602 | Ga0207711_10000922 | |||
| 1603 | Ga0207711_10002671 | |||
| 1604 | Ga0207711_10009528 | |||
| 1605 | Ga0207711_10014091 | |||
| 1606 | Ga0207711_10016607 | |||
| 1607 | Ga0207711_10060666 | |||
| 1608 | Ga0207711_10067636 | |||
| 1609 | Ga0207711_10073463 | |||
| 1610 | Ga0207711_10239315 | |||
| 1611 | Ga0207711_10467043 | |||
| 1612 | Ga0207661_10000179 | |||
| 1613 | Ga0207661_10001420 | |||
| 1614 | Ga0207661_10022584 | |||
| 1615 | Ga0207661_10037622 | |||
| 1616 | Ga0207679_10000329 | |||
| 1617 | Ga0207679_10003556 | |||
| 1618 | Ga0207679_10012146 | |||
| 1619 | Ga0207679_10033853 | |||
| 1620 | Ga0207679_10091643 | |||
| 1621 | Ga0207679_10102816 | |||
| 1622 | Ga0207679_10122799 | |||
| 1623 | Ga0207679_10147989 | |||
| 1624 | Ga0207667_10000303 | |||
| 1625 | Ga0207667_10002493 | |||
| 1626 | Ga0207667_10002920 | |||
| 1627 | Ga0207667_10008859 | |||
| 1628 | Ga0207667_10042277 | |||
| 1629 | Ga0207667_10042772 | |||
| 1630 | Ga0207667_10099634 | |||
| 1631 | Ga0207667_10123262 | |||
| 1632 | Ga0207667_10141559 | |||
| 1633 | Ga0207667_10148711 | |||
| 1634 | Ga0207667_10233205 | |||
| 1635 | Ga0207667_10459095 | |||
| 1636 | Ga0207651_10003060 | |||
| 1637 | Ga0207651_10003074 | |||
| 1638 | Ga0207651_10007393 | |||
| 1639 | Ga0207651_10059368 | |||
| 1640 | Ga0207651_10316314 | |||
| 1641 | Ga0207651_10356466 | |||
| 1642 | Ga0207640_10000774 | |||
| 1643 | Ga0207640_10008965 | |||
| 1644 | Ga0207640_10018373 | |||
| 1645 | Ga0207640_10041381 | |||
| 1646 | Ga0207640_10041824 | |||
| 1647 | Ga0207640_10163264 | |||
| 1648 | Ga0207640_10169092 | |||
| 1649 | Ga0207658_10007580 | |||
| 1650 | Ga0207658_10008291 | |||
| 1651 | Ga0207658_10008679 | |||
| 1652 | Ga0207658_10011777 | |||
| 1653 | Ga0207658_10018839 | |||
| 1654 | Ga0207658_10021768 | |||
| 1655 | Ga0207658_10050692 | |||
| 1656 | Ga0207658_10093700 | |||
| 1657 | Ga0207677_10000866 | |||
| 1658 | Ga0207677_10012218 | |||
| 1659 | Ga0207703_10006890 | |||
| 1660 | Ga0207703_10015909 | |||
| 1661 | Ga0207703_10062243 | |||
| 1662 | Ga0207639_10000458 | |||
| 1663 | Ga0207639_10013643 | |||
| 1664 | Ga0207639_10066770 | |||
| 1665 | Ga0207639_10068174 | |||
| 1666 | Ga0207639_10119548 | |||
| 1667 | Ga0207639_10292925 | |||
| 1668 | Ga0207678_10003366 | |||
| 1669 | Ga0207678_10006673 | |||
| 1670 | Ga0207678_10013063 | |||
| 1671 | Ga0207678_10013092 | |||
| 1672 | Ga0207678_10023449 | |||
| 1673 | Ga0207678_10059601 | |||
| 1674 | Ga0207678_10101308 | |||
| 1675 | Ga0207678_10137208 | |||
| 1676 | Ga0207678_10227757 | |||
| 1677 | Ga0207678_10228459 | |||
| 1678 | Ga0207702_10000391 | |||
| 1679 | Ga0207702_10029339 | |||
| 1680 | Ga0207702_10041377 | |||
| 1681 | Ga0207702_10043227 | |||
| 1682 | Ga0207702_10059874 | |||
| 1683 | Ga0207702_10129656 | |||
| 1684 | Ga0207702_10203645 | |||
| 1685 | Ga0207702_10238826 | |||
| 1686 | Ga0207641_10003418 | |||
| 1687 | Ga0207641_10042984 | |||
| 1688 | Ga0207641_10077915 | |||
| 1689 | Ga0207641_10185074 | |||
| 1690 | Ga0207641_10196187 | |||
| 1691 | Ga0207648_10003776 | |||
| 1692 | Ga0207648_10027466 | |||
| 1693 | Ga0207676_10001889 | |||
| 1694 | Ga0207676_10002064 | |||
| 1695 | Ga0207676_10011706 | |||
| 1696 | Ga0207676_10057033 | |||
| 1697 | Ga0207676_10072447 | |||
| 1698 | Ga0207676_10103091 | |||
| 1699 | Ga0207676_10104091 | |||
| 1700 | Ga0207674_10001888 | |||
| 1701 | Ga0207674_10004883 | |||
| 1702 | Ga0207674_10006854 | |||
| 1703 | Ga0207674_10010088 | |||
| 1704 | Ga0207674_10018165 | |||
| 1705 | Ga0207674_10019371 | |||
| 1706 | Ga0207674_10060594 | |||
| 1707 | Ga0207674_10165865 | |||
| 1708 | Ga0207674_10239272 | |||
| 1709 | Ga0207674_10417873 | |||
| 1710 | Ga0207674_10444634 | |||
| 1711 | Ga0207683_10007231 | |||
| 1712 | Ga0207683_10013235 | |||
| 1713 | Ga0207683_10014399 | |||
| 1714 | Ga0207683_10046319 | |||
| 1715 | Ga0207683_10263263 | |||
| 1716 | Ga0207698_10001169 | |||
| 1717 | Ga0207698_10008265 | |||
| 1718 | Ga0207698_10008788 | |||
| 1719 | Ga0207698_10019555 | |||
| 1720 | Ga0207698_10019682 | |||
| 1721 | Ga0207698_10026496 | |||
| 1722 | Ga0207698_10077076 | |||
| 1723 | Ga0207698_10087951 | |||
| 1724 | Ga0207698_10105040 | |||
| 1725 | Ga0207698_10146490 | |||
| 1726 | Ga0207698_10156424 | |||
| 1727 | Ga0207698_10210395 | |||
| 1728 | Ga0207698_10446986 | |||
| 1729 | Ga0268266_10013748 | |||
| 1730 | Ga0268266_10149110 | |||
| 1731 | Ga0268265_10005643 | |||
| 1732 | Ga0268265_10056043 | |||
| 1733 | Ga0268264_10001981 | |||
| 1734 | Ga0268264_10016391 | |||
| 1735 | Ga0268264_10102413 | |||
| 1736 | Ga0307408_100112019 | |||
| 1737 | Ga0307405_10087732 | |||
| 1738 | Ga0307410_10006754 | |||
| 1739 | Ga0307410_10008462 | |||
| 1740 | Ga0307410_10049488 | |||
| 1741 | Ga0307410_10057500 | |||
| 1742 | Ga0307410_10196528 | |||
| 1743 | Ga0307406_10002764 | |||
| 1744 | Ga0307407_10300161 | |||
| 1745 | Ga0307412_10034719 | |||
| 1746 | Ga0307412_10051476 | |||
| 1747 | Ga0307412_10147223 | |||
| 1748 | Ga0307409_100024297 | |||
| 1749 | Ga0307409_100034290 | |||
| 1750 | Ga0307409_100133978 | |||
| 1751 | Ga0307409_100177804 | |||
| 1752 | Ga0307409_100430419 | |||
| 1753 | Ga0307416_100070402 | |||
| 1754 | Ga0307416_100133019 | |||
| 1755 | Ga0307414_10159607 | |||
| 1756 | Ga0307411_10000751 | |||
| 1757 | Ga0307411_10082287 | |||
| 1758 | Ga0307411_10138565 | |||
| 1759 | Ga0307411_10200014 | |||
| 1760 | Ga0307415_100036666 | |||
| 1761 | Ga0307415_100047617 | |||
| 1762 | Ga0307415_100056242 | |||
| 1763 | Ga0307415_100057685 | |||
| 1764 | Ga0307415_100227318 | |||
| 1765 | Ga0307415_100237677 | |||
| 1766 | Ga0307415_100348086 | |||
| 1767 | Ga0373930_0002803 | |||
| 1768 | Ga0373923_0072150 | |||
| 1769 | Ga0373932_0070742 | |||
| 1770 | Ga0373957_0020896 | |||
| 1771 | Ga0373943_0027808 | |||
| 1772 | Ga0373955_0002452 | |||
| 1773 | Ga0373961_0059606 | |||
| 1774 | Ga0373931_0053388 | |||
| 1775 | Ga0373931_0166085 | |||
| 1776 | Ga0373935_0049087 | |||
| 1777 | Ga0373935_0058305 | |||
| 1778 | Ga0373927_0076274 | |||
| 1779 | Ga0373933_0053550 | |||
| 1780 | Ga0373937_0001514 | |||
| 1781 | Ga0373925_0188761 | |||
| 1782 | Ga0395899_0000732 | |||
| 1783 | Ga0395899_0001019 | |||
| 1784 | Ga0395899_0002681 | |||
| 1785 | Ga0395899_0008955 | |||
| 1786 | Ga0395899_0012197 | |||
| 1787 | Ga0395899_0016732 | |||
| 1788 | Ga0395899_0017969 | |||
| 1789 | Ga0395899_0020601 | |||
| 1790 | Ga0395899_0028045 | |||
| 1791 | Ga0395899_0030893 | |||
| 1792 | Ga0395899_0038635 | |||
| 1793 | Ga0395899_0045720 | |||
| 1794 | Ga0395899_0061012 | |||
| 1795 | Ga0395899_0063752 | |||
| 1796 | Ga0395899_0069193 | |||
| 1797 | Ga0395899_0070520 | |||
| 1798 | Ga0395899_0070568 | |||
| 1799 | Ga0395899_0075179 | |||
| 1800 | Ga0395899_0093904 | |||
| 1801 | Ga0395899_0095756 | |||
| 1802 | Ga0395899_0099480 | |||
| 1803 | Ga0395899_0101018 | |||
| 1804 | Ga0395899_0110567 | |||
| 1805 | Ga0395899_0120473 | |||
| 1806 | Ga0395899_0135490 | |||
| 1807 | Ga0395899_0178412 | |||
| 1808 | Ga0395899_0213298 | |||
| 1809 | Ga0395899_0254253 | |||
| 1810 | Ga0395899_0267402 | |||
| 1811 | Ga0395900_0000289 | |||
| 1812 | Ga0395900_0000336 | |||
| 1813 | Ga0395900_0000840 | |||
| 1814 | Ga0395900_0005450 | |||
| 1815 | Ga0395900_0009867 | |||
| 1816 | Ga0395900_0010465 | |||
| 1817 | Ga0395900_0012023 | |||
| 1818 | Ga0395900_0012599 | |||
| 1819 | Ga0395900_0021363 | |||
| 1820 | Ga0395900_0022848 | |||
| 1821 | Ga0395900_0032126 | |||
| 1822 | Ga0395900_0053674 | |||
| 1823 | Ga0395900_0055299 | |||
| 1824 | Ga0395900_0062978 | |||
| 1825 | Ga0395900_0074972 | |||
| 1826 | Ga0395900_0075036 | |||
| 1827 | Ga0395900_0084504 | |||
| 1828 | Ga0395900_0122407 | |||
| 1829 | Ga0395900_0129689 | |||
| 1830 | Ga0395900_0142793 | |||
| 1831 | Ga0395900_0144201 | |||
| 1832 | Ga0395900_0150091 | |||
| 1833 | Ga0395900_0170182 | |||
| 1834 | Ga0395900_0182935 | |||
| 1835 | Ga0395900_0244765 | |||
| 1836 | Ga0395900_0266367 | |||
| 1837 | Ga0395900_0283102 | |||
| 1838 | Ga0395900_0333032 | |||
| 1839 | Ga0395900_0414094 | |||
| 1840 | Ga0395900_0424744 | |||
| 1841 | Ga0395900_0497208 | |||
| 1842 | Ga0395898_0000055 | |||
| 1843 | Ga0395898_0000898 | |||
| 1844 | Ga0395898_0011944 | |||
| 1845 | Ga0395898_0039097 | |||
| 1846 | Ga0395898_0039654 | |||
| 1847 | Ga0395898_0064249 | |||
| 1848 | Ga0395898_0064692 | |||
| 1849 | Ga0395898_0071979 | |||
| 1850 | Ga0395898_0088781 | |||
| 1851 | Ga0395898_0117995 | |||
| 1852 | Ga0395898_0135434 | |||
| 1853 | Ga0395898_0140590 | |||
| 1854 | Ga0395898_0178190 | |||
| 1855 | Ga0395898_0199579 | |||
| 1856 | Ga0395898_0245040 | |||
| 1857 | Ga0395905_0000067 | |||
| 1858 | Ga0395905_0000204 | |||
| 1859 | Ga0395905_0001128 | |||
| 1860 | Ga0395905_0009949 | |||
| 1861 | Ga0395905_0011713 | |||
| 1862 | Ga0395905_0012098 | |||
| 1863 | Ga0395905_0012136 | |||
| 1864 | Ga0395905_0012837 | |||
| 1865 | Ga0395905_0013828 | |||
| 1866 | Ga0395905_0014777 | |||
| 1867 | Ga0395905_0015799 | |||
| 1868 | Ga0395905_0016270 | |||
| 1869 | Ga0395905_0021093 | |||
| 1870 | Ga0395905_0023138 | |||
| 1871 | Ga0395905_0032662 | |||
| 1872 | Ga0395905_0038551 | |||
| 1873 | Ga0395905_0044661 | |||
| 1874 | Ga0395905_0061770 | |||
| 1875 | Ga0395905_0073390 | |||
| 1876 | Ga0395905_0083554 | |||
| 1877 | Ga0395905_0123482 | |||
| 1878 | Ga0395905_0124151 | |||
| 1879 | Ga0395905_0181250 | |||
| 1880 | Ga0395905_0233426 | |||
| 1881 | Ga0395905_0248742 | |||
| 1882 | Ga0395905_0317234 | |||
| 1883 | Ga0395905_0317895 | |||
| 1884 | Ga0395905_0413317 | |||
| 1885 | Ga0395905_0470585 | |||
| 1886 | Ga0436364_1481755 | |||
| 1887 | Ga0395901_0000208 | |||
| 1888 | Ga0395901_0000648 | |||
| 1889 | Ga0395901_0000770 | |||
| 1890 | Ga0395901_0001244 | |||
| 1891 | Ga0395901_0002867 | |||
| 1892 | Ga0395901_0005184 | |||
| 1893 | Ga0395901_0009196 | |||
| 1894 | Ga0395901_0011794 | |||
| 1895 | Ga0395901_0013298 | |||
| 1896 | Ga0395901_0016747 | |||
| 1897 | Ga0395901_0020624 | |||
| 1898 | Ga0395901_0027515 | |||
| 1899 | Ga0395901_0074765 | |||
| 1900 | Ga0395901_0098854 | |||
| 1901 | Ga0395901_0100918 | |||
| 1902 | Ga0395901_0127830 | |||
| 1903 | Ga0395901_0131169 | |||
| 1904 | Ga0395901_0135699 | |||
| 1905 | Ga0395901_0136373 | |||
| 1906 | Ga0395901_0163100 | |||
| 1907 | Ga0395901_0175144 | |||
| 1908 | Ga0395901_0217937 | |||
| 1909 | Ga0395901_0272348 | |||
| 1910 | Ga0395901_0321598 | |||
| 1911 | Ga0395901_0337089 | |||
| 1912 | Ga0395901_0339354 | |||
| 1913 | Ga0395901_0393175 | |||
| 1914 | Ga0395901_0395011 | |||
| 1915 | Ga0395901_0468921 | |||
| 1916 | Ga0395901_0530190 | |||
| 1917 | Ga0436365_0125660 | |||
| 1918 | Ga0439445_0011268 | |||
| 1919 | Ga0439448_0007869 | |||
| 1920 | Ga0439432_040184 | |||
| 1921 | Ga0439449_0021256 | |||
| 1922 | Ga0439458_0001396 | |||
| 1923 | Ga0439458_0002081 | |||
| 1924 | Ga0439464_0000729 | |||
| 1925 | Ga0466969_0041854 | |||
| 1926 | Ga0466972_0035920 | |||
| 1927 | Ga0466972_0042133 | |||
| 1928 | Ga0466966_0000301 | |||
| 1929 | Ga0466966_0014734 | |||
| 1930 | Ga0466966_0028577 | |||
| 1931 | Ga0466961_0009376 | |||
| 1932 | Ga0466961_0014220 | |||
| 1933 | Ga0466961_0047231 | |||
| 1934 | Ga0466961_0073174 | |||
| 1935 | Ga0466961_0082316 | |||
| 1936 | Ga0466961_0163618 | |||
| 1937 | Ga0466963_0012060 | |||
| 1938 | Ga0466963_0016937 | |||
| 1939 | Ga0466963_0019403 | |||
| 1940 | Ga0466963_0021807 | |||
| 1941 | Ga0466963_0024312 | |||
| 1942 | Ga0466963_0039699 | |||
| 1943 | Ga0466963_0273661 | |||
| 1944 | Ga0466964_0027010 | |||
| 1945 | Ga0466971_0006087 | |||
| 1946 | Ga0466971_0027424 | |||
| 1947 | Ga0466971_0040971 | |||
| 1948 | Ga0466971_0080942 | |||
| 1949 | Ga0466968_0004855 | |||
| 1950 | Ga0466970_0004034 | |||
| 1951 | Ga0466970_0015259 | |||
| 1952 | Ga0466970_0049038 | |||
| 1953 | Ga0466970_0166266 | |||
| 1954 | Ga0466957_0000787 | |||
| 1955 | Ga0466957_0003763 | |||
| 1956 | Ga0466957_0013236 | |||
| 1957 | Ga0466957_0212326 | |||
| 1958 | Ga0466960_0013380 | |||
| 1959 | Ga0466959_0041141 | |||
| 1960 | Ga0466959_0058210 | |||
| 1961 | Ga0466959_0109859 | |||
| 1962 | Ga0466959_0153955 | |||
| 1963 | Ga0466959_0272683 | |||
| 1964 | Ga0466958_0002930 | |||
| 1965 | Ga0466958_0004323 | |||
| 1966 | Ga0466958_0008549 | |||
| 1967 | Ga0466958_0020162 | |||
| 1968 | Ga0466958_0187646 | |||
| 1969 | Ga0466967_0000409 | |||
| 1970 | Ga0466967_0011305 | |||
| 1971 | Ga0466967_0011339 | |||
| 1972 | Ga0466967_0051882 | |||
| 1973 | Ga0466967_0060090 | |||
| 1974 | Ga0466967_0069018 | |||
| 1975 | Ga0466967_0071927 | |||
| 1976 | Ga0466967_0100391 | |||
| 1977 | Ga0466967_0153516 | |||
| 1978 | Ga0466967_0492967 | |||
| 1979 | Ga0495596_0104336 | |||
| 1980 | Ga0495663_0004385 | |||
| 1981 | Ga0495598_0000215 | |||
| 1982 | Ga0495621_0000088 | |||
| 1983 | Ga0495621_0000383 | |||
| 1984 | Ga0495621_0009036 | |||
| 1985 | Ga0495621_0020788 | |||
| 1986 | Ga0495621_0045054 | |||
| 1987 | Ga0495633_0004015 | |||
| 1988 | Ga0495633_0042200 | |||
| 1989 | Ga0495668_0008618 | |||
| 1990 | Ga0495668_0010128 | |||
| 1991 | Ga0495668_0012707 | |||
| 1992 | Ga0495668_0030166 | |||
| 1993 | Ga0495661_0029425 | |||
| 1994 | Ga0495669_0000090 | |||
| 1995 | Ga0495669_0002359 | |||
| 1996 | Ga0495669_0004776 | |||
| 1997 | Ga0495669_0012852 | |||
| 1998 | Ga0495669_0019471 | |||
| 1999 | Ga0495669_0019493 | |||
| 2000 | Ga0495669_0020876 | |||
| 2001 | Ga0495669_0022508 | |||
| 2002 | Ga0495669_0138203 | |||
| 2003 | Ga0495670_0000192 | |||
| 2004 | Ga0495670_0021504 | |||
| 2005 | Ga0495670_0197625 | |||
| 2006 | Ga0495677_0008553 | |||
| 2007 | Ga0495677_0018667 | |||
| 2008 | Ga0495677_0027255 | |||
| 2009 | Ga0495685_044475 | |||
| 2010 | Ga0495602_0041409 | |||
| 2011 | Ga0496100_0030609 | |||
| 2012 | Ga0496100_0089871 | |||
| 2013 | Ga0496101_0001673 | |||
| 2014 | Ga0496101_0008722 | |||
| 2015 | Ga0496101_0247180 | |||
| 2016 | Ga0496102_0169260 | |||
| 2017 | Ga0496103_0022756 | |||
| 2018 | Ga0496104_0040729 | |||
| 2019 | Ga0496105_0089162 | |||
| 2020 | Ga0496106_0005495 | |||
| 2021 | Ga0496106_0018948 | |||
| 2022 | Ga0496107_0006177 | |||
| 2023 | Ga0496107_0058239 | |||
| 2024 | Ga0496107_0262388 | |||
| 2025 | Ga0496108_0032006 | |||
| 2026 | Ga0496108_0099203 | |||
| 2027 | Ga0496108_0144181 | |||
| 2028 | Ga0496109_0002106 | |||
| 2029 | Ga0496109_0011910 | |||
| 2030 | Ga0496109_0013949 | |||
| 2031 | Ga0496109_0026337 | |||
| 2032 | Ga0496109_0039480 | |||
| 2033 | Ga0496109_0064824 | |||
| 2034 | Ga0496109_0160802 | |||
| 2035 | Ga0496109_0252014 | |||
| 2036 | Ga0496110_0001399 | |||
| 2037 | Ga0496110_0002580 | |||
| 2038 | Ga0496110_0009250 | |||
| 2039 | Ga0496110_0009949 | |||
| 2040 | Ga0496110_0022339 | |||
| 2041 | Ga0496110_0452627 | |||
| 2042 | Ga0496111_0002383 | |||
| 2043 | Ga0496111_0007825 | |||
| 2044 | Ga0496111_0053092 | |||
| 2045 | Ga0496111_0078113 | |||
| 2046 | Ga0496112_0000546 | |||
| 2047 | Ga0496112_0015905 | |||
| 2048 | Ga0496112_0018449 | |||
| 2049 | Ga0496112_0019602 | |||
| 2050 | Ga0496112_0028872 | |||
| 2051 | Ga0496112_0040392 | |||
| 2052 | Ga0496112_0044417 | |||
| 2053 | Ga0496112_0268946 | |||
| 2054 | Ga0496112_0438572 | |||
| 2055 | Ga0496113_0004928 | |||
| 2056 | Ga0496113_0006309 | |||
| 2057 | Ga0496113_0006545 | |||
| 2058 | Ga0496113_0011840 | |||
| 2059 | Ga0496113_0480664 | |||
| 2060 | Ga0496114_0229609 | |||
| 2061 | Ga0496115_0013299 | |||
| 2062 | Ga0496115_0024534 | |||
| 2063 | Ga0501067_0040652 | |||
| 2064 | Ga0501230_014707 | |||
| 2065 | Ga0501234_004369 | |||
| 2066 | Ga0501263_005167 | |||
| 2067 | Ga0495655_0008567 | |||
| 2068 | Ga0500658_0000049 | |||
| 2069 | Ga0466962_0003934 | |||
| 2070 | Ga0466962_0005486 | |||
| 2071 | Ga0466962_0039444 | |||
| 2072 | Ga0466962_0107789 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7yvr-assembly1.cif.gz_D | crystal structure of l-threonine aldolase from neptunomonas marina | 0.9694 | 2 | 332 |
| 1v72-assembly1.cif.gz_A | crystal structure of phenylserine aldolase from pseudomonas putida | 0.9685 | 3 | 332 |
| 5vye-assembly1.cif.gz_A | crystal structure of l-threonine aldolase from pseudomonas putida | 0.9631 | 2 | 332 |
| 7yvr-assembly1.cif.gz_D | crystal structure of l-threonine aldolase from neptunomonas marina | 0.9609 | 2 | 332 |
| 1v72-assembly1.cif.gz_A | crystal structure of phenylserine aldolase from pseudomonas putida | 0.9572 | 3 | 332 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v72A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9777 | 12 | 247 | 3.40.640.10 |
| 5vyeD02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9672 | 12 | 248 | 3.40.640.10 |
| 1v72A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9577 | 12 | 247 | 3.40.640.10 |
| 5vyeD02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9553 | 12 | 248 | 3.40.640.10 |
| af_A4HRH1_20_264_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9417 | 6 | 247 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A086PA47-F1-model_v4 | Threonine aldolase | 0.9843 | 1 | 333 |
GO:0006520
GO:0016829 |
| AF-A0A086PA47-F1-model_v4 | Threonine aldolase | 0.9814 | 1 | 333 |
GO:0006520
GO:0016829 |
| AF-A0A2D8WUS0-F1-model_v4 | Low specificity L-threonine aldolase | 0.98 | 213 | 333 |
|
| AF-A0A6L9ZIM7-F1-model_v4 | Transposase | 0.9798 | 1 | 315 |
GO:0003677
GO:0006310 GO:0006520 GO:0016829 GO:0032196 |
| AF-A0A552U825-F1-model_v4 | Low specificity L-threonine aldolase | 0.9767 | 1 | 333 |
GO:0006520
GO:0016829 |