F488730

General Info

Members Datasets Scaffolds Average Seq Length
1036 478 816 190

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0215007|Ga0496114_0215007_89_733
Length 214
Sequence MRVGGIGPQGSNNMIKRNLLVMGLAIMLSACGFQLRGTGTNELSIKEMDVSARNAYGQTVVQLRQVLEHSGVNVHAGAPYRLVLTDEQENQRAASYGGGSRTAEYELTTTLKYSILGLNNLELLNDKVEVRKIYVRDSSNITGSDQEATQARTEMRRDLVQSMVARLQVLTPTQLDELQRKADERAKAEAEALEAARRQQAETPQQSPLEIPGR

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231012 Pseudomonas sp. GM33 Isolate Nodule
6 2511231014 Pseudomonas sp. GM48 Isolate Nodule
7 2511231015 Pseudomonas sp. GM49 Isolate Nodule
8 2511231016 Pseudomonas sp. GM50 Isolate Nodule
9 2511231017 Pseudomonas sp. GM55 Isolate Nodule
10 2511231018 Pseudomonas sp. GM60 Isolate Nodule
11 2511231019 Pseudomonas sp. GM67 Isolate Nodule
12 2511231023 Pseudomonas sp. GM80 Isolate Nodule
13 2511231031 Pseudomonas sp. GM16 Isolate Nodule
14 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
15 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
16 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
17 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
18 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
19 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
20 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
21 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
22 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
23 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
24 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
25 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
26 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
27 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
28 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
29 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
30 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
31 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
32 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
33 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
34 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
35 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
36 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
37 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
38 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
39 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
40 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
41 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
42 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
43 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
44 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
45 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
46 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
47 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
48 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
49 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
50 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
51 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
52 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
53 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
54 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
55 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
56 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
57 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
58 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
59 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
60 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
61 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
62 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
63 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
64 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
65 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
66 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
67 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
68 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
69 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
70 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
71 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
72 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
73 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
74 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
75 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
76 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
77 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
78 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
79 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
80 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
81 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
82 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
83 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
84 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
85 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
86 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
87 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
88 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
89 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
90 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
91 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
92 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
93 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
94 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
95 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
96 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
97 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
98 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
99 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
100 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
101 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
102 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
103 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
104 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
105 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
106 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
107 2765235841 Pseudomonas putida AA7 Isolate Unclassified
108 2773857670 Pseudomonas sp. 478 Isolate Unclassified
109 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
110 2773857673 Pseudomonas sp. 443 Isolate Unclassified
111 2784132063 Pseudomonas sp. 424 Isolate Unclassified
112 2784132072 Pseudomonas sp. 460 Isolate Unclassified
113 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
114 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
115 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
116 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
117 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
118 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
119 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
120 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
121 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
122 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
123 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
124 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
125 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
126 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
127 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
128 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
129 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
130 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
131 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
132 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
133 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
134 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
135 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
136 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
137 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
138 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
139 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
140 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
141 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
142 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
143 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
144 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
145 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
146 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
147 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
148 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
149 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
150 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
151 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
152 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
153 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
154 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
155 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
156 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
157 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
158 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
159 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
160 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
161 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
162 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
163 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
164 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
165 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
166 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
167 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
168 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
169 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
170 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
171 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
172 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
173 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
174 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
175 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
176 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
177 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
178 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
179 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
180 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
181 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
182 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
183 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
184 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
185 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
186 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
187 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
188 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
189 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
190 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
191 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
192 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
193 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
194 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
195 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
196 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
197 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
198 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
199 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
200 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
201 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
202 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
203 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
204 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
205 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
206 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
207 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
208 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
209 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
210 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
211 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
212 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
213 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
214 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
215 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
216 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
217 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
218 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
219 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
220 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
221 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
222 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
223 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
224 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
225 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
226 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
227 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
228 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
229 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
230 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
231 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
232 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
233 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
234 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
235 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
236 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
237 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
238 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
239 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
240 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
241 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
242 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
243 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
244 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
245 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
246 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
247 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
248 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
249 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
250 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
251 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
252 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
253 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
254 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
256 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
260 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
261 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
263 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
265 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
266 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
289 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
291 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
298 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
301 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
303 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
304 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
305 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
306 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
307 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
308 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
309 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
310 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
311 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
312 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
313 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
314 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
315 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
316 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
317 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
318 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
319 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
320 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
321 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
322 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
323 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
324 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
325 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
326 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
327 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
328 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
329 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
330 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
331 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
332 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
333 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
334 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
335 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
336 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
337 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
338 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
339 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
340 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
341 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
342 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
343 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
344 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
345 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
346 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
347 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
348 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
349 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
350 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
351 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
352 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
353 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
354 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
355 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
356 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
357 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
358 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
359 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
360 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
361 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
362 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
363 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
364 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
365 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
366 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
367 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
368 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
369 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
370 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
371 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
372 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
373 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
374 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
375 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
376 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
377 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
378 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
379 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
380 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
381 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
382 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
383 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
384 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
385 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
386 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
387 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
388 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
389 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
390 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
391 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
392 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
393 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
394 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
395 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
396 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
397 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
398 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
399 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
400 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
401 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
402 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
403 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
404 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
405 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
406 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
407 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
408 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
409 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
410 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
411 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
412 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
413 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
414 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
415 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
416 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
417 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
418 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
419 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
420 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
421 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
422 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
423 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
424 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
425 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
426 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
427 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
428 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
429 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
430 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
431 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
432 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
433 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
434 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
435 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
436 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
439 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
440 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
441 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
443 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
444 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
445 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
446 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
447 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
448 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
449 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
450 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
451 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
452 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
453 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
454 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
455 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
456 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
457 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
458 8052494512 Pseudomonas putida LD6 Isolate Unclassified
459 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
460 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
461 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
462 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
463 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
464 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
465 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
466 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
467 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
468 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
469 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
470 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
471 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
472 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
473 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
474 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
475 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
476 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
477 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
478 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.76
Metatranscriptomes 0
Isolates 21.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 4.54
Nodule 1.93
Rhizoplane 6.66
Rhizosphere 73.75
Stem 0
Stem Tuber 0
Unclassified 12.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1005956 3300001915 Bacteria 2495
2 JGI25162J39368_1000136 3300002737 Bacteria 79587
3 JGI25163J39215_1001836 3300002771 Bacteria 2834
4 JGI25164J39214_1000260 3300002772 Bacteria 39803
5 JGI25165J46597_1000222 3300003214 Bacteria 79609
6 Ga0055538_1000042 3300003751 Bacteria 164754
7 Ga0055539_1000055 3300003752 Bacteria 164754
8 Ga0055533_1000067 3300003756 Bacteria 164754
9 Ga0055532_1000053 3300003758 Bacteria 164751
10 Ga0055525_1000103 3300003759 Bacteria 134778
11 Ga0055525_1005529 3300003759 Bacteria 1072
12 Ga0055536_1029692 3300003781 Bacteria 1463
13 Ga0055530_10006117 3300003791 Bacteria 5472
14 Ga0055540_1000333 3300003792 Bacteria 40988
15 Ga0055531_10001293 3300003794 Bacteria 18852
16 Ga0055541_1000042 3300003841 Bacteria 164754
17 Ga0058692_1004487 3300003856 Bacteria 4129
18 Ga0058692_1014929 3300003856 Bacteria 1764
19 Ga0065714_10000057 3300005288 Bacteria 14109
20 Ga0065714_10011777 3300005288 Bacteria 3745
21 Ga0065714_10014311 3300005288 Bacteria 3367
22 Ga0065714_10028036 3300005288 Bacteria 1856
23 Ga0065714_10050807 3300005288 Bacteria 712
24 Ga0065714_10076676 3300005288 Bacteria 2759
25 Ga0065714_10085851 3300005288 Bacteria 2126
26 Ga0065714_10085926 3300005288 Bacteria 2123
27 Ga0065714_10126949 3300005288 Bacteria 1285
28 Ga0065714_10157207 3300005288 Bacteria 1072
29 Ga0065704_10011786 3300005289 Bacteria 2306
30 Ga0065704_10075432 3300005289 Bacteria 5593
31 Ga0065712_10078530 3300005290 Bacteria 3334
32 Ga0070670_100006989 3300005331 Bacteria 9567
33 Ga0070670_100139894 3300005331 Bacteria 2093
34 Ga0070661_100000729 3300005344 Bacteria 24032
35 Ga0070668_100021167 3300005347 Bacteria 4916
36 Ga0070668_100809591 3300005347 Bacteria 833
37 Ga0070669_100000089 3300005353 Bacteria 88172
38 Ga0070659_100311601 3300005366 Bacteria 1314
39 Ga0070714_100196763 3300005435 Bacteria 1842
40 Ga0070662_100003677 3300005457 Bacteria 9588
41 Ga0070662_100029044 3300005457 Bacteria 3856
42 Ga0068853_100000273 3300005539 Bacteria 36522
43 Ga0070665_100084079 3300005548 Bacteria 3187
44 Ga0070665_100176481 3300005548 Bacteria 2137
45 Ga0070665_100370725 3300005548 Bacteria 1438
46 Ga0068857_100184282 3300005577 Bacteria 1900
47 Ga0068854_100001639 3300005578 Bacteria 13614
48 Ga0068854_101131900 3300005578 Bacteria 698
49 Ga0068851_10000002 3300005834 Bacteria 302756
50 Ga0075363_100123516 3300006048 Bacteria 1447
51 Ga0075364_10056923 3300006051 Bacteria 2560
52 Ga0075364_10254216 3300006051 Bacteria 1194
53 Ga0075364_10314272 3300006051 Bacteria 1067
54 Ga0075364_10486738 3300006051 Bacteria 843
55 Ga0075432_10002769 3300006058 Bacteria 5877
56 Ga0075432_10041291 3300006058 Bacteria 1611
57 Ga0075432_10075276 3300006058 Bacteria 1217
58 Ga0075432_10098177 3300006058 Bacteria 1080
59 Ga0075432_10159422 3300006058 Bacteria 872
60 Ga0075432_10160167 3300006058 Bacteria 870
61 Ga0075362_10032511 3300006177 Bacteria 2264
62 Ga0075362_10271585 3300006177 Bacteria 837
63 Ga0075362_10402458 3300006177 Bacteria 690
64 Ga0075369_10195405 3300006186 Bacteria 933
65 Ga0075369_10234990 3300006186 Bacteria 850
66 Ga0075436_100171150 3300006914 Bacteria 1534
67 Ga0099823_1003349 3300006944 Bacteria 15132
68 Ga0079104_1000116 3300006946 Bacteria 114868
69 Ga0079104_1000715 3300006946 Bacteria 30029
70 Ga0099826_10081895 3300006948 Bacteria 2007
71 Ga0105251_10002219 3300009011 Bacteria 15495
72 Ga0105251_10003363 3300009011 Bacteria 11645
73 Ga0105251_10006439 3300009011 Bacteria 7476
74 Ga0105251_10007315 3300009011 Bacteria 6833
75 Ga0105251_10008296 3300009011 Bacteria 6276
76 Ga0105251_10019109 3300009011 Bacteria 3627
77 Ga0105251_10032485 3300009011 Bacteria 2600
78 Ga0105251_10073401 3300009011 Bacteria 1590
79 Ga0105251_10078169 3300009011 Bacteria 1533
80 Ga0105251_10093625 3300009011 Bacteria 1378
81 Ga0105251_10156874 3300009011 Bacteria 1026
82 Ga0105251_10338732 3300009011 Bacteria 685
83 Ga0105244_10008454 3300009036 Bacteria 6426
84 Ga0105244_10011056 3300009036 Bacteria 5437
85 Ga0105244_10015270 3300009036 Bacteria 4408
86 Ga0105244_10015328 3300009036 Bacteria 4398
87 Ga0105244_10015849 3300009036 Bacteria 4310
88 Ga0105244_10016794 3300009036 Bacteria 4158
89 Ga0105244_10018975 3300009036 Bacteria 3849
90 Ga0105244_10020043 3300009036 Bacteria 3718
91 Ga0105244_10040241 3300009036 Bacteria 2428
92 Ga0105244_10043230 3300009036 Bacteria 2326
93 Ga0105244_10043913 3300009036 Bacteria 2304
94 Ga0105244_10056060 3300009036 Bacteria 1996
95 Ga0105244_10061816 3300009036 Bacteria 1884
96 Ga0105244_10085375 3300009036 Bacteria 1557
97 Ga0105244_10144188 3300009036 Bacteria 1144
98 Ga0105244_10144189 3300009036 Bacteria 1144
99 Ga0105244_10310446 3300009036 Bacteria 729
100 Ga0105250_10000657 3300009092 Bacteria 21923
101 Ga0105250_10003615 3300009092 Bacteria 7281
102 Ga0105250_10005253 3300009092 Bacteria 5826
103 Ga0105250_10009255 3300009092 Bacteria 4153
104 Ga0105250_10015090 3300009092 Bacteria 3165
105 Ga0105250_10042387 3300009092 Bacteria 1824
106 Ga0105250_10141319 3300009092 Bacteria 998
107 Ga0105243_10007328 3300009148 Bacteria 8482
108 Ga0105243_10044419 3300009148 Bacteria 3486
109 Ga0105243_10108019 3300009148 Bacteria 2322
110 Ga0105243_10149569 3300009148 Bacteria 2002
111 Ga0105242_10000442 3300009176 Bacteria 32971
112 Ga0105248_10677641 3300009177 Bacteria 1163
113 Ga0105237_10001850 3300009545 Bacteria 27191
114 Ga0105246_10000426 3300011119 Bacteria 22450
115 Ga0105246_10000905 3300011119 Bacteria 17012
116 Ga0105246_10414105 3300011119 Bacteria 1123
117 Ga0157345_1000245 3300012498 Bacteria 7749
118 Ga0157347_1004381 3300012502 Bacteria 1308
119 Ga0157373_10006730 3300013100 Bacteria 8558
120 Ga0157373_10026471 3300013100 Bacteria 4189
121 Ga0157373_10063490 3300013100 Bacteria 2615
122 Ga0157373_10081423 3300013100 Bacteria 2282
123 Ga0157373_10100994 3300013100 Bacteria 2030
124 Ga0157373_10104375 3300013100 Bacteria 1993
125 Ga0157373_10163442 3300013100 Bacteria 1566
126 Ga0157373_10796822 3300013100 Bacteria 697
127 Ga0157371_10014654 3300013102 Bacteria 5904
128 Ga0157371_10049578 3300013102 Bacteria 2982
129 Ga0157371_10051458 3300013102 Bacteria 2927
130 Ga0157371_10114379 3300013102 Bacteria 1916
131 Ga0157371_10129258 3300013102 Bacteria 1797
132 Ga0157371_10212719 3300013102 Bacteria 1388
133 Ga0157370_10000760 3300013104 Bacteria 40285
134 Ga0157370_10060352 3300013104 Bacteria 3601
135 Ga0157370_10086219 3300013104 Bacteria 2950
136 Ga0157370_10145793 3300013104 Bacteria 2205
137 Ga0157370_10188217 3300013104 Bacteria 1916
138 Ga0157370_10285428 3300013104 Bacteria 1525
139 Ga0157370_10474759 3300013104 Bacteria 1149
140 Ga0157369_10021803 3300013105 Bacteria 7164
141 Ga0157369_10033495 3300013105 Bacteria 5645
142 Ga0157369_10063256 3300013105 Bacteria 3987
143 Ga0157369_10094938 3300013105 Bacteria 3183
144 Ga0157369_11199874 3300013105 Bacteria 774
145 Ga0163162_10016996 3300013306 Bacteria 7117
146 Ga0163162_10207248 3300013306 Bacteria 2090
147 Ga0163162_10215785 3300013306 Bacteria 2049
148 Ga0163162_11709151 3300013306 Bacteria 719
149 Ga0157372_10001236 3300013307 Bacteria 27666
150 Ga0157372_10033539 3300013307 Bacteria 5640
151 Ga0157375_10104773 3300013308 Bacteria 2918
152 Ga0157375_10124546 3300013308 Bacteria 2691
153 Ga0157375_10174804 3300013308 Bacteria 2296
154 Ga0157375_10300855 3300013308 Bacteria 1768
155 Ga0182008_10035688 3300014497 Bacteria 2489
156 Ga0182008_10035940 3300014497 Bacteria 2480
157 Ga0182008_10202343 3300014497 Bacteria 1011
158 Ga0182006_1003033 3300015261 Bacteria 8828
159 Ga0182006_1004123 3300015261 Bacteria 7223
160 Ga0182006_1010996 3300015261 Bacteria 3997
161 Ga0182006_1015400 3300015261 Bacteria 3278
162 Ga0182006_1017143 3300015261 Bacteria 3082
163 Ga0182006_1077570 3300015261 Bacteria 1218
164 Ga0182006_1186482 3300015261 Bacteria 690
165 Ga0182005_1020043 3300015265 Bacteria 1842
166 Ga0163161_10008767 3300017792 Bacteria 6991
167 Ga0163161_10063169 3300017792 Bacteria 2699
168 Ga0163161_10098585 3300017792 Bacteria 2172
169 Ga0163161_10241672 3300017792 Bacteria 1404
170 Ga0163161_10360158 3300017792 Bacteria 1158
171 Ga0163161_10511048 3300017792 Bacteria 980
172 Ga0209435_104061 3300025206 Bacteria 1662
173 Ga0209760_100058 3300025207 Bacteria 98827
174 Ga0209784_100060 3300025224 Bacteria 164838
175 Ga0209566_100075 3300025225 Bacteria 164838
176 Ga0209674_100100 3300025226 Bacteria 164838
177 Ga0209147_100096 3300025229 Bacteria 164838
178 Ga0209563_100118 3300025230 Bacteria 131627
179 Ga0209563_100190 3300025230 Bacteria 34921
180 Ga0207427_100063 3300025231 Bacteria 177711
181 Ga0209437_100133 3300025233 Bacteria 178493
182 Ga0209437_101986 3300025233 Bacteria 4220
183 Ga0209258_100221 3300025242 Bacteria 108497
184 Ga0209646_1000474 3300025246 Bacteria 20163
185 Ga0209677_100057 3300025253 Bacteria 164838
186 Ga0209759_1002980 3300025256 Bacteria 7030
187 Ga0209233_1000133 3300025261 Bacteria 202716
188 Ga0209676_1000264 3300025292 Bacteria 110593
189 Ga0209676_1000952 3300025292 Bacteria 35453
190 Ga0209676_1003131 3300025292 Bacteria 10579
191 Ga0209050_1002243 3300025298 Bacteria 17249
192 Ga0209051_1020533 3300025303 Bacteria 2840
193 Ga0207656_10000010 3300025321 Bacteria 192224
194 Ga0207696_1000047 3300025711 Bacteria 285005
195 Ga0207696_1000065 3300025711 Bacteria 231818
196 Ga0207696_1000126 3300025711 Bacteria 136197
197 Ga0207696_1005188 3300025711 Bacteria 5454
198 Ga0207696_1014911 3300025711 Bacteria 2648
199 Ga0207696_1027576 3300025711 Bacteria 1749
200 Ga0207655_1000120 3300025728 Bacteria 157018
201 Ga0207655_1000213 3300025728 Bacteria 101587
202 Ga0207655_1000214 3300025728 Bacteria 101123
203 Ga0207655_1001105 3300025728 Bacteria 26398
204 Ga0207655_1001958 3300025728 Bacteria 17595
205 Ga0207655_1006009 3300025728 Bacteria 8121
206 Ga0207655_1007585 3300025728 Bacteria 7019
207 Ga0207655_1012701 3300025728 Bacteria 4897
208 Ga0207655_1014515 3300025728 Bacteria 4446
209 Ga0207655_1016267 3300025728 Bacteria 4080
210 Ga0207655_1019894 3300025728 Bacteria 3480
211 Ga0207655_1029072 3300025728 Bacteria 2595
212 Ga0207655_1030921 3300025728 Bacteria 2479
213 Ga0207655_1046959 3300025728 Bacteria 1787
214 Ga0207655_1050213 3300025728 Bacteria 1697
215 Ga0207655_1087807 3300025728 Bacteria 1102
216 Ga0207713_1000337 3300025735 Bacteria 52167
217 Ga0207713_1000467 3300025735 Bacteria 42199
218 Ga0207713_1000862 3300025735 Bacteria 27758
219 Ga0207713_1002385 3300025735 Bacteria 13726
220 Ga0207713_1003914 3300025735 Bacteria 9909
221 Ga0207713_1005481 3300025735 Bacteria 7924
222 Ga0207713_1007268 3300025735 Bacteria 6570
223 Ga0207713_1010259 3300025735 Bacteria 5198
224 Ga0207713_1018734 3300025735 Bacteria 3416
225 Ga0207713_1024648 3300025735 Bacteria 2800
226 Ga0207713_1025957 3300025735 Bacteria 2694
227 Ga0207713_1028433 3300025735 Bacteria 2521
228 Ga0207713_1055298 3300025735 Bacteria 1550
229 Ga0207671_10000373 3300025914 Bacteria 63578
230 Ga0207649_10000126 3300025920 Bacteria 64678
231 Ga0207681_10000148 3300025923 Bacteria 58793
232 Ga0207650_10000231 3300025925 Bacteria 62555
233 Ga0207650_10000533 3300025925 Bacteria 31139
234 Ga0207664_10199118 3300025929 Bacteria 1728
235 Ga0207690_10267877 3300025932 Bacteria 1326
236 Ga0207706_10000871 3300025933 Bacteria 31040
237 Ga0207706_10008497 3300025933 Bacteria 9470
238 Ga0207686_10000466 3300025934 Bacteria 26824
239 Ga0207709_10006228 3300025935 Bacteria 6708
240 Ga0207709_10034802 3300025935 Bacteria 2972
241 Ga0207711_10728876 3300025941 Bacteria 924
242 Ga0207679_10000017 3300025945 Bacteria 253004
243 Ga0207668_10646386 3300025972 Bacteria 925
244 Ga0207640_10312254 3300025981 Bacteria 1248
245 Ga0207640_11096908 3300025981 Bacteria 704
246 Ga0207639_10001169 3300026041 Bacteria 17810
247 Ga0207674_10191000 3300026116 Bacteria 1998
248 Ga0209281_1000070 3300027111 Bacteria 277098
249 Ga0209281_1000127 3300027111 Bacteria 200036
250 Ga0209281_1005963 3300027111 Bacteria 3256
251 Ga0209973_1011128 3300027252 Bacteria 1074
252 Ga0209389_1000171 3300027296 Bacteria 52288
253 Ga0209389_1123990 3300027296 Bacteria 686
254 Ga0209371_1000165 3300027312 Bacteria 100598
255 Ga0209371_1001483 3300027312 Bacteria 15673
256 Ga0209371_1026386 3300027312 Bacteria 1323
257 Ga0209984_1002907 3300027424 Bacteria 1937
258 Ga0209995_1009447 3300027471 Bacteria 1577
259 Ga0209968_1008357 3300027526 Bacteria 1577
260 Ga0209982_1010538 3300027552 Bacteria 1370
261 Ga0209970_1002457 3300027614 Bacteria 3151
262 Ga0209983_1001998 3300027665 Bacteria 4516
263 Ga0209971_1000210 3300027682 Bacteria 17374
264 Ga0209974_10005587 3300027876 Bacteria 4415
265 Ga0207428_10003468 3300027907 Bacteria 15304
266 Ga0207428_10175745 3300027907 Bacteria 1620
267 Ga0207428_10275253 3300027907 Bacteria 1251
268 Ga0207428_10413492 3300027907 Bacteria 987
269 Ga0268266_10020462 3300028379 Bacteria 5639
270 Ga0268266_10109476 3300028379 Bacteria 2446
271 Ga0307517_10139983 3300028786 Bacteria 1703
272 Ga0268256_1000112 3300030500 Bacteria 118510
273 Ga0268256_1001272 3300030500 Bacteria 15660
274 Ga0268256_1029794 3300030500 Bacteria 1331
275 Ga0316177_1064906 3300030731 Bacteria 2233
276 Ga0316179_1060254 3300030734 Bacteria 1998
277 Ga0316178_1105767 3300030735 Bacteria 15950
278 Ga0265316_10148327 3300031344 Bacteria 1758
279 Ga0307509_10134890 3300031507 Bacteria 2416
280 Ga0307408_100000013 3300031548 Bacteria 386212
281 Ga0307408_100009242 3300031548 Bacteria 6496
282 Ga0307408_100245490 3300031548 Bacteria 1474
283 Ga0307516_10132262 3300031730 Bacteria 2273
284 Ga0307516_10367935 3300031730 Bacteria 1101
285 Ga0307405_10046929 3300031731 Bacteria 2657
286 Ga0307405_10527268 3300031731 Bacteria 951
287 Ga0307413_10086377 3300031824 Bacteria 2028
288 Ga0307406_10289134 3300031901 Bacteria 1254
289 Ga0307412_10070445 3300031911 Bacteria 2383
290 Ga0307412_10514898 3300031911 Bacteria 998
291 Ga0307412_10641727 3300031911 Bacteria 904
292 Ga0307409_100024641 3300031995 Bacteria 4201
293 Ga0307414_10120429 3300032004 Bacteria 2016
294 Ga0307414_10515446 3300032004 Bacteria 1060
295 Ga0307414_10606076 3300032004 Bacteria 982
296 Ga0307411_10248303 3300032005 Bacteria 1397
297 Ga0307510_10024652 3300033180 Bacteria 6947
298 Ga0439438_001711 3300041405 Bacteria 9656
299 Ga0439438_003638 3300041405 Bacteria 6169
300 Ga0439438_010881 3300041405 Bacteria 2857
301 Ga0439447_001783 3300041407 Bacteria 7892
302 Ga0439447_043607 3300041407 Bacteria 1086
303 Ga0439466_0009211 3300041411 Bacteria 3697
304 Ga0439466_0045262 3300041411 Bacteria 1455
305 Ga0439465_0081785 3300041413 Bacteria 1096
306 Ga0451833_0077913 3300041491 Bacteria 720
307 Ga0439432_001628 3300042006 Bacteria 8400
308 Ga0439432_004605 3300042006 Bacteria 5023
309 Ga0439432_018955 3300042006 Bacteria 2295
310 Ga0439432_027671 3300042006 Bacteria 1849
311 Ga0439451_020165 3300042009 Bacteria 1343
312 Ga0439452_001222 3300042010 Bacteria 10954
313 Ga0439452_002111 3300042010 Bacteria 7532
314 Ga0439452_003631 3300042010 Bacteria 5357
315 Ga0439452_045490 3300042010 Bacteria 1021
316 Ga0439452_049877 3300042010 Bacteria 962
317 Ga0439456_000141 3300042013 Bacteria 21861
318 Ga0439456_001028 3300042013 Bacteria 5536
319 Ga0439456_005505 3300042013 Bacteria 2571
320 Ga0439456_040907 3300042013 Bacteria 1004
321 Ga0439463_009304 3300042016 Bacteria 2416
322 Ga0439463_014348 3300042016 Bacteria 1952
323 Ga0450911_000626 3300042115 Bacteria 10757
324 Ga0450900_002075 3300042136 Bacteria 2076
325 Ga0450902_001240 3300042137 Bacteria 3436
326 Ga0450902_040737 3300042137 Bacteria 790
327 Ga0450903_000818 3300042138 Bacteria 6054
328 Ga0450905_001383 3300042142 Bacteria 3086
329 Ga0450905_004204 3300042142 Bacteria 1901
330 Ga0450905_018580 3300042142 Bacteria 1013
331 Ga0450906_006391 3300042145 Bacteria 2381
332 Ga0450907_000807 3300042146 Bacteria 7771
333 Ga0439446_0005041 3300042156 Bacteria 3379
334 Ga0450908_022141 3300042184 Bacteria 1114
335 Ga0450908_054054 3300042184 Bacteria 700
336 Ga0450909_006414 3300042185 Bacteria 1696
337 Ga0439434_0009435 3300042435 Bacteria 2869
338 Ga0439464_0006161 3300042439 Bacteria 3118
339 Ga0439464_0009552 3300042439 Bacteria 2555
340 Ga0439464_0031553 3300042439 Bacteria 1487
341 Ga0439460_0001759 3300042461 Bacteria 5142
342 Ga0439460_0001856 3300042461 Bacteria 5037
343 Ga0450918_021865 3300042531 Bacteria 1117
344 Ga0450901_000913 3300042533 Bacteria 3453
345 Ga0439440_0004014 3300042993 Bacteria 2875
346 Ga0439440_0038520 3300042993 Bacteria 1157
347 Ga0495617_003644 3300046452 Bacteria 5744
348 Ga0495617_003991 3300046452 Bacteria 5425
349 Ga0495617_008283 3300046452 Bacteria 3587
350 Ga0495617_013402 3300046452 Bacteria 2789
351 Ga0495617_127031 3300046452 Bacteria 819
352 Ga0495627_003011 3300046453 Bacteria 7703
353 Ga0495627_003628 3300046453 Bacteria 6706
354 Ga0495627_008018 3300046453 Bacteria 3989
355 Ga0495627_009630 3300046453 Bacteria 3546
356 Ga0495627_053274 3300046453 Bacteria 1211
357 Ga0495627_053563 3300046453 Bacteria 1207
358 Ga0495627_118335 3300046453 Bacteria 749
359 Ga0495603_0071885 3300046455 Bacteria 2032
360 Ga0495603_0088904 3300046455 Bacteria 1807
361 Ga0495603_0143359 3300046455 Bacteria 1389
362 Ga0495590_0002865 3300046457 Bacteria 7106
363 Ga0495590_0004461 3300046457 Bacteria 5645
364 Ga0495590_0012460 3300046457 Bacteria 3154
365 Ga0495590_0021266 3300046457 Bacteria 2300
366 Ga0495590_0098055 3300046457 Bacteria 1040
367 Ga0495591_004426 3300046458 Bacteria 6891
368 Ga0495591_004712 3300046458 Bacteria 6544
369 Ga0495591_005183 3300046458 Bacteria 6106
370 Ga0495591_006333 3300046458 Bacteria 5255
371 Ga0495591_015809 3300046458 Bacteria 2652
372 Ga0495591_031391 3300046458 Bacteria 1594
373 Ga0495591_049581 3300046458 Bacteria 1153
374 Ga0495591_057186 3300046458 Bacteria 1046
375 Ga0495591_058758 3300046458 Bacteria 1027
376 Ga0495629_0105743 3300046459 Bacteria 1963
377 Ga0495638_0008389 3300046460 Bacteria 7328
378 Ga0495638_0031999 3300046460 Bacteria 3375
379 Ga0495638_0034166 3300046460 Bacteria 3247
380 Ga0495638_0067027 3300046460 Bacteria 2204
381 Ga0495638_0118331 3300046460 Bacteria 1567
382 Ga0495653_0010010 3300046463 Bacteria 7756
383 Ga0495653_0019558 3300046463 Bacteria 5490
384 Ga0495653_0037066 3300046463 Bacteria 3835
385 Ga0495653_0043141 3300046463 Bacteria 3508
386 Ga0495653_0053916 3300046463 Bacteria 3074
387 Ga0495653_0058911 3300046463 Bacteria 2917
388 Ga0495650_0010192 3300046471 Bacteria 5263
389 Ga0495650_0010851 3300046471 Bacteria 5049
390 Ga0495650_0035072 3300046471 Bacteria 2212
391 Ga0495650_0040038 3300046471 Bacteria 2016
392 Ga0495650_0043917 3300046471 Bacteria 1892
393 Ga0495582_0076397 3300046473 Bacteria 1856
394 Ga0495605_0000033 3300046474 Bacteria 209203
395 Ga0495605_0011685 3300046474 Bacteria 4886
396 Ga0495605_0084926 3300046474 Bacteria 1475
397 Ga0495605_0087389 3300046474 Bacteria 1449
398 Ga0495605_0120187 3300046474 Bacteria 1191
399 Ga0495605_0123136 3300046474 Bacteria 1174
400 Ga0495639_0034567 3300046475 Bacteria 2261
401 Ga0495639_0209372 3300046475 Bacteria 956
402 Ga0495584_0008296 3300046491 Bacteria 5381
403 Ga0495584_0014578 3300046491 Bacteria 4006
404 Ga0495584_0014713 3300046491 Bacteria 3986
405 Ga0495584_0028553 3300046491 Bacteria 2827
406 Ga0495584_0053665 3300046491 Bacteria 2028
407 Ga0495584_0147631 3300046491 Bacteria 1194
408 Ga0495585_0006203 3300046492 Bacteria 7450
409 Ga0495585_0007570 3300046492 Bacteria 6638
410 Ga0495585_0007586 3300046492 Bacteria 6629
411 Ga0495585_0010340 3300046492 Bacteria 5562
412 Ga0495585_0013372 3300046492 Bacteria 4807
413 Ga0495585_0041784 3300046492 Bacteria 2571
414 Ga0495585_0097266 3300046492 Bacteria 1579
415 Ga0495585_0124591 3300046492 Bacteria 1360
416 Ga0495585_0130714 3300046492 Bacteria 1321
417 Ga0495585_0167840 3300046492 Bacteria 1135
418 Ga0495594_0001513 3300046499 Bacteria 12065
419 Ga0495594_0003974 3300046499 Bacteria 7606
420 Ga0495594_0141206 3300046499 Bacteria 1366
421 Ga0495596_0006708 3300046500 Bacteria 5267
422 Ga0495607_0000385 3300046501 Bacteria 45205
423 Ga0495607_0007652 3300046501 Bacteria 7443
424 Ga0495607_0008058 3300046501 Bacteria 7233
425 Ga0495607_0009852 3300046501 Bacteria 6445
426 Ga0495607_0010904 3300046501 Bacteria 6082
427 Ga0495607_0015441 3300046501 Bacteria 4950
428 Ga0495607_0020124 3300046501 Bacteria 4224
429 Ga0495607_0025262 3300046501 Bacteria 3697
430 Ga0495607_0031484 3300046501 Bacteria 3247
431 Ga0495607_0034291 3300046501 Bacteria 3080
432 Ga0495607_0069590 3300046501 Bacteria 1969
433 Ga0495607_0070533 3300046501 Bacteria 1952
434 Ga0495607_0194668 3300046501 Bacteria 1007
435 Ga0495583_0000031 3300046506 Bacteria 253982
436 Ga0495583_0007457 3300046506 Bacteria 6865
437 Ga0495583_0009172 3300046506 Bacteria 5942
438 Ga0495583_0029423 3300046506 Bacteria 2687
439 Ga0495606_0001283 3300046507 Bacteria 34807
440 Ga0495606_0011142 3300046507 Bacteria 7366
441 Ga0495606_0014345 3300046507 Bacteria 6193
442 Ga0495606_0038244 3300046507 Bacteria 3248
443 Ga0495606_0059260 3300046507 Bacteria 2456
444 Ga0495606_0080882 3300046507 Bacteria 2020
445 Ga0495606_0125346 3300046507 Bacteria 1532
446 Ga0495606_0283963 3300046507 Bacteria 903
447 Ga0495610_0006505 3300046512 Bacteria 8019
448 Ga0495610_0011678 3300046512 Bacteria 5344
449 Ga0495610_0013781 3300046512 Bacteria 4783
450 Ga0495610_0025415 3300046512 Bacteria 3178
451 Ga0495610_0041293 3300046512 Bacteria 2317
452 Ga0495610_0064910 3300046512 Bacteria 1724
453 Ga0495610_0153135 3300046512 Bacteria 981
454 Ga0495610_0155711 3300046512 Bacteria 970
455 Ga0495610_0239711 3300046512 Bacteria 723
456 Ga0495616_0008266 3300046513 Bacteria 6176
457 Ga0495616_0008271 3300046513 Bacteria 6175
458 Ga0495616_0008309 3300046513 Bacteria 6158
459 Ga0495616_0009208 3300046513 Bacteria 5791
460 Ga0495616_0009984 3300046513 Bacteria 5518
461 Ga0495616_0010112 3300046513 Bacteria 5474
462 Ga0495616_0027671 3300046513 Bacteria 3006
463 Ga0495616_0027984 3300046513 Bacteria 2987
464 Ga0495616_0102324 3300046513 Bacteria 1342
465 Ga0495620_0000007 3300046515 Bacteria 191058
466 Ga0495620_0000038 3300046515 Bacteria 114064
467 Ga0495620_0004557 3300046515 Bacteria 7800
468 Ga0495620_0005192 3300046515 Bacteria 7286
469 Ga0495620_0008729 3300046515 Bacteria 5426
470 Ga0495620_0060703 3300046515 Bacteria 1575
471 Ga0495620_0063342 3300046515 Bacteria 1533
472 Ga0495630_0043652 3300046517 Bacteria 3350
473 Ga0495630_0269343 3300046517 Bacteria 1301
474 Ga0495631_0004412 3300046518 Bacteria 7496
475 Ga0495631_0004485 3300046518 Bacteria 7424
476 Ga0495631_0005548 3300046518 Bacteria 6596
477 Ga0495631_0008300 3300046518 Bacteria 5236
478 Ga0495631_0037107 3300046518 Bacteria 2172
479 Ga0495632_0006780 3300046519 Bacteria 7314
480 Ga0495632_0008764 3300046519 Bacteria 6165
481 Ga0495632_0009603 3300046519 Bacteria 5814
482 Ga0495632_0010132 3300046519 Bacteria 5610
483 Ga0495632_0010712 3300046519 Bacteria 5404
484 Ga0495632_0011002 3300046519 Bacteria 5306
485 Ga0495632_0022838 3300046519 Bacteria 3348
486 Ga0495632_0032902 3300046519 Bacteria 2667
487 Ga0495632_0044498 3300046519 Bacteria 2215
488 Ga0495632_0050339 3300046519 Bacteria 2054
489 Ga0495632_0171011 3300046519 Bacteria 998
490 Ga0495637_0005906 3300046520 Bacteria 6188
491 Ga0495637_0005983 3300046520 Bacteria 6150
492 Ga0495637_0006324 3300046520 Bacteria 5953
493 Ga0495637_0008245 3300046520 Bacteria 5123
494 Ga0495637_0008851 3300046520 Bacteria 4928
495 Ga0495637_0016040 3300046520 Bacteria 3507
496 Ga0495637_0034590 3300046520 Bacteria 2211
497 Ga0495637_0043836 3300046520 Bacteria 1907
498 Ga0495637_0046050 3300046520 Bacteria 1846
499 Ga0495637_0049795 3300046520 Bacteria 1758
500 Ga0495637_0055588 3300046520 Bacteria 1641
501 Ga0495637_0072594 3300046520 Bacteria 1385
502 Ga0495637_0094202 3300046520 Bacteria 1177
503 Ga0495643_0002175 3300046522 Bacteria 16050
504 Ga0495643_0007114 3300046522 Bacteria 7260
505 Ga0495643_0008648 3300046522 Bacteria 6424
506 Ga0495643_0254413 3300046522 Bacteria 818
507 Ga0495644_0003628 3300046523 Bacteria 6081
508 Ga0495644_0004178 3300046523 Bacteria 5679
509 Ga0495644_0006094 3300046523 Bacteria 4687
510 Ga0495644_0042657 3300046523 Bacteria 1708
511 Ga0495644_0226715 3300046523 Bacteria 723
512 Ga0495648_0011446 3300046524 Bacteria 6680
513 Ga0495648_0011954 3300046524 Bacteria 6508
514 Ga0495648_0012362 3300046524 Bacteria 6376
515 Ga0495648_0016858 3300046524 Bacteria 5250
516 Ga0495648_0029795 3300046524 Bacteria 3616
517 Ga0495648_0084162 3300046524 Bacteria 1800
518 Ga0495648_0102488 3300046524 Bacteria 1576
519 Ga0495648_0150311 3300046524 Bacteria 1215
520 Ga0495648_0189847 3300046524 Bacteria 1037
521 Ga0495648_0195072 3300046524 Bacteria 1018
522 Ga0495666_0008217 3300046526 Bacteria 5231
523 Ga0495666_0038199 3300046526 Bacteria 2335
524 Ga0495666_0053624 3300046526 Bacteria 1935
525 Ga0495666_0208210 3300046526 Bacteria 897
526 Ga0495642_0002477 3300046528 Bacteria 7509
527 Ga0495642_0002716 3300046528 Bacteria 7103
528 Ga0495654_0002905 3300046530 Bacteria 10740
529 Ga0495654_0010726 3300046530 Bacteria 4976
530 Ga0495654_0013021 3300046530 Bacteria 4456
531 Ga0495654_0014667 3300046530 Bacteria 4167
532 Ga0495654_0028574 3300046530 Bacteria 2850
533 Ga0495654_0030153 3300046530 Bacteria 2761
534 Ga0495654_0033989 3300046530 Bacteria 2576
535 Ga0495654_0034875 3300046530 Bacteria 2536
536 Ga0495654_0054846 3300046530 Bacteria 1931
537 Ga0495654_0063934 3300046530 Bacteria 1760
538 Ga0495654_0112389 3300046530 Bacteria 1241
539 Ga0495654_0170134 3300046530 Bacteria 950
540 Ga0495654_0226347 3300046530 Bacteria 788
541 Ga0495586_0040618 3300046535 Bacteria 2504
542 Ga0495587_0010419 3300046536 Bacteria 5918
543 Ga0495587_0028418 3300046536 Bacteria 3400
544 Ga0495587_0184353 3300046536 Bacteria 1182
545 Ga0495609_0000018 3300046538 Bacteria 302609
546 Ga0495609_0005137 3300046538 Bacteria 6969
547 Ga0495609_0042659 3300046538 Bacteria 2037
548 Ga0495609_0054744 3300046538 Bacteria 1771
549 Ga0495609_0129645 3300046538 Bacteria 1080
550 Ga0495609_0216889 3300046538 Bacteria 795
551 Ga0495609_0241447 3300046538 Bacteria 745
552 Ga0495597_0005264 3300046542 Bacteria 6874
553 Ga0495597_0006864 3300046542 Bacteria 5847
554 Ga0495597_0022781 3300046542 Bacteria 2902
555 Ga0495597_0022952 3300046542 Bacteria 2890
556 Ga0495597_0027235 3300046542 Bacteria 2621
557 Ga0495597_0060028 3300046542 Bacteria 1659
558 Ga0495645_0203534 3300046543 Bacteria 1341
559 Ga0495645_0231697 3300046543 Bacteria 1237
560 Ga0495622_0004180 3300046557 Bacteria 6733
561 Ga0495622_0019197 3300046557 Bacteria 3183
562 Ga0495622_0064608 3300046557 Bacteria 1692
563 Ga0495622_0202812 3300046557 Bacteria 883
564 Ga0495633_0000062 3300046558 Bacteria 142101
565 Ga0495633_0006688 3300046558 Bacteria 6787
566 Ga0495633_0007413 3300046558 Bacteria 6314
567 Ga0495656_0098530 3300046615 Bacteria 1348
568 Ga0495656_0426676 3300046615 Bacteria 696
569 Ga0495668_0010011 3300046616 Bacteria 5773
570 Ga0495668_0011106 3300046616 Bacteria 5411
571 Ga0495668_0063756 3300046616 Bacteria 2029
572 Ga0495668_0100370 3300046616 Bacteria 1583
573 Ga0495668_0638188 3300046616 Bacteria 588
574 Ga0495634_0013020 3300046642 Bacteria 6017
575 Ga0495611_0002858 3300046648 Bacteria 7707
576 Ga0495611_0014381 3300046648 Bacteria 3380
577 Ga0495625_0013827 3300046660 Bacteria 6466
578 Ga0495625_0015355 3300046660 Bacteria 6068
579 Ga0495625_0087729 3300046660 Bacteria 2156
580 Ga0495625_0109203 3300046660 Bacteria 1892
581 Ga0495625_0127497 3300046660 Bacteria 1726
582 Ga0495625_0208003 3300046660 Bacteria 1287
583 Ga0495625_0257171 3300046660 Bacteria 1131
584 Ga0495625_0307024 3300046660 Bacteria 1013
585 Ga0495635_0012587 3300046663 Bacteria 5931
586 Ga0495635_0013095 3300046663 Bacteria 5805
587 Ga0495659_0040344 3300046664 Bacteria 1663
588 Ga0495661_0000016 3300046665 Bacteria 213593
589 Ga0495661_0000093 3300046665 Bacteria 109808
590 Ga0495661_0023098 3300046665 Bacteria 4040
591 Ga0495661_0032592 3300046665 Bacteria 3292
592 Ga0495661_0055487 3300046665 Bacteria 2374
593 Ga0495661_0061644 3300046665 Bacteria 2226
594 Ga0495661_0068289 3300046665 Bacteria 2085
595 Ga0495661_0082298 3300046665 Bacteria 1853
596 Ga0495661_0083912 3300046665 Bacteria 1830
597 Ga0495661_0123330 3300046665 Bacteria 1428
598 Ga0495661_0284994 3300046665 Bacteria 831
599 Ga0495588_0290471 3300046674 Bacteria 861
600 Ga0495657_0295161 3300046675 Bacteria 967
601 Ga0495623_0061648 3300046679 Bacteria 2351
602 Ga0495623_0138736 3300046679 Bacteria 1448
603 Ga0495646_0056606 3300046680 Bacteria 2350
604 Ga0495646_0085811 3300046680 Bacteria 1826
605 Ga0495646_0139873 3300046680 Bacteria 1354
606 Ga0495613_0010347 3300046689 Bacteria 6929
607 Ga0495624_0033930 3300046690 Bacteria 3304
608 Ga0495670_0004314 3300046691 Bacteria 6968
609 Ga0495670_0008963 3300046691 Bacteria 4921
610 Ga0495670_0010614 3300046691 Bacteria 4525
611 Ga0495670_0010693 3300046691 Bacteria 4511
612 Ga0495670_0024970 3300046691 Bacteria 2955
613 Ga0495670_0199100 3300046691 Bacteria 1060
614 Ga0495671_0008862 3300046692 Bacteria 5650
615 Ga0495671_0010374 3300046692 Bacteria 5163
616 Ga0495671_0018467 3300046692 Bacteria 3700
617 Ga0495671_0027184 3300046692 Bacteria 2956
618 Ga0495671_0062293 3300046692 Bacteria 1838
619 Ga0495671_0105874 3300046692 Bacteria 1373
620 Ga0495671_0126406 3300046692 Bacteria 1246
621 Ga0495671_0261088 3300046692 Bacteria 835
622 Ga0495649_0008240 3300046694 Bacteria 6278
623 Ga0495649_0076667 3300046694 Bacteria 1789
624 Ga0495649_0101657 3300046694 Bacteria 1527
625 Ga0495649_0129371 3300046694 Bacteria 1332
626 Ga0495649_0132531 3300046694 Bacteria 1315
627 Ga0495649_0152396 3300046694 Bacteria 1214
628 Ga0495649_0245143 3300046694 Bacteria 921
629 Ga0495649_0337284 3300046694 Bacteria 763
630 Ga0495589_0004928 3300046794 Bacteria 7076
631 Ga0495589_0008017 3300046794 Bacteria 5525
632 Ga0495589_0010829 3300046794 Bacteria 4739
633 Ga0495589_0036261 3300046794 Bacteria 2472
634 Ga0495589_0048472 3300046794 Bacteria 2103
635 Ga0495589_0267021 3300046794 Bacteria 797
636 Ga0495600_0020779 3300046809 Bacteria 4200
637 Ga0495600_0111813 3300046809 Bacteria 1778
638 Ga0495600_0210955 3300046809 Bacteria 1244
639 Ga0495660_0006928 3300046810 Bacteria 6676
640 Ga0495660_0007457 3300046810 Bacteria 6419
641 Ga0495660_0007942 3300046810 Bacteria 6232
642 Ga0495660_0010368 3300046810 Bacteria 5420
643 Ga0495660_0032967 3300046810 Bacteria 2907
644 Ga0495660_0054374 3300046810 Bacteria 2169
645 Ga0495660_0060007 3300046810 Bacteria 2044
646 Ga0495660_0063936 3300046810 Bacteria 1968
647 Ga0495660_0074819 3300046810 Bacteria 1788
648 Ga0495660_0104477 3300046810 Bacteria 1453
649 Ga0495660_0220788 3300046810 Bacteria 893
650 Ga0495660_0304467 3300046810 Bacteria 721
651 Ga0495604_0012769 3300047317 Bacteria 6686
652 Ga0495604_0015679 3300047317 Bacteria 6048
653 Ga0495604_0057565 3300047317 Bacteria 2988
654 Ga0495604_0082595 3300047317 Bacteria 2402
655 Ga0495636_0024786 3300047318 Bacteria 2434
656 Ga0495674_0060115 3300047319 Bacteria 3316
657 Ga0495672_0008164 3300047320 Bacteria 7766
658 Ga0495672_0009254 3300047320 Bacteria 7160
659 Ga0495672_0009393 3300047320 Bacteria 7089
660 Ga0495672_0009872 3300047320 Bacteria 6864
661 Ga0495672_0010474 3300047320 Bacteria 6603
662 Ga0495672_0010605 3300047320 Bacteria 6549
663 Ga0495672_0012283 3300047320 Bacteria 5988
664 Ga0495672_0016454 3300047320 Bacteria 4983
665 Ga0495672_0263274 3300047320 Bacteria 831
666 Ga0495676_0016099 3300047321 Bacteria 6642
667 Ga0495680_0019044 3300047322 Bacteria 5810
668 Ga0495680_0024149 3300047322 Bacteria 5044
669 Ga0495680_0081346 3300047322 Bacteria 2445
670 Ga0495680_0101129 3300047322 Bacteria 2147
671 Ga0495683_0000043 3300047323 Bacteria 136876
672 Ga0495683_0000092 3300047323 Bacteria 91056
673 Ga0495683_0006068 3300047323 Bacteria 6631
674 Ga0495683_0009647 3300047323 Bacteria 5138
675 Ga0495683_0023083 3300047323 Bacteria 3198
676 Ga0495683_0122415 3300047323 Bacteria 1233
677 Ga0495683_0135551 3300047323 Bacteria 1157
678 Ga0495687_006375 3300047443 Bacteria 7247
679 Ga0495687_011046 3300047443 Bacteria 4888
680 Ga0495675_0031955 3300047444 Bacteria 3361
681 Ga0495675_0066127 3300047444 Bacteria 2285
682 Ga0495675_0074321 3300047444 Bacteria 2142
683 Ga0495677_0004167 3300047445 Bacteria 5575
684 Ga0495679_000946 3300047446 Bacteria 18038
685 Ga0495679_018117 3300047446 Bacteria 2508
686 Ga0495679_076863 3300047446 Bacteria 953
687 Ga0495679_102334 3300047446 Bacteria 794
688 Ga0495673_0000667 3300047469 Bacteria 33805
689 Ga0495673_0003353 3300047469 Bacteria 10594
690 Ga0495673_0004060 3300047469 Bacteria 9324
691 Ga0495673_0012885 3300047469 Bacteria 4409
692 Ga0495673_0016477 3300047469 Bacteria 3776
693 Ga0495673_0028290 3300047469 Bacteria 2656
694 Ga0495673_0037755 3300047469 Bacteria 2203
695 Ga0495673_0044154 3300047469 Bacteria 1989
696 Ga0495673_0082953 3300047469 Bacteria 1324
697 Ga0495681_0007951 3300047470 Bacteria 6697
698 Ga0495681_0008735 3300047470 Bacteria 6319
699 Ga0495681_0010593 3300047470 Bacteria 5574
700 Ga0495681_0017753 3300047470 Bacteria 3941
701 Ga0495681_0028465 3300047470 Bacteria 2873
702 Ga0495681_0058815 3300047470 Bacteria 1779
703 Ga0495681_0089305 3300047470 Bacteria 1363
704 Ga0495681_0098812 3300047470 Bacteria 1279
705 Ga0495681_0106410 3300047470 Bacteria 1219
706 Ga0495681_0133733 3300047470 Bacteria 1053
707 Ga0495681_0273371 3300047470 Bacteria 661
708 Ga0495684_0150154 3300047471 Bacteria 1742
709 Ga0495684_0175375 3300047471 Bacteria 1592
710 Ga0495686_0009979 3300047472 Bacteria 6791
711 Ga0495686_0158653 3300047472 Bacteria 1323
712 Ga0495593_0051872 3300047673 Bacteria 2169
713 Ga0495593_0092585 3300047673 Bacteria 1555
714 Ga0495593_0113491 3300047673 Bacteria 1382
715 Ga0495593_0122005 3300047673 Bacteria 1326
716 Ga0495602_0013222 3300048088 Bacteria 8443
717 Ga0495626_0011814 3300048091 Bacteria 4599
718 Ga0495626_0012587 3300048091 Bacteria 4426
719 Ga0495626_0019578 3300048091 Bacteria 3384
720 Ga0495626_0035498 3300048091 Bacteria 2379
721 Ga0495626_0150046 3300048091 Bacteria 983
722 Ga0496100_0640719 3300048903 Bacteria 827
723 Ga0496101_0292740 3300048904 Bacteria 1274
724 Ga0496102_0016334 3300048905 Bacteria 6484
725 Ga0496110_0039272 3300048913 Bacteria 4121
726 Ga0496110_0793416 3300048913 Bacteria 851
727 Ga0496113_0528215 3300048916 Bacteria 947
728 Ga0496114_0118427 3300048917 Bacteria 2275
729 Ga0496114_0215007 3300048917 Bacteria 1687
730 Ga0496116_0016024 3300048919 Bacteria 5889
731 Ga0496116_0017138 3300048919 Bacteria 5639
732 Ga0496116_0106247 3300048919 Bacteria 1663
733 Ga0496117_0000898 3300048920 Bacteria 45839
734 Ga0496117_0008620 3300048920 Bacteria 9655
735 Ga0496117_0014929 3300048920 Bacteria 6658
736 Ga0496117_0017059 3300048920 Bacteria 6081
737 Ga0496117_0031465 3300048920 Bacteria 4049
738 Ga0496117_0086895 3300048920 Bacteria 2029
739 Ga0496117_0105981 3300048920 Bacteria 1765
740 Ga0496117_0114230 3300048920 Bacteria 1674
741 Ga0496117_0117687 3300048920 Bacteria 1639
742 Ga0496117_0139102 3300048920 Bacteria 1457
743 Ga0496118_0010838 3300048921 Bacteria 8977
744 Ga0496118_0015760 3300048921 Bacteria 6975
745 Ga0496118_0019310 3300048921 Bacteria 6096
746 Ga0496118_0062140 3300048921 Bacteria 2760
747 Ga0496118_0068650 3300048921 Bacteria 2573
748 Ga0496118_0095921 3300048921 Bacteria 2023
749 Ga0496118_0104270 3300048921 Bacteria 1904
750 Ga0496119_0000479 3300048922 Bacteria 54626
751 Ga0496119_0037604 3300048922 Bacteria 3141
752 Ga0496119_0078114 3300048922 Bacteria 1915
753 Ga0496119_0145888 3300048922 Bacteria 1273
754 Ga0496120_0044292 3300048923 Bacteria 2586
755 Ga0496120_0063510 3300048923 Bacteria 2054
756 Ga0496120_0114855 3300048923 Bacteria 1400
757 Ga0496121_0011455 3300048924 Bacteria 9844
758 Ga0496121_0023965 3300048924 Bacteria 5852
759 Ga0496121_0117549 3300048924 Bacteria 2014
760 Ga0496121_0170898 3300048924 Bacteria 1579
761 Ga0496122_0031968 3300048925 Bacteria 4363
762 Ga0496122_0054173 3300048925 Bacteria 3015
763 Ga0496122_0068053 3300048925 Bacteria 2560
764 Ga0496123_0000207 3300048926 Bacteria 120277
765 Ga0496123_0000318 3300048926 Bacteria 91911
766 Ga0496123_0016087 3300048926 Bacteria 6095
767 Ga0496123_0024450 3300048926 Bacteria 4591
768 Ga0496123_0066758 3300048926 Bacteria 2277
769 Ga0496123_0091432 3300048926 Bacteria 1805
770 Ga0496123_0224706 3300048926 Bacteria 944
771 Ga0496124_0014871 3300048927 Bacteria 7497
772 Ga0496124_0016131 3300048927 Bacteria 7124
773 Ga0496124_0018490 3300048927 Bacteria 6524
774 Ga0496124_0020983 3300048927 Bacteria 6024
775 Ga0496124_0047775 3300048927 Bacteria 3659
776 Ga0496124_0083001 3300048927 Bacteria 2630
777 Ga0496124_0146148 3300048927 Bacteria 1860
778 Ga0496124_0266705 3300048927 Bacteria 1256
779 Ga0496124_0312062 3300048927 Bacteria 1130
780 Ga0496124_0488112 3300048927 Bacteria 829
781 Ga0496125_0001906 3300048928 Bacteria 28542
782 Ga0496125_0017414 3300048928 Bacteria 6850
783 Ga0496125_0023780 3300048928 Bacteria 5649
784 Ga0496125_0025546 3300048928 Bacteria 5406
785 Ga0496125_0032585 3300048928 Bacteria 4627
786 Ga0496125_0036895 3300048928 Bacteria 4257
787 Ga0496125_0054842 3300048928 Bacteria 3254
788 Ga0496125_0110447 3300048928 Bacteria 1993
789 Ga0496126_0103893 3300048929 Bacteria 2482
790 Ga0496126_0119042 3300048929 Bacteria 2292
791 Ga0496126_0129707 3300048929 Bacteria 2180
792 Ga0496126_0143436 3300048929 Bacteria 2053
793 Ga0496126_0146719 3300048929 Bacteria 2026
794 Ga0495678_000021 3300049459 Bacteria 239150
795 Ga0495678_004847 3300049459 Bacteria 7627
796 Ga0495678_006128 3300049459 Bacteria 6457
797 Ga0495678_007492 3300049459 Bacteria 5643
798 Ga0495678_016811 3300049459 Bacteria 3332
799 Ga0495678_047663 3300049459 Bacteria 1676
800 Ga0495678_116243 3300049459 Bacteria 905
801 Ga0495678_120383 3300049459 Bacteria 882
802 Ga0495678_153816 3300049459 Bacteria 740
803 Ga0495682_0003584 3300049460 Bacteria 6856
804 Ga0495682_0006622 3300049460 Bacteria 4681
805 Ga0495682_0035960 3300049460 Bacteria 1823
806 Ga0495682_0141322 3300049460 Bacteria 859
807 Ga0495682_0170857 3300049460 Bacteria 773
808 Ga0501034_0000085 3300049571 Bacteria 166893
809 Ga0501241_001278 3300049758 Bacteria 5224
810 Ga0501269_014754 3300049766 Bacteria 959
811 nmdc:mga08x19_122007_c1 3300050514 Bacteria 1748
812 nmdc:mga08x19_553838_c1 3300050514 Bacteria 814
813 Ga0500560_135161 3300053107 Bacteria 824
814 Ga0500572_132320 3300053111 Bacteria 810
815 Ga0500618_017437 3300053125 Bacteria 1786
816 Ga0500659_0038484 3300053135 Bacteria 2602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006058 Ga0075432_10002769 Ga0075432_100027692 153
2 3300006914 Ga0075436_100171150 Ga0075436_1001711502 153
3 3300027907 Ga0207428_10175745 Ga0207428_101757452 153
4 3300046452 Ga0495617_013402 Ga0495617_013402_1137_1811 153
5 3300046453 Ga0495627_009630 Ga0495627_009630_2330_3004 153
6 3300046460 Ga0495638_0031999 Ga0495638_0031999_441_1115 153
7 3300046492 Ga0495585_0130714 Ga0495585_0130714_301_975 153
8 3300046512 Ga0495610_0155711 Ga0495610_0155711_127_801 153
9 3300046513 Ga0495616_0027984 Ga0495616_0027984_1903_2577 153
10 3300046519 Ga0495632_0050339 Ga0495632_0050339_280_954 153
11 3300046523 Ga0495644_0006094 Ga0495644_0006094_2767_3441 153
12 3300046524 Ga0495648_0195072 Ga0495648_0195072_262_936 153
13 3300046530 Ga0495654_0033989 Ga0495654_0033989_614_1288 153
14 3300046615 Ga0495656_0098530 Ga0495656_0098530_112_786 153
15 3300046660 Ga0495625_0208003 Ga0495625_0208003_485_1159 153
16 3300046665 Ga0495661_0032592 Ga0495661_0032592_844_1518 153
17 3300046691 Ga0495670_0010614 Ga0495670_0010614_1522_2196 153
18 3300046692 Ga0495671_0010374 Ga0495671_0010374_4242_4916 153
19 3300046794 Ga0495589_0267021 Ga0495589_0267021_41_715 153
20 3300046810 Ga0495660_0054374 Ga0495660_0054374_56_730 153
21 3300047320 Ga0495672_0009872 Ga0495672_0009872_2028_2702 153
22 3300047323 Ga0495683_0009647 Ga0495683_0009647_4167_4841 153
23 3300046542 Ga0495597_0027235 Ga0495597_0027235_221_880 155
24 3300005288 Ga0065714_10011777 Ga0065714_100117772 157
25 3300015265 Ga0182005_1020043 Ga0182005_10200432 159
26 3300009011 Ga0105251_10003363 Ga0105251_100033634 161
27 3300009036 Ga0105244_10043230 Ga0105244_100432302 161
28 3300013102 Ga0157371_10129258 Ga0157371_101292582 161
29 3300013105 Ga0157369_10063256 Ga0157369_100632563 161
30 3300042439 Ga0439464_0009552 Ga0439464_0009552_1199_1804 161
31 3300013100 Ga0157373_10163442 Ga0157373_101634422 162
32 3300013102 Ga0157371_10051458 Ga0157371_100514584 162
33 3300015261 Ga0182006_1015400 Ga0182006_10154002 162
34 3300025728 Ga0207655_1046959 Ga0207655_10469592 162
35 3300027312 Ga0209371_1026386 Ga0209371_10263862 162
36 3300030500 Ga0268256_1029794 Ga0268256_10297942 162
37 3300046460 Ga0495638_0067027 Ga0495638_0067027_1332_2006 163
38 3300048926 Ga0496123_0066758 Ga0496123_0066758_1352_1957 163
39 3300003856 Ga0058692_1004487 Ga0058692_10044872 164
40 3300027312 Ga0209371_1000165 Ga0209371_100016566 164
41 3300030500 Ga0268256_1000112 Ga0268256_100011226 164
42 3300042010 Ga0439452_045490 Ga0439452_045490_316_921 164
43 3300049766 Ga0501269_014754 Ga0501269_014754_147_776 164
44 3300048091 Ga0495626_0011814 Ga0495626_0011814_1000_1641 169
45 3300009148 Ga0105243_10108019 Ga0105243_101080192 170
46 3300031731 Ga0307405_10046929 Ga0307405_100469292 170
47 3300041405 Ga0439438_010881 Ga0439438_010881_723_1352 170
48 3300003791 Ga0055530_10006117 Ga0055530_100061172 171
49 3300003792 Ga0055540_1000333 Ga0055540_100033337 171
50 3300003794 Ga0055531_10001293 Ga0055531_100012934 171
51 3300005288 Ga0065714_10076676 Ga0065714_100766762 171
52 3300006058 Ga0075432_10041291 Ga0075432_100412911 171
53 3300006186 Ga0075369_10195405 Ga0075369_101954051 171
54 3300009011 Ga0105251_10338732 Ga0105251_103387321 171
55 3300009036 Ga0105244_10056060 Ga0105244_100560603 171
56 3300009036 Ga0105244_10085375 Ga0105244_100853752 171
57 3300009092 Ga0105250_10009255 Ga0105250_100092551 171
58 3300009092 Ga0105250_10141319 Ga0105250_101413191 171
59 3300009148 Ga0105243_10007328 Ga0105243_100073282 171
60 3300011119 Ga0105246_10000426 Ga0105246_100004266 171
61 3300013100 Ga0157373_10796822 Ga0157373_107968221 171
62 3300013102 Ga0157371_10049578 Ga0157371_100495783 171
63 3300013104 Ga0157370_10145793 Ga0157370_101457932 171
64 3300014497 Ga0182008_10202343 Ga0182008_102023431 171
65 3300015261 Ga0182006_1003033 Ga0182006_10030339 171
66 3300015261 Ga0182006_1186482 Ga0182006_11864821 171
67 3300046452 Ga0495617_003991 Ga0495617_003991_4314_4988 171
68 3300046457 Ga0495590_0004461 Ga0495590_0004461_709_1383 171
69 3300046458 Ga0495591_005183 Ga0495591_005183_1010_1684 171
70 3300046459 Ga0495629_0105743 Ga0495629_0105743_1208_1849 171
71 3300046463 Ga0495653_0019558 Ga0495653_0019558_701_1342 171
72 3300046463 Ga0495653_0053916 Ga0495653_0053916_1460_2101 171
73 3300046471 Ga0495650_0010192 Ga0495650_0010192_199_873 171
74 3300046473 Ga0495582_0076397 Ga0495582_0076397_425_1066 171
75 3300046475 Ga0495639_0034567 Ga0495639_0034567_421_1062 171
76 3300046491 Ga0495584_0014713 Ga0495584_0014713_2596_3270 171
77 3300046499 Ga0495594_0141206 Ga0495594_0141206_393_1067 171
78 3300046500 Ga0495596_0006708 Ga0495596_0006708_26_700 171
79 3300046501 Ga0495607_0031484 Ga0495607_0031484_2434_3108 171
80 3300046507 Ga0495606_0080882 Ga0495606_0080882_1334_2008 171
81 3300046512 Ga0495610_0011678 Ga0495610_0011678_296_970 171
82 3300046513 Ga0495616_0009208 Ga0495616_0009208_4394_5068 171
83 3300046515 Ga0495620_0060703 Ga0495620_0060703_620_1294 171
84 3300046517 Ga0495630_0043652 Ga0495630_0043652_2239_2880 171
85 3300046517 Ga0495630_0269343 Ga0495630_0269343_273_914 171
86 3300046518 Ga0495631_0008300 Ga0495631_0008300_4241_4915 171
87 3300046519 Ga0495632_0009603 Ga0495632_0009603_4392_5066 171
88 3300046520 Ga0495637_0006324 Ga0495637_0006324_4391_5065 171
89 3300046523 Ga0495644_0004178 Ga0495644_0004178_4283_4957 171
90 3300046524 Ga0495648_0029795 Ga0495648_0029795_2917_3591 171
91 3300046526 Ga0495666_0008217 Ga0495666_0008217_494_1135 171
92 3300046526 Ga0495666_0038199 Ga0495666_0038199_1237_1878 171
93 3300046526 Ga0495666_0208210 Ga0495666_0208210_28_669 171
94 3300046530 Ga0495654_0034875 Ga0495654_0034875_760_1434 171
95 3300046535 Ga0495586_0040618 Ga0495586_0040618_1134_1808 171
96 3300046536 Ga0495587_0010419 Ga0495587_0010419_304_945 171
97 3300046536 Ga0495587_0028418 Ga0495587_0028418_819_1460 171
98 3300046542 Ga0495597_0006864 Ga0495597_0006864_4422_5096 171
99 3300046543 Ga0495645_0203534 Ga0495645_0203534_276_917 171
100 3300046616 Ga0495668_0010011 Ga0495668_0010011_4339_5013 171
101 3300046642 Ga0495634_0013020 Ga0495634_0013020_4889_5530 171
102 3300046660 Ga0495625_0109203 Ga0495625_0109203_694_1368 171
103 3300046663 Ga0495635_0012587 Ga0495635_0012587_426_1067 171
104 3300046663 Ga0495635_0013095 Ga0495635_0013095_4234_4875 171
105 3300046665 Ga0495661_0061644 Ga0495661_0061644_1340_2014 171
106 3300046675 Ga0495657_0295161 Ga0495657_0295161_172_813 171
107 3300046679 Ga0495623_0061648 Ga0495623_0061648_23_664 171
108 3300046680 Ga0495646_0085811 Ga0495646_0085811_251_892 171
109 3300046680 Ga0495646_0139873 Ga0495646_0139873_476_1117 171
110 3300046692 Ga0495671_0018467 Ga0495671_0018467_3014_3688 171
111 3300046694 Ga0495649_0076667 Ga0495649_0076667_1103_1777 171
112 3300046794 Ga0495589_0008017 Ga0495589_0008017_666_1340 171
113 3300046809 Ga0495600_0020779 Ga0495600_0020779_1196_1837 171
114 3300046809 Ga0495600_0210955 Ga0495600_0210955_584_1225 171
115 3300046810 Ga0495660_0060007 Ga0495660_0060007_1230_1904 171
116 3300047317 Ga0495604_0057565 Ga0495604_0057565_545_1186 171
117 3300047317 Ga0495604_0082595 Ga0495604_0082595_1225_1866 171
118 3300047322 Ga0495680_0081346 Ga0495680_0081346_1388_2029 171
119 3300047322 Ga0495680_0101129 Ga0495680_0101129_657_1298 171
120 3300047444 Ga0495675_0031955 Ga0495675_0031955_977_1618 171
121 3300047444 Ga0495675_0066127 Ga0495675_0066127_923_1564 171
122 3300047469 Ga0495673_0016477 Ga0495673_0016477_2372_3046 171
123 3300047471 Ga0495684_0175375 Ga0495684_0175375_205_846 171
124 3300047673 Ga0495593_0051872 Ga0495593_0051872_1274_1915 171
125 3300047673 Ga0495593_0122005 Ga0495593_0122005_117_758 171
126 3300048091 Ga0495626_0012587 Ga0495626_0012587_945_1619 171
127 3300048905 Ga0496102_0016334 Ga0496102_0016334_4951_5592 171
128 3300048921 Ga0496118_0062140 Ga0496118_0062140_1963_2604 171
129 3300048929 Ga0496126_0119042 Ga0496126_0119042_192_833 171
130 3300049459 Ga0495678_007492 Ga0495678_007492_4251_4925 171
131 3300005288 Ga0065714_10050807 Ga0065714_100508071 172
132 3300006051 Ga0075364_10486738 Ga0075364_104867382 172
133 3300006058 Ga0075432_10159422 Ga0075432_101594221 172
134 3300006946 Ga0079104_1000715 Ga0079104_100071527 172
135 3300006948 Ga0099826_10081895 Ga0099826_100818952 172
136 3300013104 Ga0157370_10000760 Ga0157370_1000076034 172
137 3300017792 Ga0163161_10063169 Ga0163161_100631692 172
138 3300025292 Ga0209676_1003131 Ga0209676_10031312 172
139 3300025298 Ga0209050_1002243 Ga0209050_100224313 172
140 3300025303 Ga0209051_1020533 Ga0209051_10205332 172
141 3300025711 Ga0207696_1005188 Ga0207696_10051886 172
142 3300025735 Ga0207713_1000467 Ga0207713_100046710 172
143 3300025735 Ga0207713_1000862 Ga0207713_100086210 172
144 3300027907 Ga0207428_10275253 Ga0207428_102752531 172
145 3300028786 Ga0307517_10139983 Ga0307517_101399832 172
146 3300030731 Ga0316177_1064906 Ga0316177_10649062 172
147 3300041405 Ga0439438_003638 Ga0439438_003638_4815_5420 172
148 3300042006 Ga0439432_027671 Ga0439432_027671_750_1355 172
149 3300042010 Ga0439452_003631 Ga0439452_003631_4479_5120 172
150 3300046453 Ga0495627_053274 Ga0495627_053274_465_1070 172
151 3300046455 Ga0495603_0143359 Ga0495603_0143359_366_971 172
152 3300046474 Ga0495605_0084926 Ga0495605_0084926_268_873 172
153 3300046492 Ga0495585_0007570 Ga0495585_0007570_5017_5622 172
154 3300046499 Ga0495594_0003974 Ga0495594_0003974_2468_3073 172
155 3300046507 Ga0495606_0001283 Ga0495606_0001283_10338_10949 172
156 3300046557 Ga0495622_0019197 Ga0495622_0019197_2340_2945 172
157 3300046660 Ga0495625_0307024 Ga0495625_0307024_288_893 172
158 3300046694 Ga0495649_0132531 Ga0495649_0132531_239_850 172
159 3300047320 Ga0495672_0016454 Ga0495672_0016454_44_649 172
160 3300048913 Ga0496110_0039272 Ga0496110_0039272_2488_3093 172
161 3300048927 Ga0496124_0266705 Ga0496124_0266705_350_955 172
162 3300050514 nmdc:mga08x19_122007_c1 nmdc:mga08x19_122007_c1_1058_1663 172
163 3300006058 Ga0075432_10160167 Ga0075432_101601672 173
164 3300006946 Ga0079104_1000116 Ga0079104_100011675 173
165 3300011119 Ga0105246_10414105 Ga0105246_104141052 173
166 3300013100 Ga0157373_10026471 Ga0157373_100264712 173
167 3300017792 Ga0163161_10360158 Ga0163161_103601581 173
168 3300027111 Ga0209281_1000070 Ga0209281_100007088 173
169 3300027111 Ga0209281_1000127 Ga0209281_1000127104 173
170 3300042016 Ga0439463_009304 Ga0439463_009304_492_1097 173
171 3300042993 Ga0439440_0038520 Ga0439440_0038520_375_980 173
172 3300046523 Ga0495644_0042657 Ga0495644_0042657_627_1232 173
173 3300048928 Ga0496125_0025546 Ga0496125_0025546_537_1142 173
174 3300049459 Ga0495678_153816 Ga0495678_153816_101_706 173
175 3300050514 nmdc:mga08x19_553838_c1 nmdc:mga08x19_553838_c1_105_710 173
176 3300006051 Ga0075364_10254216 Ga0075364_102542161 174
177 3300006177 Ga0075362_10402458 Ga0075362_104024581 174
178 3300009036 Ga0105244_10008454 Ga0105244_100084542 174
179 3300025711 Ga0207696_1000065 Ga0207696_1000065134 174
180 3300025728 Ga0207655_1001958 Ga0207655_10019582 174
181 3300031730 Ga0307516_10367935 Ga0307516_103679352 174
182 3300041407 Ga0439447_043607 Ga0439447_043607_281_886 174
183 3300041411 Ga0439466_0009211 Ga0439466_0009211_723_1328 174
184 3300042010 Ga0439452_049877 Ga0439452_049877_172_777 174
185 3300042184 Ga0450908_022141 Ga0450908_022141_480_1085 174
186 3300046455 Ga0495603_0088904 Ga0495603_0088904_840_1445 174
187 3300046458 Ga0495591_031391 Ga0495591_031391_625_1266 174
188 3300046460 Ga0495638_0034166 Ga0495638_0034166_1981_2586 174
189 3300046471 Ga0495650_0040038 Ga0495650_0040038_386_991 174
190 3300046474 Ga0495605_0087389 Ga0495605_0087389_471_1076 174
191 3300046474 Ga0495605_0123136 Ga0495605_0123136_493_1098 174
192 3300046491 Ga0495584_0014578 Ga0495584_0014578_889_1494 174
193 3300046491 Ga0495584_0028553 Ga0495584_0028553_836_1441 174
194 3300046492 Ga0495585_0007586 Ga0495585_0007586_4995_5600 174
195 3300046492 Ga0495585_0010340 Ga0495585_0010340_4141_4746 174
196 3300046492 Ga0495585_0124591 Ga0495585_0124591_251_856 174
197 3300046501 Ga0495607_0000385 Ga0495607_0000385_33546_34151 174
198 3300046501 Ga0495607_0025262 Ga0495607_0025262_1004_1609 174
199 3300046501 Ga0495607_0194668 Ga0495607_0194668_174_779 174
200 3300046506 Ga0495583_0007457 Ga0495583_0007457_2451_3056 174
201 3300046507 Ga0495606_0038244 Ga0495606_0038244_1950_2555 174
202 3300046513 Ga0495616_0008271 Ga0495616_0008271_4903_5508 174
203 3300046513 Ga0495616_0010112 Ga0495616_0010112_565_1170 174
204 3300046515 Ga0495620_0008729 Ga0495620_0008729_524_1129 174
205 3300046518 Ga0495631_0005548 Ga0495631_0005548_815_1420 174
206 3300046519 Ga0495632_0010132 Ga0495632_0010132_4412_5017 174
207 3300046519 Ga0495632_0171011 Ga0495632_0171011_40_645 174
208 3300046520 Ga0495637_0005983 Ga0495637_0005983_1000_1605 174
209 3300046520 Ga0495637_0008851 Ga0495637_0008851_3461_4066 174
210 3300046520 Ga0495637_0034590 Ga0495637_0034590_1046_1651 174
211 3300046520 Ga0495637_0072594 Ga0495637_0072594_274_879 174
212 3300046523 Ga0495644_0226715 Ga0495644_0226715_87_692 174
213 3300046524 Ga0495648_0102488 Ga0495648_0102488_346_951 174
214 3300046528 Ga0495642_0002716 Ga0495642_0002716_2093_2698 174
215 3300046530 Ga0495654_0030153 Ga0495654_0030153_705_1310 174
216 3300046530 Ga0495654_0054846 Ga0495654_0054846_841_1446 174
217 3300046538 Ga0495609_0054744 Ga0495609_0054744_1108_1713 174
218 3300046538 Ga0495609_0129645 Ga0495609_0129645_357_962 174
219 3300046542 Ga0495597_0060028 Ga0495597_0060028_674_1279 174
220 3300046558 Ga0495633_0007413 Ga0495633_0007413_583_1188 174
221 3300046616 Ga0495668_0638188 Ga0495668_0638188_10_573 174
222 3300046660 Ga0495625_0013827 Ga0495625_0013827_5343_5948 174
223 3300046660 Ga0495625_0087729 Ga0495625_0087729_1294_1899 174
224 3300046664 Ga0495659_0040344 Ga0495659_0040344_385_990 174
225 3300046665 Ga0495661_0055487 Ga0495661_0055487_945_1550 174
226 3300046665 Ga0495661_0123330 Ga0495661_0123330_269_874 174
227 3300046692 Ga0495671_0105874 Ga0495671_0105874_25_630 174
228 3300046694 Ga0495649_0152396 Ga0495649_0152396_181_786 174
229 3300046694 Ga0495649_0337284 Ga0495649_0337284_57_662 174
230 3300046794 Ga0495589_0048472 Ga0495589_0048472_811_1416 174
231 3300046810 Ga0495660_0074819 Ga0495660_0074819_1173_1778 174
232 3300046810 Ga0495660_0104477 Ga0495660_0104477_38_643 174
233 3300047318 Ga0495636_0024786 Ga0495636_0024786_587_1192 174
234 3300047323 Ga0495683_0006068 Ga0495683_0006068_849_1454 174
235 3300047445 Ga0495677_0004167 Ga0495677_0004167_523_1128 174
236 3300047469 Ga0495673_0000667 Ga0495673_0000667_31297_31902 174
237 3300047469 Ga0495673_0003353 Ga0495673_0003353_811_1416 174
238 3300047470 Ga0495681_0058815 Ga0495681_0058815_206_811 174
239 3300047470 Ga0495681_0106410 Ga0495681_0106410_364_969 174
240 3300047472 Ga0495686_0158653 Ga0495686_0158653_229_834 174
241 3300048091 Ga0495626_0035498 Ga0495626_0035498_618_1223 174
242 3300048904 Ga0496101_0292740 Ga0496101_0292740_302_907 174
243 3300048916 Ga0496113_0528215 Ga0496113_0528215_268_873 174
244 3300048920 Ga0496117_0139102 Ga0496117_0139102_409_1014 174
245 3300048921 Ga0496118_0104270 Ga0496118_0104270_779_1384 174
246 3300048924 Ga0496121_0011455 Ga0496121_0011455_8472_9077 174
247 3300048924 Ga0496121_0117549 Ga0496121_0117549_912_1517 174
248 3300048925 Ga0496122_0031968 Ga0496122_0031968_714_1319 174
249 3300048926 Ga0496123_0000318 Ga0496123_0000318_90527_91132 174
250 3300048928 Ga0496125_0023780 Ga0496125_0023780_737_1342 174
251 3300049460 Ga0495682_0006622 Ga0495682_0006622_1987_2592 174
252 3300005288 Ga0065714_10000057 Ga0065714_100000574 175
253 3300005288 Ga0065714_10157207 Ga0065714_101572072 175
254 3300006058 Ga0075432_10098177 Ga0075432_100981772 175
255 3300009011 Ga0105251_10093625 Ga0105251_100936252 175
256 3300013100 Ga0157373_10104375 Ga0157373_101043752 175
257 3300013102 Ga0157371_10014654 Ga0157371_100146546 175
258 3300013105 Ga0157369_10033495 Ga0157369_100334956 175
259 3300013105 Ga0157369_11199874 Ga0157369_111998742 175
260 3300027907 Ga0207428_10003468 Ga0207428_1000346816 175
261 3300042439 Ga0439464_0006161 Ga0439464_0006161_1478_2089 175
262 3300049460 Ga0495682_0141322 Ga0495682_0141322_74_679 175
263 3300005288 Ga0065714_10126949 Ga0065714_101269492 176
264 3300005435 Ga0070714_100196763 Ga0070714_1001967632 176
265 3300006177 Ga0075362_10271585 Ga0075362_102715851 176
266 3300013104 Ga0157370_10086219 Ga0157370_100862192 176
267 3300017792 Ga0163161_10098585 Ga0163161_100985852 176
268 3300025735 Ga0207713_1024648 Ga0207713_10246482 176
269 3300025929 Ga0207664_10199118 Ga0207664_101991182 176
270 3300046455 Ga0495603_0071885 Ga0495603_0071885_1118_1723 176
271 3300046463 Ga0495653_0058911 Ga0495653_0058911_964_1569 176
272 3300046475 Ga0495639_0209372 Ga0495639_0209372_287_892 176
273 3300046501 Ga0495607_0008058 Ga0495607_0008058_623_1228 176
274 3300046520 Ga0495637_0016040 Ga0495637_0016040_1975_2580 176
275 3300046536 Ga0495587_0184353 Ga0495587_0184353_238_843 176
276 3300046557 Ga0495622_0064608 Ga0495622_0064608_271_876 176
277 3300046679 Ga0495623_0138736 Ga0495623_0138736_601_1206 176
278 3300046691 Ga0495670_0024970 Ga0495670_0024970_1194_1799 176
279 3300046692 Ga0495671_0062293 Ga0495671_0062293_265_870 176
280 3300046692 Ga0495671_0126406 Ga0495671_0126406_550_1155 176
281 3300047317 Ga0495604_0015679 Ga0495604_0015679_544_1149 176
282 3300047322 Ga0495680_0019044 Ga0495680_0019044_4378_4983 176
283 3300047444 Ga0495675_0074321 Ga0495675_0074321_1349_1954 176
284 3300047469 Ga0495673_0028290 Ga0495673_0028290_1324_1929 176
285 3300048920 Ga0496117_0014929 Ga0496117_0014929_4915_5520 176
286 3300048921 Ga0496118_0015760 Ga0496118_0015760_4894_5499 176
287 3300048928 Ga0496125_0001906 Ga0496125_0001906_2611_3216 176
288 3300046458 Ga0495591_058758 Ga0495591_058758_61_666 177
289 3300046491 Ga0495584_0008296 Ga0495584_0008296_4297_4902 177
290 3300046512 Ga0495610_0239711 Ga0495610_0239711_15_620 177
291 3300046518 Ga0495631_0004412 Ga0495631_0004412_5777_6382 177
292 3300046519 Ga0495632_0011002 Ga0495632_0011002_4054_4659 177
293 3300046520 Ga0495637_0049795 Ga0495637_0049795_174_779 177
294 3300046530 Ga0495654_0002905 Ga0495654_0002905_8927_9532 177
295 3300046615 Ga0495656_0426676 Ga0495656_0426676_71_676 177
296 3300046691 Ga0495670_0199100 Ga0495670_0199100_96_701 177
297 3300047320 Ga0495672_0009393 Ga0495672_0009393_5748_6353 177
298 3300047470 Ga0495681_0028465 Ga0495681_0028465_369_974 177
299 3300009011 Ga0105251_10078169 Ga0105251_100781692 178
300 3300009036 Ga0105244_10040241 Ga0105244_100402412 178
301 3300009036 Ga0105244_10144188 Ga0105244_101441882 178
302 3300009036 Ga0105244_10144189 Ga0105244_101441892 178
303 3300025728 Ga0207655_1029072 Ga0207655_10290722 178
304 3300025728 Ga0207655_1050213 Ga0207655_10502132 178
305 3300025728 Ga0207655_1087807 Ga0207655_10878071 178
306 3300025735 Ga0207713_1055298 Ga0207713_10552982 178
307 3300042013 Ga0439456_040907 Ga0439456_040907_312_917 178
308 3300046458 Ga0495591_004712 Ga0495591_004712_4421_5026 178
309 3300046512 Ga0495610_0064910 Ga0495610_0064910_15_620 178
310 3300046524 Ga0495648_0011446 Ga0495648_0011446_4600_5205 178
311 3300031548 Ga0307408_100009242 Ga0307408_1000092422 179
312 3300031911 Ga0307412_10070445 Ga0307412_100704452 179
313 3300031911 Ga0307412_10641727 Ga0307412_106417271 179
314 3300032004 Ga0307414_10515446 Ga0307414_105154461 179
315 3300046522 Ga0495643_0007114 Ga0495643_0007114_4559_5164 179
316 3300046524 Ga0495648_0150311 Ga0495648_0150311_573_1178 179
317 3300046526 Ga0495666_0053624 Ga0495666_0053624_956_1561 179
318 3300046810 Ga0495660_0220788 Ga0495660_0220788_38_643 179
319 3300047319 Ga0495674_0060115 Ga0495674_0060115_2077_2682 179
320 3300047673 Ga0495593_0113491 Ga0495593_0113491_216_821 179
321 3300006944 Ga0099823_1003349 Ga0099823_10033498 180
322 3300009011 Ga0105251_10007315 Ga0105251_100073152 180
323 3300027296 Ga0209389_1000171 Ga0209389_10001712 180
324 3300031824 Ga0307413_10086377 Ga0307413_100863772 180
325 3300042006 Ga0439432_001628 Ga0439432_001628_1186_1791 180
326 3300042142 Ga0450905_004204 Ga0450905_004204_475_1080 180
327 3300046457 Ga0495590_0021266 Ga0495590_0021266_629_1234 180
328 3300046458 Ga0495591_049581 Ga0495591_049581_180_785 180
329 3300046460 Ga0495638_0008389 Ga0495638_0008389_4732_5337 180
330 3300046491 Ga0495584_0147631 Ga0495584_0147631_264_869 180
331 3300046492 Ga0495585_0013372 Ga0495585_0013372_50_655 180
332 3300046501 Ga0495607_0034291 Ga0495607_0034291_229_834 180
333 3300046513 Ga0495616_0008309 Ga0495616_0008309_5003_5608 180
334 3300046519 Ga0495632_0044498 Ga0495632_0044498_889_1494 180
335 3300046523 Ga0495644_0003628 Ga0495644_0003628_4967_5572 180
336 3300046530 Ga0495654_0014667 Ga0495654_0014667_2028_2633 180
337 3300046530 Ga0495654_0063934 Ga0495654_0063934_821_1426 180
338 3300046648 Ga0495611_0014381 Ga0495611_0014381_718_1323 180
339 3300046692 Ga0495671_0008862 Ga0495671_0008862_2088_2693 180
340 3300046694 Ga0495649_0008240 Ga0495649_0008240_4695_5300 180
341 3300047320 Ga0495672_0010605 Ga0495672_0010605_4840_5445 180
342 3300047320 Ga0495672_0012283 Ga0495672_0012283_4279_4884 180
343 3300047323 Ga0495683_0023083 Ga0495683_0023083_1755_2360 180
344 3300047469 Ga0495673_0044154 Ga0495673_0044154_557_1162 180
345 3300048927 Ga0496124_0016131 Ga0496124_0016131_4702_5307 180
346 3300049459 Ga0495678_120383 Ga0495678_120383_103_708 180
347 3300053135 Ga0500659_0038484 Ga0500659_0038484_614_1219 180
348 3300005347 Ga0070668_100021167 Ga0070668_1000211674 181
349 3300006048 Ga0075363_100123516 Ga0075363_1001235162 181
350 3300006186 Ga0075369_10234990 Ga0075369_102349902 181
351 3300009036 Ga0105244_10043913 Ga0105244_100439132 181
352 3300025728 Ga0207655_1030921 Ga0207655_10309212 181
353 3300027296 Ga0209389_1123990 Ga0209389_11239901 181
354 3300047470 Ga0495681_0010593 Ga0495681_0010593_4413_5054 181
355 3300047470 Ga0495681_0133733 Ga0495681_0133733_221_826 181
356 3300003781 Ga0055536_1029692 Ga0055536_10296921 182
357 3300009036 Ga0105244_10310446 Ga0105244_103104461 182
358 3300025292 Ga0209676_1000952 Ga0209676_100095214 182
359 3300025728 Ga0207655_1007585 Ga0207655_10075852 182
360 3300031548 Ga0307408_100000013 Ga0307408_100000013253 182
361 3300046538 Ga0495609_0216889 Ga0495609_0216889_102_707 182
362 3300046557 Ga0495622_0202812 Ga0495622_0202812_116_721 182
363 3300048922 Ga0496119_0145888 Ga0496119_0145888_485_1090 182
364 3300048927 Ga0496124_0020983 Ga0496124_0020983_1079_1684 182
365 3300042137 Ga0450902_001240 Ga0450902_001240_1793_2398 183
366 3300042138 Ga0450903_000818 Ga0450903_000818_4896_5501 183
367 3300042142 Ga0450905_001383 Ga0450905_001383_208_813 183
368 3300042461 Ga0439460_0001759 Ga0439460_0001759_4312_4917 183
369 3300042533 Ga0450901_000913 Ga0450901_000913_1529_2134 183
370 3300046457 Ga0495590_0002865 Ga0495590_0002865_2289_2894 183
371 3300046474 Ga0495605_0011685 Ga0495605_0011685_4088_4693 183
372 3300046474 Ga0495605_0120187 Ga0495605_0120187_363_968 183
373 3300046524 Ga0495648_0189847 Ga0495648_0189847_276_881 183
374 3300046528 Ga0495642_0002477 Ga0495642_0002477_2422_3027 183
375 3300046530 Ga0495654_0112389 Ga0495654_0112389_198_803 183
376 3300046616 Ga0495668_0011106 Ga0495668_0011106_4379_4984 183
377 3300046616 Ga0495668_0063756 Ga0495668_0063756_961_1566 183
378 3300046674 Ga0495588_0290471 Ga0495588_0290471_170_775 183
379 3300046694 Ga0495649_0245143 Ga0495649_0245143_105_710 183
380 3300046810 Ga0495660_0006928 Ga0495660_0006928_2062_2667 183
381 3300046810 Ga0495660_0304467 Ga0495660_0304467_62_667 183
382 3300047320 Ga0495672_0010474 Ga0495672_0010474_4374_4979 183
383 3300047469 Ga0495673_0082953 Ga0495673_0082953_688_1293 183
384 3300049571 Ga0501034_0000085 Ga0501034_0000085_81139_81744 183
385 3300041413 Ga0439465_0081785 Ga0439465_0081785_97_702 184
386 3300042013 Ga0439456_001028 Ga0439456_001028_4579_5220 184
387 3300042439 Ga0439464_0031553 Ga0439464_0031553_220_825 184
388 3300046457 Ga0495590_0012460 Ga0495590_0012460_96_701 184
389 3300046471 Ga0495650_0010851 Ga0495650_0010851_146_751 184
390 3300046501 Ga0495607_0007652 Ga0495607_0007652_4728_5333 184
391 3300046513 Ga0495616_0009984 Ga0495616_0009984_4318_4923 184
392 3300046519 Ga0495632_0010712 Ga0495632_0010712_4297_4902 184
393 3300046530 Ga0495654_0170134 Ga0495654_0170134_30_635 184
394 3300046660 Ga0495625_0127497 Ga0495625_0127497_278_883 184
395 3300046810 Ga0495660_0007457 Ga0495660_0007457_4289_4894 184
396 3300047470 Ga0495681_0007951 Ga0495681_0007951_1383_1988 184
397 3300048091 Ga0495626_0150046 Ga0495626_0150046_145_750 184
398 3300049459 Ga0495678_016811 Ga0495678_016811_546_1151 184
399 3300049460 Ga0495682_0035960 Ga0495682_0035960_1182_1787 184
400 3300003759 Ga0055525_1005529 Ga0055525_10055291 185
401 3300005288 Ga0065714_10028036 Ga0065714_100280361 185
402 3300005366 Ga0070659_100311601 Ga0070659_1003116012 185
403 3300005457 Ga0070662_100029044 Ga0070662_1000290443 185
404 3300006051 Ga0075364_10056923 Ga0075364_100569232 185
405 3300009011 Ga0105251_10156874 Ga0105251_101568741 185
406 3300009036 Ga0105244_10016794 Ga0105244_100167942 185
407 3300009036 Ga0105244_10018975 Ga0105244_100189752 185
408 3300009092 Ga0105250_10005253 Ga0105250_100052531 185
409 3300013307 Ga0157372_10033539 Ga0157372_100335396 185
410 3300015261 Ga0182006_1017143 Ga0182006_10171432 185
411 3300025728 Ga0207655_1001105 Ga0207655_100110527 185
412 3300042136 Ga0450900_002075 Ga0450900_002075_1090_1695 185
413 3300046810 Ga0495660_0063936 Ga0495660_0063936_200_805 185
414 3300048924 Ga0496121_0170898 Ga0496121_0170898_83_688 185
415 3300046501 Ga0495607_0015441 Ga0495607_0015441_1249_1854 186
416 3300048913 Ga0496110_0793416 Ga0496110_0793416_84_728 186
417 3300048927 Ga0496124_0047775 Ga0496124_0047775_835_1440 186
418 3300048928 Ga0496125_0032585 Ga0496125_0032585_2916_3560 186
419 3300048929 Ga0496126_0103893 Ga0496126_0103893_809_1453 186
420 3300005548 Ga0070665_100084079 Ga0070665_1000840792 187
421 3300013100 Ga0157373_10006730 Ga0157373_100067307 187
422 3300025230 Ga0209563_100190 Ga0209563_1001902 187
423 3300025711 Ga0207696_1000047 Ga0207696_1000047171 187
424 3300025728 Ga0207655_1006009 Ga0207655_10060092 187
425 3300025735 Ga0207713_1025957 Ga0207713_10259572 187
426 3300025932 Ga0207690_10267877 Ga0207690_102678772 187
427 3300025933 Ga0207706_10008497 Ga0207706_100084975 187
428 3300046452 Ga0495617_127031 Ga0495617_127031_180_785 187
429 3300046512 Ga0495610_0153135 Ga0495610_0153135_323_928 187
430 3300046665 Ga0495661_0284994 Ga0495661_0284994_145_750 187
431 3300048920 Ga0496117_0105981 Ga0496117_0105981_1079_1684 187
432 3300048922 Ga0496119_0037604 Ga0496119_0037604_394_999 187
433 3300048924 Ga0496121_0023965 Ga0496121_0023965_4212_4817 187
434 3300005331 Ga0070670_100006989 Ga0070670_1000069898 188
435 3300012502 Ga0157347_1004381 Ga0157347_10043812 188
436 3300013306 Ga0163162_10016996 Ga0163162_100169962 188
437 3300013308 Ga0157375_10174804 Ga0157375_101748042 188
438 3300025925 Ga0207650_10000231 Ga0207650_1000023159 188
439 3300028379 Ga0268266_10020462 Ga0268266_100204626 188
440 3300046457 Ga0495590_0098055 Ga0495590_0098055_265_870 188
441 3300046458 Ga0495591_057186 Ga0495591_057186_222_827 188
442 3300046463 Ga0495653_0043141 Ga0495653_0043141_145_750 188
443 3300046492 Ga0495585_0041784 Ga0495585_0041784_1519_2124 188
444 3300046492 Ga0495585_0097266 Ga0495585_0097266_208_813 188
445 3300046501 Ga0495607_0009852 Ga0495607_0009852_1268_1873 188
446 3300046512 Ga0495610_0006505 Ga0495610_0006505_5345_5950 188
447 3300046512 Ga0495610_0041293 Ga0495610_0041293_1347_1952 188
448 3300046520 Ga0495637_0046050 Ga0495637_0046050_1198_1803 188
449 3300046616 Ga0495668_0100370 Ga0495668_0100370_111_716 188
450 3300046694 Ga0495649_0129371 Ga0495649_0129371_620_1225 188
451 3300047323 Ga0495683_0135551 Ga0495683_0135551_148_753 188
452 3300047446 Ga0495679_018117 Ga0495679_018117_1219_1824 188
453 3300047469 Ga0495673_0037755 Ga0495673_0037755_556_1161 188
454 3300048927 Ga0496124_0146148 Ga0496124_0146148_873_1478 188
455 3300009011 Ga0105251_10019109 Ga0105251_100191092 189
456 3300017792 Ga0163161_10008767 Ga0163161_100087672 189
457 3300025728 Ga0207655_1016267 Ga0207655_10162672 189
458 3300025735 Ga0207713_1010259 Ga0207713_10102594 189
459 3300033180 Ga0307510_10024652 Ga0307510_100246522 189
460 3300046452 Ga0495617_003644 Ga0495617_003644_1054_1659 189
461 3300046453 Ga0495627_003011 Ga0495627_003011_2110_2715 189
462 3300046460 Ga0495638_0118331 Ga0495638_0118331_111_716 189
463 3300046491 Ga0495584_0053665 Ga0495584_0053665_1234_1839 189
464 3300046492 Ga0495585_0167840 Ga0495585_0167840_50_655 189
465 3300046501 Ga0495607_0010904 Ga0495607_0010904_4204_4809 189
466 3300046506 Ga0495583_0009172 Ga0495583_0009172_4233_4838 189
467 3300046512 Ga0495610_0025415 Ga0495610_0025415_1329_1934 189
468 3300046513 Ga0495616_0027671 Ga0495616_0027671_1120_1725 189
469 3300046519 Ga0495632_0008764 Ga0495632_0008764_1338_1943 189
470 3300046520 Ga0495637_0005906 Ga0495637_0005906_1351_1956 189
471 3300046520 Ga0495637_0043836 Ga0495637_0043836_154_759 189
472 3300046524 Ga0495648_0011954 Ga0495648_0011954_1334_1939 189
473 3300046530 Ga0495654_0013021 Ga0495654_0013021_883_1488 189
474 3300046530 Ga0495654_0226347 Ga0495654_0226347_142_747 189
475 3300046538 Ga0495609_0042659 Ga0495609_0042659_203_808 189
476 3300046648 Ga0495611_0002858 Ga0495611_0002858_5000_5605 189
477 3300046660 Ga0495625_0015355 Ga0495625_0015355_1384_1989 189
478 3300046665 Ga0495661_0082298 Ga0495661_0082298_1107_1712 189
479 3300046691 Ga0495670_0004314 Ga0495670_0004314_2137_2742 189
480 3300046810 Ga0495660_0032967 Ga0495660_0032967_1359_1964 189
481 3300047323 Ga0495683_0122415 Ga0495683_0122415_56_661 189
482 3300047470 Ga0495681_0017753 Ga0495681_0017753_2088_2693 189
483 3300047472 Ga0495686_0009979 Ga0495686_0009979_1523_2128 189
484 3300048919 Ga0496116_0017138 Ga0496116_0017138_2962_3567 189
485 3300049459 Ga0495678_006128 Ga0495678_006128_4591_5196 189
486 3300049460 Ga0495682_0170857 Ga0495682_0170857_107_712 189
487 3300005288 Ga0065714_10014311 Ga0065714_100143113 190
488 3300041405 Ga0439438_001711 Ga0439438_001711_1773_2378 190
489 3300041407 Ga0439447_001783 Ga0439447_001783_2370_2975 190
490 3300042006 Ga0439432_004605 Ga0439432_004605_2093_2698 190
491 3300042010 Ga0439452_002111 Ga0439452_002111_2347_2952 190
492 3300042146 Ga0450907_000807 Ga0450907_000807_4942_5547 190
493 3300042156 Ga0439446_0005041 Ga0439446_0005041_442_1047 190
494 3300042185 Ga0450909_006414 Ga0450909_006414_596_1201 190
495 3300042435 Ga0439434_0009435 Ga0439434_0009435_129_734 190
496 3300042461 Ga0439460_0001856 Ga0439460_0001856_432_1037 190
497 3300042993 Ga0439440_0004014 Ga0439440_0004014_259_864 190
498 3300046542 Ga0495597_0022952 Ga0495597_0022952_1268_1921 190
499 3300047446 Ga0495679_102334 Ga0495679_102334_124_729 191
500 3300048926 Ga0496123_0024450 Ga0496123_0024450_2790_3395 191
501 3300053107 Ga0500560_135161 Ga0500560_135161_57_668 191
502 iso_pu_bacteria 651053060 651177724 191
503 3300005578 Ga0068854_100001639 Ga0068854_1000016392 192
504 3300005834 Ga0068851_10000002 Ga0068851_10000002123 192
505 3300009011 Ga0105251_10002219 Ga0105251_100022192 192
506 3300009036 Ga0105244_10011056 Ga0105244_100110564 192
507 3300009148 Ga0105243_10044419 Ga0105243_100444192 192
508 3300013102 Ga0157371_10212719 Ga0157371_102127192 192
509 3300013104 Ga0157370_10188217 Ga0157370_101882172 192
510 3300025256 Ga0209759_1002980 Ga0209759_10029802 192
511 3300025321 Ga0207656_10000010 Ga0207656_10000010134 192
512 3300025728 Ga0207655_1000214 Ga0207655_100021434 192
513 3300025735 Ga0207713_1002385 Ga0207713_100238513 192
514 3300025935 Ga0207709_10034802 Ga0207709_100348022 192
515 3300025981 Ga0207640_10312254 Ga0207640_103122542 192
516 3300046501 Ga0495607_0020124 Ga0495607_0020124_1258_1863 192
517 3300046507 Ga0495606_0059260 Ga0495606_0059260_557_1162 192
518 3300048926 Ga0496123_0224706 Ga0496123_0224706_21_626 192
519 3300005548 Ga0070665_100176481 Ga0070665_1001764812 193
520 3300046463 Ga0495653_0010010 Ga0495653_0010010_6148_6753 193
521 3300046524 Ga0495648_0016858 Ga0495648_0016858_4588_5193 193
522 3300046543 Ga0495645_0231697 Ga0495645_0231697_445_1050 193
523 3300046680 Ga0495646_0056606 Ga0495646_0056606_743_1348 193
524 3300046689 Ga0495613_0010347 Ga0495613_0010347_5381_5986 193
525 3300046690 Ga0495624_0033930 Ga0495624_0033930_999_1604 193
526 3300046809 Ga0495600_0111813 Ga0495600_0111813_167_772 193
527 3300047317 Ga0495604_0012769 Ga0495604_0012769_5379_5984 193
528 3300047320 Ga0495672_0008164 Ga0495672_0008164_1006_1611 193
529 3300047322 Ga0495680_0024149 Ga0495680_0024149_1203_1808 193
530 3300047443 Ga0495687_011046 Ga0495687_011046_4246_4851 193
531 3300047446 Ga0495679_076863 Ga0495679_076863_353_934 193
532 3300047471 Ga0495684_0150154 Ga0495684_0150154_216_821 193
533 3300047673 Ga0495593_0092585 Ga0495593_0092585_575_1180 193
534 3300048088 Ga0495602_0013222 Ga0495602_0013222_6835_7440 193
535 3300009011 Ga0105251_10032485 Ga0105251_100324852 194
536 3300009092 Ga0105250_10003615 Ga0105250_100036152 194
537 3300012498 Ga0157345_1000245 Ga0157345_10002457 194
538 3300025735 Ga0207713_1028433 Ga0207713_10284332 194
539 3300046520 Ga0495637_0055588 Ga0495637_0055588_741_1346 194
540 3300046691 Ga0495670_0008963 Ga0495670_0008963_4179_4784 194
541 3300047443 Ga0495687_006375 Ga0495687_006375_4178_4783 194
542 3300027252 Ga0209973_1011128 Ga0209973_10111282 195
543 3300027424 Ga0209984_1002907 Ga0209984_10029072 195
544 3300027471 Ga0209995_1009447 Ga0209995_10094472 195
545 3300027526 Ga0209968_1008357 Ga0209968_10083572 195
546 3300027552 Ga0209982_1010538 Ga0209982_10105382 195
547 3300027614 Ga0209970_1002457 Ga0209970_10024573 195
548 3300027665 Ga0209983_1001998 Ga0209983_10019982 195
549 3300027682 Ga0209971_1000210 Ga0209971_10002104 195
550 3300027876 Ga0209974_10005587 Ga0209974_100055872 195
551 3300046452 Ga0495617_008283 Ga0495617_008283_2889_3494 195
552 3300046458 Ga0495591_004426 Ga0495591_004426_5006_5611 195
553 3300046513 Ga0495616_0008266 Ga0495616_0008266_1313_1918 195
554 3300046538 Ga0495609_0241447 Ga0495609_0241447_44_649 195
555 iso_pu_bacteria 2600254954 2600445199 196
556 iso_pu_bacteria 2600255389 2602012305 196
557 iso_pu_bacteria 8034962539 8034966981 196
558 iso_pu_bacteria 2510065053 2510283271 197
559 iso_pu_bacteria 2510065055 2510292900 197
560 iso_pu_bacteria 2510065058 2510313371 197
561 iso_pu_bacteria 2511231004 2511252558 197
562 iso_pu_bacteria 2511231012 2511302600 197
563 iso_pu_bacteria 2511231014 2511315930 197
564 iso_pu_bacteria 2511231015 2511320431 197
565 iso_pu_bacteria 2511231016 2511325980 197
566 iso_pu_bacteria 2511231017 2511335235 197
567 iso_pu_bacteria 2511231018 2511341359 197
568 iso_pu_bacteria 2511231019 2511347285 197
569 iso_pu_bacteria 2511231023 2511368822 197
570 iso_pu_bacteria 2511231031 2511411374 197
571 iso_pu_bacteria 2512047018 2512328038 197
572 iso_pu_bacteria 2554235231 2555247070 197
573 iso_pu_bacteria 2554235341 2555672354 197
574 iso_pu_bacteria 2582580891 2583794948 197
575 iso_pu_bacteria 2597489887 2597860425 197
576 iso_pu_bacteria 2597489888 2597866166 197
577 iso_pu_bacteria 2597489889 2597872004 197
578 iso_pu_bacteria 2599185160 2599358203 197
579 iso_pu_bacteria 2599185161 2599364557 197
580 iso_pu_bacteria 2599185162 2599370907 197
581 iso_pu_bacteria 2599185163 2599376929 197
582 iso_pu_bacteria 2599185164 2599383368 197
583 iso_pu_bacteria 2599185165 2599389815 197
584 iso_pu_bacteria 2599185166 2599396103 197
585 iso_pu_bacteria 2599185167 2599401339 197
586 iso_pu_bacteria 2599185168 2599407943 197
587 iso_pu_bacteria 2599185179 2599453064 197
588 iso_pu_bacteria 2599185181 2599465018 197
589 iso_pu_bacteria 2599185182 2599471334 197
590 iso_pu_bacteria 2599185185 2599486734 197
591 iso_pu_bacteria 2599185186 2599494067 197
592 iso_pu_bacteria 2599185189 2599509818 197
593 iso_pu_bacteria 2599185190 2599515069 197
594 iso_pu_bacteria 2599185191 2599520230 197
595 iso_pu_bacteria 2599185248 2599772927 197
596 iso_pu_bacteria 2599185257 2599807142 197
597 iso_pu_bacteria 2599185288 2599881669 197
598 iso_pu_bacteria 2599185289 2599888241 197
599 iso_pu_bacteria 2599185290 2599894449 197
600 iso_pu_bacteria 2599185291 2599900977 197
601 iso_pu_bacteria 2599185300 2599930430 197
602 iso_pu_bacteria 2599185303 2599949294 197
603 iso_pu_bacteria 2599185304 2599955232 197
604 iso_pu_bacteria 2599185305 2599962707 197
605 iso_pu_bacteria 2599185306 2599967090 197
606 iso_pu_bacteria 2599185308 2599979634 197
607 iso_pu_bacteria 2599185309 2599983965 197
608 iso_pu_bacteria 2599185310 2599990317 197
609 iso_pu_bacteria 2599185311 2599997445 197
610 iso_pu_bacteria 2599185312 2600001741 197
611 iso_pu_bacteria 2599185313 2600008482 197
612 iso_pu_bacteria 2599185314 2600013446 197
613 iso_pu_bacteria 2599185315 2600020899 197
614 iso_pu_bacteria 2599185316 2600026218 197
615 iso_pu_bacteria 2599185318 2600038695 197
616 iso_pu_bacteria 2599185319 2600044144 197
617 iso_pu_bacteria 2599185320 2600048851 197
618 iso_pu_bacteria 2599185321 2600056778 197
619 iso_pu_bacteria 2599185322 2600062283 197
620 iso_pu_bacteria 2599185323 2600067702 197
621 iso_pu_bacteria 2599185324 2600074855 197
622 iso_pu_bacteria 2599185325 2600079574 197
623 iso_pu_bacteria 2599185356 2600217750 197
624 iso_pu_bacteria 2600254930 2600360379 197
625 iso_pu_bacteria 2600255283 2601628703 197
626 iso_pu_bacteria 2600255296 2601693896 197
627 iso_pu_bacteria 2600255313 2601777917 197
628 iso_pu_bacteria 2600255318 2601800523 197
629 iso_pu_bacteria 2603880185 2606078669 197
630 iso_pu_bacteria 2603880199 2606125671 197
631 iso_pu_bacteria 2619619299 2621297293 197
632 iso_pu_bacteria 2623620446 2624494473 197
633 iso_pu_bacteria 2643221565 2643844913 197
634 iso_pu_bacteria 2643221571 2643870896 197
635 iso_pu_bacteria 2643221589 2643957624 197
636 iso_pu_bacteria 2643221602 2644025738 197
637 iso_pu_bacteria 2643221633 2644189010 197
638 iso_pu_bacteria 2643221713 2644625281 197
639 iso_pu_bacteria 2651869719 2652548759 197
640 iso_pu_bacteria 2667528170 2671093871 197
641 iso_pu_bacteria 2667528171 2671100731 197
642 iso_pu_bacteria 2667528176 2671129950 197
643 iso_pu_bacteria 2671180172 2671773298 197
644 iso_pu_bacteria 2675903420 2677898435 197
645 iso_pu_bacteria 2675903515 2678265653 197
646 iso_pu_bacteria 2713897148 2715752362 197
647 iso_pu_bacteria 2713897149 2715759113 197
648 iso_pu_bacteria 2718217725 2718636146 197
649 iso_pu_bacteria 2721755607 2723250904 197
650 iso_pu_bacteria 2738541265 2738672963 197
651 iso_pu_bacteria 2738541282 2738751356 197
652 iso_pu_bacteria 2738541294 2738810221 197
653 iso_pu_bacteria 2738541303 2738860397 197
654 iso_pu_bacteria 2738541309 2738897581 197
655 iso_pu_bacteria 2738543004 2739198126 197
656 iso_pu_bacteria 2738543015 2739260892 197
657 iso_pu_bacteria 2738543016 2739266804 197
658 iso_pu_bacteria 2738543021 2739294849 197
659 iso_pu_bacteria 2738543025 2739314893 197
660 iso_pu_bacteria 2740892503 2743739972 197
661 iso_pu_bacteria 2744054620 2745006890 197
662 iso_pu_bacteria 2765235841 2765586161 197
663 iso_pu_bacteria 2773857670 2774121846 197
664 iso_pu_bacteria 2773857672 2774128959 197
665 iso_pu_bacteria 2773857673 2774137085 197
666 iso_pu_bacteria 2784132063 2784262291 197
667 iso_pu_bacteria 2784132072 2784314509 197
668 iso_pu_bacteria 2791355520 2794595259 197
669 iso_pu_bacteria 2806310737 2807410388 197
670 iso_pu_bacteria 2806310745 2807458734 197
671 iso_pu_bacteria 2808606361 2808857287 197
672 iso_pu_bacteria 2808606373 2808905298 197
673 iso_pu_bacteria 2808606376 2808926407 197
674 iso_pu_bacteria 2808606378 2808937409 197
675 iso_pu_bacteria 2808606379 2808941265 197
676 iso_pu_bacteria 2808606380 2808948568 197
677 iso_pu_bacteria 2808606381 2808953030 197
678 iso_pu_bacteria 2808606382 2808961253 197
679 iso_pu_bacteria 2808606383 2808965739 197
680 iso_pu_bacteria 2808606385 2808977551 197
681 iso_pu_bacteria 2808606388 2808992791 197
682 iso_pu_bacteria 2808606389 2809000662 197
683 iso_pu_bacteria 2808606445 2809219244 197
684 iso_pu_bacteria 2816332298 2817493582 197
685 iso_pu_bacteria 2818991456 2819659237 197
686 iso_pu_bacteria 2818991464 2819706398 197
687 iso_pu_bacteria 2823421272 2823422169 197
688 iso_pu_bacteria 2834028612 2834033208 197
689 iso_pu_bacteria 2842826826 2842829108 197
690 iso_pu_bacteria 2842832357 2842836940 197
691 iso_pu_bacteria 2842837860 2842840459 197
692 iso_pu_bacteria 2842843487 2842847677 197
693 iso_pu_bacteria 2844665904 2844666522 197
694 iso_pu_bacteria 2852612431 2852618113 197
695 iso_pu_bacteria 2852657418 2852661058 197
696 iso_pu_bacteria 2852667396 2852673171 197
697 iso_pu_bacteria 2860339153 2860343928 197
698 iso_pu_bacteria 2860867994 2860872578 197
699 iso_pu_bacteria 2878029506 2878034873 197
700 iso_pu_bacteria 2880230671 2880235511 197
701 iso_pu_bacteria 2904518522 2904522618 197
702 iso_pu_bacteria 2904550169 2904554091 197
703 iso_pu_bacteria 2908446538 2908452100 197
704 iso_pu_bacteria 2912963787 2912968419 197
705 iso_pu_bacteria 2913036834 2913042065 197
706 iso_pu_bacteria 2917070673 2917076235 197
707 iso_pu_bacteria 2917832318 2917832906 197
708 iso_pu_bacteria 2919063839 2919067747 197
709 iso_pu_bacteria 2919125081 2919128601 197
710 iso_pu_bacteria 2919155634 2919158277 197
711 iso_pu_bacteria 2919385768 2919390610 197
712 iso_pu_bacteria 2919487758 2919490924 197
713 iso_pu_bacteria 2919501602 2919505997 197
714 iso_pu_bacteria 2919697872 2919701426 197
715 iso_pu_bacteria 2923153595 2923159063 197
716 iso_pu_bacteria 2923586266 2923591015 197
717 iso_pu_bacteria 2926063275 2926067492 197
718 iso_pu_bacteria 2929144301 2929149434 197
719 iso_pu_bacteria 2929189879 2929194687 197
720 iso_pu_bacteria 2931390751 2931395964 197
721 iso_pu_bacteria 2931396565 2931397597 197
722 iso_pu_bacteria 2935353572 2935359659 197
723 iso_pu_bacteria 2939636861 2939641861 197
724 iso_pu_bacteria 2939651529 2939654662 197
725 iso_pu_bacteria 2945928738 2945931368 197
726 iso_pu_bacteria 2945961074 2945966315 197
727 iso_pu_bacteria 2946006987 2946007419 197
728 iso_pu_bacteria 2946027586 2946033180 197
729 iso_pu_bacteria 2947233263 2947233950 197
730 iso_pu_bacteria 2969304461 2969309685 197
731 iso_pu_bacteria 2974289157 2974294583 197
732 iso_pu_bacteria 2974298342 2974298921 197
733 iso_pu_bacteria 2984499530 2984501227 197
734 iso_pu_bacteria 2984504281 2984505318 197
735 iso_pu_bacteria 2988728565 2988730980 197
736 iso_pu_bacteria 2998139840 2998144930 197
737 iso_pu_bacteria 3007395558 3007398688 197
738 iso_pu_bacteria 3007419365 3007420312 197
739 iso_pu_bacteria 3007511990 3007516720 197
740 iso_pu_bacteria 3007803356 3007803628 197
741 iso_pu_bacteria 3007855910 3007860133 197
742 iso_pu_bacteria 3007861166 3007866387 197
743 iso_pu_bacteria 3007866637 3007870913 197
744 iso_pu_bacteria 3007872151 3007873610 197
745 iso_pu_bacteria 637000220 637322775 197
746 iso_pu_bacteria 640427133 640489711 197
747 iso_pu_bacteria 8015687852 8015693140 197
748 iso_pu_bacteria 8016728285 8016732788 197
749 iso_pu_bacteria 8019769354 8019771297 197
750 iso_pu_bacteria 8019775933 8019780408 197
751 iso_pu_bacteria 8029995093 8029995968 197
752 iso_pu_bacteria 8052494512 8052495240 197
753 iso_pu_bacteria 8054285046 8054286940 197
754 iso_pu_bacteria 8054347763 8054352984 197
755 iso_pu_bacteria 8054503363 8054508468 197
756 iso_pu_bacteria 8054929484 8054933623 197
757 iso_pu_bacteria 8055770955 8055776389 197
758 iso_pu_bacteria 8055817908 8055823424 197
759 iso_pu_bacteria 8055878733 8055882303 197
760 iso_pu_bacteria 8056115690 8056120699 197
761 iso_pu_bacteria 8056120720 8056121364 197
762 iso_pu_bacteria 8056125926 8056131147 197
763 iso_pu_bacteria 8056131705 8056136867 197
764 iso_pu_bacteria 8056137416 8056138079 197
765 iso_pu_bacteria 8056143049 8056148261 197
766 iso_pu_bacteria 8056148874 8056150197 197
767 iso_pu_bacteria 8056155041 8056156341 197
768 iso_pu_bacteria 8056161164 8056163138 197
769 iso_pu_bacteria 8056166840 8056171636 197
770 iso_pu_bacteria 8056177738 8056179223 197
771 iso_pu_bacteria 8056569372 8056571978 197
772 iso_pu_bacteria 8057798959 8057805232 197
773 3300001915 JGI24741J21665_1005956 JGI24741J21665_10059561 201
774 3300002737 JGI25162J39368_1000136 JGI25162J39368_100013669 201
775 3300002771 JGI25163J39215_1001836 JGI25163J39215_10018362 201
776 3300002772 JGI25164J39214_1000260 JGI25164J39214_10002606 201
777 3300003214 JGI25165J46597_1000222 JGI25165J46597_100022270 201
778 3300003751 Ga0055538_1000042 Ga0055538_100004234 201
779 3300003752 Ga0055539_1000055 Ga0055539_100005534 201
780 3300003756 Ga0055533_1000067 Ga0055533_100006734 201
781 3300003758 Ga0055532_1000053 Ga0055532_100005334 201
782 3300003759 Ga0055525_1000103 Ga0055525_1000103101 201
783 3300003841 Ga0055541_1000042 Ga0055541_1000042143 201
784 3300003856 Ga0058692_1014929 Ga0058692_10149292 201
785 3300005288 Ga0065714_10085851 Ga0065714_100858512 201
786 3300005288 Ga0065714_10085926 Ga0065714_100859262 201
787 3300005289 Ga0065704_10011786 Ga0065704_100117862 201
788 3300005289 Ga0065704_10075432 Ga0065704_100754321 201
789 3300005290 Ga0065712_10078530 Ga0065712_100785302 201
790 3300005331 Ga0070670_100139894 Ga0070670_1001398941 201
791 3300005344 Ga0070661_100000729 Ga0070661_1000007299 201
792 3300005347 Ga0070668_100809591 Ga0070668_1008095911 201
793 3300005353 Ga0070669_100000089 Ga0070669_10000008981 201
794 3300005457 Ga0070662_100003677 Ga0070662_1000036775 201
795 3300005539 Ga0068853_100000273 Ga0068853_1000002735 201
796 3300005548 Ga0070665_100370725 Ga0070665_1003707251 201
797 3300005577 Ga0068857_100184282 Ga0068857_1001842822 201
798 3300005578 Ga0068854_101131900 Ga0068854_1011319001 201
799 3300006051 Ga0075364_10314272 Ga0075364_103142721 201
800 3300006058 Ga0075432_10075276 Ga0075432_100752762 201
801 3300006177 Ga0075362_10032511 Ga0075362_100325113 201
802 3300009011 Ga0105251_10006439 Ga0105251_100064396 201
803 3300009011 Ga0105251_10008296 Ga0105251_100082962 201
804 3300009011 Ga0105251_10073401 Ga0105251_100734012 201
805 3300009036 Ga0105244_10015270 Ga0105244_100152703 201
806 3300009036 Ga0105244_10015328 Ga0105244_100153282 201
807 3300009036 Ga0105244_10015849 Ga0105244_100158495 201
808 3300009036 Ga0105244_10020043 Ga0105244_100200432 201
809 3300009036 Ga0105244_10061816 Ga0105244_100618162 201
810 3300009092 Ga0105250_10000657 Ga0105250_100006578 201
811 3300009092 Ga0105250_10015090 Ga0105250_100150902 201
812 3300009092 Ga0105250_10042387 Ga0105250_100423872 201
813 3300009148 Ga0105243_10149569 Ga0105243_101495692 201
814 3300009176 Ga0105242_10000442 Ga0105242_1000044219 201
815 3300009177 Ga0105248_10677641 Ga0105248_106776412 201
816 3300009545 Ga0105237_10001850 Ga0105237_1000185024 201
817 3300011119 Ga0105246_10000905 Ga0105246_100009052 201
818 3300013100 Ga0157373_10063490 Ga0157373_100634903 201
819 3300013100 Ga0157373_10081423 Ga0157373_100814232 201
820 3300013100 Ga0157373_10100994 Ga0157373_101009941 201
821 3300013102 Ga0157371_10114379 Ga0157371_101143792 201
822 3300013104 Ga0157370_10060352 Ga0157370_100603522 201
823 3300013104 Ga0157370_10285428 Ga0157370_102854282 201
824 3300013104 Ga0157370_10474759 Ga0157370_104747592 201
825 3300013105 Ga0157369_10021803 Ga0157369_100218033 201
826 3300013105 Ga0157369_10094938 Ga0157369_100949382 201
827 3300013306 Ga0163162_10207248 Ga0163162_102072481 201
828 3300013306 Ga0163162_10215785 Ga0163162_102157852 201
829 3300013306 Ga0163162_11709151 Ga0163162_117091512 201
830 3300013307 Ga0157372_10001236 Ga0157372_100012362 201
831 3300013308 Ga0157375_10104773 Ga0157375_101047733 201
832 3300013308 Ga0157375_10124546 Ga0157375_101245462 201
833 3300013308 Ga0157375_10300855 Ga0157375_103008552 201
834 3300014497 Ga0182008_10035688 Ga0182008_100356883 201
835 3300014497 Ga0182008_10035940 Ga0182008_100359402 201
836 3300015261 Ga0182006_1004123 Ga0182006_10041236 201
837 3300015261 Ga0182006_1010996 Ga0182006_10109962 201
838 3300015261 Ga0182006_1077570 Ga0182006_10775702 201
839 3300017792 Ga0163161_10241672 Ga0163161_102416721 201
840 3300017792 Ga0163161_10511048 Ga0163161_105110481 201
841 3300025206 Ga0209435_104061 Ga0209435_1040611 201
842 3300025207 Ga0209760_100058 Ga0209760_10005875 201
843 3300025224 Ga0209784_100060 Ga0209784_100060143 201
844 3300025225 Ga0209566_100075 Ga0209566_100075143 201
845 3300025226 Ga0209674_100100 Ga0209674_100100143 201
846 3300025229 Ga0209147_100096 Ga0209147_100096143 201
847 3300025230 Ga0209563_100118 Ga0209563_10011832 201
848 3300025231 Ga0207427_100063 Ga0207427_10006370 201
849 3300025233 Ga0209437_100133 Ga0209437_100133114 201
850 3300025233 Ga0209437_101986 Ga0209437_1019862 201
851 3300025242 Ga0209258_100221 Ga0209258_10022132 201
852 3300025246 Ga0209646_1000474 Ga0209646_10004748 201
853 3300025253 Ga0209677_100057 Ga0209677_100057143 201
854 3300025261 Ga0209233_1000133 Ga0209233_1000133142 201
855 3300025292 Ga0209676_1000264 Ga0209676_100026490 201
856 3300025711 Ga0207696_1000126 Ga0207696_100012649 201
857 3300025711 Ga0207696_1014911 Ga0207696_10149112 201
858 3300025711 Ga0207696_1027576 Ga0207696_10275762 201
859 3300025728 Ga0207655_1000120 Ga0207655_100012076 201
860 3300025728 Ga0207655_1000213 Ga0207655_100021365 201
861 3300025728 Ga0207655_1012701 Ga0207655_10127015 201
862 3300025728 Ga0207655_1014515 Ga0207655_10145152 201
863 3300025728 Ga0207655_1019894 Ga0207655_10198942 201
864 3300025735 Ga0207713_1000337 Ga0207713_100033752 201
865 3300025735 Ga0207713_1003914 Ga0207713_10039142 201
866 3300025735 Ga0207713_1005481 Ga0207713_10054813 201
867 3300025735 Ga0207713_1007268 Ga0207713_10072682 201
868 3300025735 Ga0207713_1018734 Ga0207713_10187343 201
869 3300025914 Ga0207671_10000373 Ga0207671_1000037339 201
870 3300025920 Ga0207649_10000126 Ga0207649_1000012616 201
871 3300025923 Ga0207681_10000148 Ga0207681_1000014821 201
872 3300025925 Ga0207650_10000533 Ga0207650_1000053327 201
873 3300025933 Ga0207706_10000871 Ga0207706_100008712 201
874 3300025934 Ga0207686_10000466 Ga0207686_100004662 201
875 3300025935 Ga0207709_10006228 Ga0207709_100062289 201
876 3300025941 Ga0207711_10728876 Ga0207711_107288762 201
877 3300025945 Ga0207679_10000017 Ga0207679_10000017186 201
878 3300025972 Ga0207668_10646386 Ga0207668_106463861 201
879 3300025981 Ga0207640_11096908 Ga0207640_110969081 201
880 3300026041 Ga0207639_10001169 Ga0207639_100011695 201
881 3300026116 Ga0207674_10191000 Ga0207674_101910002 201
882 3300027111 Ga0209281_1005963 Ga0209281_10059632 201
883 3300027312 Ga0209371_1001483 Ga0209371_10014834 201
884 3300027907 Ga0207428_10413492 Ga0207428_104134922 201
885 3300028379 Ga0268266_10109476 Ga0268266_101094762 201
886 3300030500 Ga0268256_1001272 Ga0268256_10012724 201
887 3300030734 Ga0316179_1060254 Ga0316179_10602542 201
888 3300030735 Ga0316178_1105767 Ga0316178_11057675 201
889 3300031344 Ga0265316_10148327 Ga0265316_101483272 201
890 3300031507 Ga0307509_10134890 Ga0307509_101348902 201
891 3300031548 Ga0307408_100245490 Ga0307408_1002454902 201
892 3300031730 Ga0307516_10132262 Ga0307516_101322622 201
893 3300031731 Ga0307405_10527268 Ga0307405_105272682 201
894 3300031901 Ga0307406_10289134 Ga0307406_102891341 201
895 3300031911 Ga0307412_10514898 Ga0307412_105148982 201
896 3300031995 Ga0307409_100024641 Ga0307409_1000246414 201
897 3300032004 Ga0307414_10120429 Ga0307414_101204292 201
898 3300032004 Ga0307414_10606076 Ga0307414_106060761 201
899 3300032005 Ga0307411_10248303 Ga0307411_102483031 201
900 3300041411 Ga0439466_0045262 Ga0439466_0045262_96_701 201
901 3300041491 Ga0451833_0077913 Ga0451833_0077913_20_625 201
902 3300042006 Ga0439432_018955 Ga0439432_018955_371_982 201
903 3300042009 Ga0439451_020165 Ga0439451_020165_229_834 201
904 3300042010 Ga0439452_001222 Ga0439452_001222_4511_5116 201
905 3300042013 Ga0439456_000141 Ga0439456_000141_18434_19042 201
906 3300042013 Ga0439456_005505 Ga0439456_005505_149_754 201
907 3300042016 Ga0439463_014348 Ga0439463_014348_18_623 201
908 3300042115 Ga0450911_000626 Ga0450911_000626_4211_4816 201
909 3300042137 Ga0450902_040737 Ga0450902_040737_74_679 201
910 3300042142 Ga0450905_018580 Ga0450905_018580_255_860 201
911 3300042145 Ga0450906_006391 Ga0450906_006391_1530_2135 201
912 3300042184 Ga0450908_054054 Ga0450908_054054_77_682 201
913 3300042531 Ga0450918_021865 Ga0450918_021865_454_1059 201
914 3300046453 Ga0495627_003628 Ga0495627_003628_1258_1863 201
915 3300046453 Ga0495627_008018 Ga0495627_008018_2115_2720 201
916 3300046453 Ga0495627_053563 Ga0495627_053563_115_720 201
917 3300046453 Ga0495627_118335 Ga0495627_118335_94_699 201
918 3300046458 Ga0495591_006333 Ga0495591_006333_4352_4957 201
919 3300046458 Ga0495591_015809 Ga0495591_015809_765_1370 201
920 3300046463 Ga0495653_0037066 Ga0495653_0037066_441_1046 201
921 3300046471 Ga0495650_0035072 Ga0495650_0035072_458_1063 201
922 3300046471 Ga0495650_0043917 Ga0495650_0043917_113_718 201
923 3300046474 Ga0495605_0000033 Ga0495605_0000033_96263_96868 201
924 3300046492 Ga0495585_0006203 Ga0495585_0006203_530_1135 201
925 3300046499 Ga0495594_0001513 Ga0495594_0001513_7804_8409 201
926 3300046501 Ga0495607_0069590 Ga0495607_0069590_1296_1901 201
927 3300046501 Ga0495607_0070533 Ga0495607_0070533_75_680 201
928 3300046506 Ga0495583_0000031 Ga0495583_0000031_157577_158182 201
929 3300046506 Ga0495583_0029423 Ga0495583_0029423_703_1308 201
930 3300046507 Ga0495606_0011142 Ga0495606_0011142_4704_5309 201
931 3300046507 Ga0495606_0014345 Ga0495606_0014345_1070_1675 201
932 3300046507 Ga0495606_0125346 Ga0495606_0125346_513_1118 201
933 3300046507 Ga0495606_0283963 Ga0495606_0283963_215_820 201
934 3300046512 Ga0495610_0013781 Ga0495610_0013781_2736_3341 201
935 3300046513 Ga0495616_0102324 Ga0495616_0102324_225_830 201
936 3300046515 Ga0495620_0000007 Ga0495620_0000007_9915_10520 201
937 3300046515 Ga0495620_0000038 Ga0495620_0000038_26803_27408 201
938 3300046515 Ga0495620_0004557 Ga0495620_0004557_2182_2787 201
939 3300046515 Ga0495620_0005192 Ga0495620_0005192_2080_2685 201
940 3300046515 Ga0495620_0063342 Ga0495620_0063342_585_1190 201
941 3300046518 Ga0495631_0004485 Ga0495631_0004485_4628_5233 201
942 3300046518 Ga0495631_0037107 Ga0495631_0037107_929_1534 201
943 3300046519 Ga0495632_0006780 Ga0495632_0006780_2196_2801 201
944 3300046519 Ga0495632_0022838 Ga0495632_0022838_1607_2212 201
945 3300046519 Ga0495632_0032902 Ga0495632_0032902_1286_1891 201
946 3300046520 Ga0495637_0008245 Ga0495637_0008245_1123_1728 201
947 3300046520 Ga0495637_0094202 Ga0495637_0094202_60_665 201
948 3300046522 Ga0495643_0002175 Ga0495643_0002175_12777_13382 201
949 3300046522 Ga0495643_0008648 Ga0495643_0008648_3046_3651 201
950 3300046522 Ga0495643_0254413 Ga0495643_0254413_184_789 201
951 3300046524 Ga0495648_0012362 Ga0495648_0012362_4405_5010 201
952 3300046524 Ga0495648_0084162 Ga0495648_0084162_876_1481 201
953 3300046530 Ga0495654_0010726 Ga0495654_0010726_1756_2361 201
954 3300046530 Ga0495654_0028574 Ga0495654_0028574_1246_1851 201
955 3300046538 Ga0495609_0000018 Ga0495609_0000018_195994_196599 201
956 3300046538 Ga0495609_0005137 Ga0495609_0005137_4285_4890 201
957 3300046542 Ga0495597_0005264 Ga0495597_0005264_1338_1943 201
958 3300046542 Ga0495597_0022781 Ga0495597_0022781_850_1455 201
959 3300046557 Ga0495622_0004180 Ga0495622_0004180_1291_1896 201
960 3300046558 Ga0495633_0000062 Ga0495633_0000062_139476_140081 201
961 3300046558 Ga0495633_0006688 Ga0495633_0006688_5012_5617 201
962 3300046660 Ga0495625_0257171 Ga0495625_0257171_10_615 201
963 3300046665 Ga0495661_0000016 Ga0495661_0000016_80979_81584 201
964 3300046665 Ga0495661_0000093 Ga0495661_0000093_43164_43769 201
965 3300046665 Ga0495661_0023098 Ga0495661_0023098_1296_1901 201
966 3300046665 Ga0495661_0068289 Ga0495661_0068289_44_649 201
967 3300046665 Ga0495661_0083912 Ga0495661_0083912_811_1416 201
968 3300046691 Ga0495670_0010693 Ga0495670_0010693_167_772 201
969 3300046692 Ga0495671_0027184 Ga0495671_0027184_2188_2793 201
970 3300046692 Ga0495671_0261088 Ga0495671_0261088_206_811 201
971 3300046694 Ga0495649_0101657 Ga0495649_0101657_106_711 201
972 3300046794 Ga0495589_0004928 Ga0495589_0004928_2080_2685 201
973 3300046794 Ga0495589_0010829 Ga0495589_0010829_3373_3978 201
974 3300046794 Ga0495589_0036261 Ga0495589_0036261_378_983 201
975 3300046810 Ga0495660_0007942 Ga0495660_0007942_1187_1792 201
976 3300046810 Ga0495660_0010368 Ga0495660_0010368_3118_3723 201
977 3300047320 Ga0495672_0009254 Ga0495672_0009254_5011_5616 201
978 3300047320 Ga0495672_0263274 Ga0495672_0263274_149_754 201
979 3300047321 Ga0495676_0016099 Ga0495676_0016099_4656_5261 201
980 3300047323 Ga0495683_0000043 Ga0495683_0000043_38743_39348 201
981 3300047323 Ga0495683_0000092 Ga0495683_0000092_1548_2153 201
982 3300047446 Ga0495679_000946 Ga0495679_000946_3453_4058 201
983 3300047469 Ga0495673_0004060 Ga0495673_0004060_2099_2704 201
984 3300047469 Ga0495673_0012885 Ga0495673_0012885_1291_1896 201
985 3300047470 Ga0495681_0008735 Ga0495681_0008735_1262_1867 201
986 3300047470 Ga0495681_0089305 Ga0495681_0089305_719_1324 201
987 3300047470 Ga0495681_0098812 Ga0495681_0098812_177_782 201
988 3300047470 Ga0495681_0273371 Ga0495681_0273371_41_646 201
989 3300048091 Ga0495626_0019578 Ga0495626_0019578_1459_2064 201
990 3300048903 Ga0496100_0640719 Ga0496100_0640719_181_786 201
991 3300048917 Ga0496114_0118427 Ga0496114_0118427_613_1218 201
992 3300048917 Ga0496114_0215007 Ga0496114_0215007_89_733 201
993 3300048919 Ga0496116_0016024 Ga0496116_0016024_4206_4811 201
994 3300048919 Ga0496116_0106247 Ga0496116_0106247_706_1311 201
995 3300048920 Ga0496117_0000898 Ga0496117_0000898_43936_44541 201
996 3300048920 Ga0496117_0008620 Ga0496117_0008620_2077_2682 201
997 3300048920 Ga0496117_0017059 Ga0496117_0017059_1057_1662 201
998 3300048920 Ga0496117_0031465 Ga0496117_0031465_1150_1755 201
999 3300048920 Ga0496117_0086895 Ga0496117_0086895_1267_1872 201
1000 3300048920 Ga0496117_0114230 Ga0496117_0114230_1046_1651 201
1001 3300048920 Ga0496117_0117687 Ga0496117_0117687_1023_1628 201
1002 3300048921 Ga0496118_0010838 Ga0496118_0010838_6440_7045 201
1003 3300048921 Ga0496118_0019310 Ga0496118_0019310_4414_5019 201
1004 3300048921 Ga0496118_0068650 Ga0496118_0068650_1234_1839 201
1005 3300048921 Ga0496118_0095921 Ga0496118_0095921_1360_1965 201
1006 3300048922 Ga0496119_0000479 Ga0496119_0000479_9037_9642 201
1007 3300048922 Ga0496119_0078114 Ga0496119_0078114_1295_1900 201
1008 3300048923 Ga0496120_0044292 Ga0496120_0044292_1059_1664 201
1009 3300048923 Ga0496120_0063510 Ga0496120_0063510_160_765 201
1010 3300048923 Ga0496120_0114855 Ga0496120_0114855_70_675 201
1011 3300048925 Ga0496122_0054173 Ga0496122_0054173_1337_1942 201
1012 3300048925 Ga0496122_0068053 Ga0496122_0068053_1178_1783 201
1013 3300048926 Ga0496123_0000207 Ga0496123_0000207_33931_34536 201
1014 3300048926 Ga0496123_0016087 Ga0496123_0016087_1072_1677 201
1015 3300048926 Ga0496123_0091432 Ga0496123_0091432_769_1374 201
1016 3300048927 Ga0496124_0014871 Ga0496124_0014871_681_1286 201
1017 3300048927 Ga0496124_0018490 Ga0496124_0018490_852_1457 201
1018 3300048927 Ga0496124_0083001 Ga0496124_0083001_743_1348 201
1019 3300048927 Ga0496124_0312062 Ga0496124_0312062_451_1056 201
1020 3300048927 Ga0496124_0488112 Ga0496124_0488112_33_644 201
1021 3300048928 Ga0496125_0017414 Ga0496125_0017414_4140_4745 201
1022 3300048928 Ga0496125_0036895 Ga0496125_0036895_1289_1894 201
1023 3300048928 Ga0496125_0054842 Ga0496125_0054842_518_1123 201
1024 3300048928 Ga0496125_0110447 Ga0496125_0110447_104_709 201
1025 3300048929 Ga0496126_0129707 Ga0496126_0129707_1239_1844 201
1026 3300048929 Ga0496126_0143436 Ga0496126_0143436_1422_2027 201
1027 3300048929 Ga0496126_0146719 Ga0496126_0146719_254_859 201
1028 3300049459 Ga0495678_000021 Ga0495678_000021_95898_96503 201
1029 3300049459 Ga0495678_004847 Ga0495678_004847_2051_2656 201
1030 3300049459 Ga0495678_047663 Ga0495678_047663_248_853 201
1031 3300049459 Ga0495678_116243 Ga0495678_116243_162_767 201
1032 3300049460 Ga0495682_0003584 Ga0495682_0003584_4823_5428 201
1033 3300049758 Ga0501241_001278 Ga0501241_001278_4402_5007 201
1034 3300053111 Ga0500572_132320 Ga0500572_132320_81_686 201
1035 3300053125 Ga0500618_017437 Ga0500618_017437_858_1463 201
1036 iso_pu_bacteria 3007315729 3007317308 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04390

LptE

Lipopolysaccharide-assembly

45

167

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h1r-assembly1.cif.gz_B crystal structure of lptde-yifl complex 0.9288 18 187
5iva-assembly1.cif.gz_B the lps transporter lptde from pseudomonas aeruginosa, core complex 0.9146 18 161
8h1r-assembly1.cif.gz_B crystal structure of lptde-yifl complex 0.9133 18 187
5iv8-assembly1.cif.gz_B the lps transporter lptde from klebsiella pneumoniae, core complex 0.8852 31 154
2r76-assembly1.cif.gz_A crystal structure of the rare lipoprotein b (so_1173) from shewanella oneidensis, northeast structural genomics consortium target sor91a 0.8829 33 154
ID Description Score Start End Superfamily
af_O45003_1_124_2.60.40.2240 Mainly Beta;Sandwich;Immunoglobulin-like;Acyl-CoA thioester hydrolase/BAAT N-terminal domain 0.8677 95 116 2.60.40.2240
2r76B00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.8508 33 151 3.30.160.150
2jxpA01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.8371 33 164 3.30.160.150
af_A0A0P0XKI8_1_297_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8325 32 62 3.40.50.720
2n8xA00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.8251 19 180 3.30.160.150
ID Description Score Start End GO Terms
AF-A0A656JK98-F1-model_v4 Lipoprotein 0.9741 36 180 GO:0001530
GO:0009279
GO:0015920
GO:0043165
GO:1990351
AF-A0A7Y7YKV5-F1-model_v4 Uncharacterized protein 0.9595 40 159 GO:0001530
GO:0009279
GO:0015920
GO:0043165
GO:1990351
AF-U2B9E9-F1-model_v4 RplB family lipoprotein 0.9575 14 179 GO:0001530
GO:0009279
GO:0015920
GO:0043165
GO:1990351
AF-A0A656JK98-F1-model_v4 Lipoprotein 0.9547 36 180 GO:0001530
GO:0009279
GO:0015920
GO:0043165
GO:1990351
AF-A0A1I4T8W6-F1-model_v4 LPS-assembly lipoprotein LptE 0.9451 14 172 GO:0001530
GO:0009279
GO:0015920
GO:0043165
GO:1990351

Feature Viewer

pLDDT pTM Quality
81.12 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map