F488735

General Info

Members Datasets Scaffolds Average Seq Length
1037 366 2074 225

Family's Representative Sequence

Representative Sequence 3300002737|JGI25162J39368_1000312|JGI25162J39368_100031232
Length 236
Sequence MALTHPAPEPIMLLHIPNILDQAQVRAIRASLDEATWTDGRETVGHQGAKVKRNLQLPDASPLRGELGRVVLDALARNPLYHAATLPLRTLTPRFNRYEGGGQYGFHVDGAVMSLPDGSQLRSDISCTLFLAEPEEYDGGELIISDTYGEHEVKLPAGDAIIYPSSSLHRVAPVTRGARIAAFFWVQSLIRDDGKRRLLFELDASIQALTHTQADPQALLQLTGVYHNLLRQWSET

Samples

Sample ID Description Type Environment
1 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
14 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
15 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
24 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
104 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
112 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
114 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
115 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
116 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
177 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
181 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
186 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
189 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
206 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
228 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
262 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
263 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
264 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
294 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
308 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
319 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
320 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
323 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
325 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
326 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
327 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
328 2643221556 Massilia sp. Root1485 Isolate Unclassified
329 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
330 2643221684 Massilia sp. Root133 Isolate Unclassified
331 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
332 2734482264 Dyella sp. AD052 Isolate Unclassified
333 2738541297 Duganella sp. GV083 Isolate Unclassified
334 2738541357 Duganella sp. GV053 Isolate Unclassified
335 2738543003 Duganella sp. GV066 Isolate Unclassified
336 2738543009 Luteibacter sp. OK325 Isolate Unclassified
337 2738543026 Duganella sp. GV089 Isolate Unclassified
338 2738543029 Duganella sp. GV039 Isolate Unclassified
339 2739367700 Dyella sp. YR388 Isolate Unclassified
340 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
341 2818991457 Xanthomonas translucens 569 Isolate Unclassified
342 2821131069 Duganella sp. 1224 Isolate Unclassified
343 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
344 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
345 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
346 2857564685 Duganella sp. R-74599 Isolate Unclassified
347 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
348 2884411467 Dyella sp. AD56 Isolate Rhizosphere
349 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
350 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
351 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
352 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
353 2919085039 Luteibacter sp. 1214 Isolate Unclassified
354 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
355 2919404418 Luteibacter sp. 3190 Isolate Unclassified
356 2928963466 Dyella japonica 1073 Isolate Unclassified
357 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
358 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
359 2941471342 Luteibacter sp. 621 Isolate Unclassified
360 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
361 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
362 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
363 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
364 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
365 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
366 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.6
Metatranscriptomes 1.35
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.62
Nodule 0
Rhizoplane 2.7
Rhizosphere 77.63
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000312 3300002737 Bacteria 43079
2 JGI24736J21556_1002906 3300001904 Bacteria 3005
3 JGI24736J21556_1005738 3300001904 Bacteria 2098
4 JGI24741J21665_1000666 3300001915 Bacteria 10367
5 JGI24741J21665_1001511 3300001915 Bacteria 6614
6 JGI24741J21665_1003717 3300001915 Bacteria 3557
7 JGI24741J21665_1011843 3300001915 Bacteria 1514
8 JGI24740J21852_10000037 3300001979 Bacteria 44368
9 JGI24740J21852_10000584 3300001979 Bacteria 15700
10 JGI24740J21852_10032002 3300001979 Bacteria 1688
11 JGI24737J22298_10018852 3300001990 Bacteria 2210
12 JGI24735J21928_10001404 3300002067 Bacteria 8506
13 JGI24738J21930_10002823 3300002075 Bacteria 4452
14 JGI25156J39149_1001792 3300002705 Bacteria 8444
15 JGI25156J39149_1001934 3300002705 Bacteria 8014
16 JGI25162J39368_1002139 3300002737 Bacteria 8295
17 JGI25162J39368_1002144 3300002737 Bacteria 8275
18 JGI25157J39369_1000191 3300002741 Bacteria 51859
19 JGI25157J39369_1001516 3300002741 Bacteria 8444
20 JGI25157J39369_1001585 3300002741 Bacteria 8014
21 JGI25163J39215_1000093 3300002771 Bacteria 37259
22 JGI25164J39214_1000140 3300002772 Bacteria 70123
23 JGI25164J39214_1000782 3300002772 Bacteria 11508
24 JGI25164J39214_1001047 3300002772 Bacteria 8295
25 JGI25152J39213_1000164 3300002773 Bacteria 45374
26 JGI25150J39212_1000286 3300002774 Bacteria 26314
27 JGI25150J39212_1012052 3300002774 Bacteria 1544
28 JGI25159J45721_1001532 3300002987 Bacteria 9476
29 JGI25151J46595_10000351 3300003187 Bacteria 49103
30 JGI25165J46597_1000261 3300003214 Bacteria 70135
31 JGI25165J46597_1001921 3300003214 Bacteria 8295
32 JGI25165J46597_1014299 3300003214 Bacteria 1081
33 JGI25153J46596_10000219 3300003215 Bacteria 49103
34 rootH1_10033081 3300003316 Bacteria 8009
35 rootH1_10113747 3300003316 Bacteria 2658
36 rootH2_10010359 3300003320 Bacteria 12893
37 rootH2_10039202 3300003320 Bacteria 37554
38 rootH2_10066632 3300003320 Bacteria 2499
39 rootH2_10124204 3300003320 Bacteria 1882
40 rootH2_10137845 3300003320 Bacteria 5918
41 rootL2_10001944 3300003322 Bacteria 3441
42 rootL2_10041905 3300003322 Bacteria 4463
43 rootL2_10148929 3300003322 Unclassified 1681
44 rootL2_10157852 3300003322 Bacteria 3803
45 rootL2_10207723 3300003322 Bacteria 1381
46 rootH1_10005577 3300003323 Bacteria 6507
47 rootH1_10019292 3300003323 Bacteria 5407
48 rootH1_10071486 3300003323 Bacteria 4059
49 rootH1_10274537 3300003323 Bacteria 2499
50 Ga0006562J51391_1054910 3300003578 Bacteria 2260
51 Ga0006562J51391_1054911 3300003578 Bacteria 1300
52 Ga0055538_1000476 3300003751 Bacteria 14728
53 Ga0055535_1000171 3300003761 Bacteria 70123
54 Ga0055542_1000400 3300003762 Bacteria 43079
55 Ga0055542_1000461 3300003762 Bacteria 38427
56 Ga0055529_1000260 3300003763 Bacteria 62931
57 Ga0055526_1000442 3300003771 Bacteria 32968
58 Ga0055537_1000128 3300003773 Bacteria 58218
59 Ga0055534_1000120 3300003784 Bacteria 57897
60 Ga0055528_1000550 3300003790 Bacteria 28631
61 Ga0058692_1000015 3300003856 Bacteria 295729
62 Ga0055543_1002426 3300004625 Bacteria 6180
63 Ga0065165_1000067 3300005262 Bacteria 170811
64 Ga0065165_1000818 3300005262 Bacteria 41213
65 Ga0065704_10070933 3300005289 Bacteria 14461
66 Ga0065704_10123342 3300005289 Bacteria 1735
67 Ga0070658_10106813 3300005327 Bacteria 2316
68 Ga0070658_10159279 3300005327 Bacteria 1893
69 Ga0070670_100001488 3300005331 Bacteria 18875
70 Ga0070670_100473814 3300005331 Bacteria 1111
71 Ga0070680_100003990 3300005336 Bacteria 11044
72 Ga0070680_100034826 3300005336 Bacteria 4062
73 Ga0070680_100036495 3300005336 Bacteria 3971
74 Ga0070680_100238402 3300005336 Bacteria 1537
75 Ga0070682_100006699 3300005337 Bacteria 6459
76 Ga0070660_100045033 3300005339 Bacteria 3376
77 Ga0070660_100054719 3300005339 Bacteria 3082
78 Ga0070660_100126984 3300005339 Bacteria 2038
79 Ga0070689_100004588 3300005340 Bacteria 9352
80 Ga0070691_10001408 3300005341 Bacteria 10265
81 Ga0070691_10077243 3300005341 Bacteria 1625
82 Ga0070661_100006000 3300005344 Bacteria 8363
83 Ga0070661_100014638 3300005344 Bacteria 5530
84 Ga0070661_100056019 3300005344 Bacteria 2887
85 Ga0070692_10000349 3300005345 Bacteria 13461
86 Ga0070692_10018555 3300005345 Bacteria 3348
87 Ga0070692_10111518 3300005345 Bacteria 1513
88 Ga0070669_100026647 3300005353 Bacteria 4160
89 Ga0070688_100036531 3300005365 Bacteria 2989
90 Ga0070659_100123250 3300005366 Bacteria 2101
91 Ga0070709_10307087 3300005434 Bacteria 1160
92 Ga0070714_100000030 3300005435 Bacteria 136610
93 Ga0070714_100002591 3300005435 Bacteria 13323
94 Ga0070710_10117064 3300005437 Bacteria 1608
95 Ga0070694_100131979 3300005444 Bacteria 1805
96 Ga0070663_100077028 3300005455 Bacteria 2440
97 Ga0070663_100081562 3300005455 Bacteria 2378
98 Ga0070663_100129959 3300005455 Bacteria 1912
99 Ga0070663_100217352 3300005455 Bacteria 1499
100 Ga0070662_100008587 3300005457 Bacteria 6662
101 Ga0070662_100036431 3300005457 Bacteria 3480
102 Ga0070681_10009936 3300005458 Bacteria 9377
103 Ga0070681_10011748 3300005458 Bacteria 8678
104 Ga0070681_10027064 3300005458 Bacteria 5766
105 Ga0070681_10146729 3300005458 Bacteria 2288
106 Ga0070681_10319129 3300005458 Bacteria 1463
107 Ga0068867_100528768 3300005459 Bacteria 1018
108 Ga0070685_10003463 3300005466 Bacteria 8025
109 Ga0070679_100001900 3300005530 Bacteria 18753
110 Ga0070679_100021990 3300005530 Bacteria 6230
111 Ga0070679_100043309 3300005530 Bacteria 4483
112 Ga0070679_100131137 3300005530 Bacteria 2488
113 Ga0070679_100471970 3300005530 Bacteria 1199
114 Ga0068853_100073218 3300005539 Bacteria 2986
115 Ga0068853_100116259 3300005539 Bacteria 2381
116 Ga0068853_100142626 3300005539 Bacteria 2151
117 Ga0070672_100201098 3300005543 Bacteria 1666
118 Ga0070696_100007797 3300005546 Bacteria 7145
119 Ga0070696_100007838 3300005546 Bacteria 7129
120 Ga0070696_100008642 3300005546 Bacteria 6812
121 Ga0070696_100096135 3300005546 Bacteria 2116
122 Ga0070693_100004730 3300005547 Bacteria 6474
123 Ga0070693_100005999 3300005547 Bacteria 5875
124 Ga0070693_100044740 3300005547 Bacteria 2505
125 Ga0068855_100016916 3300005563 Bacteria 8769
126 Ga0068855_100097413 3300005563 Bacteria 3388
127 Ga0068855_101240988 3300005563 Bacteria 774
128 Ga0070664_100014210 3300005564 Bacteria 6493
129 Ga0070664_100191075 3300005564 Bacteria 1824
130 Ga0068857_100046722 3300005577 Bacteria 3842
131 Ga0068857_100064588 3300005577 Bacteria 3254
132 Ga0068854_100025222 3300005578 Bacteria 4079
133 Ga0068854_100763037 3300005578 Bacteria 840
134 Ga0068856_100000053 3300005614 Bacteria 106241
135 Ga0068856_100050838 3300005614 Bacteria 4087
136 Ga0068856_100071133 3300005614 Bacteria 3443
137 Ga0068852_100045182 3300005616 Bacteria 3745
138 Ga0068852_100107620 3300005616 Bacteria 2529
139 Ga0068852_100840129 3300005616 Bacteria 934
140 Ga0068859_100041924 3300005617 Bacteria 4597
141 Ga0068859_100501873 3300005617 Bacteria 1308
142 Ga0068851_10003312 3300005834 Bacteria 7158
143 Ga0068862_100907268 3300005844 Bacteria 866
144 Ga0070712_100345729 3300006175 Bacteria 1216
145 Ga0075369_10045509 3300006186 Bacteria 1887
146 Ga0097620_100041924 3300006931 Bacteria 4597
147 Ga0097620_100501895 3300006931 Bacteria 1308
148 Ga0105251_10000013 3300009011 Bacteria 163226
149 Ga0105244_10002473 3300009036 Bacteria 13910
150 Ga0105244_10082412 3300009036 Bacteria 1591
151 Ga0105240_10007774 3300009093 Bacteria 15497
152 Ga0105240_10017836 3300009093 Bacteria 9551
153 Ga0105240_10024742 3300009093 Bacteria 7908
154 Ga0105240_10096229 3300009093 Bacteria 3609
155 Ga0105240_10100033 3300009093 Bacteria 3528
156 Ga0105240_10344537 3300009093 Bacteria 1692
157 Ga0105240_10519882 3300009093 Bacteria 1321
158 Ga0105245_10488298 3300009098 Bacteria 1246
159 Ga0105247_10011155 3300009101 Bacteria 5418
160 Ga0105243_10009491 3300009148 Bacteria 7407
161 Ga0105241_10009314 3300009174 Bacteria 7219
162 Ga0105241_10470796 3300009174 Bacteria 1115
163 Ga0105242_10353856 3300009176 Bacteria 1357
164 Ga0105237_10000007 3300009545 Bacteria 367690
165 Ga0105237_10073062 3300009545 Bacteria 3422
166 Ga0105237_10120806 3300009545 Bacteria 2614
167 Ga0105237_10809179 3300009545 Bacteria 944
168 Ga0105238_10004682 3300009551 Bacteria 13532
169 Ga0105238_10054795 3300009551 Bacteria 4004
170 Ga0105238_10067581 3300009551 Bacteria 3575
171 Ga0105238_10330227 3300009551 Bacteria 1512
172 Ga0105239_10004761 3300010375 Bacteria 16108
173 Ga0105239_10019886 3300010375 Bacteria 7411
174 Ga0105239_10330042 3300010375 Bacteria 1721
175 Ga0105239_10344816 3300010375 Bacteria 1681
176 Ga0105246_10233260 3300011119 Bacteria 1450
177 Ga0157373_10043986 3300013100 Bacteria 3188
178 Ga0157373_10099260 3300013100 Bacteria 2049
179 Ga0157373_10135022 3300013100 Bacteria 1735
180 Ga0157373_10151501 3300013100 Bacteria 1631
181 Ga0157373_10213663 3300013100 Bacteria 1360
182 Ga0157373_10291550 3300013100 Bacteria 1157
183 Ga0157371_10044029 3300013102 Bacteria 3179
184 Ga0157371_10061591 3300013102 Bacteria 2660
185 Ga0157371_10179179 3300013102 Bacteria 1515
186 Ga0157371_10203396 3300013102 Bacteria 1420
187 Ga0157370_10000422 3300013104 Bacteria 53330
188 Ga0157370_10010336 3300013104 Bacteria 9847
189 Ga0157370_10048875 3300013104 Bacteria 4052
190 Ga0157370_10058111 3300013104 Bacteria 3676
191 Ga0157370_10153146 3300013104 Bacteria 2145
192 Ga0157370_10266057 3300013104 Bacteria 1584
193 Ga0157370_10319479 3300013104 Bacteria 1432
194 Ga0157369_10003686 3300013105 Bacteria 18204
195 Ga0157369_10005288 3300013105 Bacteria 15040
196 Ga0157369_10011524 3300013105 Bacteria 10044
197 Ga0157369_10017788 3300013105 Bacteria 7980
198 Ga0157369_10188358 3300013105 Bacteria 2169
199 Ga0157369_10813084 3300013105 Bacteria 960
200 Ga0163162_10159801 3300013306 Bacteria 2375
201 Ga0157372_10009194 3300013307 Bacteria 10506
202 Ga0157372_10059965 3300013307 Bacteria 4257
203 Ga0157372_10530410 3300013307 Bacteria 1372
204 Ga0157372_10754388 3300013307 Bacteria 1131
205 Ga0157375_10909234 3300013308 Bacteria 1024
206 Ga0182008_10009937 3300014497 Bacteria 5115
207 Ga0182008_10032454 3300014497 Bacteria 2624
208 Ga0182008_10129187 3300014497 Bacteria 1259
209 Ga0182006_1000062 3300015261 Bacteria 155622
210 Ga0182006_1001193 3300015261 Bacteria 16261
211 Ga0182006_1065974 3300015261 Bacteria 1354
212 Ga0182007_10008394 3300015262 Bacteria 4246
213 Ga0182007_10040340 3300015262 Bacteria 1559
214 Ga0182007_10124603 3300015262 Bacteria 864
215 Ga0182005_1000295 3300015265 Bacteria 30789
216 Ga0182005_1001282 3300015265 Bacteria 10318
217 Ga0182005_1001525 3300015265 Bacteria 9219
218 Ga0182005_1002071 3300015265 Bacteria 7491
219 Ga0182005_1040483 3300015265 Bacteria 1267
220 Ga0183368_1003 3300015687 Bacteria 1276390
221 Ga0163161_10002529 3300017792 Bacteria 13048
222 Ga0163161_10026546 3300017792 Bacteria 4102
223 Ga0197907_10768171 3300020069 Bacteria 1446
224 Ga0197907_11021898 3300020069 Bacteria 1102
225 Ga0206356_10621586 3300020070 Bacteria 3813
226 Ga0206354_10516827 3300020081 Bacteria 7183
227 Ga0206354_11143003 3300020081 Bacteria 1827
228 Ga0206353_10082220 3300020082 Bacteria 3989
229 Ga0206353_10329349 3300020082 Bacteria 4816
230 Ga0206353_10411450 3300020082 Bacteria 1821
231 Ga0206353_10904244 3300020082 Bacteria 3225
232 Ga0154015_1059947 3300020610 Bacteria 1775
233 Ga0154015_1348359 3300020610 Bacteria 18569
234 Ga0213871_10006990 3300021441 Bacteria 2416
235 Ga0209760_100464 3300025207 Bacteria 8944
236 Ga0209784_100011 3300025224 Bacteria 546770
237 Ga0209566_102770 3300025225 Bacteria 3022
238 Ga0209674_100819 3300025226 Bacteria 10355
239 Ga0209672_105941 3300025228 Bacteria 2040
240 Ga0209563_100007 3300025230 Bacteria 1579402
241 Ga0207427_100019 3300025231 Bacteria 513977
242 Ga0207427_100118 3300025231 Bacteria 102109
243 Ga0207427_100120 3300025231 Bacteria 101516
244 Ga0209437_100020 3300025233 Bacteria 656374
245 Ga0209437_100054 3300025233 Bacteria 366715
246 Ga0209437_100231 3300025233 Bacteria 94387
247 Ga0209437_100362 3300025233 Bacteria 50377
248 Ga0209437_100822 3300025233 Bacteria 13804
249 Ga0209258_100216 3300025242 Bacteria 111904
250 Ga0209258_100642 3300025242 Bacteria 26804
251 Ga0209258_101611 3300025242 Bacteria 7363
252 Ga0207425_1000111 3300025245 Bacteria 77375
253 Ga0209646_1000661 3300025246 Bacteria 12795
254 Ga0209026_1000146 3300025250 Bacteria 111481
255 Ga0209026_1000205 3300025250 Bacteria 81843
256 Ga0209026_1001897 3300025250 Bacteria 8496
257 Ga0209677_103028 3300025253 Bacteria 5782
258 Ga0209677_111709 3300025253 Bacteria 1350
259 Ga0209148_1000001 3300025254 Bacteria 2545271
260 Ga0209148_1000005 3300025254 Bacteria 1806504
261 Ga0209148_1002293 3300025254 Bacteria 6886
262 Ga0209759_1000418 3300025256 Bacteria 52100
263 Ga0209759_1001506 3300025256 Bacteria 12845
264 Ga0209759_1001727 3300025256 Bacteria 11275
265 Ga0209759_1011457 3300025256 Bacteria 2520
266 Ga0209129_1000087 3300025258 Bacteria 179582
267 Ga0209129_1000445 3300025258 Bacteria 30882
268 Ga0209233_1000002 3300025261 Bacteria 2501366
269 Ga0209233_1000020 3300025261 Bacteria 798224
270 Ga0209233_1000147 3300025261 Bacteria 186517
271 Ga0209233_1012091 3300025261 Bacteria 2516
272 Ga0209565_1000006 3300025263 Bacteria 897294
273 Ga0209455_1000019 3300025272 Bacteria 705658
274 Ga0209455_1000474 3300025272 Bacteria 30028
275 Ga0209455_1005243 3300025272 Bacteria 4052
276 Ga0209673_1000004 3300025273 Bacteria 896155
277 Ga0209130_1000223 3300025284 Bacteria 74374
278 Ga0209675_1000224 3300025291 Bacteria 57961
279 Ga0209025_1000013 3300025294 Bacteria 871757
280 Ga0209564_1000102 3300025295 Bacteria 222597
281 Ga0209564_1017016 3300025295 Bacteria 2860
282 Ga0209758_1000014 3300025297 Bacteria 871757
283 Ga0209758_1016601 3300025297 Bacteria 3729
284 Ga0209256_1000495 3300025299 Bacteria 57952
285 Ga0209256_1033312 3300025299 Bacteria 1388
286 Ga0209257_1002929 3300025304 Bacteria 15721
287 Ga0207656_10007565 3300025321 Bacteria 3964
288 Ga0207655_1096355 3300025728 Bacteria 1029
289 Ga0207713_1000658 3300025735 Bacteria 32916
290 Ga0207647_10000386 3300025904 Bacteria 35954
291 Ga0207647_10024168 3300025904 Bacteria 4008
292 Ga0207647_10064426 3300025904 Bacteria 2227
293 Ga0207647_10064854 3300025904 Bacteria 2218
294 Ga0207705_10000438 3300025909 Bacteria 36022
295 Ga0207705_10027147 3300025909 Bacteria 4080
296 Ga0207705_10065415 3300025909 Bacteria 2628
297 Ga0207705_10070534 3300025909 Bacteria 2532
298 Ga0207705_10147122 3300025909 Bacteria 1763
299 Ga0207654_10091054 3300025911 Bacteria 1859
300 Ga0207707_10000379 3300025912 Bacteria 46451
301 Ga0207707_10000422 3300025912 Bacteria 44306
302 Ga0207707_10002334 3300025912 Bacteria 17084
303 Ga0207707_10036091 3300025912 Bacteria 4322
304 Ga0207707_10071702 3300025912 Bacteria 3019
305 Ga0207707_10120994 3300025912 Bacteria 2289
306 Ga0207695_10001343 3300025913 Bacteria 41721
307 Ga0207695_10002840 3300025913 Bacteria 25162
308 Ga0207695_10003487 3300025913 Bacteria 22120
309 Ga0207695_10006343 3300025913 Bacteria 15388
310 Ga0207695_10009743 3300025913 Bacteria 11825
311 Ga0207695_10186221 3300025913 Bacteria 1995
312 Ga0207695_10295616 3300025913 Bacteria 1511
313 Ga0207671_10000763 3300025914 Bacteria 40900
314 Ga0207671_10045028 3300025914 Bacteria 3262
315 Ga0207693_10535794 3300025915 Bacteria 913
316 Ga0207660_10001603 3300025917 Bacteria 15183
317 Ga0207660_10002593 3300025917 Bacteria 11851
318 Ga0207660_10022615 3300025917 Bacteria 4236
319 Ga0207660_10054227 3300025917 Bacteria 2861
320 Ga0207660_10792289 3300025917 Bacteria 773
321 Ga0207657_10001729 3300025919 Bacteria 23532
322 Ga0207657_10005904 3300025919 Bacteria 12746
323 Ga0207657_10047235 3300025919 Bacteria 3766
324 Ga0207649_10002297 3300025920 Bacteria 10755
325 Ga0207649_10192533 3300025920 Bacteria 1435
326 Ga0207649_10490945 3300025920 Bacteria 932
327 Ga0207652_10000022 3300025921 Bacteria 158642
328 Ga0207652_10000368 3300025921 Bacteria 46835
329 Ga0207652_10002541 3300025921 Bacteria 15320
330 Ga0207652_10003502 3300025921 Bacteria 12944
331 Ga0207652_10003947 3300025921 Bacteria 12129
332 Ga0207652_10008434 3300025921 Bacteria 8294
333 Ga0207652_10016897 3300025921 Bacteria 5966
334 Ga0207652_10220127 3300025921 Bacteria 1710
335 Ga0207681_10012606 3300025923 Bacteria 5219
336 Ga0207694_10077421 3300025924 Bacteria 2606
337 Ga0207650_10038304 3300025925 Bacteria 3500
338 Ga0207650_10357966 3300025925 Bacteria 1202
339 Ga0207687_10076002 3300025927 Bacteria 2411
340 Ga0207664_10000026 3300025929 Bacteria 194571
341 Ga0207664_10001262 3300025929 Bacteria 16691
342 Ga0207690_10000976 3300025932 Bacteria 18327
343 Ga0207690_10001043 3300025932 Bacteria 17728
344 Ga0207690_10003295 3300025932 Bacteria 9667
345 Ga0207690_10041774 3300025932 Bacteria 3007
346 Ga0207690_10101287 3300025932 Bacteria 2057
347 Ga0207706_10018132 3300025933 Bacteria 6334
348 Ga0207706_10058916 3300025933 Bacteria 3382
349 Ga0207686_10050122 3300025934 Bacteria 2595
350 Ga0207709_10085455 3300025935 Bacteria 2046
351 Ga0207709_10274525 3300025935 Bacteria 1242
352 Ga0207670_10002684 3300025936 Bacteria 9352
353 Ga0207661_10043391 3300025944 Bacteria 3548
354 Ga0207679_10009166 3300025945 Bacteria 6329
355 Ga0207679_10176683 3300025945 Bacteria 1763
356 Ga0207679_10728137 3300025945 Bacteria 901
357 Ga0207667_10000436 3300025949 Bacteria 55945
358 Ga0207667_10005577 3300025949 Bacteria 15357
359 Ga0207667_10009175 3300025949 Bacteria 11682
360 Ga0207667_10015489 3300025949 Bacteria 8656
361 Ga0207667_10132576 3300025949 Bacteria 2566
362 Ga0207667_10577978 3300025949 Bacteria 1134
363 Ga0207640_10000564 3300025981 Bacteria 22103
364 Ga0207640_10001437 3300025981 Bacteria 12893
365 Ga0207640_10003230 3300025981 Bacteria 8781
366 Ga0207640_10005203 3300025981 Bacteria 7079
367 Ga0207640_10005896 3300025981 Bacteria 6689
368 Ga0207639_10000637 3300026041 Bacteria 24168
369 Ga0207639_10013073 3300026041 Bacteria 5796
370 Ga0207639_10401258 3300026041 Bacteria 1235
371 Ga0207639_10487174 3300026041 Bacteria 1125
372 Ga0207678_10001228 3300026067 Bacteria 23598
373 Ga0207678_10032261 3300026067 Bacteria 4565
374 Ga0207678_10127499 3300026067 Bacteria 2171
375 Ga0207678_10173277 3300026067 Bacteria 1842
376 Ga0207702_10000032 3300026078 Bacteria 168047
377 Ga0207702_10008105 3300026078 Bacteria 8890
378 Ga0207702_10049210 3300026078 Bacteria 3556
379 Ga0207702_10266030 3300026078 Bacteria 1616
380 Ga0207702_10554683 3300026078 Bacteria 1124
381 Ga0207648_11145270 3300026089 Bacteria 730
382 Ga0207674_10011246 3300026116 Bacteria 10060
383 Ga0207674_10223023 3300026116 Bacteria 1833
384 Ga0207698_10000430 3300026142 Bacteria 24181
385 Ga0207698_10000630 3300026142 Bacteria 20437
386 Ga0207698_10617094 3300026142 Bacteria 1071
387 Ga0207698_10806906 3300026142 Bacteria 941
388 Ga0209371_1000011 3300027312 Bacteria 848456
389 Ga0268264_11041746 3300028381 Bacteria 825
390 Ga0268256_1000011 3300030500 Bacteria 848625
391 Ga0307413_10013859 3300031824 Bacteria 4073
392 Ga0307413_10123130 3300031824 Bacteria 1760
393 Ga0307413_10241196 3300031824 Bacteria 1335
394 Ga0307412_10034790 3300031911 Bacteria 3213
395 Ga0307414_10026242 3300032004 Bacteria 3747
396 Ga0395899_0045676 3300037312 Bacteria 3263
397 Ga0395899_0048045 3300037312 Bacteria 3176
398 Ga0395899_0057680 3300037312 Bacteria 2865
399 Ga0395899_0096358 3300037312 Bacteria 2139
400 Ga0395899_0118389 3300037312 Bacteria 1899
401 Ga0395899_0186063 3300037312 Bacteria 1455
402 Ga0395899_0441281 3300037312 Bacteria 854
403 Ga0395900_0000377 3300037418 Bacteria 64395
404 Ga0395900_0000867 3300037418 Bacteria 39764
405 Ga0395900_0017946 3300037418 Bacteria 7223
406 Ga0395900_0034909 3300037418 Bacteria 5180
407 Ga0395900_0043403 3300037418 Bacteria 4635
408 Ga0395900_0061686 3300037418 Bacteria 3854
409 Ga0395900_0061865 3300037418 Bacteria 3848
410 Ga0395900_0089923 3300037418 Bacteria 3156
411 Ga0395900_0123413 3300037418 Bacteria 2656
412 Ga0395900_0165920 3300037418 Bacteria 2250
413 Ga0395900_0413632 3300037418 Bacteria 1310
414 Ga0395900_0476813 3300037418 Bacteria 1200
415 Ga0395900_0717288 3300037418 Bacteria 932
416 Ga0395900_1158105 3300037418 Bacteria 689
417 Ga0395898_0001606 3300037466 Bacteria 30833
418 Ga0395898_0013117 3300037466 Bacteria 8545
419 Ga0395898_0021850 3300037466 Bacteria 6482
420 Ga0395898_0048682 3300037466 Bacteria 4155
421 Ga0395898_0079894 3300037466 Bacteria 3154
422 Ga0395898_0445540 3300037466 Bacteria 1233
423 Ga0395898_0633793 3300037466 Bacteria 1011
424 Ga0395898_0751229 3300037466 Bacteria 916
425 Ga0395905_0000156 3300037471 Bacteria 112215
426 Ga0395905_0044730 3300037471 Bacteria 4154
427 Ga0395905_0119276 3300037471 Bacteria 2479
428 Ga0395905_0166051 3300037471 Bacteria 2074
429 Ga0395905_0260686 3300037471 Bacteria 1618
430 Ga0395905_0293076 3300037471 Bacteria 1514
431 Ga0395905_0379941 3300037471 Bacteria 1306
432 Ga0395905_0393880 3300037471 Bacteria 1279
433 Ga0395905_0423131 3300037471 Bacteria 1228
434 Ga0395905_0469159 3300037471 Bacteria 1157
435 Ga0395901_0003133 3300038443 Bacteria 16607
436 Ga0395901_0007470 3300038443 Bacteria 11034
437 Ga0395901_0008127 3300038443 Bacteria 10595
438 Ga0395901_0010829 3300038443 Bacteria 9244
439 Ga0395901_0018442 3300038443 Bacteria 7123
440 Ga0395901_0034380 3300038443 Bacteria 5234
441 Ga0395901_0177526 3300038443 Bacteria 2233
442 Ga0395901_0195064 3300038443 Bacteria 2123
443 Ga0395901_0248958 3300038443 Bacteria 1852
444 Ga0395901_0379631 3300038443 Bacteria 1455
445 Ga0395901_0828035 3300038443 Bacteria 912
446 Ga0395901_1278162 3300038443 Bacteria 696
447 Ga0237819_00040 3300038705 Bacteria 45528
448 Ga0237816_00041 3300039145 Bacteria 8045
449 Ga0439436_0000438 3300041404 Bacteria 10558
450 Ga0439465_0011177 3300041413 Bacteria 2816
451 Ga0451800_0849097 3300041459 Bacteria 3763
452 Ga0451806_132004 3300041462 Bacteria 1279
453 Ga0439445_0039505 3300042004 Bacteria 1250
454 Ga0439448_0000125 3300042005 Bacteria 14499
455 Ga0439449_0013214 3300042007 Bacteria 3106
456 Ga0439450_025449 3300042008 Bacteria 1297
457 Ga0439455_0001931 3300042012 Bacteria 3644
458 Ga0439446_0000539 3300042156 Bacteria 7620
459 Ga0439458_0007133 3300042157 Bacteria 2487
460 Ga0439458_0020270 3300042157 Bacteria 1535
461 Ga0450908_000085 3300042184 Bacteria 18990
462 Ga0466972_0000981 3300044658 Bacteria 13728
463 Ga0466972_0019906 3300044658 Bacteria 3354
464 Ga0466972_0051805 3300044658 Bacteria 1979
465 Ga0466982_0000003 3300044672 Bacteria 417243
466 Ga0466982_0003001 3300044672 Bacteria 7156
467 Ga0466965_0019561 3300044683 Bacteria 3251
468 Ga0466966_0011779 3300044684 Bacteria 5794
469 Ga0466966_0108720 3300044684 Bacteria 1710
470 Ga0466966_0116376 3300044684 Bacteria 1645
471 Ga0466966_0237856 3300044684 Bacteria 1098
472 Ga0466961_0232598 3300044693 Bacteria 1134
473 Ga0466963_0122689 3300044694 Bacteria 1789
474 Ga0466964_0000822 3300044706 Bacteria 10149
475 Ga0466964_0031549 3300044706 Bacteria 2102
476 Ga0466971_0073629 3300044719 Bacteria 1552
477 Ga0466968_0000628 3300044735 Bacteria 12066
478 Ga0466968_0004407 3300044735 Bacteria 5259
479 Ga0466968_0306209 3300044735 Bacteria 765
480 Ga0466970_0003031 3300044765 Bacteria 8150
481 Ga0466970_0033522 3300044765 Bacteria 2714
482 Ga0466957_0013276 3300044842 Bacteria 4778
483 Ga0466957_0118728 3300044842 Bacteria 1684
484 Ga0466957_0152069 3300044842 Bacteria 1497
485 Ga0466960_0007328 3300044901 Bacteria 4475
486 Ga0466959_0037153 3300045049 Bacteria 3598
487 Ga0466958_0037874 3300045836 Bacteria 2891
488 Ga0466958_0057538 3300045836 Bacteria 2362
489 Ga0466958_0287947 3300045836 Bacteria 1053
490 Ga0466967_0082383 3300045976 Bacteria 2907
491 Ga0466967_0398030 3300045976 Bacteria 1339
492 Ga0466967_1042135 3300045976 Bacteria 815
493 Ga0466967_1214723 3300045976 Bacteria 751
494 Ga0495617_000020 3300046452 Bacteria 230257
495 Ga0495617_000035 3300046452 Bacteria 145195
496 Ga0495617_063588 3300046452 Bacteria 1218
497 Ga0495617_109690 3300046452 Bacteria 893
498 Ga0495627_000243 3300046453 Bacteria 57215
499 Ga0495627_008267 3300046453 Bacteria 3915
500 Ga0495627_033200 3300046453 Bacteria 1619
501 Ga0495627_075752 3300046453 Bacteria 979
502 Ga0495603_0058305 3300046455 Bacteria 2283
503 Ga0495591_025976 3300046458 Bacteria 1829
504 Ga0495638_0000107 3300046460 Bacteria 133008
505 Ga0495638_0000471 3300046460 Bacteria 48459
506 Ga0495638_0001226 3300046460 Bacteria 24272
507 Ga0495638_0079804 3300046460 Bacteria 1989
508 Ga0495638_0162189 3300046460 Bacteria 1289
509 Ga0495638_0324574 3300046460 Bacteria 821
510 Ga0495653_0000082 3300046463 Bacteria 80285
511 Ga0495653_0192882 3300046463 Bacteria 1388
512 Ga0495650_0000011 3300046471 Bacteria 615329
513 Ga0495650_0000462 3300046471 Bacteria 63149
514 Ga0495650_0000607 3300046471 Bacteria 48960
515 Ga0495650_0001057 3300046471 Bacteria 30556
516 Ga0495650_0001457 3300046471 Bacteria 22669
517 Ga0495650_0002636 3300046471 Bacteria 14038
518 Ga0495650_0014912 3300046471 Bacteria 4011
519 Ga0495650_0106164 3300046471 Bacteria 1048
520 Ga0495582_0024280 3300046473 Bacteria 3315
521 Ga0495605_0000234 3300046474 Bacteria 68169
522 Ga0495605_0000249 3300046474 Bacteria 63652
523 Ga0495605_0045715 3300046474 Bacteria 2156
524 Ga0495605_0071561 3300046474 Bacteria 1637
525 Ga0495605_0076838 3300046474 Bacteria 1568
526 Ga0495584_0001550 3300046491 Bacteria 13654
527 Ga0495584_0003045 3300046491 Bacteria 9304
528 Ga0495584_0003415 3300046491 Bacteria 8748
529 Ga0495584_0314309 3300046491 Bacteria 795
530 Ga0495585_0000243 3300046492 Bacteria 56533
531 Ga0495585_0000424 3300046492 Bacteria 40738
532 Ga0495585_0029178 3300046492 Bacteria 3141
533 Ga0495585_0085586 3300046492 Bacteria 1703
534 Ga0495596_0003347 3300046500 Bacteria 8151
535 Ga0495596_0007214 3300046500 Bacteria 5028
536 Ga0495596_0009273 3300046500 Bacteria 4334
537 Ga0495596_0010010 3300046500 Bacteria 4149
538 Ga0495596_0011456 3300046500 Bacteria 3826
539 Ga0495596_0038449 3300046500 Bacteria 1891
540 Ga0495596_0039743 3300046500 Bacteria 1858
541 Ga0495596_0092419 3300046500 Bacteria 1174
542 Ga0495596_0118252 3300046500 Bacteria 1029
543 Ga0495607_0000012 3300046501 Bacteria 195369
544 Ga0495607_0000158 3300046501 Bacteria 71682
545 Ga0495607_0000672 3300046501 Bacteria 33134
546 Ga0495607_0006215 3300046501 Bacteria 8425
547 Ga0495607_0007208 3300046501 Bacteria 7720
548 Ga0495607_0031115 3300046501 Bacteria 3269
549 Ga0495607_0057699 3300046501 Bacteria 2223
550 Ga0495607_0062153 3300046501 Bacteria 2118
551 Ga0495607_0076733 3300046501 Bacteria 1847
552 Ga0495607_0081553 3300046501 Bacteria 1776
553 Ga0495583_0000005 3300046506 Bacteria 636894
554 Ga0495583_0004110 3300046506 Bacteria 10670
555 Ga0495583_0005624 3300046506 Bacteria 8447
556 Ga0495583_0007361 3300046506 Bacteria 6933
557 Ga0495583_0008996 3300046506 Bacteria 6018
558 Ga0495583_0021164 3300046506 Bacteria 3351
559 Ga0495583_0045836 3300046506 Bacteria 2019
560 Ga0495583_0084458 3300046506 Bacteria 1375
561 Ga0495606_0000161 3300046507 Bacteria 117607
562 Ga0495606_0000559 3300046507 Bacteria 59276
563 Ga0495606_0000648 3300046507 Bacteria 54723
564 Ga0495606_0005134 3300046507 Bacteria 12699
565 Ga0495606_0007954 3300046507 Bacteria 9336
566 Ga0495606_0021559 3300046507 Bacteria 4717
567 Ga0495606_0080196 3300046507 Bacteria 2031
568 Ga0495606_0101883 3300046507 Bacteria 1746
569 Ga0495606_0145008 3300046507 Bacteria 1399
570 Ga0495610_0000014 3300046512 Bacteria 444708
571 Ga0495610_0003722 3300046512 Bacteria 11676
572 Ga0495610_0034735 3300046512 Bacteria 2594
573 Ga0495610_0113962 3300046512 Bacteria 1194
574 Ga0495616_0000060 3300046513 Bacteria 98215
575 Ga0495616_0000173 3300046513 Bacteria 54951
576 Ga0495616_0001412 3300046513 Bacteria 16715
577 Ga0495616_0005006 3300046513 Bacteria 8258
578 Ga0495616_0012387 3300046513 Bacteria 4844
579 Ga0495616_0013723 3300046513 Bacteria 4561
580 Ga0495616_0018890 3300046513 Bacteria 3769
581 Ga0495616_0020423 3300046513 Bacteria 3603
582 Ga0495616_0078505 3300046513 Bacteria 1583
583 Ga0495616_0130363 3300046513 Bacteria 1153
584 Ga0495620_0000101 3300046515 Bacteria 68526
585 Ga0495620_0011482 3300046515 Bacteria 4619
586 Ga0495631_0000103 3300046518 Bacteria 55680
587 Ga0495631_0000525 3300046518 Bacteria 25737
588 Ga0495631_0000529 3300046518 Bacteria 25592
589 Ga0495631_0001387 3300046518 Bacteria 14713
590 Ga0495631_0004486 3300046518 Bacteria 7423
591 Ga0495631_0008657 3300046518 Bacteria 5121
592 Ga0495631_0015898 3300046518 Bacteria 3596
593 Ga0495631_0023570 3300046518 Bacteria 2851
594 Ga0495631_0050725 3300046518 Bacteria 1814
595 Ga0495632_0000019 3300046519 Bacteria 215713
596 Ga0495632_0000406 3300046519 Bacteria 40685
597 Ga0495632_0000653 3300046519 Bacteria 31855
598 Ga0495632_0001400 3300046519 Bacteria 20200
599 Ga0495632_0002098 3300046519 Bacteria 15599
600 Ga0495632_0027721 3300046519 Bacteria 2963
601 Ga0495632_0105988 3300046519 Bacteria 1322
602 Ga0495632_0155286 3300046519 Bacteria 1056
603 Ga0495632_0218445 3300046519 Bacteria 862
604 Ga0495637_0011180 3300046520 Bacteria 4317
605 Ga0495637_0041836 3300046520 Bacteria 1963
606 Ga0495643_0005663 3300046522 Bacteria 8375
607 Ga0495643_0028817 3300046522 Bacteria 3110
608 Ga0495643_0031463 3300046522 Bacteria 2952
609 Ga0495643_0034002 3300046522 Bacteria 2815
610 Ga0495643_0047893 3300046522 Bacteria 2313
611 Ga0495643_0118349 3300046522 Bacteria 1340
612 Ga0495644_0019082 3300046523 Bacteria 2617
613 Ga0495648_0000288 3300046524 Bacteria 57183
614 Ga0495648_0000551 3300046524 Bacteria 40309
615 Ga0495648_0003735 3300046524 Bacteria 13273
616 Ga0495648_0013564 3300046524 Bacteria 6012
617 Ga0495648_0013849 3300046524 Bacteria 5940
618 Ga0495648_0015016 3300046524 Bacteria 5640
619 Ga0495648_0017797 3300046524 Bacteria 5066
620 Ga0495648_0027107 3300046524 Bacteria 3842
621 Ga0495648_0032089 3300046524 Bacteria 3451
622 Ga0495648_0088595 3300046524 Bacteria 1739
623 Ga0495642_0000038 3300046528 Bacteria 79256
624 Ga0495642_0000214 3300046528 Bacteria 33632
625 Ga0495642_0002954 3300046528 Bacteria 6772
626 Ga0495642_0013328 3300046528 Bacteria 3178
627 Ga0495642_0022625 3300046528 Bacteria 2477
628 Ga0495642_0032573 3300046528 Bacteria 2091
629 Ga0495642_0076928 3300046528 Bacteria 1401
630 Ga0495642_0077920 3300046528 Bacteria 1392
631 Ga0495642_0180183 3300046528 Bacteria 919
632 Ga0495654_0004328 3300046530 Bacteria 8460
633 Ga0495654_0011622 3300046530 Bacteria 4757
634 Ga0495654_0015883 3300046530 Bacteria 3990
635 Ga0495654_0030279 3300046530 Bacteria 2755
636 Ga0495654_0053327 3300046530 Bacteria 1966
637 Ga0495586_0118195 3300046535 Bacteria 1479
638 Ga0495609_0000021 3300046538 Bacteria 281770
639 Ga0495609_0001140 3300046538 Bacteria 18361
640 Ga0495609_0002120 3300046538 Bacteria 12468
641 Ga0495609_0008668 3300046538 Bacteria 4962
642 Ga0495609_0012401 3300046538 Bacteria 4043
643 Ga0495609_0018696 3300046538 Bacteria 3211
644 Ga0495609_0022596 3300046538 Bacteria 2897
645 Ga0495609_0030593 3300046538 Bacteria 2450
646 Ga0495609_0099269 3300046538 Bacteria 1262
647 Ga0495597_0000515 3300046542 Bacteria 32003
648 Ga0495597_0001373 3300046542 Bacteria 17615
649 Ga0495597_0007248 3300046542 Bacteria 5650
650 Ga0495597_0118743 3300046542 Bacteria 1103
651 Ga0495645_0067913 3300046543 Bacteria 2574
652 Ga0495622_0018204 3300046557 Bacteria 3271
653 Ga0495622_0028393 3300046557 Bacteria 2613
654 Ga0495633_0021925 3300046558 Bacteria 3188
655 Ga0495633_0039324 3300046558 Bacteria 2257
656 Ga0495633_0045599 3300046558 Bacteria 2075
657 Ga0495633_0078396 3300046558 Bacteria 1538
658 Ga0495633_0212925 3300046558 Bacteria 885
659 Ga0495656_0017663 3300046615 Bacteria 2725
660 Ga0495656_0156926 3300046615 Bacteria 1103
661 Ga0495668_0000008 3300046616 Bacteria 498364
662 Ga0495668_0000164 3300046616 Bacteria 99239
663 Ga0495668_0000457 3300046616 Bacteria 52237
664 Ga0495668_0000579 3300046616 Bacteria 44604
665 Ga0495668_0002674 3300046616 Bacteria 14308
666 Ga0495668_0015801 3300046616 Bacteria 4398
667 Ga0495668_0022095 3300046616 Bacteria 3639
668 Ga0495668_0068250 3300046616 Bacteria 1955
669 Ga0495668_0074025 3300046616 Bacteria 1870
670 Ga0495668_0094439 3300046616 Bacteria 1637
671 Ga0495668_0174543 3300046616 Bacteria 1177
672 Ga0495668_0179599 3300046616 Bacteria 1159
673 Ga0495611_0000001 3300046648 Bacteria 2628469
674 Ga0495611_0000397 3300046648 Bacteria 27409
675 Ga0495611_0000957 3300046648 Bacteria 15415
676 Ga0495611_0002336 3300046648 Bacteria 8757
677 Ga0495611_0043514 3300046648 Bacteria 2008
678 Ga0495611_0133572 3300046648 Bacteria 1158
679 Ga0495625_0000325 3300046660 Bacteria 72731
680 Ga0495625_0001449 3300046660 Bacteria 28796
681 Ga0495625_0028480 3300046660 Bacteria 4189
682 Ga0495625_0098430 3300046660 Bacteria 2012
683 Ga0495625_0101869 3300046660 Bacteria 1971
684 Ga0495625_0122610 3300046660 Bacteria 1767
685 Ga0495625_0164742 3300046660 Bacteria 1483
686 Ga0495635_0151952 3300046663 Bacteria 1576
687 Ga0495659_0004044 3300046664 Bacteria 4641
688 Ga0495661_0000052 3300046665 Bacteria 140244
689 Ga0495661_0000403 3300046665 Bacteria 46037
690 Ga0495661_0000731 3300046665 Bacteria 32210
691 Ga0495661_0025016 3300046665 Bacteria 3862
692 Ga0495661_0044535 3300046665 Bacteria 2719
693 Ga0495661_0065974 3300046665 Bacteria 2131
694 Ga0495661_0110041 3300046665 Bacteria 1536
695 Ga0495588_0000184 3300046674 Bacteria 70692
696 Ga0495588_0011307 3300046674 Bacteria 4184
697 Ga0495588_0015485 3300046674 Bacteria 3671
698 Ga0495588_0136486 3300046674 Bacteria 1295
699 Ga0495669_0000807 3300046684 Bacteria 13373
700 Ga0495669_0001911 3300046684 Bacteria 8547
701 Ga0495669_0007554 3300046684 Bacteria 4560
702 Ga0495669_0007628 3300046684 Bacteria 4540
703 Ga0495669_0093117 3300046684 Bacteria 1393
704 Ga0495613_0039901 3300046689 Bacteria 3479
705 Ga0495613_0342114 3300046689 Bacteria 1029
706 Ga0495670_0001047 3300046691 Bacteria 13384
707 Ga0495670_0002879 3300046691 Bacteria 8484
708 Ga0495670_0003247 3300046691 Bacteria 8008
709 Ga0495670_0017824 3300046691 Bacteria 3497
710 Ga0495670_0024119 3300046691 Bacteria 3005
711 Ga0495670_0037578 3300046691 Bacteria 2413
712 Ga0495670_0044174 3300046691 Bacteria 2224
713 Ga0495670_0079655 3300046691 Bacteria 1667
714 Ga0495670_0196149 3300046691 Bacteria 1068
715 Ga0495670_0324776 3300046691 Bacteria 826
716 Ga0495671_0000005 3300046692 Bacteria 509397
717 Ga0495671_0000909 3300046692 Bacteria 21072
718 Ga0495671_0002073 3300046692 Bacteria 12862
719 Ga0495671_0007302 3300046692 Bacteria 6309
720 Ga0495671_0007856 3300046692 Bacteria 6035
721 Ga0495671_0077582 3300046692 Bacteria 1629
722 Ga0495671_0085791 3300046692 Bacteria 1542
723 Ga0495671_0086562 3300046692 Bacteria 1535
724 Ga0495649_0000714 3300046694 Bacteria 27064
725 Ga0495649_0013674 3300046694 Bacteria 4677
726 Ga0495649_0014729 3300046694 Bacteria 4470
727 Ga0495649_0050596 3300046694 Bacteria 2254
728 Ga0495649_0067730 3300046694 Bacteria 1915
729 Ga0495649_0122411 3300046694 Bacteria 1375
730 Ga0495589_0000012 3300046794 Bacteria 248641
731 Ga0495589_0000139 3300046794 Bacteria 66597
732 Ga0495589_0000307 3300046794 Bacteria 39153
733 Ga0495589_0001673 3300046794 Bacteria 12702
734 Ga0495589_0002326 3300046794 Bacteria 10677
735 Ga0495589_0010378 3300046794 Bacteria 4839
736 Ga0495589_0036373 3300046794 Bacteria 2468
737 Ga0495589_0107944 3300046794 Bacteria 1344
738 Ga0495589_0152738 3300046794 Bacteria 1102
739 Ga0495589_0171098 3300046794 Bacteria 1032
740 Ga0495660_0000176 3300046810 Bacteria 69312
741 Ga0495660_0000186 3300046810 Bacteria 66806
742 Ga0495660_0011786 3300046810 Bacteria 5069
743 Ga0495660_0014484 3300046810 Bacteria 4560
744 Ga0495660_0045152 3300046810 Bacteria 2420
745 Ga0495660_0117261 3300046810 Bacteria 1351
746 Ga0495660_0295758 3300046810 Bacteria 735
747 Ga0495581_0036002 3300047315 Bacteria 2863
748 Ga0495604_0023297 3300047317 Bacteria 4939
749 Ga0495636_0049065 3300047318 Bacteria 1765
750 Ga0495672_0000801 3300047320 Bacteria 33909
751 Ga0495672_0002979 3300047320 Bacteria 14898
752 Ga0495672_0003143 3300047320 Bacteria 14375
753 Ga0495676_0000618 3300047321 Bacteria 29417
754 Ga0495680_0215811 3300047322 Bacteria 1371
755 Ga0495683_0001130 3300047323 Bacteria 18377
756 Ga0495683_0064643 3300047323 Bacteria 1806
757 Ga0495683_0124421 3300047323 Bacteria 1221
758 Ga0495683_0182440 3300047323 Bacteria 957
759 Ga0495687_000130 3300047443 Bacteria 115146
760 Ga0495687_000149 3300047443 Bacteria 106301
761 Ga0495687_000193 3300047443 Bacteria 87329
762 Ga0495687_000326 3300047443 Bacteria 61742
763 Ga0495687_002935 3300047443 Bacteria 12944
764 Ga0495687_015774 3300047443 Bacteria 3827
765 Ga0495677_0000019 3300047445 Bacteria 111380
766 Ga0495677_0003492 3300047445 Bacteria 6098
767 Ga0495677_0003797 3300047445 Bacteria 5841
768 Ga0495677_0006852 3300047445 Bacteria 4284
769 Ga0495677_0008147 3300047445 Bacteria 3891
770 Ga0495677_0035489 3300047445 Bacteria 1819
771 Ga0495679_000001 3300047446 Bacteria 1607568
772 Ga0495679_005389 3300047446 Bacteria 5673
773 Ga0495679_018740 3300047446 Bacteria 2447
774 Ga0495679_028314 3300047446 Bacteria 1839
775 Ga0495685_004657 3300047447 Bacteria 4447
776 Ga0495685_007094 3300047447 Bacteria 3691
777 Ga0495685_009073 3300047447 Bacteria 3314
778 Ga0495673_0000009 3300047469 Bacteria 731993
779 Ga0495673_0000012 3300047469 Bacteria 656908
780 Ga0495673_0000072 3300047469 Bacteria 213166
781 Ga0495673_0000798 3300047469 Bacteria 29557
782 Ga0495681_0000403 3300047470 Bacteria 33580
783 Ga0495681_0003907 3300047470 Bacteria 10273
784 Ga0495681_0005230 3300047470 Bacteria 8718
785 Ga0495681_0008236 3300047470 Bacteria 6551
786 Ga0495681_0013771 3300047470 Bacteria 4676
787 Ga0495681_0076585 3300047470 Bacteria 1503
788 Ga0495686_0000263 3300047472 Bacteria 94308
789 Ga0495686_0001334 3300047472 Bacteria 27656
790 Ga0495686_0002561 3300047472 Bacteria 16963
791 Ga0495686_0003427 3300047472 Bacteria 13759
792 Ga0495686_0021564 3300047472 Bacteria 4274
793 Ga0495686_0027591 3300047472 Bacteria 3705
794 Ga0495686_0034555 3300047472 Bacteria 3254
795 Ga0495686_0061419 3300047472 Bacteria 2333
796 Ga0495686_0062769 3300047472 Bacteria 2303
797 Ga0495686_0135386 3300047472 Bacteria 1457
798 Ga0495593_0118586 3300047673 Bacteria 1347
799 Ga0495614_0005923 3300048089 Bacteria 5507
800 Ga0495614_0055808 3300048089 Bacteria 1694
801 Ga0495615_0042158 3300048090 Bacteria 1144
802 Ga0495626_0000082 3300048091 Bacteria 128002
803 Ga0495626_0004262 3300048091 Bacteria 8833
804 Ga0495626_0020593 3300048091 Bacteria 3284
805 Ga0495626_0035231 3300048091 Bacteria 2389
806 Ga0495626_0053994 3300048091 Bacteria 1846
807 Ga0495626_0067093 3300048091 Bacteria 1621
808 Ga0495626_0123139 3300048091 Bacteria 1112
809 Ga0495626_0152188 3300048091 Bacteria 974
810 Ga0496100_0038258 3300048903 Bacteria 3039
811 Ga0496100_0038327 3300048903 Bacteria 3037
812 Ga0496100_0511974 3300048903 Bacteria 925
813 Ga0496101_0001273 3300048904 Bacteria 15089
814 Ga0496101_0407138 3300048904 Bacteria 1071
815 Ga0496102_0172792 3300048905 Bacteria 2034
816 Ga0496102_0380999 3300048905 Bacteria 1327
817 Ga0496102_0835734 3300048905 Bacteria 843
818 Ga0496103_0041532 3300048906 Bacteria 2827
819 Ga0496104_0132231 3300048907 Bacteria 2397
820 Ga0496106_0022509 3300048909 Bacteria 4683
821 Ga0496106_0029220 3300048909 Bacteria 4107
822 Ga0496106_0030235 3300048909 Bacteria 4039
823 Ga0496107_0430914 3300048910 Bacteria 980
824 Ga0496107_0583873 3300048910 Bacteria 827
825 Ga0496109_0019971 3300048912 Bacteria 5915
826 Ga0496110_0000365 3300048913 Bacteria 30306
827 Ga0496110_0413874 3300048913 Bacteria 1229
828 Ga0496111_0228244 3300048914 Bacteria 1383
829 Ga0496112_0147805 3300048915 Bacteria 2318
830 Ga0496113_0001645 3300048916 Bacteria 12596
831 Ga0496113_0018536 3300048916 Bacteria 4850
832 Ga0496115_0000110 3300048918 Bacteria 74992
833 Ga0496115_0001042 3300048918 Bacteria 20129
834 Ga0496115_0049161 3300048918 Bacteria 3375
835 Ga0496115_0415173 3300048918 Bacteria 1091
836 Ga0496117_0000730 3300048920 Bacteria 51618
837 Ga0496117_0042972 3300048920 Bacteria 3292
838 Ga0496118_0002084 3300048921 Bacteria 28123
839 Ga0496118_0002163 3300048921 Bacteria 27366
840 Ga0496118_0002572 3300048921 Bacteria 24227
841 Ga0496118_0014611 3300048921 Bacteria 7340
842 Ga0496118_0048817 3300048921 Bacteria 3264
843 Ga0496119_0000070 3300048922 Bacteria 154395
844 Ga0496119_0001714 3300048922 Bacteria 25570
845 Ga0496119_0096818 3300048922 Bacteria 1664
846 Ga0496119_0161033 3300048922 Bacteria 1193
847 Ga0496120_0000541 3300048923 Bacteria 57865
848 Ga0496120_0000637 3300048923 Bacteria 52193
849 Ga0496120_0002482 3300048923 Bacteria 18555
850 Ga0496120_0029637 3300048923 Bacteria 3339
851 Ga0496120_0119582 3300048923 Bacteria 1364
852 Ga0496121_0000355 3300048924 Bacteria 94479
853 Ga0496121_0000564 3300048924 Bacteria 69827
854 Ga0496121_0001271 3300048924 Bacteria 43433
855 Ga0496121_0010533 3300048924 Bacteria 10403
856 Ga0496121_0033678 3300048924 Bacteria 4631
857 Ga0496121_0035380 3300048924 Bacteria 4478
858 Ga0496121_0052766 3300048924 Bacteria 3410
859 Ga0496122_0001026 3300048925 Bacteria 49313
860 Ga0496122_0002103 3300048925 Bacteria 29505
861 Ga0496122_0022702 3300048925 Bacteria 5568
862 Ga0496122_0027010 3300048925 Bacteria 4925
863 Ga0496122_0041497 3300048925 Bacteria 3637
864 Ga0496122_0053908 3300048925 Bacteria 3026
865 Ga0496122_0057117 3300048925 Bacteria 2902
866 Ga0496122_0079607 3300048925 Bacteria 2289
867 Ga0496122_0084708 3300048925 Bacteria 2191
868 Ga0496122_0107031 3300048925 Bacteria 1849
869 Ga0496122_0123301 3300048925 Bacteria 1665
870 Ga0496123_0000324 3300048926 Bacteria 91012
871 Ga0496123_0001026 3300048926 Bacteria 42452
872 Ga0496123_0003625 3300048926 Bacteria 17092
873 Ga0496123_0007822 3300048926 Bacteria 9950
874 Ga0496123_0013403 3300048926 Bacteria 6887
875 Ga0496123_0029262 3300048926 Bacteria 4060
876 Ga0496123_0050963 3300048926 Bacteria 2761
877 Ga0496124_0000472 3300048927 Bacteria 69226
878 Ga0496124_0003618 3300048927 Bacteria 18770
879 Ga0496124_0004318 3300048927 Bacteria 16672
880 Ga0496124_0021238 3300048927 Bacteria 5985
881 Ga0496124_0081867 3300048927 Bacteria 2651
882 Ga0496124_0149351 3300048927 Bacteria 1835
883 Ga0496124_0309404 3300048927 Bacteria 1137
884 Ga0496124_0382706 3300048927 Bacteria 983
885 Ga0496124_0433169 3300048927 Bacteria 902
886 Ga0496125_0002514 3300048928 Bacteria 23681
887 Ga0496125_0007422 3300048928 Bacteria 11661
888 Ga0496125_0073723 3300048928 Bacteria 2652
889 Ga0496125_0374934 3300048928 Bacteria 841
890 Ga0496126_0000718 3300048929 Bacteria 60240
891 Ga0496126_0005219 3300048929 Bacteria 14980
892 Ga0496126_0006238 3300048929 Bacteria 13323
893 Ga0496126_0021896 3300048929 Bacteria 6235
894 Ga0496126_0030880 3300048929 Bacteria 5071
895 Ga0496126_0337882 3300048929 Bacteria 1234
896 Ga0496126_0520694 3300048929 Bacteria 948
897 Ga0495678_000185 3300049459 Bacteria 72410
898 Ga0495678_000374 3300049459 Bacteria 45408
899 Ga0495678_000506 3300049459 Bacteria 38048
900 Ga0495678_004668 3300049459 Bacteria 7854
901 Ga0495678_065921 3300049459 Bacteria 1343
902 Ga0495682_0000275 3300049460 Bacteria 40479
903 Ga0495682_0003201 3300049460 Bacteria 7354
904 Ga0495682_0008519 3300049460 Bacteria 4036
905 Ga0495682_0064945 3300049460 Bacteria 1316
906 Ga0501031_0005457 3300049568 Bacteria 8274
907 Ga0501031_0032257 3300049568 Bacteria 3415
908 Ga0501031_0060071 3300049568 Bacteria 2477
909 Ga0501031_0128666 3300049568 Bacteria 1654
910 Ga0501032_0016204 3300049569 Bacteria 5243
911 Ga0501033_0006447 3300049570 Bacteria 9183
912 Ga0501033_0006688 3300049570 Bacteria 9007
913 Ga0501033_0087611 3300049570 Bacteria 2278
914 Ga0501033_0111214 3300049570 Bacteria 1993
915 Ga0501033_0182636 3300049570 Bacteria 1503
916 Ga0501034_0001651 3300049571 Bacteria 28815
917 Ga0501034_0027542 3300049571 Bacteria 5781
918 Ga0501034_0253424 3300049571 Bacteria 1704
919 Ga0501034_0315302 3300049571 Bacteria 1497
920 Ga0501034_0657419 3300049571 Bacteria 949
921 Ga0501036_0064375 3300049572 Bacteria 3103
922 Ga0501036_0104709 3300049572 Bacteria 2392
923 Ga0501037_0004887 3300049573 Bacteria 9747
924 Ga0501037_0105163 3300049573 Bacteria 2034
925 Ga0501037_0166522 3300049573 Bacteria 1569
926 Ga0501037_0208218 3300049573 Bacteria 1380
927 Ga0501037_0382711 3300049573 Bacteria 967
928 Ga0501038_0010073 3300049574 Bacteria 8655
929 Ga0501038_0050580 3300049574 Bacteria 3590
930 Ga0501039_0020921 3300049575 Bacteria 5017
931 Ga0501043_0031587 3300049579 Bacteria 4162
932 Ga0501043_0038794 3300049579 Bacteria 3745
933 Ga0501043_0075397 3300049579 Bacteria 2650
934 Ga0501043_0095809 3300049579 Bacteria 2332
935 Ga0501046_0018812 3300049580 Bacteria 5737
936 Ga0501046_0290630 3300049580 Bacteria 1195
937 Ga0501046_0437527 3300049580 Bacteria 941
938 Ga0501047_0020784 3300049581 Bacteria 6306
939 Ga0501047_0025245 3300049581 Bacteria 5710
940 Ga0501047_0029713 3300049581 Bacteria 5269
941 Ga0501047_0036938 3300049581 Bacteria 4721
942 Ga0501047_0258760 3300049581 Bacteria 1588
943 Ga0501048_0031296 3300049582 Bacteria 3849
944 Ga0501069_0016628 3300049585 Bacteria 3953
945 Ga0501069_0017546 3300049585 Bacteria 3855
946 Ga0501069_0105632 3300049585 Bacteria 1600
947 Ga0501070_0003249 3300049586 Bacteria 14120
948 Ga0501070_0007449 3300049586 Bacteria 9296
949 Ga0501070_0025016 3300049586 Bacteria 5007
950 Ga0501070_0032960 3300049586 Bacteria 4333
951 Ga0501070_0045370 3300049586 Bacteria 3655
952 Ga0501070_0066396 3300049586 Bacteria 2987
953 Ga0501070_0275748 3300049586 Bacteria 1373
954 Ga0501070_0695059 3300049586 Bacteria 805
955 Ga0501071_0008172 3300049587 Bacteria 6904
956 Ga0501071_0272646 3300049587 Bacteria 1279
957 Ga0501073_0008332 3300049589 Bacteria 7689
958 Ga0501073_0092458 3300049589 Bacteria 2102
959 Ga0501073_0280705 3300049589 Bacteria 1149
960 Ga0501073_0416012 3300049589 Bacteria 929
961 Ga0501074_0017458 3300049590 Bacteria 5208
962 Ga0501074_0025204 3300049590 Bacteria 4320
963 Ga0501074_0084696 3300049590 Bacteria 2272
964 Ga0501077_0004202 3300049593 Bacteria 8698
965 Ga0501079_0175308 3300049741 Bacteria 1672
966 Ga0501080_0002764 3300049742 Bacteria 15413
967 Ga0501080_0029330 3300049742 Bacteria 5121
968 Ga0501080_0116782 3300049742 Bacteria 2473
969 Ga0501080_0166579 3300049742 Bacteria 2033
970 Ga0501269_001126 3300049766 Bacteria 3706
971 Ga0501035_0005183 3300049822 Bacteria 12327
972 Ga0501035_0013275 3300049822 Bacteria 7602
973 Ga0501035_0015679 3300049822 Bacteria 6995
974 Ga0501035_0049135 3300049822 Bacteria 3781
975 Ga0501035_0071046 3300049822 Bacteria 3083
976 Ga0501035_0090828 3300049822 Bacteria 2688
977 Ga0501044_0012051 3300049823 Bacteria 9364
978 Ga0501044_0012481 3300049823 Bacteria 9200
979 Ga0501044_0014634 3300049823 Bacteria 8460
980 Ga0501044_0048742 3300049823 Bacteria 4374
981 Ga0501044_0065375 3300049823 Bacteria 3709
982 Ga0501044_0079102 3300049823 Bacteria 3332
983 Ga0501044_0084910 3300049823 Bacteria 3199
984 Ga0501044_0203486 3300049823 Bacteria 1937
985 Ga0501044_0557136 3300049823 Bacteria 1043
986 Ga0500643_000158 3300053087 Bacteria 67902
987 Ga0500643_018770 3300053087 Bacteria 2289
988 Ga0500555_001159 3300053103 Bacteria 8670
989 Ga0500586_000882 3300053145 Bacteria 6199
990 Ga0500616_0017213 3300053153 Bacteria 4104
991 Ga0500634_0039971 3300053161 Bacteria 2550
992 Ga0587068_001536 3300059641 Bacteria 2622
993 Ga0466962_0008272 3300061719 Bacteria 4984
994 Ga0466962_0094624 3300061719 Bacteria 1432
995 Ga0466962_0170747 3300061719 Bacteria 1059
996 2538832195 2537561836 Bacteria 3910579
997 2595448109 2593339238 Bacteria 4182970
998 2595451404 2593339239 Bacteria 4124669
999 2643798610 2643221556 Bacteria 7251154
1000 2643829661 2643221562 Bacteria 4048635
1001 2644475616 2643221684 Bacteria 7145183
1002 2721028560 2718218334 Bacteria 4765486
1003 2735835848 2734482264 Unclassified 5014763
1004 2738826333 2738541297 Bacteria 6549566
1005 2739150130 2738541357 Bacteria 6549408
1006 2739192049 2738543003 Bacteria 6549560
1007 2739226949 2738543009 Bacteria 4944499
1008 2739318526 2738543026 Bacteria 6549408
1009 2739336767 2738543029 Bacteria 6549249
1010 2739730178 2739367700 Bacteria 4747630
1011 2819566591 2818991440 Bacteria 4774720
1012 2819660656 2818991457 Bacteria 5323295
1013 2821134859 2821131069 Bacteria 6108407
1014 2842915062 2842914999 Bacteria 4419378
1015 2842921423 2842918807 Bacteria 4289178
1016 2852686522 2852684882 Bacteria 5463342
1017 2857569754 2857564685 Bacteria 6290584
1018 2884339628 2884338543 Bacteria 4610696
1019 2884412232 2884411467 Bacteria 5246714
1020 2895397603 2895395659 Bacteria 3983269
1021 2895499060 2895498888 Bacteria 5283788
1022 2895528025 2895525241 Bacteria 3388457
1023 2904467247 2904463128 Bacteria 4775606
1024 2919086737 2919085039 Bacteria 4532964
1025 2919132730 2919130084 Bacteria 5301837
1026 2919404484 2919404418 Bacteria 4232372
1027 2928965579 2928963466 Bacteria 5165703
1028 2929196899 2929195423 Bacteria 5325372
1029 2939612593 2939611941 Bacteria 3892017
1030 2941474405 2941471342 Bacteria 5018624
1031 2953997418 2953994433 Bacteria 4303959
1032 2990198563 2990196909 Bacteria 4054280
1033 8002869671 8002869464 Bacteria 3588529
1034 8021625942 8021622325 Bacteria 4844743
1035 8021629866 8021626552 Bacteria 4665214
1036 8021652157 8021648035 Bacteria 4772378
1037 8047675632 8047673197 Bacteria 7395230
1038 JGI25162J39368_1000312
1039 JGI24736J21556_1002906
1040 JGI24736J21556_1005738
1041 JGI24741J21665_1000666
1042 JGI24741J21665_1001511
1043 JGI24741J21665_1003717
1044 JGI24741J21665_1011843
1045 JGI24740J21852_10000037
1046 JGI24740J21852_10000584
1047 JGI24740J21852_10032002
1048 JGI24737J22298_10018852
1049 JGI24735J21928_10001404
1050 JGI24738J21930_10002823
1051 JGI25156J39149_1001792
1052 JGI25156J39149_1001934
1053 JGI25162J39368_1002139
1054 JGI25162J39368_1002144
1055 JGI25157J39369_1000191
1056 JGI25157J39369_1001516
1057 JGI25157J39369_1001585
1058 JGI25163J39215_1000093
1059 JGI25164J39214_1000140
1060 JGI25164J39214_1000782
1061 JGI25164J39214_1001047
1062 JGI25152J39213_1000164
1063 JGI25150J39212_1000286
1064 JGI25150J39212_1012052
1065 JGI25159J45721_1001532
1066 JGI25151J46595_10000351
1067 JGI25165J46597_1000261
1068 JGI25165J46597_1001921
1069 JGI25165J46597_1014299
1070 JGI25153J46596_10000219
1071 rootH1_10033081
1072 rootH1_10113747
1073 rootH2_10010359
1074 rootH2_10039202
1075 rootH2_10066632
1076 rootH2_10124204
1077 rootH2_10137845
1078 rootL2_10001944
1079 rootL2_10041905
1080 rootL2_10148929
1081 rootL2_10157852
1082 rootL2_10207723
1083 rootH1_10005577
1084 rootH1_10019292
1085 rootH1_10071486
1086 rootH1_10274537
1087 Ga0006562J51391_1054910
1088 Ga0006562J51391_1054911
1089 Ga0055538_1000476
1090 Ga0055535_1000171
1091 Ga0055542_1000400
1092 Ga0055542_1000461
1093 Ga0055529_1000260
1094 Ga0055526_1000442
1095 Ga0055537_1000128
1096 Ga0055534_1000120
1097 Ga0055528_1000550
1098 Ga0058692_1000015
1099 Ga0055543_1002426
1100 Ga0065165_1000067
1101 Ga0065165_1000818
1102 Ga0065704_10070933
1103 Ga0065704_10123342
1104 Ga0070658_10106813
1105 Ga0070658_10159279
1106 Ga0070670_100001488
1107 Ga0070670_100473814
1108 Ga0070680_100003990
1109 Ga0070680_100034826
1110 Ga0070680_100036495
1111 Ga0070680_100238402
1112 Ga0070682_100006699
1113 Ga0070660_100045033
1114 Ga0070660_100054719
1115 Ga0070660_100126984
1116 Ga0070689_100004588
1117 Ga0070691_10001408
1118 Ga0070691_10077243
1119 Ga0070661_100006000
1120 Ga0070661_100014638
1121 Ga0070661_100056019
1122 Ga0070692_10000349
1123 Ga0070692_10018555
1124 Ga0070692_10111518
1125 Ga0070669_100026647
1126 Ga0070688_100036531
1127 Ga0070659_100123250
1128 Ga0070709_10307087
1129 Ga0070714_100000030
1130 Ga0070714_100002591
1131 Ga0070710_10117064
1132 Ga0070694_100131979
1133 Ga0070663_100077028
1134 Ga0070663_100081562
1135 Ga0070663_100129959
1136 Ga0070663_100217352
1137 Ga0070662_100008587
1138 Ga0070662_100036431
1139 Ga0070681_10009936
1140 Ga0070681_10011748
1141 Ga0070681_10027064
1142 Ga0070681_10146729
1143 Ga0070681_10319129
1144 Ga0068867_100528768
1145 Ga0070685_10003463
1146 Ga0070679_100001900
1147 Ga0070679_100021990
1148 Ga0070679_100043309
1149 Ga0070679_100131137
1150 Ga0070679_100471970
1151 Ga0068853_100073218
1152 Ga0068853_100116259
1153 Ga0068853_100142626
1154 Ga0070672_100201098
1155 Ga0070696_100007797
1156 Ga0070696_100007838
1157 Ga0070696_100008642
1158 Ga0070696_100096135
1159 Ga0070693_100004730
1160 Ga0070693_100005999
1161 Ga0070693_100044740
1162 Ga0068855_100016916
1163 Ga0068855_100097413
1164 Ga0068855_101240988
1165 Ga0070664_100014210
1166 Ga0070664_100191075
1167 Ga0068857_100046722
1168 Ga0068857_100064588
1169 Ga0068854_100025222
1170 Ga0068854_100763037
1171 Ga0068856_100000053
1172 Ga0068856_100050838
1173 Ga0068856_100071133
1174 Ga0068852_100045182
1175 Ga0068852_100107620
1176 Ga0068852_100840129
1177 Ga0068859_100041924
1178 Ga0068859_100501873
1179 Ga0068851_10003312
1180 Ga0068862_100907268
1181 Ga0070712_100345729
1182 Ga0075369_10045509
1183 Ga0097620_100041924
1184 Ga0097620_100501895
1185 Ga0105251_10000013
1186 Ga0105244_10002473
1187 Ga0105244_10082412
1188 Ga0105240_10007774
1189 Ga0105240_10017836
1190 Ga0105240_10024742
1191 Ga0105240_10096229
1192 Ga0105240_10100033
1193 Ga0105240_10344537
1194 Ga0105240_10519882
1195 Ga0105245_10488298
1196 Ga0105247_10011155
1197 Ga0105243_10009491
1198 Ga0105241_10009314
1199 Ga0105241_10470796
1200 Ga0105242_10353856
1201 Ga0105237_10000007
1202 Ga0105237_10073062
1203 Ga0105237_10120806
1204 Ga0105237_10809179
1205 Ga0105238_10004682
1206 Ga0105238_10054795
1207 Ga0105238_10067581
1208 Ga0105238_10330227
1209 Ga0105239_10004761
1210 Ga0105239_10019886
1211 Ga0105239_10330042
1212 Ga0105239_10344816
1213 Ga0105246_10233260
1214 Ga0157373_10043986
1215 Ga0157373_10099260
1216 Ga0157373_10135022
1217 Ga0157373_10151501
1218 Ga0157373_10213663
1219 Ga0157373_10291550
1220 Ga0157371_10044029
1221 Ga0157371_10061591
1222 Ga0157371_10179179
1223 Ga0157371_10203396
1224 Ga0157370_10000422
1225 Ga0157370_10010336
1226 Ga0157370_10048875
1227 Ga0157370_10058111
1228 Ga0157370_10153146
1229 Ga0157370_10266057
1230 Ga0157370_10319479
1231 Ga0157369_10003686
1232 Ga0157369_10005288
1233 Ga0157369_10011524
1234 Ga0157369_10017788
1235 Ga0157369_10188358
1236 Ga0157369_10813084
1237 Ga0163162_10159801
1238 Ga0157372_10009194
1239 Ga0157372_10059965
1240 Ga0157372_10530410
1241 Ga0157372_10754388
1242 Ga0157375_10909234
1243 Ga0182008_10009937
1244 Ga0182008_10032454
1245 Ga0182008_10129187
1246 Ga0182006_1000062
1247 Ga0182006_1001193
1248 Ga0182006_1065974
1249 Ga0182007_10008394
1250 Ga0182007_10040340
1251 Ga0182007_10124603
1252 Ga0182005_1000295
1253 Ga0182005_1001282
1254 Ga0182005_1001525
1255 Ga0182005_1002071
1256 Ga0182005_1040483
1257 Ga0183368_1003
1258 Ga0163161_10002529
1259 Ga0163161_10026546
1260 Ga0197907_10768171
1261 Ga0197907_11021898
1262 Ga0206356_10621586
1263 Ga0206354_10516827
1264 Ga0206354_11143003
1265 Ga0206353_10082220
1266 Ga0206353_10329349
1267 Ga0206353_10411450
1268 Ga0206353_10904244
1269 Ga0154015_1059947
1270 Ga0154015_1348359
1271 Ga0213871_10006990
1272 Ga0209760_100464
1273 Ga0209784_100011
1274 Ga0209566_102770
1275 Ga0209674_100819
1276 Ga0209672_105941
1277 Ga0209563_100007
1278 Ga0207427_100019
1279 Ga0207427_100118
1280 Ga0207427_100120
1281 Ga0209437_100020
1282 Ga0209437_100054
1283 Ga0209437_100231
1284 Ga0209437_100362
1285 Ga0209437_100822
1286 Ga0209258_100216
1287 Ga0209258_100642
1288 Ga0209258_101611
1289 Ga0207425_1000111
1290 Ga0209646_1000661
1291 Ga0209026_1000146
1292 Ga0209026_1000205
1293 Ga0209026_1001897
1294 Ga0209677_103028
1295 Ga0209677_111709
1296 Ga0209148_1000001
1297 Ga0209148_1000005
1298 Ga0209148_1002293
1299 Ga0209759_1000418
1300 Ga0209759_1001506
1301 Ga0209759_1001727
1302 Ga0209759_1011457
1303 Ga0209129_1000087
1304 Ga0209129_1000445
1305 Ga0209233_1000002
1306 Ga0209233_1000020
1307 Ga0209233_1000147
1308 Ga0209233_1012091
1309 Ga0209565_1000006
1310 Ga0209455_1000019
1311 Ga0209455_1000474
1312 Ga0209455_1005243
1313 Ga0209673_1000004
1314 Ga0209130_1000223
1315 Ga0209675_1000224
1316 Ga0209025_1000013
1317 Ga0209564_1000102
1318 Ga0209564_1017016
1319 Ga0209758_1000014
1320 Ga0209758_1016601
1321 Ga0209256_1000495
1322 Ga0209256_1033312
1323 Ga0209257_1002929
1324 Ga0207656_10007565
1325 Ga0207655_1096355
1326 Ga0207713_1000658
1327 Ga0207647_10000386
1328 Ga0207647_10024168
1329 Ga0207647_10064426
1330 Ga0207647_10064854
1331 Ga0207705_10000438
1332 Ga0207705_10027147
1333 Ga0207705_10065415
1334 Ga0207705_10070534
1335 Ga0207705_10147122
1336 Ga0207654_10091054
1337 Ga0207707_10000379
1338 Ga0207707_10000422
1339 Ga0207707_10002334
1340 Ga0207707_10036091
1341 Ga0207707_10071702
1342 Ga0207707_10120994
1343 Ga0207695_10001343
1344 Ga0207695_10002840
1345 Ga0207695_10003487
1346 Ga0207695_10006343
1347 Ga0207695_10009743
1348 Ga0207695_10186221
1349 Ga0207695_10295616
1350 Ga0207671_10000763
1351 Ga0207671_10045028
1352 Ga0207693_10535794
1353 Ga0207660_10001603
1354 Ga0207660_10002593
1355 Ga0207660_10022615
1356 Ga0207660_10054227
1357 Ga0207660_10792289
1358 Ga0207657_10001729
1359 Ga0207657_10005904
1360 Ga0207657_10047235
1361 Ga0207649_10002297
1362 Ga0207649_10192533
1363 Ga0207649_10490945
1364 Ga0207652_10000022
1365 Ga0207652_10000368
1366 Ga0207652_10002541
1367 Ga0207652_10003502
1368 Ga0207652_10003947
1369 Ga0207652_10008434
1370 Ga0207652_10016897
1371 Ga0207652_10220127
1372 Ga0207681_10012606
1373 Ga0207694_10077421
1374 Ga0207650_10038304
1375 Ga0207650_10357966
1376 Ga0207687_10076002
1377 Ga0207664_10000026
1378 Ga0207664_10001262
1379 Ga0207690_10000976
1380 Ga0207690_10001043
1381 Ga0207690_10003295
1382 Ga0207690_10041774
1383 Ga0207690_10101287
1384 Ga0207706_10018132
1385 Ga0207706_10058916
1386 Ga0207686_10050122
1387 Ga0207709_10085455
1388 Ga0207709_10274525
1389 Ga0207670_10002684
1390 Ga0207661_10043391
1391 Ga0207679_10009166
1392 Ga0207679_10176683
1393 Ga0207679_10728137
1394 Ga0207667_10000436
1395 Ga0207667_10005577
1396 Ga0207667_10009175
1397 Ga0207667_10015489
1398 Ga0207667_10132576
1399 Ga0207667_10577978
1400 Ga0207640_10000564
1401 Ga0207640_10001437
1402 Ga0207640_10003230
1403 Ga0207640_10005203
1404 Ga0207640_10005896
1405 Ga0207639_10000637
1406 Ga0207639_10013073
1407 Ga0207639_10401258
1408 Ga0207639_10487174
1409 Ga0207678_10001228
1410 Ga0207678_10032261
1411 Ga0207678_10127499
1412 Ga0207678_10173277
1413 Ga0207702_10000032
1414 Ga0207702_10008105
1415 Ga0207702_10049210
1416 Ga0207702_10266030
1417 Ga0207702_10554683
1418 Ga0207648_11145270
1419 Ga0207674_10011246
1420 Ga0207674_10223023
1421 Ga0207698_10000430
1422 Ga0207698_10000630
1423 Ga0207698_10617094
1424 Ga0207698_10806906
1425 Ga0209371_1000011
1426 Ga0268264_11041746
1427 Ga0268256_1000011
1428 Ga0307413_10013859
1429 Ga0307413_10123130
1430 Ga0307413_10241196
1431 Ga0307412_10034790
1432 Ga0307414_10026242
1433 Ga0395899_0045676
1434 Ga0395899_0048045
1435 Ga0395899_0057680
1436 Ga0395899_0096358
1437 Ga0395899_0118389
1438 Ga0395899_0186063
1439 Ga0395899_0441281
1440 Ga0395900_0000377
1441 Ga0395900_0000867
1442 Ga0395900_0017946
1443 Ga0395900_0034909
1444 Ga0395900_0043403
1445 Ga0395900_0061686
1446 Ga0395900_0061865
1447 Ga0395900_0089923
1448 Ga0395900_0123413
1449 Ga0395900_0165920
1450 Ga0395900_0413632
1451 Ga0395900_0476813
1452 Ga0395900_0717288
1453 Ga0395900_1158105
1454 Ga0395898_0001606
1455 Ga0395898_0013117
1456 Ga0395898_0021850
1457 Ga0395898_0048682
1458 Ga0395898_0079894
1459 Ga0395898_0445540
1460 Ga0395898_0633793
1461 Ga0395898_0751229
1462 Ga0395905_0000156
1463 Ga0395905_0044730
1464 Ga0395905_0119276
1465 Ga0395905_0166051
1466 Ga0395905_0260686
1467 Ga0395905_0293076
1468 Ga0395905_0379941
1469 Ga0395905_0393880
1470 Ga0395905_0423131
1471 Ga0395905_0469159
1472 Ga0395901_0003133
1473 Ga0395901_0007470
1474 Ga0395901_0008127
1475 Ga0395901_0010829
1476 Ga0395901_0018442
1477 Ga0395901_0034380
1478 Ga0395901_0177526
1479 Ga0395901_0195064
1480 Ga0395901_0248958
1481 Ga0395901_0379631
1482 Ga0395901_0828035
1483 Ga0395901_1278162
1484 Ga0237819_00040
1485 Ga0237816_00041
1486 Ga0439436_0000438
1487 Ga0439465_0011177
1488 Ga0451800_0849097
1489 Ga0451806_132004
1490 Ga0439445_0039505
1491 Ga0439448_0000125
1492 Ga0439449_0013214
1493 Ga0439450_025449
1494 Ga0439455_0001931
1495 Ga0439446_0000539
1496 Ga0439458_0007133
1497 Ga0439458_0020270
1498 Ga0450908_000085
1499 Ga0466972_0000981
1500 Ga0466972_0019906
1501 Ga0466972_0051805
1502 Ga0466982_0000003
1503 Ga0466982_0003001
1504 Ga0466965_0019561
1505 Ga0466966_0011779
1506 Ga0466966_0108720
1507 Ga0466966_0116376
1508 Ga0466966_0237856
1509 Ga0466961_0232598
1510 Ga0466963_0122689
1511 Ga0466964_0000822
1512 Ga0466964_0031549
1513 Ga0466971_0073629
1514 Ga0466968_0000628
1515 Ga0466968_0004407
1516 Ga0466968_0306209
1517 Ga0466970_0003031
1518 Ga0466970_0033522
1519 Ga0466957_0013276
1520 Ga0466957_0118728
1521 Ga0466957_0152069
1522 Ga0466960_0007328
1523 Ga0466959_0037153
1524 Ga0466958_0037874
1525 Ga0466958_0057538
1526 Ga0466958_0287947
1527 Ga0466967_0082383
1528 Ga0466967_0398030
1529 Ga0466967_1042135
1530 Ga0466967_1214723
1531 Ga0495617_000020
1532 Ga0495617_000035
1533 Ga0495617_063588
1534 Ga0495617_109690
1535 Ga0495627_000243
1536 Ga0495627_008267
1537 Ga0495627_033200
1538 Ga0495627_075752
1539 Ga0495603_0058305
1540 Ga0495591_025976
1541 Ga0495638_0000107
1542 Ga0495638_0000471
1543 Ga0495638_0001226
1544 Ga0495638_0079804
1545 Ga0495638_0162189
1546 Ga0495638_0324574
1547 Ga0495653_0000082
1548 Ga0495653_0192882
1549 Ga0495650_0000011
1550 Ga0495650_0000462
1551 Ga0495650_0000607
1552 Ga0495650_0001057
1553 Ga0495650_0001457
1554 Ga0495650_0002636
1555 Ga0495650_0014912
1556 Ga0495650_0106164
1557 Ga0495582_0024280
1558 Ga0495605_0000234
1559 Ga0495605_0000249
1560 Ga0495605_0045715
1561 Ga0495605_0071561
1562 Ga0495605_0076838
1563 Ga0495584_0001550
1564 Ga0495584_0003045
1565 Ga0495584_0003415
1566 Ga0495584_0314309
1567 Ga0495585_0000243
1568 Ga0495585_0000424
1569 Ga0495585_0029178
1570 Ga0495585_0085586
1571 Ga0495596_0003347
1572 Ga0495596_0007214
1573 Ga0495596_0009273
1574 Ga0495596_0010010
1575 Ga0495596_0011456
1576 Ga0495596_0038449
1577 Ga0495596_0039743
1578 Ga0495596_0092419
1579 Ga0495596_0118252
1580 Ga0495607_0000012
1581 Ga0495607_0000158
1582 Ga0495607_0000672
1583 Ga0495607_0006215
1584 Ga0495607_0007208
1585 Ga0495607_0031115
1586 Ga0495607_0057699
1587 Ga0495607_0062153
1588 Ga0495607_0076733
1589 Ga0495607_0081553
1590 Ga0495583_0000005
1591 Ga0495583_0004110
1592 Ga0495583_0005624
1593 Ga0495583_0007361
1594 Ga0495583_0008996
1595 Ga0495583_0021164
1596 Ga0495583_0045836
1597 Ga0495583_0084458
1598 Ga0495606_0000161
1599 Ga0495606_0000559
1600 Ga0495606_0000648
1601 Ga0495606_0005134
1602 Ga0495606_0007954
1603 Ga0495606_0021559
1604 Ga0495606_0080196
1605 Ga0495606_0101883
1606 Ga0495606_0145008
1607 Ga0495610_0000014
1608 Ga0495610_0003722
1609 Ga0495610_0034735
1610 Ga0495610_0113962
1611 Ga0495616_0000060
1612 Ga0495616_0000173
1613 Ga0495616_0001412
1614 Ga0495616_0005006
1615 Ga0495616_0012387
1616 Ga0495616_0013723
1617 Ga0495616_0018890
1618 Ga0495616_0020423
1619 Ga0495616_0078505
1620 Ga0495616_0130363
1621 Ga0495620_0000101
1622 Ga0495620_0011482
1623 Ga0495631_0000103
1624 Ga0495631_0000525
1625 Ga0495631_0000529
1626 Ga0495631_0001387
1627 Ga0495631_0004486
1628 Ga0495631_0008657
1629 Ga0495631_0015898
1630 Ga0495631_0023570
1631 Ga0495631_0050725
1632 Ga0495632_0000019
1633 Ga0495632_0000406
1634 Ga0495632_0000653
1635 Ga0495632_0001400
1636 Ga0495632_0002098
1637 Ga0495632_0027721
1638 Ga0495632_0105988
1639 Ga0495632_0155286
1640 Ga0495632_0218445
1641 Ga0495637_0011180
1642 Ga0495637_0041836
1643 Ga0495643_0005663
1644 Ga0495643_0028817
1645 Ga0495643_0031463
1646 Ga0495643_0034002
1647 Ga0495643_0047893
1648 Ga0495643_0118349
1649 Ga0495644_0019082
1650 Ga0495648_0000288
1651 Ga0495648_0000551
1652 Ga0495648_0003735
1653 Ga0495648_0013564
1654 Ga0495648_0013849
1655 Ga0495648_0015016
1656 Ga0495648_0017797
1657 Ga0495648_0027107
1658 Ga0495648_0032089
1659 Ga0495648_0088595
1660 Ga0495642_0000038
1661 Ga0495642_0000214
1662 Ga0495642_0002954
1663 Ga0495642_0013328
1664 Ga0495642_0022625
1665 Ga0495642_0032573
1666 Ga0495642_0076928
1667 Ga0495642_0077920
1668 Ga0495642_0180183
1669 Ga0495654_0004328
1670 Ga0495654_0011622
1671 Ga0495654_0015883
1672 Ga0495654_0030279
1673 Ga0495654_0053327
1674 Ga0495586_0118195
1675 Ga0495609_0000021
1676 Ga0495609_0001140
1677 Ga0495609_0002120
1678 Ga0495609_0008668
1679 Ga0495609_0012401
1680 Ga0495609_0018696
1681 Ga0495609_0022596
1682 Ga0495609_0030593
1683 Ga0495609_0099269
1684 Ga0495597_0000515
1685 Ga0495597_0001373
1686 Ga0495597_0007248
1687 Ga0495597_0118743
1688 Ga0495645_0067913
1689 Ga0495622_0018204
1690 Ga0495622_0028393
1691 Ga0495633_0021925
1692 Ga0495633_0039324
1693 Ga0495633_0045599
1694 Ga0495633_0078396
1695 Ga0495633_0212925
1696 Ga0495656_0017663
1697 Ga0495656_0156926
1698 Ga0495668_0000008
1699 Ga0495668_0000164
1700 Ga0495668_0000457
1701 Ga0495668_0000579
1702 Ga0495668_0002674
1703 Ga0495668_0015801
1704 Ga0495668_0022095
1705 Ga0495668_0068250
1706 Ga0495668_0074025
1707 Ga0495668_0094439
1708 Ga0495668_0174543
1709 Ga0495668_0179599
1710 Ga0495611_0000001
1711 Ga0495611_0000397
1712 Ga0495611_0000957
1713 Ga0495611_0002336
1714 Ga0495611_0043514
1715 Ga0495611_0133572
1716 Ga0495625_0000325
1717 Ga0495625_0001449
1718 Ga0495625_0028480
1719 Ga0495625_0098430
1720 Ga0495625_0101869
1721 Ga0495625_0122610
1722 Ga0495625_0164742
1723 Ga0495635_0151952
1724 Ga0495659_0004044
1725 Ga0495661_0000052
1726 Ga0495661_0000403
1727 Ga0495661_0000731
1728 Ga0495661_0025016
1729 Ga0495661_0044535
1730 Ga0495661_0065974
1731 Ga0495661_0110041
1732 Ga0495588_0000184
1733 Ga0495588_0011307
1734 Ga0495588_0015485
1735 Ga0495588_0136486
1736 Ga0495669_0000807
1737 Ga0495669_0001911
1738 Ga0495669_0007554
1739 Ga0495669_0007628
1740 Ga0495669_0093117
1741 Ga0495613_0039901
1742 Ga0495613_0342114
1743 Ga0495670_0001047
1744 Ga0495670_0002879
1745 Ga0495670_0003247
1746 Ga0495670_0017824
1747 Ga0495670_0024119
1748 Ga0495670_0037578
1749 Ga0495670_0044174
1750 Ga0495670_0079655
1751 Ga0495670_0196149
1752 Ga0495670_0324776
1753 Ga0495671_0000005
1754 Ga0495671_0000909
1755 Ga0495671_0002073
1756 Ga0495671_0007302
1757 Ga0495671_0007856
1758 Ga0495671_0077582
1759 Ga0495671_0085791
1760 Ga0495671_0086562
1761 Ga0495649_0000714
1762 Ga0495649_0013674
1763 Ga0495649_0014729
1764 Ga0495649_0050596
1765 Ga0495649_0067730
1766 Ga0495649_0122411
1767 Ga0495589_0000012
1768 Ga0495589_0000139
1769 Ga0495589_0000307
1770 Ga0495589_0001673
1771 Ga0495589_0002326
1772 Ga0495589_0010378
1773 Ga0495589_0036373
1774 Ga0495589_0107944
1775 Ga0495589_0152738
1776 Ga0495589_0171098
1777 Ga0495660_0000176
1778 Ga0495660_0000186
1779 Ga0495660_0011786
1780 Ga0495660_0014484
1781 Ga0495660_0045152
1782 Ga0495660_0117261
1783 Ga0495660_0295758
1784 Ga0495581_0036002
1785 Ga0495604_0023297
1786 Ga0495636_0049065
1787 Ga0495672_0000801
1788 Ga0495672_0002979
1789 Ga0495672_0003143
1790 Ga0495676_0000618
1791 Ga0495680_0215811
1792 Ga0495683_0001130
1793 Ga0495683_0064643
1794 Ga0495683_0124421
1795 Ga0495683_0182440
1796 Ga0495687_000130
1797 Ga0495687_000149
1798 Ga0495687_000193
1799 Ga0495687_000326
1800 Ga0495687_002935
1801 Ga0495687_015774
1802 Ga0495677_0000019
1803 Ga0495677_0003492
1804 Ga0495677_0003797
1805 Ga0495677_0006852
1806 Ga0495677_0008147
1807 Ga0495677_0035489
1808 Ga0495679_000001
1809 Ga0495679_005389
1810 Ga0495679_018740
1811 Ga0495679_028314
1812 Ga0495685_004657
1813 Ga0495685_007094
1814 Ga0495685_009073
1815 Ga0495673_0000009
1816 Ga0495673_0000012
1817 Ga0495673_0000072
1818 Ga0495673_0000798
1819 Ga0495681_0000403
1820 Ga0495681_0003907
1821 Ga0495681_0005230
1822 Ga0495681_0008236
1823 Ga0495681_0013771
1824 Ga0495681_0076585
1825 Ga0495686_0000263
1826 Ga0495686_0001334
1827 Ga0495686_0002561
1828 Ga0495686_0003427
1829 Ga0495686_0021564
1830 Ga0495686_0027591
1831 Ga0495686_0034555
1832 Ga0495686_0061419
1833 Ga0495686_0062769
1834 Ga0495686_0135386
1835 Ga0495593_0118586
1836 Ga0495614_0005923
1837 Ga0495614_0055808
1838 Ga0495615_0042158
1839 Ga0495626_0000082
1840 Ga0495626_0004262
1841 Ga0495626_0020593
1842 Ga0495626_0035231
1843 Ga0495626_0053994
1844 Ga0495626_0067093
1845 Ga0495626_0123139
1846 Ga0495626_0152188
1847 Ga0496100_0038258
1848 Ga0496100_0038327
1849 Ga0496100_0511974
1850 Ga0496101_0001273
1851 Ga0496101_0407138
1852 Ga0496102_0172792
1853 Ga0496102_0380999
1854 Ga0496102_0835734
1855 Ga0496103_0041532
1856 Ga0496104_0132231
1857 Ga0496106_0022509
1858 Ga0496106_0029220
1859 Ga0496106_0030235
1860 Ga0496107_0430914
1861 Ga0496107_0583873
1862 Ga0496109_0019971
1863 Ga0496110_0000365
1864 Ga0496110_0413874
1865 Ga0496111_0228244
1866 Ga0496112_0147805
1867 Ga0496113_0001645
1868 Ga0496113_0018536
1869 Ga0496115_0000110
1870 Ga0496115_0001042
1871 Ga0496115_0049161
1872 Ga0496115_0415173
1873 Ga0496117_0000730
1874 Ga0496117_0042972
1875 Ga0496118_0002084
1876 Ga0496118_0002163
1877 Ga0496118_0002572
1878 Ga0496118_0014611
1879 Ga0496118_0048817
1880 Ga0496119_0000070
1881 Ga0496119_0001714
1882 Ga0496119_0096818
1883 Ga0496119_0161033
1884 Ga0496120_0000541
1885 Ga0496120_0000637
1886 Ga0496120_0002482
1887 Ga0496120_0029637
1888 Ga0496120_0119582
1889 Ga0496121_0000355
1890 Ga0496121_0000564
1891 Ga0496121_0001271
1892 Ga0496121_0010533
1893 Ga0496121_0033678
1894 Ga0496121_0035380
1895 Ga0496121_0052766
1896 Ga0496122_0001026
1897 Ga0496122_0002103
1898 Ga0496122_0022702
1899 Ga0496122_0027010
1900 Ga0496122_0041497
1901 Ga0496122_0053908
1902 Ga0496122_0057117
1903 Ga0496122_0079607
1904 Ga0496122_0084708
1905 Ga0496122_0107031
1906 Ga0496122_0123301
1907 Ga0496123_0000324
1908 Ga0496123_0001026
1909 Ga0496123_0003625
1910 Ga0496123_0007822
1911 Ga0496123_0013403
1912 Ga0496123_0029262
1913 Ga0496123_0050963
1914 Ga0496124_0000472
1915 Ga0496124_0003618
1916 Ga0496124_0004318
1917 Ga0496124_0021238
1918 Ga0496124_0081867
1919 Ga0496124_0149351
1920 Ga0496124_0309404
1921 Ga0496124_0382706
1922 Ga0496124_0433169
1923 Ga0496125_0002514
1924 Ga0496125_0007422
1925 Ga0496125_0073723
1926 Ga0496125_0374934
1927 Ga0496126_0000718
1928 Ga0496126_0005219
1929 Ga0496126_0006238
1930 Ga0496126_0021896
1931 Ga0496126_0030880
1932 Ga0496126_0337882
1933 Ga0496126_0520694
1934 Ga0495678_000185
1935 Ga0495678_000374
1936 Ga0495678_000506
1937 Ga0495678_004668
1938 Ga0495678_065921
1939 Ga0495682_0000275
1940 Ga0495682_0003201
1941 Ga0495682_0008519
1942 Ga0495682_0064945
1943 Ga0501031_0005457
1944 Ga0501031_0032257
1945 Ga0501031_0060071
1946 Ga0501031_0128666
1947 Ga0501032_0016204
1948 Ga0501033_0006447
1949 Ga0501033_0006688
1950 Ga0501033_0087611
1951 Ga0501033_0111214
1952 Ga0501033_0182636
1953 Ga0501034_0001651
1954 Ga0501034_0027542
1955 Ga0501034_0253424
1956 Ga0501034_0315302
1957 Ga0501034_0657419
1958 Ga0501036_0064375
1959 Ga0501036_0104709
1960 Ga0501037_0004887
1961 Ga0501037_0105163
1962 Ga0501037_0166522
1963 Ga0501037_0208218
1964 Ga0501037_0382711
1965 Ga0501038_0010073
1966 Ga0501038_0050580
1967 Ga0501039_0020921
1968 Ga0501043_0031587
1969 Ga0501043_0038794
1970 Ga0501043_0075397
1971 Ga0501043_0095809
1972 Ga0501046_0018812
1973 Ga0501046_0290630
1974 Ga0501046_0437527
1975 Ga0501047_0020784
1976 Ga0501047_0025245
1977 Ga0501047_0029713
1978 Ga0501047_0036938
1979 Ga0501047_0258760
1980 Ga0501048_0031296
1981 Ga0501069_0016628
1982 Ga0501069_0017546
1983 Ga0501069_0105632
1984 Ga0501070_0003249
1985 Ga0501070_0007449
1986 Ga0501070_0025016
1987 Ga0501070_0032960
1988 Ga0501070_0045370
1989 Ga0501070_0066396
1990 Ga0501070_0275748
1991 Ga0501070_0695059
1992 Ga0501071_0008172
1993 Ga0501071_0272646
1994 Ga0501073_0008332
1995 Ga0501073_0092458
1996 Ga0501073_0280705
1997 Ga0501073_0416012
1998 Ga0501074_0017458
1999 Ga0501074_0025204
2000 Ga0501074_0084696
2001 Ga0501077_0004202
2002 Ga0501079_0175308
2003 Ga0501080_0002764
2004 Ga0501080_0029330
2005 Ga0501080_0116782
2006 Ga0501080_0166579
2007 Ga0501269_001126
2008 Ga0501035_0005183
2009 Ga0501035_0013275
2010 Ga0501035_0015679
2011 Ga0501035_0049135
2012 Ga0501035_0071046
2013 Ga0501035_0090828
2014 Ga0501044_0012051
2015 Ga0501044_0012481
2016 Ga0501044_0014634
2017 Ga0501044_0048742
2018 Ga0501044_0065375
2019 Ga0501044_0079102
2020 Ga0501044_0084910
2021 Ga0501044_0203486
2022 Ga0501044_0557136
2023 Ga0500643_000158
2024 Ga0500643_018770
2025 Ga0500555_001159
2026 Ga0500586_000882
2027 Ga0500616_0017213
2028 Ga0500634_0039971
2029 Ga0587068_001536
2030 Ga0466962_0008272
2031 Ga0466962_0094624
2032 Ga0466962_0170747
2033 2538832195
2034 2595448109
2035 2595451404
2036 2643798610
2037 2643829661
2038 2644475616
2039 2721028560
2040 2735835848
2041 2738826333
2042 2739150130
2043 2739192049
2044 2739226949
2045 2739318526
2046 2739336767
2047 2739730178
2048 2819566591
2049 2819660656
2050 2821134859
2051 2842915062
2052 2842921423
2053 2852686522
2054 2857569754
2055 2884339628
2056 2884412232
2057 2895397603
2058 2895499060
2059 2895528025
2060 2904467247
2061 2919086737
2062 2919132730
2063 2919404484
2064 2928965579
2065 2929196899
2066 2939612593
2067 2941474405
2068 2953997418
2069 2990198563
2070 8002869671
2071 8021625942
2072 8021629866
2073 8021652157
2074 8047675632

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18331

PKHD_C

PKHD-type hydroxylase C-terminal domain

193

235

0.99

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

93

187

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ahx-assembly1.cif.gz_A-2 copper-sensing operon regulator protein (csorgz) 0.991 183 221
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9825 2 225
5lcy-assembly1.cif.gz_C formaldehyde-responsive regulator frmr e64h variant from salmonella enterica serovar typhimurium 0.9735 183 218
3dkq-assembly1.cif.gz_C-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.971 1 225
3dkq-assembly1.cif.gz_A-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9507 1 225
ID Description Score Start End Superfamily
3dkqA02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 1.002 179 225 4.10.860.20
3dkqC02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9962 179 225 4.10.860.20
3dkqA02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9807 179 225 4.10.860.20
3dkqC02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9756 179 225 4.10.860.20
5lcyC00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.9735 183 218 1.20.58.1000
ID Description Score Start End GO Terms
AF-A0A259S409-F1-model_v4 Fe2+-dependent dioxygenase 0.9887 22 225 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A840FY28-F1-model_v4 PKHD-type hydroxylase (EC 1.14.11.-) 0.9864 2 225 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-G0AXX8-F1-model_v4 deleted 0.985 1 225
AF-B9MCK8-F1-model_v4 PKHD-type hydroxylase Dtpsy_0528 (EC 1.14.11.-) 0.9843 1 225 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A2X3F8N6-F1-model_v4 Iron-uptake factor PiuC (EC 1.14.11.-) 0.9843 110 174 GO:0006879
GO:0006974
GO:0016706

Map