F488735
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1037 | 366 | 2074 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300002737|JGI25162J39368_1000312|JGI25162J39368_100031232 |
| Length | 236 |
| Sequence | MALTHPAPEPIMLLHIPNILDQAQVRAIRASLDEATWTDGRETVGHQGAKVKRNLQLPDASPLRGELGRVVLDALARNPLYHAATLPLRTLTPRFNRYEGGGQYGFHVDGAVMSLPDGSQLRSDISCTLFLAEPEEYDGGELIISDTYGEHEVKLPAGDAIIYPSSSLHRVAPVTRGARIAAFFWVQSLIRDDGKRRLLFELDASIQALTHTQADPQALLQLTGVYHNLLRQWSET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 13 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 14 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 15 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 19 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 20 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 21 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 22 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 23 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 104 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 177 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 178 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 179 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 180 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 182 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 183 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 184 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 185 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 186 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 187 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 188 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 189 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 190 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 191 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 192 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 197 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 198 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 199 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 200 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 201 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 204 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 205 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 284 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 285 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 286 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 287 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 288 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 289 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 290 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 291 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 319 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 320 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 323 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 325 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 326 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 327 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 328 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 329 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 330 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 331 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 332 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 333 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 334 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 335 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 336 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 337 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 338 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 339 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 340 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 341 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 342 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 343 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 344 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 345 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 346 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 347 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 348 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 349 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 350 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 351 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 352 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 353 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 354 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 355 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 356 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 357 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 358 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 359 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 360 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 361 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 362 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 363 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 364 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 365 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 366 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.6 |
| Metatranscriptomes | 1.35 |
| Isolates | 4.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.62 |
| Nodule | 0 |
| Rhizoplane | 2.7 |
| Rhizosphere | 77.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000312 | 3300002737 | Bacteria | 43079 |
| 2 | JGI24736J21556_1002906 | 3300001904 | Bacteria | 3005 |
| 3 | JGI24736J21556_1005738 | 3300001904 | Bacteria | 2098 |
| 4 | JGI24741J21665_1000666 | 3300001915 | Bacteria | 10367 |
| 5 | JGI24741J21665_1001511 | 3300001915 | Bacteria | 6614 |
| 6 | JGI24741J21665_1003717 | 3300001915 | Bacteria | 3557 |
| 7 | JGI24741J21665_1011843 | 3300001915 | Bacteria | 1514 |
| 8 | JGI24740J21852_10000037 | 3300001979 | Bacteria | 44368 |
| 9 | JGI24740J21852_10000584 | 3300001979 | Bacteria | 15700 |
| 10 | JGI24740J21852_10032002 | 3300001979 | Bacteria | 1688 |
| 11 | JGI24737J22298_10018852 | 3300001990 | Bacteria | 2210 |
| 12 | JGI24735J21928_10001404 | 3300002067 | Bacteria | 8506 |
| 13 | JGI24738J21930_10002823 | 3300002075 | Bacteria | 4452 |
| 14 | JGI25156J39149_1001792 | 3300002705 | Bacteria | 8444 |
| 15 | JGI25156J39149_1001934 | 3300002705 | Bacteria | 8014 |
| 16 | JGI25162J39368_1002139 | 3300002737 | Bacteria | 8295 |
| 17 | JGI25162J39368_1002144 | 3300002737 | Bacteria | 8275 |
| 18 | JGI25157J39369_1000191 | 3300002741 | Bacteria | 51859 |
| 19 | JGI25157J39369_1001516 | 3300002741 | Bacteria | 8444 |
| 20 | JGI25157J39369_1001585 | 3300002741 | Bacteria | 8014 |
| 21 | JGI25163J39215_1000093 | 3300002771 | Bacteria | 37259 |
| 22 | JGI25164J39214_1000140 | 3300002772 | Bacteria | 70123 |
| 23 | JGI25164J39214_1000782 | 3300002772 | Bacteria | 11508 |
| 24 | JGI25164J39214_1001047 | 3300002772 | Bacteria | 8295 |
| 25 | JGI25152J39213_1000164 | 3300002773 | Bacteria | 45374 |
| 26 | JGI25150J39212_1000286 | 3300002774 | Bacteria | 26314 |
| 27 | JGI25150J39212_1012052 | 3300002774 | Bacteria | 1544 |
| 28 | JGI25159J45721_1001532 | 3300002987 | Bacteria | 9476 |
| 29 | JGI25151J46595_10000351 | 3300003187 | Bacteria | 49103 |
| 30 | JGI25165J46597_1000261 | 3300003214 | Bacteria | 70135 |
| 31 | JGI25165J46597_1001921 | 3300003214 | Bacteria | 8295 |
| 32 | JGI25165J46597_1014299 | 3300003214 | Bacteria | 1081 |
| 33 | JGI25153J46596_10000219 | 3300003215 | Bacteria | 49103 |
| 34 | rootH1_10033081 | 3300003316 | Bacteria | 8009 |
| 35 | rootH1_10113747 | 3300003316 | Bacteria | 2658 |
| 36 | rootH2_10010359 | 3300003320 | Bacteria | 12893 |
| 37 | rootH2_10039202 | 3300003320 | Bacteria | 37554 |
| 38 | rootH2_10066632 | 3300003320 | Bacteria | 2499 |
| 39 | rootH2_10124204 | 3300003320 | Bacteria | 1882 |
| 40 | rootH2_10137845 | 3300003320 | Bacteria | 5918 |
| 41 | rootL2_10001944 | 3300003322 | Bacteria | 3441 |
| 42 | rootL2_10041905 | 3300003322 | Bacteria | 4463 |
| 43 | rootL2_10148929 | 3300003322 | Unclassified | 1681 |
| 44 | rootL2_10157852 | 3300003322 | Bacteria | 3803 |
| 45 | rootL2_10207723 | 3300003322 | Bacteria | 1381 |
| 46 | rootH1_10005577 | 3300003323 | Bacteria | 6507 |
| 47 | rootH1_10019292 | 3300003323 | Bacteria | 5407 |
| 48 | rootH1_10071486 | 3300003323 | Bacteria | 4059 |
| 49 | rootH1_10274537 | 3300003323 | Bacteria | 2499 |
| 50 | Ga0006562J51391_1054910 | 3300003578 | Bacteria | 2260 |
| 51 | Ga0006562J51391_1054911 | 3300003578 | Bacteria | 1300 |
| 52 | Ga0055538_1000476 | 3300003751 | Bacteria | 14728 |
| 53 | Ga0055535_1000171 | 3300003761 | Bacteria | 70123 |
| 54 | Ga0055542_1000400 | 3300003762 | Bacteria | 43079 |
| 55 | Ga0055542_1000461 | 3300003762 | Bacteria | 38427 |
| 56 | Ga0055529_1000260 | 3300003763 | Bacteria | 62931 |
| 57 | Ga0055526_1000442 | 3300003771 | Bacteria | 32968 |
| 58 | Ga0055537_1000128 | 3300003773 | Bacteria | 58218 |
| 59 | Ga0055534_1000120 | 3300003784 | Bacteria | 57897 |
| 60 | Ga0055528_1000550 | 3300003790 | Bacteria | 28631 |
| 61 | Ga0058692_1000015 | 3300003856 | Bacteria | 295729 |
| 62 | Ga0055543_1002426 | 3300004625 | Bacteria | 6180 |
| 63 | Ga0065165_1000067 | 3300005262 | Bacteria | 170811 |
| 64 | Ga0065165_1000818 | 3300005262 | Bacteria | 41213 |
| 65 | Ga0065704_10070933 | 3300005289 | Bacteria | 14461 |
| 66 | Ga0065704_10123342 | 3300005289 | Bacteria | 1735 |
| 67 | Ga0070658_10106813 | 3300005327 | Bacteria | 2316 |
| 68 | Ga0070658_10159279 | 3300005327 | Bacteria | 1893 |
| 69 | Ga0070670_100001488 | 3300005331 | Bacteria | 18875 |
| 70 | Ga0070670_100473814 | 3300005331 | Bacteria | 1111 |
| 71 | Ga0070680_100003990 | 3300005336 | Bacteria | 11044 |
| 72 | Ga0070680_100034826 | 3300005336 | Bacteria | 4062 |
| 73 | Ga0070680_100036495 | 3300005336 | Bacteria | 3971 |
| 74 | Ga0070680_100238402 | 3300005336 | Bacteria | 1537 |
| 75 | Ga0070682_100006699 | 3300005337 | Bacteria | 6459 |
| 76 | Ga0070660_100045033 | 3300005339 | Bacteria | 3376 |
| 77 | Ga0070660_100054719 | 3300005339 | Bacteria | 3082 |
| 78 | Ga0070660_100126984 | 3300005339 | Bacteria | 2038 |
| 79 | Ga0070689_100004588 | 3300005340 | Bacteria | 9352 |
| 80 | Ga0070691_10001408 | 3300005341 | Bacteria | 10265 |
| 81 | Ga0070691_10077243 | 3300005341 | Bacteria | 1625 |
| 82 | Ga0070661_100006000 | 3300005344 | Bacteria | 8363 |
| 83 | Ga0070661_100014638 | 3300005344 | Bacteria | 5530 |
| 84 | Ga0070661_100056019 | 3300005344 | Bacteria | 2887 |
| 85 | Ga0070692_10000349 | 3300005345 | Bacteria | 13461 |
| 86 | Ga0070692_10018555 | 3300005345 | Bacteria | 3348 |
| 87 | Ga0070692_10111518 | 3300005345 | Bacteria | 1513 |
| 88 | Ga0070669_100026647 | 3300005353 | Bacteria | 4160 |
| 89 | Ga0070688_100036531 | 3300005365 | Bacteria | 2989 |
| 90 | Ga0070659_100123250 | 3300005366 | Bacteria | 2101 |
| 91 | Ga0070709_10307087 | 3300005434 | Bacteria | 1160 |
| 92 | Ga0070714_100000030 | 3300005435 | Bacteria | 136610 |
| 93 | Ga0070714_100002591 | 3300005435 | Bacteria | 13323 |
| 94 | Ga0070710_10117064 | 3300005437 | Bacteria | 1608 |
| 95 | Ga0070694_100131979 | 3300005444 | Bacteria | 1805 |
| 96 | Ga0070663_100077028 | 3300005455 | Bacteria | 2440 |
| 97 | Ga0070663_100081562 | 3300005455 | Bacteria | 2378 |
| 98 | Ga0070663_100129959 | 3300005455 | Bacteria | 1912 |
| 99 | Ga0070663_100217352 | 3300005455 | Bacteria | 1499 |
| 100 | Ga0070662_100008587 | 3300005457 | Bacteria | 6662 |
| 101 | Ga0070662_100036431 | 3300005457 | Bacteria | 3480 |
| 102 | Ga0070681_10009936 | 3300005458 | Bacteria | 9377 |
| 103 | Ga0070681_10011748 | 3300005458 | Bacteria | 8678 |
| 104 | Ga0070681_10027064 | 3300005458 | Bacteria | 5766 |
| 105 | Ga0070681_10146729 | 3300005458 | Bacteria | 2288 |
| 106 | Ga0070681_10319129 | 3300005458 | Bacteria | 1463 |
| 107 | Ga0068867_100528768 | 3300005459 | Bacteria | 1018 |
| 108 | Ga0070685_10003463 | 3300005466 | Bacteria | 8025 |
| 109 | Ga0070679_100001900 | 3300005530 | Bacteria | 18753 |
| 110 | Ga0070679_100021990 | 3300005530 | Bacteria | 6230 |
| 111 | Ga0070679_100043309 | 3300005530 | Bacteria | 4483 |
| 112 | Ga0070679_100131137 | 3300005530 | Bacteria | 2488 |
| 113 | Ga0070679_100471970 | 3300005530 | Bacteria | 1199 |
| 114 | Ga0068853_100073218 | 3300005539 | Bacteria | 2986 |
| 115 | Ga0068853_100116259 | 3300005539 | Bacteria | 2381 |
| 116 | Ga0068853_100142626 | 3300005539 | Bacteria | 2151 |
| 117 | Ga0070672_100201098 | 3300005543 | Bacteria | 1666 |
| 118 | Ga0070696_100007797 | 3300005546 | Bacteria | 7145 |
| 119 | Ga0070696_100007838 | 3300005546 | Bacteria | 7129 |
| 120 | Ga0070696_100008642 | 3300005546 | Bacteria | 6812 |
| 121 | Ga0070696_100096135 | 3300005546 | Bacteria | 2116 |
| 122 | Ga0070693_100004730 | 3300005547 | Bacteria | 6474 |
| 123 | Ga0070693_100005999 | 3300005547 | Bacteria | 5875 |
| 124 | Ga0070693_100044740 | 3300005547 | Bacteria | 2505 |
| 125 | Ga0068855_100016916 | 3300005563 | Bacteria | 8769 |
| 126 | Ga0068855_100097413 | 3300005563 | Bacteria | 3388 |
| 127 | Ga0068855_101240988 | 3300005563 | Bacteria | 774 |
| 128 | Ga0070664_100014210 | 3300005564 | Bacteria | 6493 |
| 129 | Ga0070664_100191075 | 3300005564 | Bacteria | 1824 |
| 130 | Ga0068857_100046722 | 3300005577 | Bacteria | 3842 |
| 131 | Ga0068857_100064588 | 3300005577 | Bacteria | 3254 |
| 132 | Ga0068854_100025222 | 3300005578 | Bacteria | 4079 |
| 133 | Ga0068854_100763037 | 3300005578 | Bacteria | 840 |
| 134 | Ga0068856_100000053 | 3300005614 | Bacteria | 106241 |
| 135 | Ga0068856_100050838 | 3300005614 | Bacteria | 4087 |
| 136 | Ga0068856_100071133 | 3300005614 | Bacteria | 3443 |
| 137 | Ga0068852_100045182 | 3300005616 | Bacteria | 3745 |
| 138 | Ga0068852_100107620 | 3300005616 | Bacteria | 2529 |
| 139 | Ga0068852_100840129 | 3300005616 | Bacteria | 934 |
| 140 | Ga0068859_100041924 | 3300005617 | Bacteria | 4597 |
| 141 | Ga0068859_100501873 | 3300005617 | Bacteria | 1308 |
| 142 | Ga0068851_10003312 | 3300005834 | Bacteria | 7158 |
| 143 | Ga0068862_100907268 | 3300005844 | Bacteria | 866 |
| 144 | Ga0070712_100345729 | 3300006175 | Bacteria | 1216 |
| 145 | Ga0075369_10045509 | 3300006186 | Bacteria | 1887 |
| 146 | Ga0097620_100041924 | 3300006931 | Bacteria | 4597 |
| 147 | Ga0097620_100501895 | 3300006931 | Bacteria | 1308 |
| 148 | Ga0105251_10000013 | 3300009011 | Bacteria | 163226 |
| 149 | Ga0105244_10002473 | 3300009036 | Bacteria | 13910 |
| 150 | Ga0105244_10082412 | 3300009036 | Bacteria | 1591 |
| 151 | Ga0105240_10007774 | 3300009093 | Bacteria | 15497 |
| 152 | Ga0105240_10017836 | 3300009093 | Bacteria | 9551 |
| 153 | Ga0105240_10024742 | 3300009093 | Bacteria | 7908 |
| 154 | Ga0105240_10096229 | 3300009093 | Bacteria | 3609 |
| 155 | Ga0105240_10100033 | 3300009093 | Bacteria | 3528 |
| 156 | Ga0105240_10344537 | 3300009093 | Bacteria | 1692 |
| 157 | Ga0105240_10519882 | 3300009093 | Bacteria | 1321 |
| 158 | Ga0105245_10488298 | 3300009098 | Bacteria | 1246 |
| 159 | Ga0105247_10011155 | 3300009101 | Bacteria | 5418 |
| 160 | Ga0105243_10009491 | 3300009148 | Bacteria | 7407 |
| 161 | Ga0105241_10009314 | 3300009174 | Bacteria | 7219 |
| 162 | Ga0105241_10470796 | 3300009174 | Bacteria | 1115 |
| 163 | Ga0105242_10353856 | 3300009176 | Bacteria | 1357 |
| 164 | Ga0105237_10000007 | 3300009545 | Bacteria | 367690 |
| 165 | Ga0105237_10073062 | 3300009545 | Bacteria | 3422 |
| 166 | Ga0105237_10120806 | 3300009545 | Bacteria | 2614 |
| 167 | Ga0105237_10809179 | 3300009545 | Bacteria | 944 |
| 168 | Ga0105238_10004682 | 3300009551 | Bacteria | 13532 |
| 169 | Ga0105238_10054795 | 3300009551 | Bacteria | 4004 |
| 170 | Ga0105238_10067581 | 3300009551 | Bacteria | 3575 |
| 171 | Ga0105238_10330227 | 3300009551 | Bacteria | 1512 |
| 172 | Ga0105239_10004761 | 3300010375 | Bacteria | 16108 |
| 173 | Ga0105239_10019886 | 3300010375 | Bacteria | 7411 |
| 174 | Ga0105239_10330042 | 3300010375 | Bacteria | 1721 |
| 175 | Ga0105239_10344816 | 3300010375 | Bacteria | 1681 |
| 176 | Ga0105246_10233260 | 3300011119 | Bacteria | 1450 |
| 177 | Ga0157373_10043986 | 3300013100 | Bacteria | 3188 |
| 178 | Ga0157373_10099260 | 3300013100 | Bacteria | 2049 |
| 179 | Ga0157373_10135022 | 3300013100 | Bacteria | 1735 |
| 180 | Ga0157373_10151501 | 3300013100 | Bacteria | 1631 |
| 181 | Ga0157373_10213663 | 3300013100 | Bacteria | 1360 |
| 182 | Ga0157373_10291550 | 3300013100 | Bacteria | 1157 |
| 183 | Ga0157371_10044029 | 3300013102 | Bacteria | 3179 |
| 184 | Ga0157371_10061591 | 3300013102 | Bacteria | 2660 |
| 185 | Ga0157371_10179179 | 3300013102 | Bacteria | 1515 |
| 186 | Ga0157371_10203396 | 3300013102 | Bacteria | 1420 |
| 187 | Ga0157370_10000422 | 3300013104 | Bacteria | 53330 |
| 188 | Ga0157370_10010336 | 3300013104 | Bacteria | 9847 |
| 189 | Ga0157370_10048875 | 3300013104 | Bacteria | 4052 |
| 190 | Ga0157370_10058111 | 3300013104 | Bacteria | 3676 |
| 191 | Ga0157370_10153146 | 3300013104 | Bacteria | 2145 |
| 192 | Ga0157370_10266057 | 3300013104 | Bacteria | 1584 |
| 193 | Ga0157370_10319479 | 3300013104 | Bacteria | 1432 |
| 194 | Ga0157369_10003686 | 3300013105 | Bacteria | 18204 |
| 195 | Ga0157369_10005288 | 3300013105 | Bacteria | 15040 |
| 196 | Ga0157369_10011524 | 3300013105 | Bacteria | 10044 |
| 197 | Ga0157369_10017788 | 3300013105 | Bacteria | 7980 |
| 198 | Ga0157369_10188358 | 3300013105 | Bacteria | 2169 |
| 199 | Ga0157369_10813084 | 3300013105 | Bacteria | 960 |
| 200 | Ga0163162_10159801 | 3300013306 | Bacteria | 2375 |
| 201 | Ga0157372_10009194 | 3300013307 | Bacteria | 10506 |
| 202 | Ga0157372_10059965 | 3300013307 | Bacteria | 4257 |
| 203 | Ga0157372_10530410 | 3300013307 | Bacteria | 1372 |
| 204 | Ga0157372_10754388 | 3300013307 | Bacteria | 1131 |
| 205 | Ga0157375_10909234 | 3300013308 | Bacteria | 1024 |
| 206 | Ga0182008_10009937 | 3300014497 | Bacteria | 5115 |
| 207 | Ga0182008_10032454 | 3300014497 | Bacteria | 2624 |
| 208 | Ga0182008_10129187 | 3300014497 | Bacteria | 1259 |
| 209 | Ga0182006_1000062 | 3300015261 | Bacteria | 155622 |
| 210 | Ga0182006_1001193 | 3300015261 | Bacteria | 16261 |
| 211 | Ga0182006_1065974 | 3300015261 | Bacteria | 1354 |
| 212 | Ga0182007_10008394 | 3300015262 | Bacteria | 4246 |
| 213 | Ga0182007_10040340 | 3300015262 | Bacteria | 1559 |
| 214 | Ga0182007_10124603 | 3300015262 | Bacteria | 864 |
| 215 | Ga0182005_1000295 | 3300015265 | Bacteria | 30789 |
| 216 | Ga0182005_1001282 | 3300015265 | Bacteria | 10318 |
| 217 | Ga0182005_1001525 | 3300015265 | Bacteria | 9219 |
| 218 | Ga0182005_1002071 | 3300015265 | Bacteria | 7491 |
| 219 | Ga0182005_1040483 | 3300015265 | Bacteria | 1267 |
| 220 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 221 | Ga0163161_10002529 | 3300017792 | Bacteria | 13048 |
| 222 | Ga0163161_10026546 | 3300017792 | Bacteria | 4102 |
| 223 | Ga0197907_10768171 | 3300020069 | Bacteria | 1446 |
| 224 | Ga0197907_11021898 | 3300020069 | Bacteria | 1102 |
| 225 | Ga0206356_10621586 | 3300020070 | Bacteria | 3813 |
| 226 | Ga0206354_10516827 | 3300020081 | Bacteria | 7183 |
| 227 | Ga0206354_11143003 | 3300020081 | Bacteria | 1827 |
| 228 | Ga0206353_10082220 | 3300020082 | Bacteria | 3989 |
| 229 | Ga0206353_10329349 | 3300020082 | Bacteria | 4816 |
| 230 | Ga0206353_10411450 | 3300020082 | Bacteria | 1821 |
| 231 | Ga0206353_10904244 | 3300020082 | Bacteria | 3225 |
| 232 | Ga0154015_1059947 | 3300020610 | Bacteria | 1775 |
| 233 | Ga0154015_1348359 | 3300020610 | Bacteria | 18569 |
| 234 | Ga0213871_10006990 | 3300021441 | Bacteria | 2416 |
| 235 | Ga0209760_100464 | 3300025207 | Bacteria | 8944 |
| 236 | Ga0209784_100011 | 3300025224 | Bacteria | 546770 |
| 237 | Ga0209566_102770 | 3300025225 | Bacteria | 3022 |
| 238 | Ga0209674_100819 | 3300025226 | Bacteria | 10355 |
| 239 | Ga0209672_105941 | 3300025228 | Bacteria | 2040 |
| 240 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 241 | Ga0207427_100019 | 3300025231 | Bacteria | 513977 |
| 242 | Ga0207427_100118 | 3300025231 | Bacteria | 102109 |
| 243 | Ga0207427_100120 | 3300025231 | Bacteria | 101516 |
| 244 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 245 | Ga0209437_100054 | 3300025233 | Bacteria | 366715 |
| 246 | Ga0209437_100231 | 3300025233 | Bacteria | 94387 |
| 247 | Ga0209437_100362 | 3300025233 | Bacteria | 50377 |
| 248 | Ga0209437_100822 | 3300025233 | Bacteria | 13804 |
| 249 | Ga0209258_100216 | 3300025242 | Bacteria | 111904 |
| 250 | Ga0209258_100642 | 3300025242 | Bacteria | 26804 |
| 251 | Ga0209258_101611 | 3300025242 | Bacteria | 7363 |
| 252 | Ga0207425_1000111 | 3300025245 | Bacteria | 77375 |
| 253 | Ga0209646_1000661 | 3300025246 | Bacteria | 12795 |
| 254 | Ga0209026_1000146 | 3300025250 | Bacteria | 111481 |
| 255 | Ga0209026_1000205 | 3300025250 | Bacteria | 81843 |
| 256 | Ga0209026_1001897 | 3300025250 | Bacteria | 8496 |
| 257 | Ga0209677_103028 | 3300025253 | Bacteria | 5782 |
| 258 | Ga0209677_111709 | 3300025253 | Bacteria | 1350 |
| 259 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 260 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 261 | Ga0209148_1002293 | 3300025254 | Bacteria | 6886 |
| 262 | Ga0209759_1000418 | 3300025256 | Bacteria | 52100 |
| 263 | Ga0209759_1001506 | 3300025256 | Bacteria | 12845 |
| 264 | Ga0209759_1001727 | 3300025256 | Bacteria | 11275 |
| 265 | Ga0209759_1011457 | 3300025256 | Bacteria | 2520 |
| 266 | Ga0209129_1000087 | 3300025258 | Bacteria | 179582 |
| 267 | Ga0209129_1000445 | 3300025258 | Bacteria | 30882 |
| 268 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 269 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 270 | Ga0209233_1000147 | 3300025261 | Bacteria | 186517 |
| 271 | Ga0209233_1012091 | 3300025261 | Bacteria | 2516 |
| 272 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 273 | Ga0209455_1000019 | 3300025272 | Bacteria | 705658 |
| 274 | Ga0209455_1000474 | 3300025272 | Bacteria | 30028 |
| 275 | Ga0209455_1005243 | 3300025272 | Bacteria | 4052 |
| 276 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 277 | Ga0209130_1000223 | 3300025284 | Bacteria | 74374 |
| 278 | Ga0209675_1000224 | 3300025291 | Bacteria | 57961 |
| 279 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 280 | Ga0209564_1000102 | 3300025295 | Bacteria | 222597 |
| 281 | Ga0209564_1017016 | 3300025295 | Bacteria | 2860 |
| 282 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 283 | Ga0209758_1016601 | 3300025297 | Bacteria | 3729 |
| 284 | Ga0209256_1000495 | 3300025299 | Bacteria | 57952 |
| 285 | Ga0209256_1033312 | 3300025299 | Bacteria | 1388 |
| 286 | Ga0209257_1002929 | 3300025304 | Bacteria | 15721 |
| 287 | Ga0207656_10007565 | 3300025321 | Bacteria | 3964 |
| 288 | Ga0207655_1096355 | 3300025728 | Bacteria | 1029 |
| 289 | Ga0207713_1000658 | 3300025735 | Bacteria | 32916 |
| 290 | Ga0207647_10000386 | 3300025904 | Bacteria | 35954 |
| 291 | Ga0207647_10024168 | 3300025904 | Bacteria | 4008 |
| 292 | Ga0207647_10064426 | 3300025904 | Bacteria | 2227 |
| 293 | Ga0207647_10064854 | 3300025904 | Bacteria | 2218 |
| 294 | Ga0207705_10000438 | 3300025909 | Bacteria | 36022 |
| 295 | Ga0207705_10027147 | 3300025909 | Bacteria | 4080 |
| 296 | Ga0207705_10065415 | 3300025909 | Bacteria | 2628 |
| 297 | Ga0207705_10070534 | 3300025909 | Bacteria | 2532 |
| 298 | Ga0207705_10147122 | 3300025909 | Bacteria | 1763 |
| 299 | Ga0207654_10091054 | 3300025911 | Bacteria | 1859 |
| 300 | Ga0207707_10000379 | 3300025912 | Bacteria | 46451 |
| 301 | Ga0207707_10000422 | 3300025912 | Bacteria | 44306 |
| 302 | Ga0207707_10002334 | 3300025912 | Bacteria | 17084 |
| 303 | Ga0207707_10036091 | 3300025912 | Bacteria | 4322 |
| 304 | Ga0207707_10071702 | 3300025912 | Bacteria | 3019 |
| 305 | Ga0207707_10120994 | 3300025912 | Bacteria | 2289 |
| 306 | Ga0207695_10001343 | 3300025913 | Bacteria | 41721 |
| 307 | Ga0207695_10002840 | 3300025913 | Bacteria | 25162 |
| 308 | Ga0207695_10003487 | 3300025913 | Bacteria | 22120 |
| 309 | Ga0207695_10006343 | 3300025913 | Bacteria | 15388 |
| 310 | Ga0207695_10009743 | 3300025913 | Bacteria | 11825 |
| 311 | Ga0207695_10186221 | 3300025913 | Bacteria | 1995 |
| 312 | Ga0207695_10295616 | 3300025913 | Bacteria | 1511 |
| 313 | Ga0207671_10000763 | 3300025914 | Bacteria | 40900 |
| 314 | Ga0207671_10045028 | 3300025914 | Bacteria | 3262 |
| 315 | Ga0207693_10535794 | 3300025915 | Bacteria | 913 |
| 316 | Ga0207660_10001603 | 3300025917 | Bacteria | 15183 |
| 317 | Ga0207660_10002593 | 3300025917 | Bacteria | 11851 |
| 318 | Ga0207660_10022615 | 3300025917 | Bacteria | 4236 |
| 319 | Ga0207660_10054227 | 3300025917 | Bacteria | 2861 |
| 320 | Ga0207660_10792289 | 3300025917 | Bacteria | 773 |
| 321 | Ga0207657_10001729 | 3300025919 | Bacteria | 23532 |
| 322 | Ga0207657_10005904 | 3300025919 | Bacteria | 12746 |
| 323 | Ga0207657_10047235 | 3300025919 | Bacteria | 3766 |
| 324 | Ga0207649_10002297 | 3300025920 | Bacteria | 10755 |
| 325 | Ga0207649_10192533 | 3300025920 | Bacteria | 1435 |
| 326 | Ga0207649_10490945 | 3300025920 | Bacteria | 932 |
| 327 | Ga0207652_10000022 | 3300025921 | Bacteria | 158642 |
| 328 | Ga0207652_10000368 | 3300025921 | Bacteria | 46835 |
| 329 | Ga0207652_10002541 | 3300025921 | Bacteria | 15320 |
| 330 | Ga0207652_10003502 | 3300025921 | Bacteria | 12944 |
| 331 | Ga0207652_10003947 | 3300025921 | Bacteria | 12129 |
| 332 | Ga0207652_10008434 | 3300025921 | Bacteria | 8294 |
| 333 | Ga0207652_10016897 | 3300025921 | Bacteria | 5966 |
| 334 | Ga0207652_10220127 | 3300025921 | Bacteria | 1710 |
| 335 | Ga0207681_10012606 | 3300025923 | Bacteria | 5219 |
| 336 | Ga0207694_10077421 | 3300025924 | Bacteria | 2606 |
| 337 | Ga0207650_10038304 | 3300025925 | Bacteria | 3500 |
| 338 | Ga0207650_10357966 | 3300025925 | Bacteria | 1202 |
| 339 | Ga0207687_10076002 | 3300025927 | Bacteria | 2411 |
| 340 | Ga0207664_10000026 | 3300025929 | Bacteria | 194571 |
| 341 | Ga0207664_10001262 | 3300025929 | Bacteria | 16691 |
| 342 | Ga0207690_10000976 | 3300025932 | Bacteria | 18327 |
| 343 | Ga0207690_10001043 | 3300025932 | Bacteria | 17728 |
| 344 | Ga0207690_10003295 | 3300025932 | Bacteria | 9667 |
| 345 | Ga0207690_10041774 | 3300025932 | Bacteria | 3007 |
| 346 | Ga0207690_10101287 | 3300025932 | Bacteria | 2057 |
| 347 | Ga0207706_10018132 | 3300025933 | Bacteria | 6334 |
| 348 | Ga0207706_10058916 | 3300025933 | Bacteria | 3382 |
| 349 | Ga0207686_10050122 | 3300025934 | Bacteria | 2595 |
| 350 | Ga0207709_10085455 | 3300025935 | Bacteria | 2046 |
| 351 | Ga0207709_10274525 | 3300025935 | Bacteria | 1242 |
| 352 | Ga0207670_10002684 | 3300025936 | Bacteria | 9352 |
| 353 | Ga0207661_10043391 | 3300025944 | Bacteria | 3548 |
| 354 | Ga0207679_10009166 | 3300025945 | Bacteria | 6329 |
| 355 | Ga0207679_10176683 | 3300025945 | Bacteria | 1763 |
| 356 | Ga0207679_10728137 | 3300025945 | Bacteria | 901 |
| 357 | Ga0207667_10000436 | 3300025949 | Bacteria | 55945 |
| 358 | Ga0207667_10005577 | 3300025949 | Bacteria | 15357 |
| 359 | Ga0207667_10009175 | 3300025949 | Bacteria | 11682 |
| 360 | Ga0207667_10015489 | 3300025949 | Bacteria | 8656 |
| 361 | Ga0207667_10132576 | 3300025949 | Bacteria | 2566 |
| 362 | Ga0207667_10577978 | 3300025949 | Bacteria | 1134 |
| 363 | Ga0207640_10000564 | 3300025981 | Bacteria | 22103 |
| 364 | Ga0207640_10001437 | 3300025981 | Bacteria | 12893 |
| 365 | Ga0207640_10003230 | 3300025981 | Bacteria | 8781 |
| 366 | Ga0207640_10005203 | 3300025981 | Bacteria | 7079 |
| 367 | Ga0207640_10005896 | 3300025981 | Bacteria | 6689 |
| 368 | Ga0207639_10000637 | 3300026041 | Bacteria | 24168 |
| 369 | Ga0207639_10013073 | 3300026041 | Bacteria | 5796 |
| 370 | Ga0207639_10401258 | 3300026041 | Bacteria | 1235 |
| 371 | Ga0207639_10487174 | 3300026041 | Bacteria | 1125 |
| 372 | Ga0207678_10001228 | 3300026067 | Bacteria | 23598 |
| 373 | Ga0207678_10032261 | 3300026067 | Bacteria | 4565 |
| 374 | Ga0207678_10127499 | 3300026067 | Bacteria | 2171 |
| 375 | Ga0207678_10173277 | 3300026067 | Bacteria | 1842 |
| 376 | Ga0207702_10000032 | 3300026078 | Bacteria | 168047 |
| 377 | Ga0207702_10008105 | 3300026078 | Bacteria | 8890 |
| 378 | Ga0207702_10049210 | 3300026078 | Bacteria | 3556 |
| 379 | Ga0207702_10266030 | 3300026078 | Bacteria | 1616 |
| 380 | Ga0207702_10554683 | 3300026078 | Bacteria | 1124 |
| 381 | Ga0207648_11145270 | 3300026089 | Bacteria | 730 |
| 382 | Ga0207674_10011246 | 3300026116 | Bacteria | 10060 |
| 383 | Ga0207674_10223023 | 3300026116 | Bacteria | 1833 |
| 384 | Ga0207698_10000430 | 3300026142 | Bacteria | 24181 |
| 385 | Ga0207698_10000630 | 3300026142 | Bacteria | 20437 |
| 386 | Ga0207698_10617094 | 3300026142 | Bacteria | 1071 |
| 387 | Ga0207698_10806906 | 3300026142 | Bacteria | 941 |
| 388 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 389 | Ga0268264_11041746 | 3300028381 | Bacteria | 825 |
| 390 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 391 | Ga0307413_10013859 | 3300031824 | Bacteria | 4073 |
| 392 | Ga0307413_10123130 | 3300031824 | Bacteria | 1760 |
| 393 | Ga0307413_10241196 | 3300031824 | Bacteria | 1335 |
| 394 | Ga0307412_10034790 | 3300031911 | Bacteria | 3213 |
| 395 | Ga0307414_10026242 | 3300032004 | Bacteria | 3747 |
| 396 | Ga0395899_0045676 | 3300037312 | Bacteria | 3263 |
| 397 | Ga0395899_0048045 | 3300037312 | Bacteria | 3176 |
| 398 | Ga0395899_0057680 | 3300037312 | Bacteria | 2865 |
| 399 | Ga0395899_0096358 | 3300037312 | Bacteria | 2139 |
| 400 | Ga0395899_0118389 | 3300037312 | Bacteria | 1899 |
| 401 | Ga0395899_0186063 | 3300037312 | Bacteria | 1455 |
| 402 | Ga0395899_0441281 | 3300037312 | Bacteria | 854 |
| 403 | Ga0395900_0000377 | 3300037418 | Bacteria | 64395 |
| 404 | Ga0395900_0000867 | 3300037418 | Bacteria | 39764 |
| 405 | Ga0395900_0017946 | 3300037418 | Bacteria | 7223 |
| 406 | Ga0395900_0034909 | 3300037418 | Bacteria | 5180 |
| 407 | Ga0395900_0043403 | 3300037418 | Bacteria | 4635 |
| 408 | Ga0395900_0061686 | 3300037418 | Bacteria | 3854 |
| 409 | Ga0395900_0061865 | 3300037418 | Bacteria | 3848 |
| 410 | Ga0395900_0089923 | 3300037418 | Bacteria | 3156 |
| 411 | Ga0395900_0123413 | 3300037418 | Bacteria | 2656 |
| 412 | Ga0395900_0165920 | 3300037418 | Bacteria | 2250 |
| 413 | Ga0395900_0413632 | 3300037418 | Bacteria | 1310 |
| 414 | Ga0395900_0476813 | 3300037418 | Bacteria | 1200 |
| 415 | Ga0395900_0717288 | 3300037418 | Bacteria | 932 |
| 416 | Ga0395900_1158105 | 3300037418 | Bacteria | 689 |
| 417 | Ga0395898_0001606 | 3300037466 | Bacteria | 30833 |
| 418 | Ga0395898_0013117 | 3300037466 | Bacteria | 8545 |
| 419 | Ga0395898_0021850 | 3300037466 | Bacteria | 6482 |
| 420 | Ga0395898_0048682 | 3300037466 | Bacteria | 4155 |
| 421 | Ga0395898_0079894 | 3300037466 | Bacteria | 3154 |
| 422 | Ga0395898_0445540 | 3300037466 | Bacteria | 1233 |
| 423 | Ga0395898_0633793 | 3300037466 | Bacteria | 1011 |
| 424 | Ga0395898_0751229 | 3300037466 | Bacteria | 916 |
| 425 | Ga0395905_0000156 | 3300037471 | Bacteria | 112215 |
| 426 | Ga0395905_0044730 | 3300037471 | Bacteria | 4154 |
| 427 | Ga0395905_0119276 | 3300037471 | Bacteria | 2479 |
| 428 | Ga0395905_0166051 | 3300037471 | Bacteria | 2074 |
| 429 | Ga0395905_0260686 | 3300037471 | Bacteria | 1618 |
| 430 | Ga0395905_0293076 | 3300037471 | Bacteria | 1514 |
| 431 | Ga0395905_0379941 | 3300037471 | Bacteria | 1306 |
| 432 | Ga0395905_0393880 | 3300037471 | Bacteria | 1279 |
| 433 | Ga0395905_0423131 | 3300037471 | Bacteria | 1228 |
| 434 | Ga0395905_0469159 | 3300037471 | Bacteria | 1157 |
| 435 | Ga0395901_0003133 | 3300038443 | Bacteria | 16607 |
| 436 | Ga0395901_0007470 | 3300038443 | Bacteria | 11034 |
| 437 | Ga0395901_0008127 | 3300038443 | Bacteria | 10595 |
| 438 | Ga0395901_0010829 | 3300038443 | Bacteria | 9244 |
| 439 | Ga0395901_0018442 | 3300038443 | Bacteria | 7123 |
| 440 | Ga0395901_0034380 | 3300038443 | Bacteria | 5234 |
| 441 | Ga0395901_0177526 | 3300038443 | Bacteria | 2233 |
| 442 | Ga0395901_0195064 | 3300038443 | Bacteria | 2123 |
| 443 | Ga0395901_0248958 | 3300038443 | Bacteria | 1852 |
| 444 | Ga0395901_0379631 | 3300038443 | Bacteria | 1455 |
| 445 | Ga0395901_0828035 | 3300038443 | Bacteria | 912 |
| 446 | Ga0395901_1278162 | 3300038443 | Bacteria | 696 |
| 447 | Ga0237819_00040 | 3300038705 | Bacteria | 45528 |
| 448 | Ga0237816_00041 | 3300039145 | Bacteria | 8045 |
| 449 | Ga0439436_0000438 | 3300041404 | Bacteria | 10558 |
| 450 | Ga0439465_0011177 | 3300041413 | Bacteria | 2816 |
| 451 | Ga0451800_0849097 | 3300041459 | Bacteria | 3763 |
| 452 | Ga0451806_132004 | 3300041462 | Bacteria | 1279 |
| 453 | Ga0439445_0039505 | 3300042004 | Bacteria | 1250 |
| 454 | Ga0439448_0000125 | 3300042005 | Bacteria | 14499 |
| 455 | Ga0439449_0013214 | 3300042007 | Bacteria | 3106 |
| 456 | Ga0439450_025449 | 3300042008 | Bacteria | 1297 |
| 457 | Ga0439455_0001931 | 3300042012 | Bacteria | 3644 |
| 458 | Ga0439446_0000539 | 3300042156 | Bacteria | 7620 |
| 459 | Ga0439458_0007133 | 3300042157 | Bacteria | 2487 |
| 460 | Ga0439458_0020270 | 3300042157 | Bacteria | 1535 |
| 461 | Ga0450908_000085 | 3300042184 | Bacteria | 18990 |
| 462 | Ga0466972_0000981 | 3300044658 | Bacteria | 13728 |
| 463 | Ga0466972_0019906 | 3300044658 | Bacteria | 3354 |
| 464 | Ga0466972_0051805 | 3300044658 | Bacteria | 1979 |
| 465 | Ga0466982_0000003 | 3300044672 | Bacteria | 417243 |
| 466 | Ga0466982_0003001 | 3300044672 | Bacteria | 7156 |
| 467 | Ga0466965_0019561 | 3300044683 | Bacteria | 3251 |
| 468 | Ga0466966_0011779 | 3300044684 | Bacteria | 5794 |
| 469 | Ga0466966_0108720 | 3300044684 | Bacteria | 1710 |
| 470 | Ga0466966_0116376 | 3300044684 | Bacteria | 1645 |
| 471 | Ga0466966_0237856 | 3300044684 | Bacteria | 1098 |
| 472 | Ga0466961_0232598 | 3300044693 | Bacteria | 1134 |
| 473 | Ga0466963_0122689 | 3300044694 | Bacteria | 1789 |
| 474 | Ga0466964_0000822 | 3300044706 | Bacteria | 10149 |
| 475 | Ga0466964_0031549 | 3300044706 | Bacteria | 2102 |
| 476 | Ga0466971_0073629 | 3300044719 | Bacteria | 1552 |
| 477 | Ga0466968_0000628 | 3300044735 | Bacteria | 12066 |
| 478 | Ga0466968_0004407 | 3300044735 | Bacteria | 5259 |
| 479 | Ga0466968_0306209 | 3300044735 | Bacteria | 765 |
| 480 | Ga0466970_0003031 | 3300044765 | Bacteria | 8150 |
| 481 | Ga0466970_0033522 | 3300044765 | Bacteria | 2714 |
| 482 | Ga0466957_0013276 | 3300044842 | Bacteria | 4778 |
| 483 | Ga0466957_0118728 | 3300044842 | Bacteria | 1684 |
| 484 | Ga0466957_0152069 | 3300044842 | Bacteria | 1497 |
| 485 | Ga0466960_0007328 | 3300044901 | Bacteria | 4475 |
| 486 | Ga0466959_0037153 | 3300045049 | Bacteria | 3598 |
| 487 | Ga0466958_0037874 | 3300045836 | Bacteria | 2891 |
| 488 | Ga0466958_0057538 | 3300045836 | Bacteria | 2362 |
| 489 | Ga0466958_0287947 | 3300045836 | Bacteria | 1053 |
| 490 | Ga0466967_0082383 | 3300045976 | Bacteria | 2907 |
| 491 | Ga0466967_0398030 | 3300045976 | Bacteria | 1339 |
| 492 | Ga0466967_1042135 | 3300045976 | Bacteria | 815 |
| 493 | Ga0466967_1214723 | 3300045976 | Bacteria | 751 |
| 494 | Ga0495617_000020 | 3300046452 | Bacteria | 230257 |
| 495 | Ga0495617_000035 | 3300046452 | Bacteria | 145195 |
| 496 | Ga0495617_063588 | 3300046452 | Bacteria | 1218 |
| 497 | Ga0495617_109690 | 3300046452 | Bacteria | 893 |
| 498 | Ga0495627_000243 | 3300046453 | Bacteria | 57215 |
| 499 | Ga0495627_008267 | 3300046453 | Bacteria | 3915 |
| 500 | Ga0495627_033200 | 3300046453 | Bacteria | 1619 |
| 501 | Ga0495627_075752 | 3300046453 | Bacteria | 979 |
| 502 | Ga0495603_0058305 | 3300046455 | Bacteria | 2283 |
| 503 | Ga0495591_025976 | 3300046458 | Bacteria | 1829 |
| 504 | Ga0495638_0000107 | 3300046460 | Bacteria | 133008 |
| 505 | Ga0495638_0000471 | 3300046460 | Bacteria | 48459 |
| 506 | Ga0495638_0001226 | 3300046460 | Bacteria | 24272 |
| 507 | Ga0495638_0079804 | 3300046460 | Bacteria | 1989 |
| 508 | Ga0495638_0162189 | 3300046460 | Bacteria | 1289 |
| 509 | Ga0495638_0324574 | 3300046460 | Bacteria | 821 |
| 510 | Ga0495653_0000082 | 3300046463 | Bacteria | 80285 |
| 511 | Ga0495653_0192882 | 3300046463 | Bacteria | 1388 |
| 512 | Ga0495650_0000011 | 3300046471 | Bacteria | 615329 |
| 513 | Ga0495650_0000462 | 3300046471 | Bacteria | 63149 |
| 514 | Ga0495650_0000607 | 3300046471 | Bacteria | 48960 |
| 515 | Ga0495650_0001057 | 3300046471 | Bacteria | 30556 |
| 516 | Ga0495650_0001457 | 3300046471 | Bacteria | 22669 |
| 517 | Ga0495650_0002636 | 3300046471 | Bacteria | 14038 |
| 518 | Ga0495650_0014912 | 3300046471 | Bacteria | 4011 |
| 519 | Ga0495650_0106164 | 3300046471 | Bacteria | 1048 |
| 520 | Ga0495582_0024280 | 3300046473 | Bacteria | 3315 |
| 521 | Ga0495605_0000234 | 3300046474 | Bacteria | 68169 |
| 522 | Ga0495605_0000249 | 3300046474 | Bacteria | 63652 |
| 523 | Ga0495605_0045715 | 3300046474 | Bacteria | 2156 |
| 524 | Ga0495605_0071561 | 3300046474 | Bacteria | 1637 |
| 525 | Ga0495605_0076838 | 3300046474 | Bacteria | 1568 |
| 526 | Ga0495584_0001550 | 3300046491 | Bacteria | 13654 |
| 527 | Ga0495584_0003045 | 3300046491 | Bacteria | 9304 |
| 528 | Ga0495584_0003415 | 3300046491 | Bacteria | 8748 |
| 529 | Ga0495584_0314309 | 3300046491 | Bacteria | 795 |
| 530 | Ga0495585_0000243 | 3300046492 | Bacteria | 56533 |
| 531 | Ga0495585_0000424 | 3300046492 | Bacteria | 40738 |
| 532 | Ga0495585_0029178 | 3300046492 | Bacteria | 3141 |
| 533 | Ga0495585_0085586 | 3300046492 | Bacteria | 1703 |
| 534 | Ga0495596_0003347 | 3300046500 | Bacteria | 8151 |
| 535 | Ga0495596_0007214 | 3300046500 | Bacteria | 5028 |
| 536 | Ga0495596_0009273 | 3300046500 | Bacteria | 4334 |
| 537 | Ga0495596_0010010 | 3300046500 | Bacteria | 4149 |
| 538 | Ga0495596_0011456 | 3300046500 | Bacteria | 3826 |
| 539 | Ga0495596_0038449 | 3300046500 | Bacteria | 1891 |
| 540 | Ga0495596_0039743 | 3300046500 | Bacteria | 1858 |
| 541 | Ga0495596_0092419 | 3300046500 | Bacteria | 1174 |
| 542 | Ga0495596_0118252 | 3300046500 | Bacteria | 1029 |
| 543 | Ga0495607_0000012 | 3300046501 | Bacteria | 195369 |
| 544 | Ga0495607_0000158 | 3300046501 | Bacteria | 71682 |
| 545 | Ga0495607_0000672 | 3300046501 | Bacteria | 33134 |
| 546 | Ga0495607_0006215 | 3300046501 | Bacteria | 8425 |
| 547 | Ga0495607_0007208 | 3300046501 | Bacteria | 7720 |
| 548 | Ga0495607_0031115 | 3300046501 | Bacteria | 3269 |
| 549 | Ga0495607_0057699 | 3300046501 | Bacteria | 2223 |
| 550 | Ga0495607_0062153 | 3300046501 | Bacteria | 2118 |
| 551 | Ga0495607_0076733 | 3300046501 | Bacteria | 1847 |
| 552 | Ga0495607_0081553 | 3300046501 | Bacteria | 1776 |
| 553 | Ga0495583_0000005 | 3300046506 | Bacteria | 636894 |
| 554 | Ga0495583_0004110 | 3300046506 | Bacteria | 10670 |
| 555 | Ga0495583_0005624 | 3300046506 | Bacteria | 8447 |
| 556 | Ga0495583_0007361 | 3300046506 | Bacteria | 6933 |
| 557 | Ga0495583_0008996 | 3300046506 | Bacteria | 6018 |
| 558 | Ga0495583_0021164 | 3300046506 | Bacteria | 3351 |
| 559 | Ga0495583_0045836 | 3300046506 | Bacteria | 2019 |
| 560 | Ga0495583_0084458 | 3300046506 | Bacteria | 1375 |
| 561 | Ga0495606_0000161 | 3300046507 | Bacteria | 117607 |
| 562 | Ga0495606_0000559 | 3300046507 | Bacteria | 59276 |
| 563 | Ga0495606_0000648 | 3300046507 | Bacteria | 54723 |
| 564 | Ga0495606_0005134 | 3300046507 | Bacteria | 12699 |
| 565 | Ga0495606_0007954 | 3300046507 | Bacteria | 9336 |
| 566 | Ga0495606_0021559 | 3300046507 | Bacteria | 4717 |
| 567 | Ga0495606_0080196 | 3300046507 | Bacteria | 2031 |
| 568 | Ga0495606_0101883 | 3300046507 | Bacteria | 1746 |
| 569 | Ga0495606_0145008 | 3300046507 | Bacteria | 1399 |
| 570 | Ga0495610_0000014 | 3300046512 | Bacteria | 444708 |
| 571 | Ga0495610_0003722 | 3300046512 | Bacteria | 11676 |
| 572 | Ga0495610_0034735 | 3300046512 | Bacteria | 2594 |
| 573 | Ga0495610_0113962 | 3300046512 | Bacteria | 1194 |
| 574 | Ga0495616_0000060 | 3300046513 | Bacteria | 98215 |
| 575 | Ga0495616_0000173 | 3300046513 | Bacteria | 54951 |
| 576 | Ga0495616_0001412 | 3300046513 | Bacteria | 16715 |
| 577 | Ga0495616_0005006 | 3300046513 | Bacteria | 8258 |
| 578 | Ga0495616_0012387 | 3300046513 | Bacteria | 4844 |
| 579 | Ga0495616_0013723 | 3300046513 | Bacteria | 4561 |
| 580 | Ga0495616_0018890 | 3300046513 | Bacteria | 3769 |
| 581 | Ga0495616_0020423 | 3300046513 | Bacteria | 3603 |
| 582 | Ga0495616_0078505 | 3300046513 | Bacteria | 1583 |
| 583 | Ga0495616_0130363 | 3300046513 | Bacteria | 1153 |
| 584 | Ga0495620_0000101 | 3300046515 | Bacteria | 68526 |
| 585 | Ga0495620_0011482 | 3300046515 | Bacteria | 4619 |
| 586 | Ga0495631_0000103 | 3300046518 | Bacteria | 55680 |
| 587 | Ga0495631_0000525 | 3300046518 | Bacteria | 25737 |
| 588 | Ga0495631_0000529 | 3300046518 | Bacteria | 25592 |
| 589 | Ga0495631_0001387 | 3300046518 | Bacteria | 14713 |
| 590 | Ga0495631_0004486 | 3300046518 | Bacteria | 7423 |
| 591 | Ga0495631_0008657 | 3300046518 | Bacteria | 5121 |
| 592 | Ga0495631_0015898 | 3300046518 | Bacteria | 3596 |
| 593 | Ga0495631_0023570 | 3300046518 | Bacteria | 2851 |
| 594 | Ga0495631_0050725 | 3300046518 | Bacteria | 1814 |
| 595 | Ga0495632_0000019 | 3300046519 | Bacteria | 215713 |
| 596 | Ga0495632_0000406 | 3300046519 | Bacteria | 40685 |
| 597 | Ga0495632_0000653 | 3300046519 | Bacteria | 31855 |
| 598 | Ga0495632_0001400 | 3300046519 | Bacteria | 20200 |
| 599 | Ga0495632_0002098 | 3300046519 | Bacteria | 15599 |
| 600 | Ga0495632_0027721 | 3300046519 | Bacteria | 2963 |
| 601 | Ga0495632_0105988 | 3300046519 | Bacteria | 1322 |
| 602 | Ga0495632_0155286 | 3300046519 | Bacteria | 1056 |
| 603 | Ga0495632_0218445 | 3300046519 | Bacteria | 862 |
| 604 | Ga0495637_0011180 | 3300046520 | Bacteria | 4317 |
| 605 | Ga0495637_0041836 | 3300046520 | Bacteria | 1963 |
| 606 | Ga0495643_0005663 | 3300046522 | Bacteria | 8375 |
| 607 | Ga0495643_0028817 | 3300046522 | Bacteria | 3110 |
| 608 | Ga0495643_0031463 | 3300046522 | Bacteria | 2952 |
| 609 | Ga0495643_0034002 | 3300046522 | Bacteria | 2815 |
| 610 | Ga0495643_0047893 | 3300046522 | Bacteria | 2313 |
| 611 | Ga0495643_0118349 | 3300046522 | Bacteria | 1340 |
| 612 | Ga0495644_0019082 | 3300046523 | Bacteria | 2617 |
| 613 | Ga0495648_0000288 | 3300046524 | Bacteria | 57183 |
| 614 | Ga0495648_0000551 | 3300046524 | Bacteria | 40309 |
| 615 | Ga0495648_0003735 | 3300046524 | Bacteria | 13273 |
| 616 | Ga0495648_0013564 | 3300046524 | Bacteria | 6012 |
| 617 | Ga0495648_0013849 | 3300046524 | Bacteria | 5940 |
| 618 | Ga0495648_0015016 | 3300046524 | Bacteria | 5640 |
| 619 | Ga0495648_0017797 | 3300046524 | Bacteria | 5066 |
| 620 | Ga0495648_0027107 | 3300046524 | Bacteria | 3842 |
| 621 | Ga0495648_0032089 | 3300046524 | Bacteria | 3451 |
| 622 | Ga0495648_0088595 | 3300046524 | Bacteria | 1739 |
| 623 | Ga0495642_0000038 | 3300046528 | Bacteria | 79256 |
| 624 | Ga0495642_0000214 | 3300046528 | Bacteria | 33632 |
| 625 | Ga0495642_0002954 | 3300046528 | Bacteria | 6772 |
| 626 | Ga0495642_0013328 | 3300046528 | Bacteria | 3178 |
| 627 | Ga0495642_0022625 | 3300046528 | Bacteria | 2477 |
| 628 | Ga0495642_0032573 | 3300046528 | Bacteria | 2091 |
| 629 | Ga0495642_0076928 | 3300046528 | Bacteria | 1401 |
| 630 | Ga0495642_0077920 | 3300046528 | Bacteria | 1392 |
| 631 | Ga0495642_0180183 | 3300046528 | Bacteria | 919 |
| 632 | Ga0495654_0004328 | 3300046530 | Bacteria | 8460 |
| 633 | Ga0495654_0011622 | 3300046530 | Bacteria | 4757 |
| 634 | Ga0495654_0015883 | 3300046530 | Bacteria | 3990 |
| 635 | Ga0495654_0030279 | 3300046530 | Bacteria | 2755 |
| 636 | Ga0495654_0053327 | 3300046530 | Bacteria | 1966 |
| 637 | Ga0495586_0118195 | 3300046535 | Bacteria | 1479 |
| 638 | Ga0495609_0000021 | 3300046538 | Bacteria | 281770 |
| 639 | Ga0495609_0001140 | 3300046538 | Bacteria | 18361 |
| 640 | Ga0495609_0002120 | 3300046538 | Bacteria | 12468 |
| 641 | Ga0495609_0008668 | 3300046538 | Bacteria | 4962 |
| 642 | Ga0495609_0012401 | 3300046538 | Bacteria | 4043 |
| 643 | Ga0495609_0018696 | 3300046538 | Bacteria | 3211 |
| 644 | Ga0495609_0022596 | 3300046538 | Bacteria | 2897 |
| 645 | Ga0495609_0030593 | 3300046538 | Bacteria | 2450 |
| 646 | Ga0495609_0099269 | 3300046538 | Bacteria | 1262 |
| 647 | Ga0495597_0000515 | 3300046542 | Bacteria | 32003 |
| 648 | Ga0495597_0001373 | 3300046542 | Bacteria | 17615 |
| 649 | Ga0495597_0007248 | 3300046542 | Bacteria | 5650 |
| 650 | Ga0495597_0118743 | 3300046542 | Bacteria | 1103 |
| 651 | Ga0495645_0067913 | 3300046543 | Bacteria | 2574 |
| 652 | Ga0495622_0018204 | 3300046557 | Bacteria | 3271 |
| 653 | Ga0495622_0028393 | 3300046557 | Bacteria | 2613 |
| 654 | Ga0495633_0021925 | 3300046558 | Bacteria | 3188 |
| 655 | Ga0495633_0039324 | 3300046558 | Bacteria | 2257 |
| 656 | Ga0495633_0045599 | 3300046558 | Bacteria | 2075 |
| 657 | Ga0495633_0078396 | 3300046558 | Bacteria | 1538 |
| 658 | Ga0495633_0212925 | 3300046558 | Bacteria | 885 |
| 659 | Ga0495656_0017663 | 3300046615 | Bacteria | 2725 |
| 660 | Ga0495656_0156926 | 3300046615 | Bacteria | 1103 |
| 661 | Ga0495668_0000008 | 3300046616 | Bacteria | 498364 |
| 662 | Ga0495668_0000164 | 3300046616 | Bacteria | 99239 |
| 663 | Ga0495668_0000457 | 3300046616 | Bacteria | 52237 |
| 664 | Ga0495668_0000579 | 3300046616 | Bacteria | 44604 |
| 665 | Ga0495668_0002674 | 3300046616 | Bacteria | 14308 |
| 666 | Ga0495668_0015801 | 3300046616 | Bacteria | 4398 |
| 667 | Ga0495668_0022095 | 3300046616 | Bacteria | 3639 |
| 668 | Ga0495668_0068250 | 3300046616 | Bacteria | 1955 |
| 669 | Ga0495668_0074025 | 3300046616 | Bacteria | 1870 |
| 670 | Ga0495668_0094439 | 3300046616 | Bacteria | 1637 |
| 671 | Ga0495668_0174543 | 3300046616 | Bacteria | 1177 |
| 672 | Ga0495668_0179599 | 3300046616 | Bacteria | 1159 |
| 673 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 674 | Ga0495611_0000397 | 3300046648 | Bacteria | 27409 |
| 675 | Ga0495611_0000957 | 3300046648 | Bacteria | 15415 |
| 676 | Ga0495611_0002336 | 3300046648 | Bacteria | 8757 |
| 677 | Ga0495611_0043514 | 3300046648 | Bacteria | 2008 |
| 678 | Ga0495611_0133572 | 3300046648 | Bacteria | 1158 |
| 679 | Ga0495625_0000325 | 3300046660 | Bacteria | 72731 |
| 680 | Ga0495625_0001449 | 3300046660 | Bacteria | 28796 |
| 681 | Ga0495625_0028480 | 3300046660 | Bacteria | 4189 |
| 682 | Ga0495625_0098430 | 3300046660 | Bacteria | 2012 |
| 683 | Ga0495625_0101869 | 3300046660 | Bacteria | 1971 |
| 684 | Ga0495625_0122610 | 3300046660 | Bacteria | 1767 |
| 685 | Ga0495625_0164742 | 3300046660 | Bacteria | 1483 |
| 686 | Ga0495635_0151952 | 3300046663 | Bacteria | 1576 |
| 687 | Ga0495659_0004044 | 3300046664 | Bacteria | 4641 |
| 688 | Ga0495661_0000052 | 3300046665 | Bacteria | 140244 |
| 689 | Ga0495661_0000403 | 3300046665 | Bacteria | 46037 |
| 690 | Ga0495661_0000731 | 3300046665 | Bacteria | 32210 |
| 691 | Ga0495661_0025016 | 3300046665 | Bacteria | 3862 |
| 692 | Ga0495661_0044535 | 3300046665 | Bacteria | 2719 |
| 693 | Ga0495661_0065974 | 3300046665 | Bacteria | 2131 |
| 694 | Ga0495661_0110041 | 3300046665 | Bacteria | 1536 |
| 695 | Ga0495588_0000184 | 3300046674 | Bacteria | 70692 |
| 696 | Ga0495588_0011307 | 3300046674 | Bacteria | 4184 |
| 697 | Ga0495588_0015485 | 3300046674 | Bacteria | 3671 |
| 698 | Ga0495588_0136486 | 3300046674 | Bacteria | 1295 |
| 699 | Ga0495669_0000807 | 3300046684 | Bacteria | 13373 |
| 700 | Ga0495669_0001911 | 3300046684 | Bacteria | 8547 |
| 701 | Ga0495669_0007554 | 3300046684 | Bacteria | 4560 |
| 702 | Ga0495669_0007628 | 3300046684 | Bacteria | 4540 |
| 703 | Ga0495669_0093117 | 3300046684 | Bacteria | 1393 |
| 704 | Ga0495613_0039901 | 3300046689 | Bacteria | 3479 |
| 705 | Ga0495613_0342114 | 3300046689 | Bacteria | 1029 |
| 706 | Ga0495670_0001047 | 3300046691 | Bacteria | 13384 |
| 707 | Ga0495670_0002879 | 3300046691 | Bacteria | 8484 |
| 708 | Ga0495670_0003247 | 3300046691 | Bacteria | 8008 |
| 709 | Ga0495670_0017824 | 3300046691 | Bacteria | 3497 |
| 710 | Ga0495670_0024119 | 3300046691 | Bacteria | 3005 |
| 711 | Ga0495670_0037578 | 3300046691 | Bacteria | 2413 |
| 712 | Ga0495670_0044174 | 3300046691 | Bacteria | 2224 |
| 713 | Ga0495670_0079655 | 3300046691 | Bacteria | 1667 |
| 714 | Ga0495670_0196149 | 3300046691 | Bacteria | 1068 |
| 715 | Ga0495670_0324776 | 3300046691 | Bacteria | 826 |
| 716 | Ga0495671_0000005 | 3300046692 | Bacteria | 509397 |
| 717 | Ga0495671_0000909 | 3300046692 | Bacteria | 21072 |
| 718 | Ga0495671_0002073 | 3300046692 | Bacteria | 12862 |
| 719 | Ga0495671_0007302 | 3300046692 | Bacteria | 6309 |
| 720 | Ga0495671_0007856 | 3300046692 | Bacteria | 6035 |
| 721 | Ga0495671_0077582 | 3300046692 | Bacteria | 1629 |
| 722 | Ga0495671_0085791 | 3300046692 | Bacteria | 1542 |
| 723 | Ga0495671_0086562 | 3300046692 | Bacteria | 1535 |
| 724 | Ga0495649_0000714 | 3300046694 | Bacteria | 27064 |
| 725 | Ga0495649_0013674 | 3300046694 | Bacteria | 4677 |
| 726 | Ga0495649_0014729 | 3300046694 | Bacteria | 4470 |
| 727 | Ga0495649_0050596 | 3300046694 | Bacteria | 2254 |
| 728 | Ga0495649_0067730 | 3300046694 | Bacteria | 1915 |
| 729 | Ga0495649_0122411 | 3300046694 | Bacteria | 1375 |
| 730 | Ga0495589_0000012 | 3300046794 | Bacteria | 248641 |
| 731 | Ga0495589_0000139 | 3300046794 | Bacteria | 66597 |
| 732 | Ga0495589_0000307 | 3300046794 | Bacteria | 39153 |
| 733 | Ga0495589_0001673 | 3300046794 | Bacteria | 12702 |
| 734 | Ga0495589_0002326 | 3300046794 | Bacteria | 10677 |
| 735 | Ga0495589_0010378 | 3300046794 | Bacteria | 4839 |
| 736 | Ga0495589_0036373 | 3300046794 | Bacteria | 2468 |
| 737 | Ga0495589_0107944 | 3300046794 | Bacteria | 1344 |
| 738 | Ga0495589_0152738 | 3300046794 | Bacteria | 1102 |
| 739 | Ga0495589_0171098 | 3300046794 | Bacteria | 1032 |
| 740 | Ga0495660_0000176 | 3300046810 | Bacteria | 69312 |
| 741 | Ga0495660_0000186 | 3300046810 | Bacteria | 66806 |
| 742 | Ga0495660_0011786 | 3300046810 | Bacteria | 5069 |
| 743 | Ga0495660_0014484 | 3300046810 | Bacteria | 4560 |
| 744 | Ga0495660_0045152 | 3300046810 | Bacteria | 2420 |
| 745 | Ga0495660_0117261 | 3300046810 | Bacteria | 1351 |
| 746 | Ga0495660_0295758 | 3300046810 | Bacteria | 735 |
| 747 | Ga0495581_0036002 | 3300047315 | Bacteria | 2863 |
| 748 | Ga0495604_0023297 | 3300047317 | Bacteria | 4939 |
| 749 | Ga0495636_0049065 | 3300047318 | Bacteria | 1765 |
| 750 | Ga0495672_0000801 | 3300047320 | Bacteria | 33909 |
| 751 | Ga0495672_0002979 | 3300047320 | Bacteria | 14898 |
| 752 | Ga0495672_0003143 | 3300047320 | Bacteria | 14375 |
| 753 | Ga0495676_0000618 | 3300047321 | Bacteria | 29417 |
| 754 | Ga0495680_0215811 | 3300047322 | Bacteria | 1371 |
| 755 | Ga0495683_0001130 | 3300047323 | Bacteria | 18377 |
| 756 | Ga0495683_0064643 | 3300047323 | Bacteria | 1806 |
| 757 | Ga0495683_0124421 | 3300047323 | Bacteria | 1221 |
| 758 | Ga0495683_0182440 | 3300047323 | Bacteria | 957 |
| 759 | Ga0495687_000130 | 3300047443 | Bacteria | 115146 |
| 760 | Ga0495687_000149 | 3300047443 | Bacteria | 106301 |
| 761 | Ga0495687_000193 | 3300047443 | Bacteria | 87329 |
| 762 | Ga0495687_000326 | 3300047443 | Bacteria | 61742 |
| 763 | Ga0495687_002935 | 3300047443 | Bacteria | 12944 |
| 764 | Ga0495687_015774 | 3300047443 | Bacteria | 3827 |
| 765 | Ga0495677_0000019 | 3300047445 | Bacteria | 111380 |
| 766 | Ga0495677_0003492 | 3300047445 | Bacteria | 6098 |
| 767 | Ga0495677_0003797 | 3300047445 | Bacteria | 5841 |
| 768 | Ga0495677_0006852 | 3300047445 | Bacteria | 4284 |
| 769 | Ga0495677_0008147 | 3300047445 | Bacteria | 3891 |
| 770 | Ga0495677_0035489 | 3300047445 | Bacteria | 1819 |
| 771 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 772 | Ga0495679_005389 | 3300047446 | Bacteria | 5673 |
| 773 | Ga0495679_018740 | 3300047446 | Bacteria | 2447 |
| 774 | Ga0495679_028314 | 3300047446 | Bacteria | 1839 |
| 775 | Ga0495685_004657 | 3300047447 | Bacteria | 4447 |
| 776 | Ga0495685_007094 | 3300047447 | Bacteria | 3691 |
| 777 | Ga0495685_009073 | 3300047447 | Bacteria | 3314 |
| 778 | Ga0495673_0000009 | 3300047469 | Bacteria | 731993 |
| 779 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 780 | Ga0495673_0000072 | 3300047469 | Bacteria | 213166 |
| 781 | Ga0495673_0000798 | 3300047469 | Bacteria | 29557 |
| 782 | Ga0495681_0000403 | 3300047470 | Bacteria | 33580 |
| 783 | Ga0495681_0003907 | 3300047470 | Bacteria | 10273 |
| 784 | Ga0495681_0005230 | 3300047470 | Bacteria | 8718 |
| 785 | Ga0495681_0008236 | 3300047470 | Bacteria | 6551 |
| 786 | Ga0495681_0013771 | 3300047470 | Bacteria | 4676 |
| 787 | Ga0495681_0076585 | 3300047470 | Bacteria | 1503 |
| 788 | Ga0495686_0000263 | 3300047472 | Bacteria | 94308 |
| 789 | Ga0495686_0001334 | 3300047472 | Bacteria | 27656 |
| 790 | Ga0495686_0002561 | 3300047472 | Bacteria | 16963 |
| 791 | Ga0495686_0003427 | 3300047472 | Bacteria | 13759 |
| 792 | Ga0495686_0021564 | 3300047472 | Bacteria | 4274 |
| 793 | Ga0495686_0027591 | 3300047472 | Bacteria | 3705 |
| 794 | Ga0495686_0034555 | 3300047472 | Bacteria | 3254 |
| 795 | Ga0495686_0061419 | 3300047472 | Bacteria | 2333 |
| 796 | Ga0495686_0062769 | 3300047472 | Bacteria | 2303 |
| 797 | Ga0495686_0135386 | 3300047472 | Bacteria | 1457 |
| 798 | Ga0495593_0118586 | 3300047673 | Bacteria | 1347 |
| 799 | Ga0495614_0005923 | 3300048089 | Bacteria | 5507 |
| 800 | Ga0495614_0055808 | 3300048089 | Bacteria | 1694 |
| 801 | Ga0495615_0042158 | 3300048090 | Bacteria | 1144 |
| 802 | Ga0495626_0000082 | 3300048091 | Bacteria | 128002 |
| 803 | Ga0495626_0004262 | 3300048091 | Bacteria | 8833 |
| 804 | Ga0495626_0020593 | 3300048091 | Bacteria | 3284 |
| 805 | Ga0495626_0035231 | 3300048091 | Bacteria | 2389 |
| 806 | Ga0495626_0053994 | 3300048091 | Bacteria | 1846 |
| 807 | Ga0495626_0067093 | 3300048091 | Bacteria | 1621 |
| 808 | Ga0495626_0123139 | 3300048091 | Bacteria | 1112 |
| 809 | Ga0495626_0152188 | 3300048091 | Bacteria | 974 |
| 810 | Ga0496100_0038258 | 3300048903 | Bacteria | 3039 |
| 811 | Ga0496100_0038327 | 3300048903 | Bacteria | 3037 |
| 812 | Ga0496100_0511974 | 3300048903 | Bacteria | 925 |
| 813 | Ga0496101_0001273 | 3300048904 | Bacteria | 15089 |
| 814 | Ga0496101_0407138 | 3300048904 | Bacteria | 1071 |
| 815 | Ga0496102_0172792 | 3300048905 | Bacteria | 2034 |
| 816 | Ga0496102_0380999 | 3300048905 | Bacteria | 1327 |
| 817 | Ga0496102_0835734 | 3300048905 | Bacteria | 843 |
| 818 | Ga0496103_0041532 | 3300048906 | Bacteria | 2827 |
| 819 | Ga0496104_0132231 | 3300048907 | Bacteria | 2397 |
| 820 | Ga0496106_0022509 | 3300048909 | Bacteria | 4683 |
| 821 | Ga0496106_0029220 | 3300048909 | Bacteria | 4107 |
| 822 | Ga0496106_0030235 | 3300048909 | Bacteria | 4039 |
| 823 | Ga0496107_0430914 | 3300048910 | Bacteria | 980 |
| 824 | Ga0496107_0583873 | 3300048910 | Bacteria | 827 |
| 825 | Ga0496109_0019971 | 3300048912 | Bacteria | 5915 |
| 826 | Ga0496110_0000365 | 3300048913 | Bacteria | 30306 |
| 827 | Ga0496110_0413874 | 3300048913 | Bacteria | 1229 |
| 828 | Ga0496111_0228244 | 3300048914 | Bacteria | 1383 |
| 829 | Ga0496112_0147805 | 3300048915 | Bacteria | 2318 |
| 830 | Ga0496113_0001645 | 3300048916 | Bacteria | 12596 |
| 831 | Ga0496113_0018536 | 3300048916 | Bacteria | 4850 |
| 832 | Ga0496115_0000110 | 3300048918 | Bacteria | 74992 |
| 833 | Ga0496115_0001042 | 3300048918 | Bacteria | 20129 |
| 834 | Ga0496115_0049161 | 3300048918 | Bacteria | 3375 |
| 835 | Ga0496115_0415173 | 3300048918 | Bacteria | 1091 |
| 836 | Ga0496117_0000730 | 3300048920 | Bacteria | 51618 |
| 837 | Ga0496117_0042972 | 3300048920 | Bacteria | 3292 |
| 838 | Ga0496118_0002084 | 3300048921 | Bacteria | 28123 |
| 839 | Ga0496118_0002163 | 3300048921 | Bacteria | 27366 |
| 840 | Ga0496118_0002572 | 3300048921 | Bacteria | 24227 |
| 841 | Ga0496118_0014611 | 3300048921 | Bacteria | 7340 |
| 842 | Ga0496118_0048817 | 3300048921 | Bacteria | 3264 |
| 843 | Ga0496119_0000070 | 3300048922 | Bacteria | 154395 |
| 844 | Ga0496119_0001714 | 3300048922 | Bacteria | 25570 |
| 845 | Ga0496119_0096818 | 3300048922 | Bacteria | 1664 |
| 846 | Ga0496119_0161033 | 3300048922 | Bacteria | 1193 |
| 847 | Ga0496120_0000541 | 3300048923 | Bacteria | 57865 |
| 848 | Ga0496120_0000637 | 3300048923 | Bacteria | 52193 |
| 849 | Ga0496120_0002482 | 3300048923 | Bacteria | 18555 |
| 850 | Ga0496120_0029637 | 3300048923 | Bacteria | 3339 |
| 851 | Ga0496120_0119582 | 3300048923 | Bacteria | 1364 |
| 852 | Ga0496121_0000355 | 3300048924 | Bacteria | 94479 |
| 853 | Ga0496121_0000564 | 3300048924 | Bacteria | 69827 |
| 854 | Ga0496121_0001271 | 3300048924 | Bacteria | 43433 |
| 855 | Ga0496121_0010533 | 3300048924 | Bacteria | 10403 |
| 856 | Ga0496121_0033678 | 3300048924 | Bacteria | 4631 |
| 857 | Ga0496121_0035380 | 3300048924 | Bacteria | 4478 |
| 858 | Ga0496121_0052766 | 3300048924 | Bacteria | 3410 |
| 859 | Ga0496122_0001026 | 3300048925 | Bacteria | 49313 |
| 860 | Ga0496122_0002103 | 3300048925 | Bacteria | 29505 |
| 861 | Ga0496122_0022702 | 3300048925 | Bacteria | 5568 |
| 862 | Ga0496122_0027010 | 3300048925 | Bacteria | 4925 |
| 863 | Ga0496122_0041497 | 3300048925 | Bacteria | 3637 |
| 864 | Ga0496122_0053908 | 3300048925 | Bacteria | 3026 |
| 865 | Ga0496122_0057117 | 3300048925 | Bacteria | 2902 |
| 866 | Ga0496122_0079607 | 3300048925 | Bacteria | 2289 |
| 867 | Ga0496122_0084708 | 3300048925 | Bacteria | 2191 |
| 868 | Ga0496122_0107031 | 3300048925 | Bacteria | 1849 |
| 869 | Ga0496122_0123301 | 3300048925 | Bacteria | 1665 |
| 870 | Ga0496123_0000324 | 3300048926 | Bacteria | 91012 |
| 871 | Ga0496123_0001026 | 3300048926 | Bacteria | 42452 |
| 872 | Ga0496123_0003625 | 3300048926 | Bacteria | 17092 |
| 873 | Ga0496123_0007822 | 3300048926 | Bacteria | 9950 |
| 874 | Ga0496123_0013403 | 3300048926 | Bacteria | 6887 |
| 875 | Ga0496123_0029262 | 3300048926 | Bacteria | 4060 |
| 876 | Ga0496123_0050963 | 3300048926 | Bacteria | 2761 |
| 877 | Ga0496124_0000472 | 3300048927 | Bacteria | 69226 |
| 878 | Ga0496124_0003618 | 3300048927 | Bacteria | 18770 |
| 879 | Ga0496124_0004318 | 3300048927 | Bacteria | 16672 |
| 880 | Ga0496124_0021238 | 3300048927 | Bacteria | 5985 |
| 881 | Ga0496124_0081867 | 3300048927 | Bacteria | 2651 |
| 882 | Ga0496124_0149351 | 3300048927 | Bacteria | 1835 |
| 883 | Ga0496124_0309404 | 3300048927 | Bacteria | 1137 |
| 884 | Ga0496124_0382706 | 3300048927 | Bacteria | 983 |
| 885 | Ga0496124_0433169 | 3300048927 | Bacteria | 902 |
| 886 | Ga0496125_0002514 | 3300048928 | Bacteria | 23681 |
| 887 | Ga0496125_0007422 | 3300048928 | Bacteria | 11661 |
| 888 | Ga0496125_0073723 | 3300048928 | Bacteria | 2652 |
| 889 | Ga0496125_0374934 | 3300048928 | Bacteria | 841 |
| 890 | Ga0496126_0000718 | 3300048929 | Bacteria | 60240 |
| 891 | Ga0496126_0005219 | 3300048929 | Bacteria | 14980 |
| 892 | Ga0496126_0006238 | 3300048929 | Bacteria | 13323 |
| 893 | Ga0496126_0021896 | 3300048929 | Bacteria | 6235 |
| 894 | Ga0496126_0030880 | 3300048929 | Bacteria | 5071 |
| 895 | Ga0496126_0337882 | 3300048929 | Bacteria | 1234 |
| 896 | Ga0496126_0520694 | 3300048929 | Bacteria | 948 |
| 897 | Ga0495678_000185 | 3300049459 | Bacteria | 72410 |
| 898 | Ga0495678_000374 | 3300049459 | Bacteria | 45408 |
| 899 | Ga0495678_000506 | 3300049459 | Bacteria | 38048 |
| 900 | Ga0495678_004668 | 3300049459 | Bacteria | 7854 |
| 901 | Ga0495678_065921 | 3300049459 | Bacteria | 1343 |
| 902 | Ga0495682_0000275 | 3300049460 | Bacteria | 40479 |
| 903 | Ga0495682_0003201 | 3300049460 | Bacteria | 7354 |
| 904 | Ga0495682_0008519 | 3300049460 | Bacteria | 4036 |
| 905 | Ga0495682_0064945 | 3300049460 | Bacteria | 1316 |
| 906 | Ga0501031_0005457 | 3300049568 | Bacteria | 8274 |
| 907 | Ga0501031_0032257 | 3300049568 | Bacteria | 3415 |
| 908 | Ga0501031_0060071 | 3300049568 | Bacteria | 2477 |
| 909 | Ga0501031_0128666 | 3300049568 | Bacteria | 1654 |
| 910 | Ga0501032_0016204 | 3300049569 | Bacteria | 5243 |
| 911 | Ga0501033_0006447 | 3300049570 | Bacteria | 9183 |
| 912 | Ga0501033_0006688 | 3300049570 | Bacteria | 9007 |
| 913 | Ga0501033_0087611 | 3300049570 | Bacteria | 2278 |
| 914 | Ga0501033_0111214 | 3300049570 | Bacteria | 1993 |
| 915 | Ga0501033_0182636 | 3300049570 | Bacteria | 1503 |
| 916 | Ga0501034_0001651 | 3300049571 | Bacteria | 28815 |
| 917 | Ga0501034_0027542 | 3300049571 | Bacteria | 5781 |
| 918 | Ga0501034_0253424 | 3300049571 | Bacteria | 1704 |
| 919 | Ga0501034_0315302 | 3300049571 | Bacteria | 1497 |
| 920 | Ga0501034_0657419 | 3300049571 | Bacteria | 949 |
| 921 | Ga0501036_0064375 | 3300049572 | Bacteria | 3103 |
| 922 | Ga0501036_0104709 | 3300049572 | Bacteria | 2392 |
| 923 | Ga0501037_0004887 | 3300049573 | Bacteria | 9747 |
| 924 | Ga0501037_0105163 | 3300049573 | Bacteria | 2034 |
| 925 | Ga0501037_0166522 | 3300049573 | Bacteria | 1569 |
| 926 | Ga0501037_0208218 | 3300049573 | Bacteria | 1380 |
| 927 | Ga0501037_0382711 | 3300049573 | Bacteria | 967 |
| 928 | Ga0501038_0010073 | 3300049574 | Bacteria | 8655 |
| 929 | Ga0501038_0050580 | 3300049574 | Bacteria | 3590 |
| 930 | Ga0501039_0020921 | 3300049575 | Bacteria | 5017 |
| 931 | Ga0501043_0031587 | 3300049579 | Bacteria | 4162 |
| 932 | Ga0501043_0038794 | 3300049579 | Bacteria | 3745 |
| 933 | Ga0501043_0075397 | 3300049579 | Bacteria | 2650 |
| 934 | Ga0501043_0095809 | 3300049579 | Bacteria | 2332 |
| 935 | Ga0501046_0018812 | 3300049580 | Bacteria | 5737 |
| 936 | Ga0501046_0290630 | 3300049580 | Bacteria | 1195 |
| 937 | Ga0501046_0437527 | 3300049580 | Bacteria | 941 |
| 938 | Ga0501047_0020784 | 3300049581 | Bacteria | 6306 |
| 939 | Ga0501047_0025245 | 3300049581 | Bacteria | 5710 |
| 940 | Ga0501047_0029713 | 3300049581 | Bacteria | 5269 |
| 941 | Ga0501047_0036938 | 3300049581 | Bacteria | 4721 |
| 942 | Ga0501047_0258760 | 3300049581 | Bacteria | 1588 |
| 943 | Ga0501048_0031296 | 3300049582 | Bacteria | 3849 |
| 944 | Ga0501069_0016628 | 3300049585 | Bacteria | 3953 |
| 945 | Ga0501069_0017546 | 3300049585 | Bacteria | 3855 |
| 946 | Ga0501069_0105632 | 3300049585 | Bacteria | 1600 |
| 947 | Ga0501070_0003249 | 3300049586 | Bacteria | 14120 |
| 948 | Ga0501070_0007449 | 3300049586 | Bacteria | 9296 |
| 949 | Ga0501070_0025016 | 3300049586 | Bacteria | 5007 |
| 950 | Ga0501070_0032960 | 3300049586 | Bacteria | 4333 |
| 951 | Ga0501070_0045370 | 3300049586 | Bacteria | 3655 |
| 952 | Ga0501070_0066396 | 3300049586 | Bacteria | 2987 |
| 953 | Ga0501070_0275748 | 3300049586 | Bacteria | 1373 |
| 954 | Ga0501070_0695059 | 3300049586 | Bacteria | 805 |
| 955 | Ga0501071_0008172 | 3300049587 | Bacteria | 6904 |
| 956 | Ga0501071_0272646 | 3300049587 | Bacteria | 1279 |
| 957 | Ga0501073_0008332 | 3300049589 | Bacteria | 7689 |
| 958 | Ga0501073_0092458 | 3300049589 | Bacteria | 2102 |
| 959 | Ga0501073_0280705 | 3300049589 | Bacteria | 1149 |
| 960 | Ga0501073_0416012 | 3300049589 | Bacteria | 929 |
| 961 | Ga0501074_0017458 | 3300049590 | Bacteria | 5208 |
| 962 | Ga0501074_0025204 | 3300049590 | Bacteria | 4320 |
| 963 | Ga0501074_0084696 | 3300049590 | Bacteria | 2272 |
| 964 | Ga0501077_0004202 | 3300049593 | Bacteria | 8698 |
| 965 | Ga0501079_0175308 | 3300049741 | Bacteria | 1672 |
| 966 | Ga0501080_0002764 | 3300049742 | Bacteria | 15413 |
| 967 | Ga0501080_0029330 | 3300049742 | Bacteria | 5121 |
| 968 | Ga0501080_0116782 | 3300049742 | Bacteria | 2473 |
| 969 | Ga0501080_0166579 | 3300049742 | Bacteria | 2033 |
| 970 | Ga0501269_001126 | 3300049766 | Bacteria | 3706 |
| 971 | Ga0501035_0005183 | 3300049822 | Bacteria | 12327 |
| 972 | Ga0501035_0013275 | 3300049822 | Bacteria | 7602 |
| 973 | Ga0501035_0015679 | 3300049822 | Bacteria | 6995 |
| 974 | Ga0501035_0049135 | 3300049822 | Bacteria | 3781 |
| 975 | Ga0501035_0071046 | 3300049822 | Bacteria | 3083 |
| 976 | Ga0501035_0090828 | 3300049822 | Bacteria | 2688 |
| 977 | Ga0501044_0012051 | 3300049823 | Bacteria | 9364 |
| 978 | Ga0501044_0012481 | 3300049823 | Bacteria | 9200 |
| 979 | Ga0501044_0014634 | 3300049823 | Bacteria | 8460 |
| 980 | Ga0501044_0048742 | 3300049823 | Bacteria | 4374 |
| 981 | Ga0501044_0065375 | 3300049823 | Bacteria | 3709 |
| 982 | Ga0501044_0079102 | 3300049823 | Bacteria | 3332 |
| 983 | Ga0501044_0084910 | 3300049823 | Bacteria | 3199 |
| 984 | Ga0501044_0203486 | 3300049823 | Bacteria | 1937 |
| 985 | Ga0501044_0557136 | 3300049823 | Bacteria | 1043 |
| 986 | Ga0500643_000158 | 3300053087 | Bacteria | 67902 |
| 987 | Ga0500643_018770 | 3300053087 | Bacteria | 2289 |
| 988 | Ga0500555_001159 | 3300053103 | Bacteria | 8670 |
| 989 | Ga0500586_000882 | 3300053145 | Bacteria | 6199 |
| 990 | Ga0500616_0017213 | 3300053153 | Bacteria | 4104 |
| 991 | Ga0500634_0039971 | 3300053161 | Bacteria | 2550 |
| 992 | Ga0587068_001536 | 3300059641 | Bacteria | 2622 |
| 993 | Ga0466962_0008272 | 3300061719 | Bacteria | 4984 |
| 994 | Ga0466962_0094624 | 3300061719 | Bacteria | 1432 |
| 995 | Ga0466962_0170747 | 3300061719 | Bacteria | 1059 |
| 996 | 2538832195 | 2537561836 | Bacteria | 3910579 |
| 997 | 2595448109 | 2593339238 | Bacteria | 4182970 |
| 998 | 2595451404 | 2593339239 | Bacteria | 4124669 |
| 999 | 2643798610 | 2643221556 | Bacteria | 7251154 |
| 1000 | 2643829661 | 2643221562 | Bacteria | 4048635 |
| 1001 | 2644475616 | 2643221684 | Bacteria | 7145183 |
| 1002 | 2721028560 | 2718218334 | Bacteria | 4765486 |
| 1003 | 2735835848 | 2734482264 | Unclassified | 5014763 |
| 1004 | 2738826333 | 2738541297 | Bacteria | 6549566 |
| 1005 | 2739150130 | 2738541357 | Bacteria | 6549408 |
| 1006 | 2739192049 | 2738543003 | Bacteria | 6549560 |
| 1007 | 2739226949 | 2738543009 | Bacteria | 4944499 |
| 1008 | 2739318526 | 2738543026 | Bacteria | 6549408 |
| 1009 | 2739336767 | 2738543029 | Bacteria | 6549249 |
| 1010 | 2739730178 | 2739367700 | Bacteria | 4747630 |
| 1011 | 2819566591 | 2818991440 | Bacteria | 4774720 |
| 1012 | 2819660656 | 2818991457 | Bacteria | 5323295 |
| 1013 | 2821134859 | 2821131069 | Bacteria | 6108407 |
| 1014 | 2842915062 | 2842914999 | Bacteria | 4419378 |
| 1015 | 2842921423 | 2842918807 | Bacteria | 4289178 |
| 1016 | 2852686522 | 2852684882 | Bacteria | 5463342 |
| 1017 | 2857569754 | 2857564685 | Bacteria | 6290584 |
| 1018 | 2884339628 | 2884338543 | Bacteria | 4610696 |
| 1019 | 2884412232 | 2884411467 | Bacteria | 5246714 |
| 1020 | 2895397603 | 2895395659 | Bacteria | 3983269 |
| 1021 | 2895499060 | 2895498888 | Bacteria | 5283788 |
| 1022 | 2895528025 | 2895525241 | Bacteria | 3388457 |
| 1023 | 2904467247 | 2904463128 | Bacteria | 4775606 |
| 1024 | 2919086737 | 2919085039 | Bacteria | 4532964 |
| 1025 | 2919132730 | 2919130084 | Bacteria | 5301837 |
| 1026 | 2919404484 | 2919404418 | Bacteria | 4232372 |
| 1027 | 2928965579 | 2928963466 | Bacteria | 5165703 |
| 1028 | 2929196899 | 2929195423 | Bacteria | 5325372 |
| 1029 | 2939612593 | 2939611941 | Bacteria | 3892017 |
| 1030 | 2941474405 | 2941471342 | Bacteria | 5018624 |
| 1031 | 2953997418 | 2953994433 | Bacteria | 4303959 |
| 1032 | 2990198563 | 2990196909 | Bacteria | 4054280 |
| 1033 | 8002869671 | 8002869464 | Bacteria | 3588529 |
| 1034 | 8021625942 | 8021622325 | Bacteria | 4844743 |
| 1035 | 8021629866 | 8021626552 | Bacteria | 4665214 |
| 1036 | 8021652157 | 8021648035 | Bacteria | 4772378 |
| 1037 | 8047675632 | 8047673197 | Bacteria | 7395230 |
| 1038 | JGI25162J39368_1000312 | |||
| 1039 | JGI24736J21556_1002906 | |||
| 1040 | JGI24736J21556_1005738 | |||
| 1041 | JGI24741J21665_1000666 | |||
| 1042 | JGI24741J21665_1001511 | |||
| 1043 | JGI24741J21665_1003717 | |||
| 1044 | JGI24741J21665_1011843 | |||
| 1045 | JGI24740J21852_10000037 | |||
| 1046 | JGI24740J21852_10000584 | |||
| 1047 | JGI24740J21852_10032002 | |||
| 1048 | JGI24737J22298_10018852 | |||
| 1049 | JGI24735J21928_10001404 | |||
| 1050 | JGI24738J21930_10002823 | |||
| 1051 | JGI25156J39149_1001792 | |||
| 1052 | JGI25156J39149_1001934 | |||
| 1053 | JGI25162J39368_1002139 | |||
| 1054 | JGI25162J39368_1002144 | |||
| 1055 | JGI25157J39369_1000191 | |||
| 1056 | JGI25157J39369_1001516 | |||
| 1057 | JGI25157J39369_1001585 | |||
| 1058 | JGI25163J39215_1000093 | |||
| 1059 | JGI25164J39214_1000140 | |||
| 1060 | JGI25164J39214_1000782 | |||
| 1061 | JGI25164J39214_1001047 | |||
| 1062 | JGI25152J39213_1000164 | |||
| 1063 | JGI25150J39212_1000286 | |||
| 1064 | JGI25150J39212_1012052 | |||
| 1065 | JGI25159J45721_1001532 | |||
| 1066 | JGI25151J46595_10000351 | |||
| 1067 | JGI25165J46597_1000261 | |||
| 1068 | JGI25165J46597_1001921 | |||
| 1069 | JGI25165J46597_1014299 | |||
| 1070 | JGI25153J46596_10000219 | |||
| 1071 | rootH1_10033081 | |||
| 1072 | rootH1_10113747 | |||
| 1073 | rootH2_10010359 | |||
| 1074 | rootH2_10039202 | |||
| 1075 | rootH2_10066632 | |||
| 1076 | rootH2_10124204 | |||
| 1077 | rootH2_10137845 | |||
| 1078 | rootL2_10001944 | |||
| 1079 | rootL2_10041905 | |||
| 1080 | rootL2_10148929 | |||
| 1081 | rootL2_10157852 | |||
| 1082 | rootL2_10207723 | |||
| 1083 | rootH1_10005577 | |||
| 1084 | rootH1_10019292 | |||
| 1085 | rootH1_10071486 | |||
| 1086 | rootH1_10274537 | |||
| 1087 | Ga0006562J51391_1054910 | |||
| 1088 | Ga0006562J51391_1054911 | |||
| 1089 | Ga0055538_1000476 | |||
| 1090 | Ga0055535_1000171 | |||
| 1091 | Ga0055542_1000400 | |||
| 1092 | Ga0055542_1000461 | |||
| 1093 | Ga0055529_1000260 | |||
| 1094 | Ga0055526_1000442 | |||
| 1095 | Ga0055537_1000128 | |||
| 1096 | Ga0055534_1000120 | |||
| 1097 | Ga0055528_1000550 | |||
| 1098 | Ga0058692_1000015 | |||
| 1099 | Ga0055543_1002426 | |||
| 1100 | Ga0065165_1000067 | |||
| 1101 | Ga0065165_1000818 | |||
| 1102 | Ga0065704_10070933 | |||
| 1103 | Ga0065704_10123342 | |||
| 1104 | Ga0070658_10106813 | |||
| 1105 | Ga0070658_10159279 | |||
| 1106 | Ga0070670_100001488 | |||
| 1107 | Ga0070670_100473814 | |||
| 1108 | Ga0070680_100003990 | |||
| 1109 | Ga0070680_100034826 | |||
| 1110 | Ga0070680_100036495 | |||
| 1111 | Ga0070680_100238402 | |||
| 1112 | Ga0070682_100006699 | |||
| 1113 | Ga0070660_100045033 | |||
| 1114 | Ga0070660_100054719 | |||
| 1115 | Ga0070660_100126984 | |||
| 1116 | Ga0070689_100004588 | |||
| 1117 | Ga0070691_10001408 | |||
| 1118 | Ga0070691_10077243 | |||
| 1119 | Ga0070661_100006000 | |||
| 1120 | Ga0070661_100014638 | |||
| 1121 | Ga0070661_100056019 | |||
| 1122 | Ga0070692_10000349 | |||
| 1123 | Ga0070692_10018555 | |||
| 1124 | Ga0070692_10111518 | |||
| 1125 | Ga0070669_100026647 | |||
| 1126 | Ga0070688_100036531 | |||
| 1127 | Ga0070659_100123250 | |||
| 1128 | Ga0070709_10307087 | |||
| 1129 | Ga0070714_100000030 | |||
| 1130 | Ga0070714_100002591 | |||
| 1131 | Ga0070710_10117064 | |||
| 1132 | Ga0070694_100131979 | |||
| 1133 | Ga0070663_100077028 | |||
| 1134 | Ga0070663_100081562 | |||
| 1135 | Ga0070663_100129959 | |||
| 1136 | Ga0070663_100217352 | |||
| 1137 | Ga0070662_100008587 | |||
| 1138 | Ga0070662_100036431 | |||
| 1139 | Ga0070681_10009936 | |||
| 1140 | Ga0070681_10011748 | |||
| 1141 | Ga0070681_10027064 | |||
| 1142 | Ga0070681_10146729 | |||
| 1143 | Ga0070681_10319129 | |||
| 1144 | Ga0068867_100528768 | |||
| 1145 | Ga0070685_10003463 | |||
| 1146 | Ga0070679_100001900 | |||
| 1147 | Ga0070679_100021990 | |||
| 1148 | Ga0070679_100043309 | |||
| 1149 | Ga0070679_100131137 | |||
| 1150 | Ga0070679_100471970 | |||
| 1151 | Ga0068853_100073218 | |||
| 1152 | Ga0068853_100116259 | |||
| 1153 | Ga0068853_100142626 | |||
| 1154 | Ga0070672_100201098 | |||
| 1155 | Ga0070696_100007797 | |||
| 1156 | Ga0070696_100007838 | |||
| 1157 | Ga0070696_100008642 | |||
| 1158 | Ga0070696_100096135 | |||
| 1159 | Ga0070693_100004730 | |||
| 1160 | Ga0070693_100005999 | |||
| 1161 | Ga0070693_100044740 | |||
| 1162 | Ga0068855_100016916 | |||
| 1163 | Ga0068855_100097413 | |||
| 1164 | Ga0068855_101240988 | |||
| 1165 | Ga0070664_100014210 | |||
| 1166 | Ga0070664_100191075 | |||
| 1167 | Ga0068857_100046722 | |||
| 1168 | Ga0068857_100064588 | |||
| 1169 | Ga0068854_100025222 | |||
| 1170 | Ga0068854_100763037 | |||
| 1171 | Ga0068856_100000053 | |||
| 1172 | Ga0068856_100050838 | |||
| 1173 | Ga0068856_100071133 | |||
| 1174 | Ga0068852_100045182 | |||
| 1175 | Ga0068852_100107620 | |||
| 1176 | Ga0068852_100840129 | |||
| 1177 | Ga0068859_100041924 | |||
| 1178 | Ga0068859_100501873 | |||
| 1179 | Ga0068851_10003312 | |||
| 1180 | Ga0068862_100907268 | |||
| 1181 | Ga0070712_100345729 | |||
| 1182 | Ga0075369_10045509 | |||
| 1183 | Ga0097620_100041924 | |||
| 1184 | Ga0097620_100501895 | |||
| 1185 | Ga0105251_10000013 | |||
| 1186 | Ga0105244_10002473 | |||
| 1187 | Ga0105244_10082412 | |||
| 1188 | Ga0105240_10007774 | |||
| 1189 | Ga0105240_10017836 | |||
| 1190 | Ga0105240_10024742 | |||
| 1191 | Ga0105240_10096229 | |||
| 1192 | Ga0105240_10100033 | |||
| 1193 | Ga0105240_10344537 | |||
| 1194 | Ga0105240_10519882 | |||
| 1195 | Ga0105245_10488298 | |||
| 1196 | Ga0105247_10011155 | |||
| 1197 | Ga0105243_10009491 | |||
| 1198 | Ga0105241_10009314 | |||
| 1199 | Ga0105241_10470796 | |||
| 1200 | Ga0105242_10353856 | |||
| 1201 | Ga0105237_10000007 | |||
| 1202 | Ga0105237_10073062 | |||
| 1203 | Ga0105237_10120806 | |||
| 1204 | Ga0105237_10809179 | |||
| 1205 | Ga0105238_10004682 | |||
| 1206 | Ga0105238_10054795 | |||
| 1207 | Ga0105238_10067581 | |||
| 1208 | Ga0105238_10330227 | |||
| 1209 | Ga0105239_10004761 | |||
| 1210 | Ga0105239_10019886 | |||
| 1211 | Ga0105239_10330042 | |||
| 1212 | Ga0105239_10344816 | |||
| 1213 | Ga0105246_10233260 | |||
| 1214 | Ga0157373_10043986 | |||
| 1215 | Ga0157373_10099260 | |||
| 1216 | Ga0157373_10135022 | |||
| 1217 | Ga0157373_10151501 | |||
| 1218 | Ga0157373_10213663 | |||
| 1219 | Ga0157373_10291550 | |||
| 1220 | Ga0157371_10044029 | |||
| 1221 | Ga0157371_10061591 | |||
| 1222 | Ga0157371_10179179 | |||
| 1223 | Ga0157371_10203396 | |||
| 1224 | Ga0157370_10000422 | |||
| 1225 | Ga0157370_10010336 | |||
| 1226 | Ga0157370_10048875 | |||
| 1227 | Ga0157370_10058111 | |||
| 1228 | Ga0157370_10153146 | |||
| 1229 | Ga0157370_10266057 | |||
| 1230 | Ga0157370_10319479 | |||
| 1231 | Ga0157369_10003686 | |||
| 1232 | Ga0157369_10005288 | |||
| 1233 | Ga0157369_10011524 | |||
| 1234 | Ga0157369_10017788 | |||
| 1235 | Ga0157369_10188358 | |||
| 1236 | Ga0157369_10813084 | |||
| 1237 | Ga0163162_10159801 | |||
| 1238 | Ga0157372_10009194 | |||
| 1239 | Ga0157372_10059965 | |||
| 1240 | Ga0157372_10530410 | |||
| 1241 | Ga0157372_10754388 | |||
| 1242 | Ga0157375_10909234 | |||
| 1243 | Ga0182008_10009937 | |||
| 1244 | Ga0182008_10032454 | |||
| 1245 | Ga0182008_10129187 | |||
| 1246 | Ga0182006_1000062 | |||
| 1247 | Ga0182006_1001193 | |||
| 1248 | Ga0182006_1065974 | |||
| 1249 | Ga0182007_10008394 | |||
| 1250 | Ga0182007_10040340 | |||
| 1251 | Ga0182007_10124603 | |||
| 1252 | Ga0182005_1000295 | |||
| 1253 | Ga0182005_1001282 | |||
| 1254 | Ga0182005_1001525 | |||
| 1255 | Ga0182005_1002071 | |||
| 1256 | Ga0182005_1040483 | |||
| 1257 | Ga0183368_1003 | |||
| 1258 | Ga0163161_10002529 | |||
| 1259 | Ga0163161_10026546 | |||
| 1260 | Ga0197907_10768171 | |||
| 1261 | Ga0197907_11021898 | |||
| 1262 | Ga0206356_10621586 | |||
| 1263 | Ga0206354_10516827 | |||
| 1264 | Ga0206354_11143003 | |||
| 1265 | Ga0206353_10082220 | |||
| 1266 | Ga0206353_10329349 | |||
| 1267 | Ga0206353_10411450 | |||
| 1268 | Ga0206353_10904244 | |||
| 1269 | Ga0154015_1059947 | |||
| 1270 | Ga0154015_1348359 | |||
| 1271 | Ga0213871_10006990 | |||
| 1272 | Ga0209760_100464 | |||
| 1273 | Ga0209784_100011 | |||
| 1274 | Ga0209566_102770 | |||
| 1275 | Ga0209674_100819 | |||
| 1276 | Ga0209672_105941 | |||
| 1277 | Ga0209563_100007 | |||
| 1278 | Ga0207427_100019 | |||
| 1279 | Ga0207427_100118 | |||
| 1280 | Ga0207427_100120 | |||
| 1281 | Ga0209437_100020 | |||
| 1282 | Ga0209437_100054 | |||
| 1283 | Ga0209437_100231 | |||
| 1284 | Ga0209437_100362 | |||
| 1285 | Ga0209437_100822 | |||
| 1286 | Ga0209258_100216 | |||
| 1287 | Ga0209258_100642 | |||
| 1288 | Ga0209258_101611 | |||
| 1289 | Ga0207425_1000111 | |||
| 1290 | Ga0209646_1000661 | |||
| 1291 | Ga0209026_1000146 | |||
| 1292 | Ga0209026_1000205 | |||
| 1293 | Ga0209026_1001897 | |||
| 1294 | Ga0209677_103028 | |||
| 1295 | Ga0209677_111709 | |||
| 1296 | Ga0209148_1000001 | |||
| 1297 | Ga0209148_1000005 | |||
| 1298 | Ga0209148_1002293 | |||
| 1299 | Ga0209759_1000418 | |||
| 1300 | Ga0209759_1001506 | |||
| 1301 | Ga0209759_1001727 | |||
| 1302 | Ga0209759_1011457 | |||
| 1303 | Ga0209129_1000087 | |||
| 1304 | Ga0209129_1000445 | |||
| 1305 | Ga0209233_1000002 | |||
| 1306 | Ga0209233_1000020 | |||
| 1307 | Ga0209233_1000147 | |||
| 1308 | Ga0209233_1012091 | |||
| 1309 | Ga0209565_1000006 | |||
| 1310 | Ga0209455_1000019 | |||
| 1311 | Ga0209455_1000474 | |||
| 1312 | Ga0209455_1005243 | |||
| 1313 | Ga0209673_1000004 | |||
| 1314 | Ga0209130_1000223 | |||
| 1315 | Ga0209675_1000224 | |||
| 1316 | Ga0209025_1000013 | |||
| 1317 | Ga0209564_1000102 | |||
| 1318 | Ga0209564_1017016 | |||
| 1319 | Ga0209758_1000014 | |||
| 1320 | Ga0209758_1016601 | |||
| 1321 | Ga0209256_1000495 | |||
| 1322 | Ga0209256_1033312 | |||
| 1323 | Ga0209257_1002929 | |||
| 1324 | Ga0207656_10007565 | |||
| 1325 | Ga0207655_1096355 | |||
| 1326 | Ga0207713_1000658 | |||
| 1327 | Ga0207647_10000386 | |||
| 1328 | Ga0207647_10024168 | |||
| 1329 | Ga0207647_10064426 | |||
| 1330 | Ga0207647_10064854 | |||
| 1331 | Ga0207705_10000438 | |||
| 1332 | Ga0207705_10027147 | |||
| 1333 | Ga0207705_10065415 | |||
| 1334 | Ga0207705_10070534 | |||
| 1335 | Ga0207705_10147122 | |||
| 1336 | Ga0207654_10091054 | |||
| 1337 | Ga0207707_10000379 | |||
| 1338 | Ga0207707_10000422 | |||
| 1339 | Ga0207707_10002334 | |||
| 1340 | Ga0207707_10036091 | |||
| 1341 | Ga0207707_10071702 | |||
| 1342 | Ga0207707_10120994 | |||
| 1343 | Ga0207695_10001343 | |||
| 1344 | Ga0207695_10002840 | |||
| 1345 | Ga0207695_10003487 | |||
| 1346 | Ga0207695_10006343 | |||
| 1347 | Ga0207695_10009743 | |||
| 1348 | Ga0207695_10186221 | |||
| 1349 | Ga0207695_10295616 | |||
| 1350 | Ga0207671_10000763 | |||
| 1351 | Ga0207671_10045028 | |||
| 1352 | Ga0207693_10535794 | |||
| 1353 | Ga0207660_10001603 | |||
| 1354 | Ga0207660_10002593 | |||
| 1355 | Ga0207660_10022615 | |||
| 1356 | Ga0207660_10054227 | |||
| 1357 | Ga0207660_10792289 | |||
| 1358 | Ga0207657_10001729 | |||
| 1359 | Ga0207657_10005904 | |||
| 1360 | Ga0207657_10047235 | |||
| 1361 | Ga0207649_10002297 | |||
| 1362 | Ga0207649_10192533 | |||
| 1363 | Ga0207649_10490945 | |||
| 1364 | Ga0207652_10000022 | |||
| 1365 | Ga0207652_10000368 | |||
| 1366 | Ga0207652_10002541 | |||
| 1367 | Ga0207652_10003502 | |||
| 1368 | Ga0207652_10003947 | |||
| 1369 | Ga0207652_10008434 | |||
| 1370 | Ga0207652_10016897 | |||
| 1371 | Ga0207652_10220127 | |||
| 1372 | Ga0207681_10012606 | |||
| 1373 | Ga0207694_10077421 | |||
| 1374 | Ga0207650_10038304 | |||
| 1375 | Ga0207650_10357966 | |||
| 1376 | Ga0207687_10076002 | |||
| 1377 | Ga0207664_10000026 | |||
| 1378 | Ga0207664_10001262 | |||
| 1379 | Ga0207690_10000976 | |||
| 1380 | Ga0207690_10001043 | |||
| 1381 | Ga0207690_10003295 | |||
| 1382 | Ga0207690_10041774 | |||
| 1383 | Ga0207690_10101287 | |||
| 1384 | Ga0207706_10018132 | |||
| 1385 | Ga0207706_10058916 | |||
| 1386 | Ga0207686_10050122 | |||
| 1387 | Ga0207709_10085455 | |||
| 1388 | Ga0207709_10274525 | |||
| 1389 | Ga0207670_10002684 | |||
| 1390 | Ga0207661_10043391 | |||
| 1391 | Ga0207679_10009166 | |||
| 1392 | Ga0207679_10176683 | |||
| 1393 | Ga0207679_10728137 | |||
| 1394 | Ga0207667_10000436 | |||
| 1395 | Ga0207667_10005577 | |||
| 1396 | Ga0207667_10009175 | |||
| 1397 | Ga0207667_10015489 | |||
| 1398 | Ga0207667_10132576 | |||
| 1399 | Ga0207667_10577978 | |||
| 1400 | Ga0207640_10000564 | |||
| 1401 | Ga0207640_10001437 | |||
| 1402 | Ga0207640_10003230 | |||
| 1403 | Ga0207640_10005203 | |||
| 1404 | Ga0207640_10005896 | |||
| 1405 | Ga0207639_10000637 | |||
| 1406 | Ga0207639_10013073 | |||
| 1407 | Ga0207639_10401258 | |||
| 1408 | Ga0207639_10487174 | |||
| 1409 | Ga0207678_10001228 | |||
| 1410 | Ga0207678_10032261 | |||
| 1411 | Ga0207678_10127499 | |||
| 1412 | Ga0207678_10173277 | |||
| 1413 | Ga0207702_10000032 | |||
| 1414 | Ga0207702_10008105 | |||
| 1415 | Ga0207702_10049210 | |||
| 1416 | Ga0207702_10266030 | |||
| 1417 | Ga0207702_10554683 | |||
| 1418 | Ga0207648_11145270 | |||
| 1419 | Ga0207674_10011246 | |||
| 1420 | Ga0207674_10223023 | |||
| 1421 | Ga0207698_10000430 | |||
| 1422 | Ga0207698_10000630 | |||
| 1423 | Ga0207698_10617094 | |||
| 1424 | Ga0207698_10806906 | |||
| 1425 | Ga0209371_1000011 | |||
| 1426 | Ga0268264_11041746 | |||
| 1427 | Ga0268256_1000011 | |||
| 1428 | Ga0307413_10013859 | |||
| 1429 | Ga0307413_10123130 | |||
| 1430 | Ga0307413_10241196 | |||
| 1431 | Ga0307412_10034790 | |||
| 1432 | Ga0307414_10026242 | |||
| 1433 | Ga0395899_0045676 | |||
| 1434 | Ga0395899_0048045 | |||
| 1435 | Ga0395899_0057680 | |||
| 1436 | Ga0395899_0096358 | |||
| 1437 | Ga0395899_0118389 | |||
| 1438 | Ga0395899_0186063 | |||
| 1439 | Ga0395899_0441281 | |||
| 1440 | Ga0395900_0000377 | |||
| 1441 | Ga0395900_0000867 | |||
| 1442 | Ga0395900_0017946 | |||
| 1443 | Ga0395900_0034909 | |||
| 1444 | Ga0395900_0043403 | |||
| 1445 | Ga0395900_0061686 | |||
| 1446 | Ga0395900_0061865 | |||
| 1447 | Ga0395900_0089923 | |||
| 1448 | Ga0395900_0123413 | |||
| 1449 | Ga0395900_0165920 | |||
| 1450 | Ga0395900_0413632 | |||
| 1451 | Ga0395900_0476813 | |||
| 1452 | Ga0395900_0717288 | |||
| 1453 | Ga0395900_1158105 | |||
| 1454 | Ga0395898_0001606 | |||
| 1455 | Ga0395898_0013117 | |||
| 1456 | Ga0395898_0021850 | |||
| 1457 | Ga0395898_0048682 | |||
| 1458 | Ga0395898_0079894 | |||
| 1459 | Ga0395898_0445540 | |||
| 1460 | Ga0395898_0633793 | |||
| 1461 | Ga0395898_0751229 | |||
| 1462 | Ga0395905_0000156 | |||
| 1463 | Ga0395905_0044730 | |||
| 1464 | Ga0395905_0119276 | |||
| 1465 | Ga0395905_0166051 | |||
| 1466 | Ga0395905_0260686 | |||
| 1467 | Ga0395905_0293076 | |||
| 1468 | Ga0395905_0379941 | |||
| 1469 | Ga0395905_0393880 | |||
| 1470 | Ga0395905_0423131 | |||
| 1471 | Ga0395905_0469159 | |||
| 1472 | Ga0395901_0003133 | |||
| 1473 | Ga0395901_0007470 | |||
| 1474 | Ga0395901_0008127 | |||
| 1475 | Ga0395901_0010829 | |||
| 1476 | Ga0395901_0018442 | |||
| 1477 | Ga0395901_0034380 | |||
| 1478 | Ga0395901_0177526 | |||
| 1479 | Ga0395901_0195064 | |||
| 1480 | Ga0395901_0248958 | |||
| 1481 | Ga0395901_0379631 | |||
| 1482 | Ga0395901_0828035 | |||
| 1483 | Ga0395901_1278162 | |||
| 1484 | Ga0237819_00040 | |||
| 1485 | Ga0237816_00041 | |||
| 1486 | Ga0439436_0000438 | |||
| 1487 | Ga0439465_0011177 | |||
| 1488 | Ga0451800_0849097 | |||
| 1489 | Ga0451806_132004 | |||
| 1490 | Ga0439445_0039505 | |||
| 1491 | Ga0439448_0000125 | |||
| 1492 | Ga0439449_0013214 | |||
| 1493 | Ga0439450_025449 | |||
| 1494 | Ga0439455_0001931 | |||
| 1495 | Ga0439446_0000539 | |||
| 1496 | Ga0439458_0007133 | |||
| 1497 | Ga0439458_0020270 | |||
| 1498 | Ga0450908_000085 | |||
| 1499 | Ga0466972_0000981 | |||
| 1500 | Ga0466972_0019906 | |||
| 1501 | Ga0466972_0051805 | |||
| 1502 | Ga0466982_0000003 | |||
| 1503 | Ga0466982_0003001 | |||
| 1504 | Ga0466965_0019561 | |||
| 1505 | Ga0466966_0011779 | |||
| 1506 | Ga0466966_0108720 | |||
| 1507 | Ga0466966_0116376 | |||
| 1508 | Ga0466966_0237856 | |||
| 1509 | Ga0466961_0232598 | |||
| 1510 | Ga0466963_0122689 | |||
| 1511 | Ga0466964_0000822 | |||
| 1512 | Ga0466964_0031549 | |||
| 1513 | Ga0466971_0073629 | |||
| 1514 | Ga0466968_0000628 | |||
| 1515 | Ga0466968_0004407 | |||
| 1516 | Ga0466968_0306209 | |||
| 1517 | Ga0466970_0003031 | |||
| 1518 | Ga0466970_0033522 | |||
| 1519 | Ga0466957_0013276 | |||
| 1520 | Ga0466957_0118728 | |||
| 1521 | Ga0466957_0152069 | |||
| 1522 | Ga0466960_0007328 | |||
| 1523 | Ga0466959_0037153 | |||
| 1524 | Ga0466958_0037874 | |||
| 1525 | Ga0466958_0057538 | |||
| 1526 | Ga0466958_0287947 | |||
| 1527 | Ga0466967_0082383 | |||
| 1528 | Ga0466967_0398030 | |||
| 1529 | Ga0466967_1042135 | |||
| 1530 | Ga0466967_1214723 | |||
| 1531 | Ga0495617_000020 | |||
| 1532 | Ga0495617_000035 | |||
| 1533 | Ga0495617_063588 | |||
| 1534 | Ga0495617_109690 | |||
| 1535 | Ga0495627_000243 | |||
| 1536 | Ga0495627_008267 | |||
| 1537 | Ga0495627_033200 | |||
| 1538 | Ga0495627_075752 | |||
| 1539 | Ga0495603_0058305 | |||
| 1540 | Ga0495591_025976 | |||
| 1541 | Ga0495638_0000107 | |||
| 1542 | Ga0495638_0000471 | |||
| 1543 | Ga0495638_0001226 | |||
| 1544 | Ga0495638_0079804 | |||
| 1545 | Ga0495638_0162189 | |||
| 1546 | Ga0495638_0324574 | |||
| 1547 | Ga0495653_0000082 | |||
| 1548 | Ga0495653_0192882 | |||
| 1549 | Ga0495650_0000011 | |||
| 1550 | Ga0495650_0000462 | |||
| 1551 | Ga0495650_0000607 | |||
| 1552 | Ga0495650_0001057 | |||
| 1553 | Ga0495650_0001457 | |||
| 1554 | Ga0495650_0002636 | |||
| 1555 | Ga0495650_0014912 | |||
| 1556 | Ga0495650_0106164 | |||
| 1557 | Ga0495582_0024280 | |||
| 1558 | Ga0495605_0000234 | |||
| 1559 | Ga0495605_0000249 | |||
| 1560 | Ga0495605_0045715 | |||
| 1561 | Ga0495605_0071561 | |||
| 1562 | Ga0495605_0076838 | |||
| 1563 | Ga0495584_0001550 | |||
| 1564 | Ga0495584_0003045 | |||
| 1565 | Ga0495584_0003415 | |||
| 1566 | Ga0495584_0314309 | |||
| 1567 | Ga0495585_0000243 | |||
| 1568 | Ga0495585_0000424 | |||
| 1569 | Ga0495585_0029178 | |||
| 1570 | Ga0495585_0085586 | |||
| 1571 | Ga0495596_0003347 | |||
| 1572 | Ga0495596_0007214 | |||
| 1573 | Ga0495596_0009273 | |||
| 1574 | Ga0495596_0010010 | |||
| 1575 | Ga0495596_0011456 | |||
| 1576 | Ga0495596_0038449 | |||
| 1577 | Ga0495596_0039743 | |||
| 1578 | Ga0495596_0092419 | |||
| 1579 | Ga0495596_0118252 | |||
| 1580 | Ga0495607_0000012 | |||
| 1581 | Ga0495607_0000158 | |||
| 1582 | Ga0495607_0000672 | |||
| 1583 | Ga0495607_0006215 | |||
| 1584 | Ga0495607_0007208 | |||
| 1585 | Ga0495607_0031115 | |||
| 1586 | Ga0495607_0057699 | |||
| 1587 | Ga0495607_0062153 | |||
| 1588 | Ga0495607_0076733 | |||
| 1589 | Ga0495607_0081553 | |||
| 1590 | Ga0495583_0000005 | |||
| 1591 | Ga0495583_0004110 | |||
| 1592 | Ga0495583_0005624 | |||
| 1593 | Ga0495583_0007361 | |||
| 1594 | Ga0495583_0008996 | |||
| 1595 | Ga0495583_0021164 | |||
| 1596 | Ga0495583_0045836 | |||
| 1597 | Ga0495583_0084458 | |||
| 1598 | Ga0495606_0000161 | |||
| 1599 | Ga0495606_0000559 | |||
| 1600 | Ga0495606_0000648 | |||
| 1601 | Ga0495606_0005134 | |||
| 1602 | Ga0495606_0007954 | |||
| 1603 | Ga0495606_0021559 | |||
| 1604 | Ga0495606_0080196 | |||
| 1605 | Ga0495606_0101883 | |||
| 1606 | Ga0495606_0145008 | |||
| 1607 | Ga0495610_0000014 | |||
| 1608 | Ga0495610_0003722 | |||
| 1609 | Ga0495610_0034735 | |||
| 1610 | Ga0495610_0113962 | |||
| 1611 | Ga0495616_0000060 | |||
| 1612 | Ga0495616_0000173 | |||
| 1613 | Ga0495616_0001412 | |||
| 1614 | Ga0495616_0005006 | |||
| 1615 | Ga0495616_0012387 | |||
| 1616 | Ga0495616_0013723 | |||
| 1617 | Ga0495616_0018890 | |||
| 1618 | Ga0495616_0020423 | |||
| 1619 | Ga0495616_0078505 | |||
| 1620 | Ga0495616_0130363 | |||
| 1621 | Ga0495620_0000101 | |||
| 1622 | Ga0495620_0011482 | |||
| 1623 | Ga0495631_0000103 | |||
| 1624 | Ga0495631_0000525 | |||
| 1625 | Ga0495631_0000529 | |||
| 1626 | Ga0495631_0001387 | |||
| 1627 | Ga0495631_0004486 | |||
| 1628 | Ga0495631_0008657 | |||
| 1629 | Ga0495631_0015898 | |||
| 1630 | Ga0495631_0023570 | |||
| 1631 | Ga0495631_0050725 | |||
| 1632 | Ga0495632_0000019 | |||
| 1633 | Ga0495632_0000406 | |||
| 1634 | Ga0495632_0000653 | |||
| 1635 | Ga0495632_0001400 | |||
| 1636 | Ga0495632_0002098 | |||
| 1637 | Ga0495632_0027721 | |||
| 1638 | Ga0495632_0105988 | |||
| 1639 | Ga0495632_0155286 | |||
| 1640 | Ga0495632_0218445 | |||
| 1641 | Ga0495637_0011180 | |||
| 1642 | Ga0495637_0041836 | |||
| 1643 | Ga0495643_0005663 | |||
| 1644 | Ga0495643_0028817 | |||
| 1645 | Ga0495643_0031463 | |||
| 1646 | Ga0495643_0034002 | |||
| 1647 | Ga0495643_0047893 | |||
| 1648 | Ga0495643_0118349 | |||
| 1649 | Ga0495644_0019082 | |||
| 1650 | Ga0495648_0000288 | |||
| 1651 | Ga0495648_0000551 | |||
| 1652 | Ga0495648_0003735 | |||
| 1653 | Ga0495648_0013564 | |||
| 1654 | Ga0495648_0013849 | |||
| 1655 | Ga0495648_0015016 | |||
| 1656 | Ga0495648_0017797 | |||
| 1657 | Ga0495648_0027107 | |||
| 1658 | Ga0495648_0032089 | |||
| 1659 | Ga0495648_0088595 | |||
| 1660 | Ga0495642_0000038 | |||
| 1661 | Ga0495642_0000214 | |||
| 1662 | Ga0495642_0002954 | |||
| 1663 | Ga0495642_0013328 | |||
| 1664 | Ga0495642_0022625 | |||
| 1665 | Ga0495642_0032573 | |||
| 1666 | Ga0495642_0076928 | |||
| 1667 | Ga0495642_0077920 | |||
| 1668 | Ga0495642_0180183 | |||
| 1669 | Ga0495654_0004328 | |||
| 1670 | Ga0495654_0011622 | |||
| 1671 | Ga0495654_0015883 | |||
| 1672 | Ga0495654_0030279 | |||
| 1673 | Ga0495654_0053327 | |||
| 1674 | Ga0495586_0118195 | |||
| 1675 | Ga0495609_0000021 | |||
| 1676 | Ga0495609_0001140 | |||
| 1677 | Ga0495609_0002120 | |||
| 1678 | Ga0495609_0008668 | |||
| 1679 | Ga0495609_0012401 | |||
| 1680 | Ga0495609_0018696 | |||
| 1681 | Ga0495609_0022596 | |||
| 1682 | Ga0495609_0030593 | |||
| 1683 | Ga0495609_0099269 | |||
| 1684 | Ga0495597_0000515 | |||
| 1685 | Ga0495597_0001373 | |||
| 1686 | Ga0495597_0007248 | |||
| 1687 | Ga0495597_0118743 | |||
| 1688 | Ga0495645_0067913 | |||
| 1689 | Ga0495622_0018204 | |||
| 1690 | Ga0495622_0028393 | |||
| 1691 | Ga0495633_0021925 | |||
| 1692 | Ga0495633_0039324 | |||
| 1693 | Ga0495633_0045599 | |||
| 1694 | Ga0495633_0078396 | |||
| 1695 | Ga0495633_0212925 | |||
| 1696 | Ga0495656_0017663 | |||
| 1697 | Ga0495656_0156926 | |||
| 1698 | Ga0495668_0000008 | |||
| 1699 | Ga0495668_0000164 | |||
| 1700 | Ga0495668_0000457 | |||
| 1701 | Ga0495668_0000579 | |||
| 1702 | Ga0495668_0002674 | |||
| 1703 | Ga0495668_0015801 | |||
| 1704 | Ga0495668_0022095 | |||
| 1705 | Ga0495668_0068250 | |||
| 1706 | Ga0495668_0074025 | |||
| 1707 | Ga0495668_0094439 | |||
| 1708 | Ga0495668_0174543 | |||
| 1709 | Ga0495668_0179599 | |||
| 1710 | Ga0495611_0000001 | |||
| 1711 | Ga0495611_0000397 | |||
| 1712 | Ga0495611_0000957 | |||
| 1713 | Ga0495611_0002336 | |||
| 1714 | Ga0495611_0043514 | |||
| 1715 | Ga0495611_0133572 | |||
| 1716 | Ga0495625_0000325 | |||
| 1717 | Ga0495625_0001449 | |||
| 1718 | Ga0495625_0028480 | |||
| 1719 | Ga0495625_0098430 | |||
| 1720 | Ga0495625_0101869 | |||
| 1721 | Ga0495625_0122610 | |||
| 1722 | Ga0495625_0164742 | |||
| 1723 | Ga0495635_0151952 | |||
| 1724 | Ga0495659_0004044 | |||
| 1725 | Ga0495661_0000052 | |||
| 1726 | Ga0495661_0000403 | |||
| 1727 | Ga0495661_0000731 | |||
| 1728 | Ga0495661_0025016 | |||
| 1729 | Ga0495661_0044535 | |||
| 1730 | Ga0495661_0065974 | |||
| 1731 | Ga0495661_0110041 | |||
| 1732 | Ga0495588_0000184 | |||
| 1733 | Ga0495588_0011307 | |||
| 1734 | Ga0495588_0015485 | |||
| 1735 | Ga0495588_0136486 | |||
| 1736 | Ga0495669_0000807 | |||
| 1737 | Ga0495669_0001911 | |||
| 1738 | Ga0495669_0007554 | |||
| 1739 | Ga0495669_0007628 | |||
| 1740 | Ga0495669_0093117 | |||
| 1741 | Ga0495613_0039901 | |||
| 1742 | Ga0495613_0342114 | |||
| 1743 | Ga0495670_0001047 | |||
| 1744 | Ga0495670_0002879 | |||
| 1745 | Ga0495670_0003247 | |||
| 1746 | Ga0495670_0017824 | |||
| 1747 | Ga0495670_0024119 | |||
| 1748 | Ga0495670_0037578 | |||
| 1749 | Ga0495670_0044174 | |||
| 1750 | Ga0495670_0079655 | |||
| 1751 | Ga0495670_0196149 | |||
| 1752 | Ga0495670_0324776 | |||
| 1753 | Ga0495671_0000005 | |||
| 1754 | Ga0495671_0000909 | |||
| 1755 | Ga0495671_0002073 | |||
| 1756 | Ga0495671_0007302 | |||
| 1757 | Ga0495671_0007856 | |||
| 1758 | Ga0495671_0077582 | |||
| 1759 | Ga0495671_0085791 | |||
| 1760 | Ga0495671_0086562 | |||
| 1761 | Ga0495649_0000714 | |||
| 1762 | Ga0495649_0013674 | |||
| 1763 | Ga0495649_0014729 | |||
| 1764 | Ga0495649_0050596 | |||
| 1765 | Ga0495649_0067730 | |||
| 1766 | Ga0495649_0122411 | |||
| 1767 | Ga0495589_0000012 | |||
| 1768 | Ga0495589_0000139 | |||
| 1769 | Ga0495589_0000307 | |||
| 1770 | Ga0495589_0001673 | |||
| 1771 | Ga0495589_0002326 | |||
| 1772 | Ga0495589_0010378 | |||
| 1773 | Ga0495589_0036373 | |||
| 1774 | Ga0495589_0107944 | |||
| 1775 | Ga0495589_0152738 | |||
| 1776 | Ga0495589_0171098 | |||
| 1777 | Ga0495660_0000176 | |||
| 1778 | Ga0495660_0000186 | |||
| 1779 | Ga0495660_0011786 | |||
| 1780 | Ga0495660_0014484 | |||
| 1781 | Ga0495660_0045152 | |||
| 1782 | Ga0495660_0117261 | |||
| 1783 | Ga0495660_0295758 | |||
| 1784 | Ga0495581_0036002 | |||
| 1785 | Ga0495604_0023297 | |||
| 1786 | Ga0495636_0049065 | |||
| 1787 | Ga0495672_0000801 | |||
| 1788 | Ga0495672_0002979 | |||
| 1789 | Ga0495672_0003143 | |||
| 1790 | Ga0495676_0000618 | |||
| 1791 | Ga0495680_0215811 | |||
| 1792 | Ga0495683_0001130 | |||
| 1793 | Ga0495683_0064643 | |||
| 1794 | Ga0495683_0124421 | |||
| 1795 | Ga0495683_0182440 | |||
| 1796 | Ga0495687_000130 | |||
| 1797 | Ga0495687_000149 | |||
| 1798 | Ga0495687_000193 | |||
| 1799 | Ga0495687_000326 | |||
| 1800 | Ga0495687_002935 | |||
| 1801 | Ga0495687_015774 | |||
| 1802 | Ga0495677_0000019 | |||
| 1803 | Ga0495677_0003492 | |||
| 1804 | Ga0495677_0003797 | |||
| 1805 | Ga0495677_0006852 | |||
| 1806 | Ga0495677_0008147 | |||
| 1807 | Ga0495677_0035489 | |||
| 1808 | Ga0495679_000001 | |||
| 1809 | Ga0495679_005389 | |||
| 1810 | Ga0495679_018740 | |||
| 1811 | Ga0495679_028314 | |||
| 1812 | Ga0495685_004657 | |||
| 1813 | Ga0495685_007094 | |||
| 1814 | Ga0495685_009073 | |||
| 1815 | Ga0495673_0000009 | |||
| 1816 | Ga0495673_0000012 | |||
| 1817 | Ga0495673_0000072 | |||
| 1818 | Ga0495673_0000798 | |||
| 1819 | Ga0495681_0000403 | |||
| 1820 | Ga0495681_0003907 | |||
| 1821 | Ga0495681_0005230 | |||
| 1822 | Ga0495681_0008236 | |||
| 1823 | Ga0495681_0013771 | |||
| 1824 | Ga0495681_0076585 | |||
| 1825 | Ga0495686_0000263 | |||
| 1826 | Ga0495686_0001334 | |||
| 1827 | Ga0495686_0002561 | |||
| 1828 | Ga0495686_0003427 | |||
| 1829 | Ga0495686_0021564 | |||
| 1830 | Ga0495686_0027591 | |||
| 1831 | Ga0495686_0034555 | |||
| 1832 | Ga0495686_0061419 | |||
| 1833 | Ga0495686_0062769 | |||
| 1834 | Ga0495686_0135386 | |||
| 1835 | Ga0495593_0118586 | |||
| 1836 | Ga0495614_0005923 | |||
| 1837 | Ga0495614_0055808 | |||
| 1838 | Ga0495615_0042158 | |||
| 1839 | Ga0495626_0000082 | |||
| 1840 | Ga0495626_0004262 | |||
| 1841 | Ga0495626_0020593 | |||
| 1842 | Ga0495626_0035231 | |||
| 1843 | Ga0495626_0053994 | |||
| 1844 | Ga0495626_0067093 | |||
| 1845 | Ga0495626_0123139 | |||
| 1846 | Ga0495626_0152188 | |||
| 1847 | Ga0496100_0038258 | |||
| 1848 | Ga0496100_0038327 | |||
| 1849 | Ga0496100_0511974 | |||
| 1850 | Ga0496101_0001273 | |||
| 1851 | Ga0496101_0407138 | |||
| 1852 | Ga0496102_0172792 | |||
| 1853 | Ga0496102_0380999 | |||
| 1854 | Ga0496102_0835734 | |||
| 1855 | Ga0496103_0041532 | |||
| 1856 | Ga0496104_0132231 | |||
| 1857 | Ga0496106_0022509 | |||
| 1858 | Ga0496106_0029220 | |||
| 1859 | Ga0496106_0030235 | |||
| 1860 | Ga0496107_0430914 | |||
| 1861 | Ga0496107_0583873 | |||
| 1862 | Ga0496109_0019971 | |||
| 1863 | Ga0496110_0000365 | |||
| 1864 | Ga0496110_0413874 | |||
| 1865 | Ga0496111_0228244 | |||
| 1866 | Ga0496112_0147805 | |||
| 1867 | Ga0496113_0001645 | |||
| 1868 | Ga0496113_0018536 | |||
| 1869 | Ga0496115_0000110 | |||
| 1870 | Ga0496115_0001042 | |||
| 1871 | Ga0496115_0049161 | |||
| 1872 | Ga0496115_0415173 | |||
| 1873 | Ga0496117_0000730 | |||
| 1874 | Ga0496117_0042972 | |||
| 1875 | Ga0496118_0002084 | |||
| 1876 | Ga0496118_0002163 | |||
| 1877 | Ga0496118_0002572 | |||
| 1878 | Ga0496118_0014611 | |||
| 1879 | Ga0496118_0048817 | |||
| 1880 | Ga0496119_0000070 | |||
| 1881 | Ga0496119_0001714 | |||
| 1882 | Ga0496119_0096818 | |||
| 1883 | Ga0496119_0161033 | |||
| 1884 | Ga0496120_0000541 | |||
| 1885 | Ga0496120_0000637 | |||
| 1886 | Ga0496120_0002482 | |||
| 1887 | Ga0496120_0029637 | |||
| 1888 | Ga0496120_0119582 | |||
| 1889 | Ga0496121_0000355 | |||
| 1890 | Ga0496121_0000564 | |||
| 1891 | Ga0496121_0001271 | |||
| 1892 | Ga0496121_0010533 | |||
| 1893 | Ga0496121_0033678 | |||
| 1894 | Ga0496121_0035380 | |||
| 1895 | Ga0496121_0052766 | |||
| 1896 | Ga0496122_0001026 | |||
| 1897 | Ga0496122_0002103 | |||
| 1898 | Ga0496122_0022702 | |||
| 1899 | Ga0496122_0027010 | |||
| 1900 | Ga0496122_0041497 | |||
| 1901 | Ga0496122_0053908 | |||
| 1902 | Ga0496122_0057117 | |||
| 1903 | Ga0496122_0079607 | |||
| 1904 | Ga0496122_0084708 | |||
| 1905 | Ga0496122_0107031 | |||
| 1906 | Ga0496122_0123301 | |||
| 1907 | Ga0496123_0000324 | |||
| 1908 | Ga0496123_0001026 | |||
| 1909 | Ga0496123_0003625 | |||
| 1910 | Ga0496123_0007822 | |||
| 1911 | Ga0496123_0013403 | |||
| 1912 | Ga0496123_0029262 | |||
| 1913 | Ga0496123_0050963 | |||
| 1914 | Ga0496124_0000472 | |||
| 1915 | Ga0496124_0003618 | |||
| 1916 | Ga0496124_0004318 | |||
| 1917 | Ga0496124_0021238 | |||
| 1918 | Ga0496124_0081867 | |||
| 1919 | Ga0496124_0149351 | |||
| 1920 | Ga0496124_0309404 | |||
| 1921 | Ga0496124_0382706 | |||
| 1922 | Ga0496124_0433169 | |||
| 1923 | Ga0496125_0002514 | |||
| 1924 | Ga0496125_0007422 | |||
| 1925 | Ga0496125_0073723 | |||
| 1926 | Ga0496125_0374934 | |||
| 1927 | Ga0496126_0000718 | |||
| 1928 | Ga0496126_0005219 | |||
| 1929 | Ga0496126_0006238 | |||
| 1930 | Ga0496126_0021896 | |||
| 1931 | Ga0496126_0030880 | |||
| 1932 | Ga0496126_0337882 | |||
| 1933 | Ga0496126_0520694 | |||
| 1934 | Ga0495678_000185 | |||
| 1935 | Ga0495678_000374 | |||
| 1936 | Ga0495678_000506 | |||
| 1937 | Ga0495678_004668 | |||
| 1938 | Ga0495678_065921 | |||
| 1939 | Ga0495682_0000275 | |||
| 1940 | Ga0495682_0003201 | |||
| 1941 | Ga0495682_0008519 | |||
| 1942 | Ga0495682_0064945 | |||
| 1943 | Ga0501031_0005457 | |||
| 1944 | Ga0501031_0032257 | |||
| 1945 | Ga0501031_0060071 | |||
| 1946 | Ga0501031_0128666 | |||
| 1947 | Ga0501032_0016204 | |||
| 1948 | Ga0501033_0006447 | |||
| 1949 | Ga0501033_0006688 | |||
| 1950 | Ga0501033_0087611 | |||
| 1951 | Ga0501033_0111214 | |||
| 1952 | Ga0501033_0182636 | |||
| 1953 | Ga0501034_0001651 | |||
| 1954 | Ga0501034_0027542 | |||
| 1955 | Ga0501034_0253424 | |||
| 1956 | Ga0501034_0315302 | |||
| 1957 | Ga0501034_0657419 | |||
| 1958 | Ga0501036_0064375 | |||
| 1959 | Ga0501036_0104709 | |||
| 1960 | Ga0501037_0004887 | |||
| 1961 | Ga0501037_0105163 | |||
| 1962 | Ga0501037_0166522 | |||
| 1963 | Ga0501037_0208218 | |||
| 1964 | Ga0501037_0382711 | |||
| 1965 | Ga0501038_0010073 | |||
| 1966 | Ga0501038_0050580 | |||
| 1967 | Ga0501039_0020921 | |||
| 1968 | Ga0501043_0031587 | |||
| 1969 | Ga0501043_0038794 | |||
| 1970 | Ga0501043_0075397 | |||
| 1971 | Ga0501043_0095809 | |||
| 1972 | Ga0501046_0018812 | |||
| 1973 | Ga0501046_0290630 | |||
| 1974 | Ga0501046_0437527 | |||
| 1975 | Ga0501047_0020784 | |||
| 1976 | Ga0501047_0025245 | |||
| 1977 | Ga0501047_0029713 | |||
| 1978 | Ga0501047_0036938 | |||
| 1979 | Ga0501047_0258760 | |||
| 1980 | Ga0501048_0031296 | |||
| 1981 | Ga0501069_0016628 | |||
| 1982 | Ga0501069_0017546 | |||
| 1983 | Ga0501069_0105632 | |||
| 1984 | Ga0501070_0003249 | |||
| 1985 | Ga0501070_0007449 | |||
| 1986 | Ga0501070_0025016 | |||
| 1987 | Ga0501070_0032960 | |||
| 1988 | Ga0501070_0045370 | |||
| 1989 | Ga0501070_0066396 | |||
| 1990 | Ga0501070_0275748 | |||
| 1991 | Ga0501070_0695059 | |||
| 1992 | Ga0501071_0008172 | |||
| 1993 | Ga0501071_0272646 | |||
| 1994 | Ga0501073_0008332 | |||
| 1995 | Ga0501073_0092458 | |||
| 1996 | Ga0501073_0280705 | |||
| 1997 | Ga0501073_0416012 | |||
| 1998 | Ga0501074_0017458 | |||
| 1999 | Ga0501074_0025204 | |||
| 2000 | Ga0501074_0084696 | |||
| 2001 | Ga0501077_0004202 | |||
| 2002 | Ga0501079_0175308 | |||
| 2003 | Ga0501080_0002764 | |||
| 2004 | Ga0501080_0029330 | |||
| 2005 | Ga0501080_0116782 | |||
| 2006 | Ga0501080_0166579 | |||
| 2007 | Ga0501269_001126 | |||
| 2008 | Ga0501035_0005183 | |||
| 2009 | Ga0501035_0013275 | |||
| 2010 | Ga0501035_0015679 | |||
| 2011 | Ga0501035_0049135 | |||
| 2012 | Ga0501035_0071046 | |||
| 2013 | Ga0501035_0090828 | |||
| 2014 | Ga0501044_0012051 | |||
| 2015 | Ga0501044_0012481 | |||
| 2016 | Ga0501044_0014634 | |||
| 2017 | Ga0501044_0048742 | |||
| 2018 | Ga0501044_0065375 | |||
| 2019 | Ga0501044_0079102 | |||
| 2020 | Ga0501044_0084910 | |||
| 2021 | Ga0501044_0203486 | |||
| 2022 | Ga0501044_0557136 | |||
| 2023 | Ga0500643_000158 | |||
| 2024 | Ga0500643_018770 | |||
| 2025 | Ga0500555_001159 | |||
| 2026 | Ga0500586_000882 | |||
| 2027 | Ga0500616_0017213 | |||
| 2028 | Ga0500634_0039971 | |||
| 2029 | Ga0587068_001536 | |||
| 2030 | Ga0466962_0008272 | |||
| 2031 | Ga0466962_0094624 | |||
| 2032 | Ga0466962_0170747 | |||
| 2033 | 2538832195 | |||
| 2034 | 2595448109 | |||
| 2035 | 2595451404 | |||
| 2036 | 2643798610 | |||
| 2037 | 2643829661 | |||
| 2038 | 2644475616 | |||
| 2039 | 2721028560 | |||
| 2040 | 2735835848 | |||
| 2041 | 2738826333 | |||
| 2042 | 2739150130 | |||
| 2043 | 2739192049 | |||
| 2044 | 2739226949 | |||
| 2045 | 2739318526 | |||
| 2046 | 2739336767 | |||
| 2047 | 2739730178 | |||
| 2048 | 2819566591 | |||
| 2049 | 2819660656 | |||
| 2050 | 2821134859 | |||
| 2051 | 2842915062 | |||
| 2052 | 2842921423 | |||
| 2053 | 2852686522 | |||
| 2054 | 2857569754 | |||
| 2055 | 2884339628 | |||
| 2056 | 2884412232 | |||
| 2057 | 2895397603 | |||
| 2058 | 2895499060 | |||
| 2059 | 2895528025 | |||
| 2060 | 2904467247 | |||
| 2061 | 2919086737 | |||
| 2062 | 2919132730 | |||
| 2063 | 2919404484 | |||
| 2064 | 2928965579 | |||
| 2065 | 2929196899 | |||
| 2066 | 2939612593 | |||
| 2067 | 2941474405 | |||
| 2068 | 2953997418 | |||
| 2069 | 2990198563 | |||
| 2070 | 8002869671 | |||
| 2071 | 8021625942 | |||
| 2072 | 8021629866 | |||
| 2073 | 8021652157 | |||
| 2074 | 8047675632 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ahx-assembly1.cif.gz_A-2 | copper-sensing operon regulator protein (csorgz) | 0.991 | 183 | 221 |
| 3dkq-assembly1.cif.gz_B-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9825 | 2 | 225 |
| 5lcy-assembly1.cif.gz_C | formaldehyde-responsive regulator frmr e64h variant from salmonella enterica serovar typhimurium | 0.9735 | 183 | 218 |
| 3dkq-assembly1.cif.gz_C-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.971 | 1 | 225 |
| 3dkq-assembly1.cif.gz_A-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9507 | 1 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dkqA02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 1.002 | 179 | 225 | 4.10.860.20 |
| 3dkqC02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9962 | 179 | 225 | 4.10.860.20 |
| 3dkqA02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9807 | 179 | 225 | 4.10.860.20 |
| 3dkqC02 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9756 | 179 | 225 | 4.10.860.20 |
| 5lcyC00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer | 0.9735 | 183 | 218 | 1.20.58.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259S409-F1-model_v4 | Fe2+-dependent dioxygenase | 0.9887 | 22 | 225 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |
| AF-A0A840FY28-F1-model_v4 | PKHD-type hydroxylase (EC 1.14.11.-) | 0.9864 | 2 | 225 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |
| AF-G0AXX8-F1-model_v4 | deleted | 0.985 | 1 | 225 |
|
| AF-B9MCK8-F1-model_v4 | PKHD-type hydroxylase Dtpsy_0528 (EC 1.14.11.-) | 0.9843 | 1 | 225 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |
| AF-A0A2X3F8N6-F1-model_v4 | Iron-uptake factor PiuC (EC 1.14.11.-) | 0.9843 | 110 | 174 |
GO:0006879
GO:0006974 GO:0016706 |